1EG4A

Structure of a dystrophin ww domain fragment in complex with a beta-dystroglycan peptide
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
260
structure length
260
Chain Sequence
PASQHFLSTSVQGPWERAISPNKVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-DYSTROGLYCAN
publication title Structure of a WW domain containing fragment of dystrophin in complex with beta-dystroglycan.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 93
structure length 260
sequence length 260
ec nomenclature
pdb deposition date 2000-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF09068 EF-hand_2 EF hand
A PF09069 EF-hand_3 EF-hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1eg4A03
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1eg4A04
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1eg4A01
4NDDA 1IWQA 2LAJA 2LUCA 1YVHA 1NX1A 1BMOA 1LA3A 1NPQA 4NQGA 2M7LA 1CFCA 4I5KA 1ZUZA 1B7TY 2ZR5A 1CFPA 1R6PA 3AAJA 2XP7A 1PK0D 2JRFA 4WQ2A 4MSPA 4DCKA 2NZ0A 1SR6B 3TDZA 1UHIA 1SPYA 1QX7A 2LVIA 2XPBA 3M0WA 3PATA 2YSGA 3OB1B 1SCVA 3JVTC 2Y5IA 3BUOB 4QJ3B 4OCIA 1Y6WA 1TCOB 1LXFC 2EC6C 2HF5A 1B9AA 1KWOC 1S6CA 3O2PA 2LUXA 3VRQA 1FBVA 4GGFA 1NMVA 5JOLA 5HKWA 3A4UB 2WOSA 2V53A 1S36A 2I18A 4C0JA 1EJ3A 1GGZA 1QJTA 1S26D 2F3YA 1CTRA 1UUSA 2L98A 2OTGB 4YRUA 3OX6A 3SG4A 1ZMZA 1S6IA 2JT8A 4YGBB 1MQ1A 1EG3A 1CMGA 1FF1A 1X02A 1AUIB 3TDBA 5F6TA 3EK8A 4ZCVA 1HQVA 1XFVO 2ITKA 4ICBA 4GFTA 1BJFA 2K7BA 4XYNA 2BBMA 2L4HA 3NTPA 2BL0B 1C7VA 1K94A 1DT7B 5AHTA 2CXJA 1B8RA 5IBWA 1N2DA 1KFXL 2LMUA 1D1OA 3I5GC 5D7FA 2FOTA 2E6WA 3PALA 2JPTA 3TUYB 1TNQA 1DJIA 4PHNA 1JUOA 2ZN9A 2EHBA 3AKBA 3PM8A 2M8IA 1K9QA 1I5HW 1OMDA 3KCEA 2KNEA 2B1UA 3TS5C 1QIWA 1YUTA 4GPLB 2ZRTA 1ALVA 3OB2B 5D69A 1MWNA 1S5GZ 2BCXA 2BKHB 1JF0A 1TRFA 2IS9A 2M8UA 3GK2A 3TDIA 2QACA 5AFPA 2KI4C 2M1UA 4I5NB 4QIBA 1EG4A 3I5IC 4ORBB 1Y0VH 2KI6D 1SNLA 1B8LA 2LLTA 2OTGC 3OP0A 3D0YB 5CSFA 2JQ6A 3IQQA 1XA5A 2R2IA 1GJYA 2LMVA 1KSOA 1W7JB 3LCPC 1ZFSA 1E8AA 2JNXA 2KFGA 3HCMA 2K8MB 1TOPA 4GUKA 4WRIA 3BOWB 5ER4X 4A4CA 5HYDA 1IJ5A 5I8NA 2DK1A 2JXLA 3NSLA 4PALA 4FQOA 1KFXS 2L0PA 4PCWA 1BF5A 2LANA 4JQ0D 2KAVA 2RGIA 1YTZC 2CTNA 1YUSA 2CCMA 2DK7A 2KHNA 2KBIA 1RFJA 1PULA 1QLKA 1Y1UA 2AAOA 2KBMA 4CFQA 4ETOA 1NUBA 1UURA 1UHJA 1XFWO 4TNCA 4CFRA 1YW5A 1MHOA 3JVTB 4PDZA 3KADA 1KFUS 1WRLA 2FCEA 4YGAA 4ZCUA 1G4YR 1K9UA 4HRGA 1KWOB 3EVUA 5KSZA 2XPAA 3TZ1A 1KQMB 3WNXB 1SY9A 2PVBA 1A75B 2BBNA 1NWDA 4N5XA 2LHIA 3E3RA 4PE4A 1XFZO 4XJKA 4ORCB 1QX2A 1IJ6A 1CM4A 1WLMA 5CSIA 1SL7A 4NDCA 1CB1A 1JBAA 2JMFA 1BG1A 3SG7A 4YBHB 3BXKA 3WHTB 2LVKA 1JFJA 4PHMA 3SG5A 3TDUA 1M45A 2M49B 2M3WA 2M29A 3LK0A 3PN7C 2M1KB 3DVMA 4PE7A 4YI8A 1B47A 4IL1A 2L4IA 1SL8A 3MSEB 3QRXA 1RWYA 2AMIA 2KOTA 2NLNA 1DJWA 3CR2A 1K96A 3CR4X 1XFXO 1TN4A 2M7NA 1WLZA 3NSKA 3I5HB 4P5OE 2KQYA 2LHLA 4MRYA 3NSIA 5I2QA 1EH2A 1F8AB 1OZOA 4F0ZB 2KQ6A 3KAIA 1DJZA 1V1FA 2DOQA 1QX5B 2F3ZA 2NCOA 1K2HA 1AHRA 1UHHA 4YI9A 3I5GB 2F8PA 2HQ8A 1R2UA 2ZNEA 2ZAJA 2BCBA 2KYFA 4CIDA 3K21A 1NCZA 2GGMA 4OV2A 3CLNA 3EKHA 1GQMA 2XP6A 3TCZA 3ZNIA 4OVNF 2MAZA 4PE1A 3D10A 2ZQTA 1YX7A 3TS5B 3KAGA 3CGAA 4ORAB 2L2EA 1QIVA 1BLQA 2LV7A 1WMVA 1KQMC 2KSPA 2BE4A 1QVIZ 1DTLA 1A2XA 1PSBA 2LP3A 2KI4B 3DVKA 1OMVA 3PSRA 5DKRA 3I5IB 1KK7Y 1TNXA 1K9KA 2BA1A 3CS1A 2JV4A 2WORA 1SL9A 2MLEC 4PHJA 2OS8C 4MRXA 1QATA 3RLZA 1F55A 1KK8C 3KEVA 1K9PA 3GK1A 2JT0A 3RM1A 1DJXA 3DD4A 2YSIA 1JSAA 1C7WA 2KAXA 2O5GA 2LLUA 4N1GA 1NX3A 5JJGA 2K7OA 2WCEA 3I5HC 1H4BA 5CQ2A 1S6JA 4U84A 1AJ5A 4DRWA 1S1EA 1SYMA 2LC5A 2HETA 2KI6C 2LCPA 4USLA 1U5IA 3AAKA 4YGDB 2TN4A 2K2FA 2Q4UA 4U86A 1MXEA 1CLBA 1SMGA 4MN0A 5CSJA 1SCMB 2DWVA 1NYAA 1TTXA 1WDCC 1J7PA 2ZRSA 5AEQA 3CNGA 1GGWA 1DJHA 3O6BA 4GBAA 1EXRA 3GOFA 2KXQA 1KFUL 4C0KA 2I7AA 3BQ3A 3JTDC 4WQ3A 2G9BA 2H61C 4MLWA 3BUMB 5HKZA 1YRUB 2LM5A 2ZQSA 1XFUO 1CDLA 2XP8A 4HRHA 1CDPA 3OHMB 4REXA 2M0RA 2LAPA 3EK7A 4DS7A 3PN7B 2L5XB 1ZCNA 1EL4A 2JTZA 2WC8A 2HPSA 3FWBA 1XK4C 1SBJA 1YRTB 2BCAA 2XP3A 3SG2A 1M39A 2Y1NA 2KAYA 5HKYA 2E30A 4M2PA 3M7NA 2GGZA 4JPZB 2PMYA 2BE6A 1QS7A 1JMQA 1HT9A 1M31A 2NXQA 3KO0A 2K61A 2KGRA 2CBLA 2LMTA 3NSOA 1F4OA 4AOMA 4L9MA 5AERA 5ER5A 4GGNA 2L50A 1MF8B 2H2KA 2MHHA 1J7QA 1ALWA 3KAHA 2WNDA 1BR4B 3O78A 1RECA 3DVEA 2F21A 1MXLC 1FW4A 1KCYA 2JT3A 1J7OA 2JC2A 1XYDA 3PLFB 5G08A 3EVVA 2ZR6A 2SASA 4OKHA 4AQIA 1K8UA 4CLNA 3M85A 1PINA 1RTP1 1Y1AA 1SCMC 2XP5A 2QPTA 1DVIA 1IG5A 1CNPA 1F71A 3KABA 5HLVA 1B7TZ 5KU1A 4A4BA 4BY4A 1DGUA 4R1EA 1AJ4A 1F70A 2Q5AA 2BECA 1S5GY 1OSAA 2JU0A 4I5JA 4YGEB 2OPOA 1YURA 3O4YA 3WH0A 2OS8B 2M3OW 1FPWA 1KK8B 1K95A 3FIAA 3IQOA 4P2YB 3C1VA 3CR5X 2Q91A 1JF2A 2KYCA 4PE0A 2AUCA 1UP5A 2F2OA 1A29A 2F2PA 4AQJA 3TC5A 5AANA 1JWDA 2K2AA 2EGDA 2GV5A 3D0YA 1WRKA 3WHUB 1PRWA 1KSMA 4BY5A 3LL8B 1CFDA 2JULA 5CSNA 3VGOA 4CPVA 3BOWA 2ZNDA 3NXAA 1JFKA 1XFYO 4N1FA 1LKJA 3VRRA 1A03A 1TCFA 1SRAA 2MRDA 2O60A 1H8BA 1LVCD 2JZIA 2FJUB 1O6WA 4PHKA 4C0LA 1WDCB 1K90D 1N65A 5HLOA 3SIBA 2PALA 3CWGA 1ZOTB 2WCFA 1BT6A 3I5FC 3JTDB 4GNKB 2K7DA 2RE3A 1PVBA 2YSFA 4D1EA 2EZ5W 1SKTA 4MBEA 1VRKA 1LINA 1BU3A 2COLB 4NDBA 3VROA 3DF0B 1RK9A 3EVRA 1TNPA 3A8RA 1YUUA 1YVLA 2JNFA 4GGFC 1MR8A 3CTNA 1K93D 1A75A 3AKAA 3FWCA 3ICBA 4E68A 2E45A 1SW8A 2PSRA 1OE9B 2JTTA 3BUXB 2KGBC 5K89A 2LE9B 1DGVA 3KF9A 4U8DA 1F4QA 1PVAA 1OMRA 2D8NA 3EKJA 1LA0A 1TK7A 5I2OA 2I94A 1OOJA 2YSHA 3KAFA 4U85A 1CDMA 1YR5A 4DUQA 2SCPA 2MDIA 4YGCB 3DVJA 1A4PA 1QV0A 1XO5A 4MVFA 2ZQVA 1L2OC 2Y4QA 2DMVA 3SIAA 1K9RA 1QV1A 3CZTX 2DJYA 1QTXA 2KDHA 4QJ4B 1OZSA 4MZLA 1IH0A 1G8IA 4QJ5B 2XP4A 2FCDA 3SG6A 1J55A 2WCBA 3EK4A 1UWOA 4MZJA 2LNKA 2Y1MA 2YSBA 1PALA 2M9GA 2LVVA 5KTYA 1WR7A 4UPGA 3VRNA 1DF0B 2JX8A 1WRZA 2CT9A 1F8HA 1FI6A 1QVIY 3KHEA 1J1EA 4HREE 1CLLA 1W7IB 1BR1B 3GK4X 4FTGA 1J1DA 1NCXA 1SR6C 1UHNA 2ISDA 1V1GA 1G33A 1WY9A 1IGVA 3LK1A 3SJSA 3FS7A 1C07A 1BODA 5CPVA 4XJKB 2H61A 1AP4A 2JXCA 2ZKMX 3HX4A 1M46A 2K0JA 1N0YA 3DF0A 5B8IB 1L7ZA 1S3PA 4HSZA 2VRGA 2PRUA 4E5RA 3BUWB 4OR9B 5J3XA 3H4SE 2K7CA 3LE4A 1ODBA 1YX8A 1NP8A 1MUXA 1XK4A 5TNCA 1DMOA 1JC2A 2JWWA 2ZFDA 3F45A 2G2BA 2M8JA 4M2QA 3OOBA 2ZR4A 1QLSA 1RROA 1CDNA 2ZQUA 5PALA 1NSHA 2XP9A 3L4HA 2ZN8A 2A4JA 2L51A 3WXAA 1IKUA 5DKQA 2JXWA 5AXIA 4M2OA 2KFHA 1XVJA 1PSRA 3I5FB 2KFFA 2MBXA 1B4CA 1RJVA 1AVSA 2I2RE 2P6BB 2MLFC 2LVJA 3ZWHA 1CFFA 2BL0C 1BOCA 3PFVA 1AK8A 4I5LB 1DJGA 1NX0A 5I2LA 2M97A 1Y1XA 1IQ3A 3BUNB 2LLSA 1QASA 2MJWB 2CNPA 5BPJA 1ZACA 2L4JA 1DJYA 1CMFA 1CKKA 1DF0A 3OX5A 3TUYC 1QXPA 2EC6B 1UHKA 1KQVA 3LLEA 1M63B 2F33A 1CLMA 2MA2A 5GQQC 4DIRA 1F54A 3SG3A 1IQ5A 1B1GA 1IRJA 3BYAA 5FYXA 2NCPA 1KK7Z 4GAOA 4MEWA 3VRPA 1NCYA 5DKNA 1L2OB 4MZKA 1B8CA 1CM1A 1NX2A 1TIZA 2HQWA 2PASA 1Q80A 2JOJA 4JWQA 1OQPA 1SK6D 2BKIB 1FI5A 4Q04A 3KPXA 1NIWA 1J7RA 3IF7A 3ODKA 2LP2A 1TNWA 1U5IB
chains in the Genus database with same CATH superfamily
4NDDA 3V2LA 1IWQA 3BFAA 2LUCA 1YVHA 2LAJA 1NX1A 1BMOA 1LA3A 1NPQA 4NQGA 2M7LA 1CFCA 1OOFA 4I5KA 1ZUZA 1B7TY 2ZR5A 1CFPA 1R6PA 3AAJA 2XP7A 1PK0D 2JRFA 4WQ2A 4MSPA 4DCKA 3D75A 2NZ0A 1SR6B 3TDZA 1UHIA 1SPYA 1QX7A 2LVIA 2XPBA 3M0WA 3PATA 2YSGA 3OB1B 1SCVA 3JVTC 2Y5IA 3BUOB 4QJ3B 4OCIA 1Y6WA 1TCOB 1LXFC 2EC6C 2HF5A 1B9AA 1KWOC 1S6CA 3O2PA 2LUXA 3VRQA 2BNXA 1FBVA 4GGFA 1NMVA 5JOLA 5HKWA 3A4UB 2WOSA 2WCLA 3BFBA 2V53A 1S36A 2I18A 4C0JA 1EJ3A 1GGZA 1QJTA 1S26D 2F3YA 1CTRA 1UUSA 2L98A 2OTGB 2PYQA 4YRUA 3OX6A 3SG4A 1ZMZA 1S6IA 3DXLA 2JT8A 4YGBB 1MQ1A 1EG3A 1CMGA 1FF1A 1X02A 1AUIB 5DKRA 3TDBA 5F6TA 3EK8A 4ZCVA 1FLCA 2FJYA 1HQVA 1XFVO 2ITKA 4ICBA 4GFTA 1BJFA 1XFRA 2BAPA 2K7BA 4XYNA 3D78A 2BBMA 2L4HA 3NTPA 2BL0B 4INWA 1C7VA 1K94A 1DT7B 5AHTA 2CXJA 1B8RA 3DZTA 5IBWA 1N2DA 1KFXL 2LMUA 3FSBA 1D1OA 3CDNA 3I5GC 4INXA 5D7FA 2FOTA 2E6WA 3IVTA 3PALA 2JPTA 3TUYB 1TNQA 1DJIA 4PHNA 3S0AA 1JUOA 2ZN9A 2EHBA 3AKBA 3OGNA 3PM8A 2M8IA 1K9QA 1I5HW 1OMDA 3KCEA 2KNEA 2B1UA 3TS5C 1QIWA 1YUTA 4GPLB 2ZRTA 1ALVA 2P71A 3OB2B 1DEKA 5D69A 1MWNA 1S5GZ 2BCXA 2BKHB 1JF0A 1TRFA 2IS9A 2L5YA 2M8UA 3GK2A 2QACA 5D3OA 3TDIA 2KI4C 2M1UA 4I5NB 3DYEA 1EG4A 3I5IC 4ORBB 4QIBA 1Y0VH 2KI6D 1SNLA 1B8LA 2LLTA 2OTGC 3OP0A 3D0YB 5CSFA 2JQ6A 3IQQA 1XA5A 2R2IA 1GJYA 2LMVA 1KSOA 4OZDA 1W7JB 3LCPC 1ZFSA 1E8AA 2JNXA 2KFGA 3D77A 3HCMA 2K8MB 1TOPA 4GUKA 4WRIA 3BOWB 5ER4X 4A4CA 5HYDA 1IJ5A 5I8NA 2DK1A 2JXLA 3NSLA 4PALA 4FQOA 1KFXS 2JPOA 2L0PA 4PCWA 4A0TA 1BF5A 2LANA 4JQ0D 2KAVA 2RGIA 1YTZC 4KYNA 2CTNA 1YUSA 2CCMA 2DK7A 2KHNA 3MQHA 2KBIA 1RFJA 1PULA 1QLKA 1Y1UA 2AAOA 2KBMA 4CFQA 4ETOA 1NUBA 1UURA 1QWVA 1UHJA 1XFWO 2WCMA 4TNCA 4CFRA 1YW5A 1MHOA 3JVTB 1T14A 4PDZA 4JKTA 3KADA 1KFUS 1WRLA 2FCEA 3NHTA 4YGAA 3B86A 4ZCUA 3MQGA 5DICA 1G4YR 1K9UA 2QDIA 4HRGA 1KWOB 3EVUA 5KSZA 2XPAA 3TZ1A 1KQMB 3WNXB 1SY9A 2PVBA 1A75B 2BBNA 4JD9A 1NWDA 4N5XA 1DELA 2LHIA 3E3RA 4PE4A 3SS4A 1XFZO 4XJKA 1TUJA 4ORCB 1QX2A 1IJ6A 1CM4A 1WLMA 5CSIA 1SL7A 4NDCA 1CB1A 3OBVA 1JBAA 3S0GA 1BG1A 2JMFA 3FE9A 1W9ZA 3SG7A 4YBHB 3BXKA 3WHTB 1ORGA 2LVKA 1JFJA 4PHMA 3SG5A 3TDUA 3L4LA 1M45A 4GLXA 2M49B 2M3WA 2M29A 3LK0A 3PN7C 2M1KB 2YGUA 3DVMA 4PE7A 4YI8A 4F7FA 1B47A 2KLEA 4IL1A 2L4IA 1SL8A 3MSEB 3QRXA 1RWYA 2AMIA 2KOTA 2NLNA 1DJWA 3CR2A 1K96A 3CR4X 1XFXO 3LKXB 1TN4A 2M7NA 1WLZA 3NSKA 3I5HB 3CZ2A 2KQYA 2LHLA 4MRYA 3NSIA 4P5OE 5I2QA 1EH2A 1OZOA 4F0ZB 1F8AB 2KQ6A 1P28A 3KAIA 5E64A 1DJZA 1V1FA 2DOQA 1QX5B 2F3ZA 2NCOA 3S0FA 1K2HA 3NHIA 1AHRA 1UHHA 4YI9A 3I5GB 2F8PA 2HQ8A 1R2UA 3B6XA 2ZNEA 3D76A 1TR8A 2ZAJA 1OOHA 2BCBA 1K9RA 2KYFA 4CIDA 3K21A 1NCZA 2GGMA 2QEBA 4OV2A 3CLNA 3EKHA 1GQMA 2XP6A 3TCZA 3ZNIA 4OVNF 2MAZA 4PE1A 3D10A 2ZQTA 1YX7A 3TS5B 3KAGA 3CGAA 4ORAB 2L2EA 1QIVA 5FI2A 1BLQA 2LV7A 1WMVA 1KQMC 2KSPA 2WCKA 2BE4A 2WADA 1QVIZ 1DTLA 1A2XA 1PSBA 2LP3A 2KI4B 3CZ1A 1OMVA 3DVKA 3PSRA 3I5IB 3PJIA 1C3YA 1KK7Y 1TNXA 1K9KA 2BA1A 2YAJB 3CS1A 2JV4A 2WORA 1SL9A 2MLEC 4PHJA 2OS8C 4MRXA 1QATA 1Z2CB 3RLZA 1KK8C 3KEVA 1K9PA 3UNWA 1F55A 3MCBB 3GK1A 2JT0A 3RM1A 1DJXA 3DD4A 2YSIA 1JSAA 3D73A 1C7WA 2KAXA 2O5GA 2QRVA 2LLUA 4N1GA 5U47A 1NX3A 5JJGA 2K7OA 2WCEA 3I5HC 1H4BA 5CQ2A 1S6JA 2WCJA 4U84A 1AJ5A 3R1OA 4DRWA 1S1EA 1SYMA 2LC5A 2HETA 2KI6C 2LCPA 2WC6A 4USLA 1U5IA 3AAKA 2QEOA 4YGDB 2TN4A 2K2FA 3FE8A 3Q8IA 2Q4UA 2Y8NB 4U86A 1MXEA 1CLBA 1SMGA 4MN0A 5CSJA 1SCMB 2DWVA 1NYAA 1TTXA 1WDCC 1J7PA 2ZRSA 5AEQA 3CNGA 1GGWA 1DJHA 3O6BA 4GBAA 1EXRA 3GOFA 5I94A 1KFUL 2KXQA 4C0KA 2I7AA 3BQ3A 3JTDC 4WQ3A 2G9BA 2H61C 4MLWA 3BUMB 3BFHA 5HKZA 1YRUB 2LM5A 2ZQSA 1XFUO 1CDLA 2XP8A 1DC1A 4HRHA 1CDPA 3OHMB 4REXA 2M0RA 2LAPA 3EK7A 4DS7A 3PN7B 2L5XB 1ZCNA 1EL4A 2JTZA 3K1EA 1RP5A 2WC8A 2HPSA 3FWBA 1XK4C 1SBJA 1YRTB 2BCAA 2XP3A 3S0BA 3SG2A 1M39A 2Y1NA 2KAYA 5HKYA 2E30A 4M2PA 3M7NA 1C3ZA 2GGZA 4JPZB 2PMYA 2BE6A 1OOIX 1QS7A 1JMQA 3UO9A 3MCBA 1HT9A 1M31A 2NXQA 3KO0A 2K61A 2KGRA 2P70A 2CBLA 4FQTA 2LMTA 3NSOA 1F4OA 4AOMA 4L9MA 2PQLA 5AERA 5ER5A 4GGNA 2L50A 1MF8B 2H2KA 2MHHA 1J7QA 1ALWA 3KAHA 2WNDA 1BR4B 3O78A 1RECA 3DVEA 5HL1A 2F21A 1MXLC 1FW4A 1KCYA 2JT3A 1J7OA 2JC2A 1XYDA 5E66A 3PLFB 5G08A 3EVVA 3EG5B 2ZR6A 2SASA 4OKHA 4AQIA 1K8UA 4CLNA 3M85A 2H8VA 1PINA 1RTP1 1Y1AA 1SCMC 2XP5A 2QPTA 1DVIA 1IG5A 1CNPA 1F71A 2KPHA 3KABA 5HLVA 1B7TZ 5KU1A 4A4BA 4BY4A 1DGUA 4R1EA 1AJ4A 1F70A 2Q5AA 2BECA 1S5GY 1OSAA 2JU0A 4I5JA 3B88A 4YGEB 2ERBA 2OPOA 1YURA 1OW4A 3O4YA 3WH0A 2OS8B 2M3OW 1FPWA 1KK8B 1K95A 3FIAA 3IQOA 4P2YB 3C1VA 3CR5X 2Q91A 1JF2A 3N7HA 2KYCA 3CYZA 4PE0A 2AUCA 2QEVA 3R72A 1UP5A 2F2OA 1A29A 2F2PA 4AQJA 3TC5A 5AANA 1JWDA 1Z4HA 2K2AA 2EGDA 3BJHA 2GV5A 3D0YA 1WRKA 3WHUB 1PRWA 1KSMA 4BY5A 3LL8B 3O4XA 1CFDA 2JULA 5CSNA 5FI7A 3VGOA 4CPVA 3BOWA 3B87A 2ZNDA 3NXAA 1JFKA 1XFYO 4N1FA 3FE6A 1LKJA 3VRRA 3RZSA 1A03A 1TCFA 1SRAA 2MRDA 2O60A 1H8BA 1LVCD 2WAEA 2JZIA 2FJUB 1O6WA 4PHKA 4C0LA 1WDCB 1K90D 1N65A 5HLOA 3SIBA 2PALA 3CABA 3CWGA 1ZOTB 2WCFA 1BT6A 3I5FC 3JTDB 4GNKB 2K7DA 2GTEA 4PT1A 2RE3A 1PVBA 2YSFA 2K60A 4D1EA 2EZ5W 1SKTA 4MBEA 1VRKA 1LINA 1BU3A 2COLB 4NDBA 3VROA 1OOGA 3DF0B 1RK9A 1GM0A 3EVRA 1TNPA 3A8RA 1YUUA 1YVLA 2JNFA 4GGFC 1MR8A 1TWOA 3CTNA 1K93D 1A75A 3AKAA 3FWCA 3ICBA 4E68A 2E45A 1SW8A 2PSRA 1OE9B 2JTTA 3BUXB 2KGBC 5K89A 3L47A 2LE9B 1DGVA 3KF9A 4U8DA 1F4QA 3S0EA 1PVAA 1OMRA 4IJ7A 3QMEA 2D8NA 3EKJA 1LA0A 3L4AA 5I2OA 1TK7A 2I94A 1OOJA 2YSHA 1SSEB 3KAFA 3PQHA 1CDMA 1YR5A 4U85A 4DUQA 2SCPA 2MDIA 4YGCB 3DVJA 3CZ0A 1A4PA 1QV0A 1XO5A 4MVFA 3LKXA 3R1VA 2ZQVA 1L2OC 2Y4QA 5AFPA 3SIAA 2DMVA 1QV1A 3CZTX 2DJYA 1QTXA 2KDHA 4QJ4B 1OZSA 4MZLA 1IH0A 1G8IA 4QJ5B 2XP4A 2FCDA 3SG6A 1J55A 2WCBA 3EK4A 1UWOA 4MZJA 2LNKA 2Y1MA 2YSBA 1PALA 2M9GA 2LVVA 3SS5A 5KTYA 4UPGA 1WR7A 3VRNA 1DF0B 2JX8A 1WRZA 2CT9A 1F8HA 3FSCA 1FI6A 1QVIY 3KHEA 5E62A 1J1EA 3DY9A 4HREE 1CLLA 1W7IB 1BR1B 3GK4X 4FTGA 1J1DA 1NCXA 1SR6C 1UHNA 2ISDA 1V1GA 1G33A 1WY9A 1DQEA 1IGVA 3LK1A 3FS7A 3SJSA 1C07A 5E5WA 1BODA 5CPVA 4XJKB 1LS8A 2H61A 1AP4A 4A0UA 2JXCA 2ZKMX 3HX4A 1M46A 2K0JA 1N0YA 2KLDA 3DF0A 1L7ZA 5B8IB 1S3PA 4HSZA 2VRGA 2PRUA 4E5RA 3BUWB 4OR9B 5J3XA 3H4SE 2K7CA 3LE4A 1ODBA 1YX8A 1NP8A 1MUXA 1XK4A 5TNCA 1DMOA 1JC2A 2JWWA 2ZFDA 3F45A 2G2BA 2L2CA 2M8JA 4M2QA 3OOBA 2ZR4A 1QLSA 1RROA 3B7AA 1CDNA 2ZQUA 3NGVA 5PALA 1NSHA 2XP9A 3L4HA 2ZN8A 2A4JA 2L51A 3WXAA 1IKUA 5DKQA 2JXWA 5AXIA 4M2OA 2KFHA 1XVJA 1PSRA 3I5FB 2KFFA 2MBXA 1B4CA 5EL2A 1RJVA 3FS8A 1AVSA 2I2RE 2P6BB 2MLFC 3S0DA 2LVJA 3ZWHA 1CFFA 2BL0C 1BOCA 3PFVA 1AK8A 4I5LB 1DJGA 1NX0A 5I2LA 2M97A 1IIOA 1Y1XA 1IQ3A 3BUNB 2LLSA 1QASA 2MJWB 2CNPA 5BPJA 1ZACA 2L4JA 1DJYA 1CMFA 3PM2A 1CKKA 1DF0A 3OX5A 3TUYC 1QXPA 2EC6B 1UHKA 3R1PA 2WC5A 3SS3A 1KQVA 3LLEA 1M63B 1TUZA 1CLMA 2F33A 2MA2A 5GQQC 4DIRA 1F54A 3SG3A 2OWOA 1IQ5A 1B1GA 1IRJA 3BYAA 5FYXA 2NCPA 5E65A 1KK7Z 4GAOA 4MEWA 3VRPA 2WCHA 5FI6A 1NCYA 3D74A 5DKNA 1L2OB 4MZKA 1B8CA 1CM1A 1NX2A 1TIZA 2HQWA 2PASA 1Q80A 2JOJA 3VB1A 4JWQA 1OQPA 1SK6D 2BKIB 1FI5A 4Q04A 3KPXA 1NIWA 1J7RA 2QEHA 3IF7A 3ODKA 2LP2A 1TNWA 1U5IB
chains in the Genus database with same CATH topology
4NDDA 1IWQA 2LAJA 2LUCA 1YVHA 1NX1A 1BMOA 1LA3A 1NPQA 4NQGA 2M7LA 1CFCA 4I5KA 1ZUZA 1B7TY 2ZR5A 1CFPA 1R6PA 3AAJA 2XP7A 1PK0D 2JRFA 4WQ2A 4MSPA 4DCKA 2NZ0A 1SR6B 3TDZA 1UHIA 1SPYA 1QX7A 2LVIA 2XPBA 3M0WA 3PATA 2YSGA 3OB1B 1SCVA 3JVTC 2Y5IA 3BUOB 4QJ3B 4OCIA 1Y6WA 1TCOB 1LXFC 2EC6C 2HF5A 1B9AA 1KWOC 1S6CA 3O2PA 2LUXA 3VRQA 1FBVA 4GGFA 1NMVA 5JOLA 5HKWA 3A4UB 2WOSA 2V53A 1S36A 2I18A 4C0JA 1EJ3A 1GGZA 1QJTA 1S26D 2F3YA 1CTRA 1UUSA 2L98A 2OTGB 4YRUA 3OX6A 3SG4A 1ZMZA 1S6IA 2JT8A 4YGBB 1MQ1A 1EG3A 1CMGA 1FF1A 1X02A 1AUIB 3TDBA 5F6TA 3EK8A 4ZCVA 1FLCA 1HQVA 1XFVO 2ITKA 4ICBA 4GFTA 1BJFA 2K7BA 4XYNA 2BBMA 2L4HA 3NTPA 2BL0B 1C7VA 1K94A 1DT7B 5AHTA 2CXJA 1B8RA 5IBWA 1N2DA 1KFXL 2LMUA 3FSBA 1D1OA 3I5GC 5D7FA 2FOTA 2E6WA 3PALA 2JPTA 3TUYB 1TNQA 1DJIA 4PHNA 1JUOA 2ZN9A 2EHBA 3AKBA 3PM8A 2M8IA 1K9QA 1I5HW 1OMDA 3KCEA 2KNEA 2B1UA 3TS5C 1QIWA 1YUTA 4GPLB 2ZRTA 1ALVA 3OB2B 5D69A 1MWNA 1S5GZ 2BCXA 2BKHB 1JF0A 1TRFA 2IS9A 2M8UA 3GK2A 3TDIA 2QACA 5AFPA 2KI4C 2M1UA 4I5NB 4QIBA 1EG4A 3I5IC 4ORBB 1Y0VH 2KI6D 1SNLA 1B8LA 2LLTA 2OTGC 3OP0A 3D0YB 5CSFA 2JQ6A 3IQQA 1XA5A 2R2IA 1GJYA 2LMVA 1KSOA 1W7JB 3LCPC 1ZFSA 1E8AA 2JNXA 2KFGA 3HCMA 2K8MB 1TOPA 4GUKA 4WRIA 3BOWB 5ER4X 4A4CA 5HYDA 1IJ5A 5I8NA 2DK1A 2JXLA 3NSLA 4PALA 4FQOA 1KFXS 2L0PA 4PCWA 4A0TA 1BF5A 2LANA 4JQ0D 2KAVA 2RGIA 1YTZC 2CTNA 1YUSA 2CCMA 2DK7A 2KHNA 3MQHA 2KBIA 1RFJA 1PULA 1QLKA 1Y1UA 2AAOA 2KBMA 4CFQA 4ETOA 1NUBA 1UURA 1UHJA 1XFWO 4TNCA 4CFRA 1YW5A 1MHOA 3JVTB 4PDZA 3KADA 1KFUS 1WRLA 2FCEA 4YGAA 4ZCUA 3MQGA 1G4YR 1K9UA 4HRGA 1KWOB 3EVUA 5KSZA 2XPAA 3TZ1A 1KQMB 3WNXB 1SY9A 2PVBA 1A75B 2BBNA 1NWDA 4N5XA 2LHIA 3E3RA 4PE4A 1XFZO 4XJKA 4ORCB 1QX2A 1IJ6A 1CM4A 1WLMA 5CSIA 1SL7A 4NDCA 1CB1A 1JBAA 2JMFA 1BG1A 3SG7A 4YBHB 3BXKA 3WHTB 2LVKA 1JFJA 4PHMA 3SG5A 3TDUA 4GLXA 1M45A 2M49B 2M3WA 2M29A 3LK0A 3PN7C 2M1KB 3DVMA 4PE7A 4YI8A 1B47A 4IL1A 2L4IA 1SL8A 3MSEB 3QRXA 1RWYA 2AMIA 2KOTA 2NLNA 1DJWA 3CR2A 1K96A 3CR4X 1XFXO 3LKXB 1TN4A 2M7NA 1WLZA 3NSKA 3I5HB 4P5OE 2KQYA 2LHLA 4MRYA 3NSIA 5I2QA 1EH2A 1F8AB 1OZOA 4F0ZB 2KQ6A 3KAIA 5E64A 1DJZA 1V1FA 2DOQA 1QX5B 2F3ZA 2NCOA 1K2HA 1AHRA 1UHHA 4YI9A 3I5GB 2F8PA 2HQ8A 1R2UA 2ZNEA 2ZAJA 1TR8A 2BCBA 2KYFA 4CIDA 3K21A 1NCZA 2GGMA 4OV2A 3CLNA 3EKHA 1GQMA 2XP6A 3TCZA 3ZNIA 4OVNF 2MAZA 4PE1A 3D10A 2ZQTA 1YX7A 3TS5B 3KAGA 3CGAA 4ORAB 2L2EA 1QIVA 1BLQA 2LV7A 1WMVA 1KQMC 2KSPA 2BE4A 2WADA 1QVIZ 1DTLA 1A2XA 1PSBA 2LP3A 2KI4B 3DVKA 1OMVA 3PSRA 5DKRA 3I5IB 1KK7Y 1TNXA 1K9KA 2BA1A 2YAJB 3CS1A 2JV4A 2WORA 1SL9A 2MLEC 4PHJA 2OS8C 4MRXA 1QATA 3RLZA 1F55A 1KK8C 3KEVA 1K9PA 3MCBB 3GK1A 2JT0A 3RM1A 1DJXA 3DD4A 2YSIA 1JSAA 1C7WA 2KAXA 2O5GA 2QRVA 2LLUA 4N1GA 5U47A 1NX3A 5JJGA 2K7OA 2WCEA 3I5HC 1H4BA 5CQ2A 1S6JA 4U84A 1AJ5A 4DRWA 1S1EA 1SYMA 2LC5A 2HETA 2KI6C 2LCPA 4USLA 1U5IA 3AAKA 4YGDB 2TN4A 2K2FA 2Q4UA 2Y8NB 4U86A 1MXEA 1CLBA 1SMGA 4MN0A 5CSJA 1SCMB 2DWVA 1NYAA 1TTXA 1WDCC 1J7PA 2ZRSA 5AEQA 3CNGA 1GGWA 1DJHA 3O6BA 4GBAA 1EXRA 3GOFA 2KXQA 1KFUL 4C0KA 2I7AA 3BQ3A 3JTDC 4WQ3A 2G9BA 2H61C 4MLWA 3BUMB 5HKZA 1YRUB 2LM5A 2ZQSA 1XFUO 1CDLA 2XP8A 4HRHA 1CDPA 3OHMB 4REXA 2M0RA 2LAPA 3EK7A 4DS7A 3PN7B 2L5XB 1ZCNA 1EL4A 2JTZA 1RP5A 2WC8A 2HPSA 3FWBA 1XK4C 1SBJA 1YRTB 2BCAA 2XP3A 3SG2A 1M39A 2Y1NA 2KAYA 5HKYA 2E30A 4M2PA 3M7NA 2GGZA 4JPZB 2PMYA 2BE6A 1QS7A 1JMQA 3MCBA 1HT9A 1M31A 2NXQA 3KO0A 2K61A 2KGRA 2CBLA 2LMTA 3NSOA 1F4OA 4AOMA 4L9MA 5AERA 5ER5A 4GGNA 2L50A 1MF8B 2H2KA 2MHHA 1J7QA 1ALWA 3KAHA 2WNDA 1BR4B 3O78A 1RECA 3DVEA 2F21A 1MXLC 1FW4A 1KCYA 2JT3A 1J7OA 2JC2A 1XYDA 5E66A 3PLFB 5G08A 3EVVA 2ZR6A 2SASA 4OKHA 4AQIA 1K8UA 4CLNA 3M85A 1PINA 1RTP1 1Y1AA 1SCMC 2XP5A 2QPTA 1DVIA 1IG5A 1CNPA 1F71A 3KABA 5HLVA 1B7TZ 5KU1A 4A4BA 4BY4A 1DGUA 4R1EA 1AJ4A 1F70A 2Q5AA 2BECA 1S5GY 1OSAA 2JU0A 4I5JA 4YGEB 2OPOA 1YURA 3O4YA 3WH0A 2OS8B 2M3OW 1FPWA 1KK8B 1K95A 3FIAA 3IQOA 4P2YB 3C1VA 3CR5X 2Q91A 1JF2A 2KYCA 4PE0A 2AUCA 1UP5A 2F2OA 1A29A 2F2PA 4AQJA 3TC5A 5AANA 1JWDA 2K2AA 2EGDA 2GV5A 3D0YA 1WRKA 3WHUB 1PRWA 1KSMA 4BY5A 3LL8B 1CFDA 2JULA 5CSNA 3VGOA 4CPVA 3BOWA 2ZNDA 3NXAA 1JFKA 1XFYO 4N1FA 1LKJA 3VRRA 1A03A 1TCFA 1SRAA 2MRDA 2O60A 1H8BA 1LVCD 2WAEA 2JZIA 2FJUB 1O6WA 4PHKA 4C0LA 1WDCB 1K90D 1N65A 5HLOA 3SIBA 2PALA 3CWGA 1ZOTB 2WCFA 1BT6A 3I5FC 3JTDB 4GNKB 2K7DA 2RE3A 1PVBA 2YSFA 4D1EA 2EZ5W 1SKTA 4MBEA 1VRKA 1LINA 1BU3A 2COLB 4NDBA 3VROA 3DF0B 1RK9A 3EVRA 1TNPA 3A8RA 1YUUA 1YVLA 2JNFA 4GGFC 1MR8A 3CTNA 1K93D 1A75A 3AKAA 3FWCA 3ICBA 4E68A 2E45A 1SW8A 2PSRA 1OE9B 2JTTA 3BUXB 2KGBC 5K89A 2LE9B 1DGVA 3KF9A 4U8DA 1F4QA 1PVAA 1OMRA 2D8NA 3EKJA 1LA0A 1TK7A 5I2OA 3PQHA 2I94A 1OOJA 2YSHA 3KAFA 4U85A 1CDMA 1YR5A 4DUQA 2SCPA 2MDIA 4YGCB 3DVJA 1A4PA 1QV0A 1XO5A 4MVFA 3LKXA 2ZQVA 1L2OC 2Y4QA 2DMVA 3SIAA 1K9RA 1QV1A 3CZTX 2DJYA 1QTXA 2KDHA 4QJ4B 1OZSA 4MZLA 1IH0A 1G8IA 4QJ5B 2XP4A 2FCDA 3SG6A 1J55A 2WCBA 3EK4A 1UWOA 4MZJA 2LNKA 2Y1MA 2YSBA 1PALA 2M9GA 2LVVA 5KTYA 1WR7A 4UPGA 3VRNA 1DF0B 2JX8A 1WRZA 2CT9A 1F8HA 3FSCA 1FI6A 1QVIY 3KHEA 5E62A 1J1EA 4HREE 1CLLA 1W7IB 1BR1B 3GK4X 4FTGA 1J1DA 1NCXA 1SR6C 1UHNA 2ISDA 1V1GA 1G33A 1WY9A 1IGVA 3LK1A 3SJSA 3FS7A 1C07A 5E5WA 1BODA 5CPVA 4XJKB 2H61A 1AP4A 4A0UA 2JXCA 2ZKMX 3HX4A 1M46A 2K0JA 1N0YA 3DF0A 5B8IB 1L7ZA 1S3PA 4HSZA 2VRGA 2PRUA 4E5RA 3BUWB 4OR9B 5J3XA 3H4SE 2K7CA 3LE4A 1ODBA 1YX8A 1NP8A 1MUXA 1XK4A 5TNCA 1DMOA 1JC2A 2JWWA 2ZFDA 3F45A 2G2BA 2M8JA 4M2QA 3OOBA 2ZR4A 1QLSA 1RROA 1CDNA 2ZQUA 5PALA 1NSHA 2XP9A 3L4HA 2ZN8A 2A4JA 2L51A 3WXAA 1IKUA 5DKQA 2JXWA 5AXIA 4M2OA 2KFHA 1XVJA 1PSRA 3I5FB 2KFFA 2MBXA 1B4CA 1RJVA 3FS8A 1AVSA 2I2RE 2P6BB 2MLFC 2LVJA 3ZWHA 1CFFA 2BL0C 1BOCA 3PFVA 1AK8A 4I5LB 1DJGA 1NX0A 5I2LA 2M97A 1Y1XA 1IQ3A 3BUNB 2LLSA 1QASA 2MJWB 2CNPA 5BPJA 1ZACA 2L4JA 1DJYA 1CMFA 1CKKA 1DF0A 3OX5A 3TUYC 1QXPA 2EC6B 1UHKA 1KQVA 3LLEA 1M63B 2F33A 1CLMA 2MA2A 5GQQC 4DIRA 1F54A 3SG3A 2OWOA 1IQ5A 1B1GA 1IRJA 3BYAA 5FYXA 2NCPA 5E65A 1KK7Z 4GAOA 4MEWA 3VRPA 1NCYA 5DKNA 1L2OB 4MZKA 1B8CA 1CM1A 1NX2A 1TIZA 2HQWA 2PASA 1Q80A 2JOJA 4JWQA 1OQPA 1SK6D 2BKIB 1FI5A 4Q04A 3KPXA 1NIWA 1J7RA 3IF7A 3ODKA 2LP2A 1TNWA 1U5IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NDD A;  1IWQ A;  2LAJ A;  2LUC A;  1YVH A;  1NX1 A;  1BMO A;  1LA3 A;  1NPQ A;  4NQG A;  2M7L A;  1CFC A;  4I5K A;  1ZUZ A;  1B7T Y;  2ZR5 A;  1CFP A;  1R6P A;  3AAJ A;  2XP7 A;  1PK0 D;  2JRF A;  4WQ2 A;  4MSP A;  4DCK A;  2NZ0 A;  1SR6 B;  3TDZ A;  1UHI A;  1SPY A;  1QX7 A;  2LVI A;  2XPB A;  3M0W A;  3PAT A;  2YSG A;  3OB1 B;  1SCV A;  3JVT C;  2Y5I A;  3BUO B;  4QJ3 B;  4OCI A;  1Y6W A;  1TCO B;  1LXF C;  2EC6 C;  2HF5 A;  1B9A A;  1KWO C;  1S6C A;  3O2P A;  2LUX A;  3VRQ A;  1FBV A;  4GGF A;  1NMV A;  5JOL A;  5HKW A;  3A4U B;  2WOS A;  2V53 A;  1S36 A;  2I18 A;  4C0J A;  1EJ3 A;  1GGZ A;  1QJT A;  1S26 D;  2F3Y A;  1CTR A;  1UUS A;  2L98 A;  2OTG B;  4YRU A;  3OX6 A;  3SG4 A;  1ZMZ A;  1S6I A;  2JT8 A;  4YGB B;  1MQ1 A;  1EG3 A;  1CMG A;  1FF1 A;  1X02 A;  1AUI B;  3TDB A;  5F6T A;  3EK8 A;  4ZCV A;  1HQV A;  1XFV O;  2ITK A;  4ICB A;  4GFT A;  1BJF A;  2K7B A;  4XYN A;  2BBM A;  2L4H A;  3NTP A;  2BL0 B;  1C7V A;  1K94 A;  1DT7 B;  5AHT A;  2CXJ A;  1B8R A;  5IBW A;  1N2D A;  1KFX L;  2LMU A;  1D1O A;  3I5G C;  5D7F A;  2FOT A;  2E6W A;  3PAL A;  2JPT A;  3TUY B;  1TNQ A;  1DJI A;  4PHN A;  1JUO A;  2ZN9 A;  2EHB A;  3AKB A;  3PM8 A;  2M8I A;  1K9Q A;  1I5H W;  1OMD A;  3KCE A;  2KNE A;  2B1U A;  3TS5 C;  1QIW A;  1YUT A;  4GPL B;  2ZRT A;  1ALV A;  3OB2 B;  5D69 A;  1MWN A;  1S5G Z;  2BCX A;  2BKH B;  1JF0 A;  1TRF A;  2IS9 A;  2M8U A;  3GK2 A;  3TDI A;  2QAC A;  5AFP A;  2KI4 C;  2M1U A;  4I5N B;  4QIB A;  1EG4 A;  3I5I C;  4ORB B;  1Y0V H;  2KI6 D;  1SNL A;  1B8L A;  2LLT A;  2OTG C;  3OP0 A;  3D0Y B;  5CSF A;  2JQ6 A;  3IQQ A;  1XA5 A;  2R2I A;  1GJY A;  2LMV A;  1KSO A;  1W7J B;  3LCP C;  1ZFS A;  1E8A A;  2JNX A;  2KFG A;  3HCM A;  2K8M B;  1TOP A;  4GUK A;  4WRI A;  3BOW B;  5ER4 X;  4A4C A;  5HYD A;  1IJ5 A;  5I8N A;  2DK1 A;  2JXL A;  3NSL A;  4PAL A;  4FQO A;  1KFX S;  2L0P A;  4PCW A;  1BF5 A;  2LAN A;  4JQ0 D;  2KAV A;  2RGI A;  1YTZ C;  2CTN A;  1YUS A;  2CCM A;  2DK7 A;  2KHN A;  2KBI A;  1RFJ A;  1PUL A;  1QLK A;  1Y1U A;  2AAO A;  2KBM A;  4CFQ A;  4ETO A;  1NUB A;  1UUR A;  1UHJ A;  1XFW O;  4TNC A;  4CFR A;  1YW5 A;  1MHO A;  3JVT B;  4PDZ A;  3KAD A;  1KFU S;  1WRL A;  2FCE A;  4YGA A;  4ZCU A;  1G4Y R;  1K9U A;  4HRG A;  1KWO B;  3EVU A;  5KSZ A;  2XPA A;  3TZ1 A;  1KQM B;  3WNX B;  1SY9 A;  2PVB A;  1A75 B;  2BBN A;  1NWD A;  4N5X A;  2LHI A;  3E3R A;  4PE4 A;  1XFZ O;  4XJK A;  4ORC B;  1QX2 A;  1IJ6 A;  1CM4 A;  1WLM A;  5CSI A;  1SL7 A;  4NDC A;  1CB1 A;  1JBA A;  2JMF A;  1BG1 A;  3SG7 A;  4YBH B;  3BXK A;  3WHT B;  2LVK A;  1JFJ A;  4PHM A;  3SG5 A;  3TDU A;  1M45 A;  2M49 B;  2M3W A;  2M29 A;  3LK0 A;  3PN7 C;  2M1K B;  3DVM A;  4PE7 A;  4YI8 A;  1B47 A;  4IL1 A;  2L4I A;  1SL8 A;  3MSE B;  3QRX A;  1RWY A;  2AMI A;  2KOT A;  2NLN A;  1DJW A;  3CR2 A;  1K96 A;  3CR4 X;  1XFX O;  1TN4 A;  2M7N A;  1WLZ A;  3NSK A;  3I5H B;  4P5O E;  2KQY A;  2LHL A;  4MRY A;  3NSI A;  5I2Q A;  1EH2 A;  1F8A B;  1OZO A;  4F0Z B;  2KQ6 A;  3KAI A;  1DJZ A;  1V1F A;  2DOQ A;  1QX5 B;  2F3Z A;  2NCO A;  1K2H A;  1AHR A;  1UHH A;  4YI9 A;  3I5G B;  2F8P A;  2HQ8 A;  1R2U A;  2ZNE A;  2ZAJ A;  2BCB A;  2KYF A;  4CID A;  3K21 A;  1NCZ A;  2GGM A;  4OV2 A;  3CLN A;  3EKH A;  1GQM A;  2XP6 A;  3TCZ A;  3ZNI A;  4OVN F;  2MAZ A;  4PE1 A;  3D10 A;  2ZQT A;  1YX7 A;  3TS5 B;  3KAG A;  3CGA A;  4ORA B;  2L2E A;  1QIV A;  1BLQ A;  2LV7 A;  1WMV A;  1KQM C;  2KSP A;  2BE4 A;  1QVI Z;  1DTL A;  1A2X A;  1PSB A;  2LP3 A;  2KI4 B;  3DVK A;  1OMV A;  3PSR A;  5DKR A;  3I5I B;  1KK7 Y;  1TNX A;  1K9K A;  2BA1 A;  3CS1 A;  2JV4 A;  2WOR A;  1SL9 A;  2MLE C;  4PHJ A;  2OS8 C;  4MRX A;  1QAT A;  3RLZ A;  1F55 A;  1KK8 C;  3KEV A;  1K9P A;  3GK1 A;  2JT0 A;  3RM1 A;  1DJX A;  3DD4 A;  2YSI A;  1JSA A;  1C7W A;  2KAX A;  2O5G A;  2LLU A;  4N1G A;  1NX3 A;  5JJG A;  2K7O A;  2WCE A;  3I5H C;  1H4B A;  5CQ2 A;  1S6J A;  4U84 A;  1AJ5 A;  4DRW A;  1S1E A;  1SYM A;  2LC5 A;  2HET A;  2KI6 C;  2LCP A;  4USL A;  1U5I A;  3AAK A;  4YGD B;  2TN4 A;  2K2F A;  2Q4U A;  4U86 A;  1MXE A;  1CLB A;  1SMG A;  4MN0 A;  5CSJ A;  1SCM B;  2DWV A;  1NYA A;  1TTX A;  1WDC C;  1J7P A;  2ZRS A;  5AEQ A;  3CNG A;  1GGW A;  1DJH A;  3O6B A;  4GBA A;  1EXR A;  3GOF A;  2KXQ A;  1KFU L;  4C0K A;  2I7A A;  3BQ3 A;  3JTD C;  4WQ3 A;  2G9B A;  2H61 C;  4MLW A;  3BUM B;  5HKZ A;  1YRU B;  2LM5 A;  2ZQS A;  1XFU O;  1CDL A;  2XP8 A;  4HRH A;  1CDP A;  3OHM B;  4REX A;  2M0R A;  2LAP A;  3EK7 A;  4DS7 A;  3PN7 B;  2L5X B;  1ZCN A;  1EL4 A;  2JTZ A;  2WC8 A;  2HPS A;  3FWB A;  1XK4 C;  1SBJ A;  1YRT B;  2BCA A;  2XP3 A;  3SG2 A;  1M39 A;  2Y1N A;  2KAY A;  5HKY A;  2E30 A;  4M2P A;  3M7N A;  2GGZ A;  4JPZ B;  2PMY A;  2BE6 A;  1QS7 A;  1JMQ A;  1HT9 A;  1M31 A;  2NXQ A;  3KO0 A;  2K61 A;  2KGR A;  2CBL A;  2LMT A;  3NSO A;  1F4O A;  4AOM A;  4L9M A;  5AER A;  5ER5 A;  4GGN A;  2L50 A;  1MF8 B;  2H2K A;  2MHH A;  1J7Q A;  1ALW A;  3KAH A;  2WND A;  1BR4 B;  3O78 A;  1REC A;  3DVE A;  2F21 A;  1MXL C;  1FW4 A;  1KCY A;  2JT3 A;  1J7O A;  2JC2 A;  1XYD A;  3PLF B;  5G08 A;  3EVV A;  2ZR6 A;  2SAS A;  4OKH A;  4AQI A;  1K8U A;  4CLN A;  3M85 A;  1PIN A;  1RTP 1;  1Y1A A;  1SCM C;  2XP5 A;  2QPT A;  1DVI A;  1IG5 A;  1CNP A;  1F71 A;  3KAB A;  5HLV A;  1B7T Z;  5KU1 A;  4A4B A;  4BY4 A;  1DGU A;  4R1E A;  1AJ4 A;  1F70 A;  2Q5A A;  2BEC A;  1S5G Y;  1OSA A;  2JU0 A;  4I5J A;  4YGE B;  2OPO A;  1YUR A;  3O4Y A;  3WH0 A;  2OS8 B;  2M3O W;  1FPW A;  1KK8 B;  1K95 A;  3FIA A;  3IQO A;  4P2Y B;  3C1V A;  3CR5 X;  2Q91 A;  1JF2 A;  2KYC A;  4PE0 A;  2AUC A;  1UP5 A;  2F2O A;  1A29 A;  2F2P A;  4AQJ A;  3TC5 A;  5AAN A;  1JWD A;  2K2A A;  2EGD A;  2GV5 A;  3D0Y A;  1WRK A;  3WHU B;  1PRW A;  1KSM A;  4BY5 A;  3LL8 B;  1CFD A;  2JUL A;  5CSN A;  3VGO A;  4CPV A;  3BOW A;  2ZND A;  3NXA A;  1JFK A;  1XFY O;  4N1F A;  1LKJ A;  3VRR A;  1A03 A;  1TCF A;  1SRA A;  2MRD A;  2O60 A;  1H8B A;  1LVC D;  2JZI A;  2FJU B;  1O6W A;  4PHK A;  4C0L A;  1WDC B;  1K90 D;  1N65 A;  5HLO A;  3SIB A;  2PAL A;  3CWG A;  1ZOT B;  2WCF A;  1BT6 A;  3I5F C;  3JTD B;  4GNK B;  2K7D A;  2RE3 A;  1PVB A;  2YSF A;  4D1E A;  2EZ5 W;  1SKT A;  4MBE A;  1VRK A;  1LIN A;  1BU3 A;  2COL B;  4NDB A;  3VRO A;  3DF0 B;  1RK9 A;  3EVR A;  1TNP A;  3A8R A;  1YUU A;  1YVL A;  2JNF A;  4GGF C;  1MR8 A;  3CTN A;  1K93 D;  1A75 A;  3AKA A;  3FWC A;  3ICB A;  4E68 A;  2E45 A;  1SW8 A;  2PSR A;  1OE9 B;  2JTT A;  3BUX B;  2KGB C;  5K89 A;  2LE9 B;  1DGV A;  3KF9 A;  4U8D A;  1F4Q A;  1PVA A;  1OMR A;  2D8N A;  3EKJ A;  1LA0 A;  1TK7 A;  5I2O A;  2I94 A;  1OOJ A;  2YSH A;  3KAF A;  4U85 A;  1CDM A;  1YR5 A;  4DUQ A;  2SCP A;  2MDI A;  4YGC B;  3DVJ A;  1A4P A;  1QV0 A;  1XO5 A;  4MVF A;  2ZQV A;  1L2O C;  2Y4Q A;  2DMV A;  3SIA A;  1K9R A;  1QV1 A;  3CZT X;  2DJY A;  1QTX A;  2KDH A;  4QJ4 B;  1OZS A;  4MZL A;  1IH0 A;  1G8I A;  4QJ5 B;  2XP4 A;  2FCD A;  3SG6 A;  1J55 A;  2WCB A;  3EK4 A;  1UWO A;  4MZJ A;  2LNK A;  2Y1M A;  2YSB A;  1PAL A;  2M9G A;  2LVV A;  5KTY A;  1WR7 A;  4UPG A;  3VRN A;  1DF0 B;  2JX8 A;  1WRZ A;  2CT9 A;  1F8H A;  1FI6 A;  1QVI Y;  3KHE A;  1J1E A;  4HRE E;  1CLL A;  1W7I B;  1BR1 B;  3GK4 X;  4FTG A;  1J1D A;  1NCX A;  1SR6 C;  1UHN A;  2ISD A;  1V1G A;  1G33 A;  1WY9 A;  1IGV A;  3LK1 A;  3SJS A;  3FS7 A;  1C07 A;  1BOD A;  5CPV A;  4XJK B;  2H61 A;  1AP4 A;  2JXC A;  2ZKM X;  3HX4 A;  1M46 A;  2K0J A;  1N0Y A;  3DF0 A;  5B8I B;  1L7Z A;  1S3P A;  4HSZ A;  2VRG A;  2PRU A;  4E5R A;  3BUW B;  4OR9 B;  5J3X A;  3H4S E;  2K7C A;  3LE4 A;  1ODB A;  1YX8 A;  1NP8 A;  1MUX A;  1XK4 A;  5TNC A;  1DMO A;  1JC2 A;  2JWW A;  2ZFD A;  3F45 A;  2G2B A;  2M8J A;  4M2Q A;  3OOB A;  2ZR4 A;  1QLS A;  1RRO A;  1CDN A;  2ZQU A;  5PAL A;  1NSH A;  2XP9 A;  3L4H A;  2ZN8 A;  2A4J A;  2L51 A;  3WXA A;  1IKU A;  5DKQ A;  2JXW A;  5AXI A;  4M2O A;  2KFH A;  1XVJ A;  1PSR A;  3I5F B;  2KFF A;  2MBX A;  1B4C A;  1RJV A;  1AVS A;  2I2R E;  2P6B B;  2MLF C;  2LVJ A;  3ZWH A;  1CFF A;  2BL0 C;  1BOC A;  3PFV A;  1AK8 A;  4I5L B;  1DJG A;  1NX0 A;  5I2L A;  2M97 A;  1Y1X A;  1IQ3 A;  3BUN B;  2LLS A;  1QAS A;  2MJW B;  2CNP A;  5BPJ A;  1ZAC A;  2L4J A;  1DJY A;  1CMF A;  1CKK A;  1DF0 A;  3OX5 A;  3TUY C;  1QXP A;  2EC6 B;  1UHK A;  1KQV A;  3LLE A;  1M63 B;  2F33 A;  1CLM A;  2MA2 A;  5GQQ C;  4DIR A;  1F54 A;  3SG3 A;  1IQ5 A;  1B1G A;  1IRJ A;  3BYA A;  5FYX A;  2NCP A;  1KK7 Z;  4GAO A;  4MEW A;  3VRP A;  1NCY A;  5DKN A;  1L2O B;  4MZK A;  1B8C A;  1CM1 A;  1NX2 A;  1TIZ A;  2HQW A;  2PAS A;  1Q80 A;  2JOJ A;  4JWQ A;  1OQP A;  1SK6 D;  2BKI B;  1FI5 A;  4Q04 A;  3KPX A;  1NIW A;  1J7R A;  3IF7 A;  3ODK A;  2LP2 A;  1TNW A;  1U5I B; 
#chains in the Genus database with same CATH topology
 4NDD A;  3V2L A;  1IWQ A;  3BFA A;  2LUC A;  1YVH A;  2LAJ A;  1NX1 A;  1BMO A;  1LA3 A;  1NPQ A;  4NQG A;  2M7L A;  1CFC A;  1OOF A;  4I5K A;  1ZUZ A;  1B7T Y;  2ZR5 A;  1CFP A;  1R6P A;  3AAJ A;  2XP7 A;  1PK0 D;  2JRF A;  4WQ2 A;  4MSP A;  4DCK A;  3D75 A;  2NZ0 A;  1SR6 B;  3TDZ A;  1UHI A;  1SPY A;  1QX7 A;  2LVI A;  2XPB A;  3M0W A;  3PAT A;  2YSG A;  3OB1 B;  1SCV A;  3JVT C;  2Y5I A;  3BUO B;  4QJ3 B;  4OCI A;  1Y6W A;  1TCO B;  1LXF C;  2EC6 C;  2HF5 A;  1B9A A;  1KWO C;  1S6C A;  3O2P A;  2LUX A;  3VRQ A;  2BNX A;  1FBV A;  4GGF A;  1NMV A;  5JOL A;  5HKW A;  3A4U B;  2WOS A;  2WCL A;  3BFB A;  2V53 A;  1S36 A;  2I18 A;  4C0J A;  1EJ3 A;  1GGZ A;  1QJT A;  1S26 D;  2F3Y A;  1CTR A;  1UUS A;  2L98 A;  2OTG B;  2PYQ A;  4YRU A;  3OX6 A;  3SG4 A;  1ZMZ A;  1S6I A;  3DXL A;  2JT8 A;  4YGB B;  1MQ1 A;  1EG3 A;  1CMG A;  1FF1 A;  1X02 A;  1AUI B;  5DKR A;  3TDB A;  5F6T A;  3EK8 A;  4ZCV A;  1FLC A;  2FJY A;  1HQV A;  1XFV O;  2ITK A;  4ICB A;  4GFT A;  1BJF A;  1XFR A;  2BAP A;  2K7B A;  4XYN A;  3D78 A;  2BBM A;  2L4H A;  3NTP A;  2BL0 B;  4INW A;  1C7V A;  1K94 A;  1DT7 B;  5AHT A;  2CXJ A;  1B8R A;  3DZT A;  5IBW A;  1N2D A;  1KFX L;  2LMU A;  3FSB A;  1D1O A;  3CDN A;  3I5G C;  4INX A;  5D7F A;  2FOT A;  2E6W A;  3IVT A;  3PAL A;  2JPT A;  3TUY B;  1TNQ A;  1DJI A;  4PHN A;  3S0A A;  1JUO A;  2ZN9 A;  2EHB A;  3AKB A;  3OGN A;  3PM8 A;  2M8I A;  1K9Q A;  1I5H W;  1OMD A;  3KCE A;  2KNE A;  2B1U A;  3TS5 C;  1QIW A;  1YUT A;  4GPL B;  2ZRT A;  1ALV A;  2P71 A;  3OB2 B;  1DEK A;  5D69 A;  1MWN A;  1S5G Z;  2BCX A;  2BKH B;  1JF0 A;  1TRF A;  2IS9 A;  2L5Y A;  2M8U A;  3GK2 A;  2QAC A;  5D3O A;  3TDI A;  2KI4 C;  2M1U A;  4I5N B;  3DYE A;  1EG4 A;  3I5I C;  4ORB B;  4QIB A;  1Y0V H;  2KI6 D;  1SNL A;  1B8L A;  2LLT A;  2OTG C;  3OP0 A;  3D0Y B;  5CSF A;  2JQ6 A;  3IQQ A;  1XA5 A;  2R2I A;  1GJY A;  2LMV A;  1KSO A;  4OZD A;  1W7J B;  3LCP C;  1ZFS A;  1E8A A;  2JNX A;  2KFG A;  3D77 A;  3HCM A;  2K8M B;  1TOP A;  4GUK A;  4WRI A;  3BOW B;  5ER4 X;  4A4C A;  5HYD A;  1IJ5 A;  5I8N A;  2DK1 A;  2JXL A;  3NSL A;  4PAL A;  4FQO A;  1KFX S;  2JPO A;  2L0P A;  4PCW A;  4A0T A;  1BF5 A;  2LAN A;  4JQ0 D;  2KAV A;  2RGI A;  1YTZ C;  4KYN A;  2CTN A;  1YUS A;  2CCM A;  2DK7 A;  2KHN A;  3MQH A;  2KBI A;  1RFJ A;  1PUL A;  1QLK A;  1Y1U A;  2AAO A;  2KBM A;  4CFQ A;  4ETO A;  1NUB A;  1UUR A;  1QWV A;  1UHJ A;  1XFW O;  2WCM A;  4TNC A;  4CFR A;  1YW5 A;  1MHO A;  3JVT B;  1T14 A;  4PDZ A;  4JKT A;  3KAD A;  1KFU S;  1WRL A;  2FCE A;  3NHT A;  4YGA A;  3B86 A;  4ZCU A;  3MQG A;  5DIC A;  1G4Y R;  1K9U A;  2QDI A;  4HRG A;  1KWO B;  3EVU A;  5KSZ A;  2XPA A;  3TZ1 A;  1KQM B;  3WNX B;  1SY9 A;  2PVB A;  1A75 B;  2BBN A;  4JD9 A;  1NWD A;  4N5X A;  1DEL A;  2LHI A;  3E3R A;  4PE4 A;  3SS4 A;  1XFZ O;  4XJK A;  1TUJ A;  4ORC B;  1QX2 A;  1IJ6 A;  1CM4 A;  1WLM A;  5CSI A;  1SL7 A;  4NDC A;  1CB1 A;  3OBV A;  1JBA A;  3S0G A;  1BG1 A;  2JMF A;  3FE9 A;  1W9Z A;  3SG7 A;  4YBH B;  3BXK A;  3WHT B;  1ORG A;  2LVK A;  1JFJ A;  4PHM A;  3SG5 A;  3TDU A;  3L4L A;  1M45 A;  4GLX A;  2M49 B;  2M3W A;  2M29 A;  3LK0 A;  3PN7 C;  2M1K B;  2YGU A;  3DVM A;  4PE7 A;  4YI8 A;  4F7F A;  1B47 A;  2KLE A;  4IL1 A;  2L4I A;  1SL8 A;  3MSE B;  3QRX A;  1RWY A;  2AMI A;  2KOT A;  2NLN A;  1DJW A;  3CR2 A;  1K96 A;  3CR4 X;  1XFX O;  3LKX B;  1TN4 A;  2M7N A;  1WLZ A;  3NSK A;  3I5H B;  3CZ2 A;  2KQY A;  2LHL A;  4MRY A;  3NSI A;  4P5O E;  5I2Q A;  1EH2 A;  1OZO A;  4F0Z B;  1F8A B;  2KQ6 A;  1P28 A;  3KAI A;  5E64 A;  1DJZ A;  1V1F A;  2DOQ A;  1QX5 B;  2F3Z A;  2NCO A;  3S0F A;  1K2H A;  3NHI A;  1AHR A;  1UHH A;  4YI9 A;  3I5G B;  2F8P A;  2HQ8 A;  1R2U A;  3B6X A;  2ZNE A;  3D76 A;  1TR8 A;  2ZAJ A;  1OOH A;  2BCB A;  1K9R A;  2KYF A;  4CID A;  3K21 A;  1NCZ A;  2GGM A;  2QEB A;  4OV2 A;  3CLN A;  3EKH A;  1GQM A;  2XP6 A;  3TCZ A;  3ZNI A;  4OVN F;  2MAZ A;  4PE1 A;  3D10 A;  2ZQT A;  1YX7 A;  3TS5 B;  3KAG A;  3CGA A;  4ORA B;  2L2E A;  1QIV A;  5FI2 A;  1BLQ A;  2LV7 A;  1WMV A;  1KQM C;  2KSP A;  2WCK A;  2BE4 A;  2WAD A;  1QVI Z;  1DTL A;  1A2X A;  1PSB A;  2LP3 A;  2KI4 B;  3CZ1 A;  1OMV A;  3DVK A;  3PSR A;  3I5I B;  3PJI A;  1C3Y A;  1KK7 Y;  1TNX A;  1K9K A;  2BA1 A;  2YAJ B;  3CS1 A;  2JV4 A;  2WOR A;  1SL9 A;  2MLE C;  4PHJ A;  2OS8 C;  4MRX A;  1QAT A;  1Z2C B;  3RLZ A;  1KK8 C;  3KEV A;  1K9P A;  3UNW A;  1F55 A;  3MCB B;  3GK1 A;  2JT0 A;  3RM1 A;  1DJX A;  3DD4 A;  2YSI A;  1JSA A;  3D73 A;  1C7W A;  2KAX A;  2O5G A;  2QRV A;  2LLU A;  4N1G A;  5U47 A;  1NX3 A;  5JJG A;  2K7O A;  2WCE A;  3I5H C;  1H4B A;  5CQ2 A;  1S6J A;  2WCJ A;  4U84 A;  1AJ5 A;  3R1O A;  4DRW A;  1S1E A;  1SYM A;  2LC5 A;  2HET A;  2KI6 C;  2LCP A;  2WC6 A;  4USL A;  1U5I A;  3AAK A;  2QEO A;  4YGD B;  2TN4 A;  2K2F A;  3FE8 A;  3Q8I A;  2Q4U A;  2Y8N B;  4U86 A;  1MXE A;  1CLB A;  1SMG A;  4MN0 A;  5CSJ A;  1SCM B;  2DWV A;  1NYA A;  1TTX A;  1WDC C;  1J7P A;  2ZRS A;  5AEQ A;  3CNG A;  1GGW A;  1DJH A;  3O6B A;  4GBA A;  1EXR A;  3GOF A;  5I94 A;  1KFU L;  2KXQ A;  4C0K A;  2I7A A;  3BQ3 A;  3JTD C;  4WQ3 A;  2G9B A;  2H61 C;  4MLW A;  3BUM B;  3BFH A;  5HKZ A;  1YRU B;  2LM5 A;  2ZQS A;  1XFU O;  1CDL A;  2XP8 A;  1DC1 A;  4HRH A;  1CDP A;  3OHM B;  4REX A;  2M0R A;  2LAP A;  3EK7 A;  4DS7 A;  3PN7 B;  2L5X B;  1ZCN A;  1EL4 A;  2JTZ A;  3K1E A;  1RP5 A;  2WC8 A;  2HPS A;  3FWB A;  1XK4 C;  1SBJ A;  1YRT B;  2BCA A;  2XP3 A;  3S0B A;  3SG2 A;  1M39 A;  2Y1N A;  2KAY A;  5HKY A;  2E30 A;  4M2P A;  3M7N A;  1C3Z A;  2GGZ A;  4JPZ B;  2PMY A;  2BE6 A;  1OOI X;  1QS7 A;  1JMQ A;  3UO9 A;  3MCB A;  1HT9 A;  1M31 A;  2NXQ A;  3KO0 A;  2K61 A;  2KGR A;  2P70 A;  2CBL A;  4FQT A;  2LMT A;  3NSO A;  1F4O A;  4AOM A;  4L9M A;  2PQL A;  5AER A;  5ER5 A;  4GGN A;  2L50 A;  1MF8 B;  2H2K A;  2MHH A;  1J7Q A;  1ALW A;  3KAH A;  2WND A;  1BR4 B;  3O78 A;  1REC A;  3DVE A;  5HL1 A;  2F21 A;  1MXL C;  1FW4 A;  1KCY A;  2JT3 A;  1J7O A;  2JC2 A;  1XYD A;  5E66 A;  3PLF B;  5G08 A;  3EVV A;  3EG5 B;  2ZR6 A;  2SAS A;  4OKH A;  4AQI A;  1K8U A;  4CLN A;  3M85 A;  2H8V A;  1PIN A;  1RTP 1;  1Y1A A;  1SCM C;  2XP5 A;  2QPT A;  1DVI A;  1IG5 A;  1CNP A;  1F71 A;  2KPH A;  3KAB A;  5HLV A;  1B7T Z;  5KU1 A;  4A4B A;  4BY4 A;  1DGU A;  4R1E A;  1AJ4 A;  1F70 A;  2Q5A A;  2BEC A;  1S5G Y;  1OSA A;  2JU0 A;  4I5J A;  3B88 A;  4YGE B;  2ERB A;  2OPO A;  1YUR A;  1OW4 A;  3O4Y A;  3WH0 A;  2OS8 B;  2M3O W;  1FPW A;  1KK8 B;  1K95 A;  3FIA A;  3IQO A;  4P2Y B;  3C1V A;  3CR5 X;  2Q91 A;  1JF2 A;  3N7H A;  2KYC A;  3CYZ A;  4PE0 A;  2AUC A;  2QEV A;  3R72 A;  1UP5 A;  2F2O A;  1A29 A;  2F2P A;  4AQJ A;  3TC5 A;  5AAN A;  1JWD A;  1Z4H A;  2K2A A;  2EGD A;  3BJH A;  2GV5 A;  3D0Y A;  1WRK A;  3WHU B;  1PRW A;  1KSM A;  4BY5 A;  3LL8 B;  3O4X A;  1CFD A;  2JUL A;  5CSN A;  5FI7 A;  3VGO A;  4CPV A;  3BOW A;  3B87 A;  2ZND A;  3NXA A;  1JFK A;  1XFY O;  4N1F A;  3FE6 A;  1LKJ A;  3VRR A;  3RZS A;  1A03 A;  1TCF A;  1SRA A;  2MRD A;  2O60 A;  1H8B A;  1LVC D;  2WAE A;  2JZI A;  2FJU B;  1O6W A;  4PHK A;  4C0L A;  1WDC B;  1K90 D;  1N65 A;  5HLO A;  3SIB A;  2PAL A;  3CAB A;  3CWG A;  1ZOT B;  2WCF A;  1BT6 A;  3I5F C;  3JTD B;  4GNK B;  2K7D A;  2GTE A;  4PT1 A;  2RE3 A;  1PVB A;  2YSF A;  2K60 A;  4D1E A;  2EZ5 W;  1SKT A;  4MBE A;  1VRK A;  1LIN A;  1BU3 A;  2COL B;  4NDB A;  3VRO A;  1OOG A;  3DF0 B;  1RK9 A;  1GM0 A;  3EVR A;  1TNP A;  3A8R A;  1YUU A;  1YVL A;  2JNF A;  4GGF C;  1MR8 A;  1TWO A;  3CTN A;  1K93 D;  1A75 A;  3AKA A;  3FWC A;  3ICB A;  4E68 A;  2E45 A;  1SW8 A;  2PSR A;  1OE9 B;  2JTT A;  3BUX B;  2KGB C;  5K89 A;  3L47 A;  2LE9 B;  1DGV A;  3KF9 A;  4U8D A;  1F4Q A;  3S0E A;  1PVA A;  1OMR A;  4IJ7 A;  3QME A;  2D8N A;  3EKJ A;  1LA0 A;  3L4A A;  5I2O A;  1TK7 A;  2I94 A;  1OOJ A;  2YSH A;  1SSE B;  3KAF A;  3PQH A;  1CDM A;  1YR5 A;  4U85 A;  4DUQ A;  2SCP A;  2MDI A;  4YGC B;  3DVJ A;  3CZ0 A;  1A4P A;  1QV0 A;  1XO5 A;  4MVF A;  3LKX A;  3R1V A;  2ZQV A;  1L2O C;  2Y4Q A;  5AFP A;  3SIA A;  2DMV A;  1QV1 A;  3CZT X;  2DJY A;  1QTX A;  2KDH A;  4QJ4 B;  1OZS A;  4MZL A;  1IH0 A;  1G8I A;  4QJ5 B;  2XP4 A;  2FCD A;  3SG6 A;  1J55 A;  2WCB A;  3EK4 A;  1UWO A;  4MZJ A;  2LNK A;  2Y1M A;  2YSB A;  1PAL A;  2M9G A;  2LVV A;  3SS5 A;  5KTY A;  4UPG A;  1WR7 A;  3VRN A;  1DF0 B;  2JX8 A;  1WRZ A;  2CT9 A;  1F8H A;  3FSC A;  1FI6 A;  1QVI Y;  3KHE A;  5E62 A;  1J1E A;  3DY9 A;  4HRE E;  1CLL A;  1W7I B;  1BR1 B;  3GK4 X;  4FTG A;  1J1D A;  1NCX A;  1SR6 C;  1UHN A;  2ISD A;  1V1G A;  1G33 A;  1WY9 A;  1DQE A;  1IGV A;  3LK1 A;  3FS7 A;  3SJS A;  1C07 A;  5E5W A;  1BOD A;  5CPV A;  4XJK B;  1LS8 A;  2H61 A;  1AP4 A;  4A0U A;  2JXC A;  2ZKM X;  3HX4 A;  1M46 A;  2K0J A;  1N0Y A;  2KLD A;  3DF0 A;  1L7Z A;  5B8I B;  1S3P A;  4HSZ A;  2VRG A;  2PRU A;  4E5R A;  3BUW B;  4OR9 B;  5J3X A;  3H4S E;  2K7C A;  3LE4 A;  1ODB A;  1YX8 A;  1NP8 A;  1MUX A;  1XK4 A;  5TNC A;  1DMO A;  1JC2 A;  2JWW A;  2ZFD A;  3F45 A;  2G2B A;  2L2C A;  2M8J A;  4M2Q A;  3OOB A;  2ZR4 A;  1QLS A;  1RRO A;  3B7A A;  1CDN A;  2ZQU A;  3NGV A;  5PAL A;  1NSH A;  2XP9 A;  3L4H A;  2ZN8 A;  2A4J A;  2L51 A;  3WXA A;  1IKU A;  5DKQ A;  2JXW A;  5AXI A;  4M2O A;  2KFH A;  1XVJ A;  1PSR A;  3I5F B;  2KFF A;  2MBX A;  1B4C A;  5EL2 A;  1RJV A;  3FS8 A;  1AVS A;  2I2R E;  2P6B B;  2MLF C;  3S0D A;  2LVJ A;  3ZWH A;  1CFF A;  2BL0 C;  1BOC A;  3PFV A;  1AK8 A;  4I5L B;  1DJG A;  1NX0 A;  5I2L A;  2M97 A;  1IIO A;  1Y1X A;  1IQ3 A;  3BUN B;  2LLS A;  1QAS A;  2MJW B;  2CNP A;  5BPJ A;  1ZAC A;  2L4J A;  1DJY A;  1CMF A;  3PM2 A;  1CKK A;  1DF0 A;  3OX5 A;  3TUY C;  1QXP A;  2EC6 B;  1UHK A;  3R1P A;  2WC5 A;  3SS3 A;  1KQV A;  3LLE A;  1M63 B;  1TUZ A;  1CLM A;  2F33 A;  2MA2 A;  5GQQ C;  4DIR A;  1F54 A;  3SG3 A;  2OWO A;  1IQ5 A;  1B1G A;  1IRJ A;  3BYA A;  5FYX A;  2NCP A;  5E65 A;  1KK7 Z;  4GAO A;  4MEW A;  3VRP A;  2WCH A;  5FI6 A;  1NCY A;  3D74 A;  5DKN A;  1L2O B;  4MZK A;  1B8C A;  1CM1 A;  1NX2 A;  1TIZ A;  2HQW A;  2PAS A;  1Q80 A;  2JOJ A;  3VB1 A;  4JWQ A;  1OQP A;  1SK6 D;  2BKI B;  1FI5 A;  4Q04 A;  3KPX A;  1NIW A;  1J7R A;  2QEH A;  3IF7 A;  3ODK A;  2LP2 A;  1TNW A;  1U5I B; 
#chains in the Genus database with same CATH homology
 4NDD A;  1IWQ A;  2LAJ A;  2LUC A;  1YVH A;  1NX1 A;  1BMO A;  1LA3 A;  1NPQ A;  4NQG A;  2M7L A;  1CFC A;  4I5K A;  1ZUZ A;  1B7T Y;  2ZR5 A;  1CFP A;  1R6P A;  3AAJ A;  2XP7 A;  1PK0 D;  2JRF A;  4WQ2 A;  4MSP A;  4DCK A;  2NZ0 A;  1SR6 B;  3TDZ A;  1UHI A;  1SPY A;  1QX7 A;  2LVI A;  2XPB A;  3M0W A;  3PAT A;  2YSG A;  3OB1 B;  1SCV A;  3JVT C;  2Y5I A;  3BUO B;  4QJ3 B;  4OCI A;  1Y6W A;  1TCO B;  1LXF C;  2EC6 C;  2HF5 A;  1B9A A;  1KWO C;  1S6C A;  3O2P A;  2LUX A;  3VRQ A;  1FBV A;  4GGF A;  1NMV A;  5JOL A;  5HKW A;  3A4U B;  2WOS A;  2V53 A;  1S36 A;  2I18 A;  4C0J A;  1EJ3 A;  1GGZ A;  1QJT A;  1S26 D;  2F3Y A;  1CTR A;  1UUS A;  2L98 A;  2OTG B;  4YRU A;  3OX6 A;  3SG4 A;  1ZMZ A;  1S6I A;  2JT8 A;  4YGB B;  1MQ1 A;  1EG3 A;  1CMG A;  1FF1 A;  1X02 A;  1AUI B;  3TDB A;  5F6T A;  3EK8 A;  4ZCV A;  1FLC A;  1HQV A;  1XFV O;  2ITK A;  4ICB A;  4GFT A;  1BJF A;  2K7B A;  4XYN A;  2BBM A;  2L4H A;  3NTP A;  2BL0 B;  1C7V A;  1K94 A;  1DT7 B;  5AHT A;  2CXJ A;  1B8R A;  5IBW A;  1N2D A;  1KFX L;  2LMU A;  3FSB A;  1D1O A;  3I5G C;  5D7F A;  2FOT A;  2E6W A;  3PAL A;  2JPT A;  3TUY B;  1TNQ A;  1DJI A;  4PHN A;  1JUO A;  2ZN9 A;  2EHB A;  3AKB A;  3PM8 A;  2M8I A;  1K9Q A;  1I5H W;  1OMD A;  3KCE A;  2KNE A;  2B1U A;  3TS5 C;  1QIW A;  1YUT A;  4GPL B;  2ZRT A;  1ALV A;  3OB2 B;  5D69 A;  1MWN A;  1S5G Z;  2BCX A;  2BKH B;  1JF0 A;  1TRF A;  2IS9 A;  2M8U A;  3GK2 A;  3TDI A;  2QAC A;  5AFP A;  2KI4 C;  2M1U A;  4I5N B;  4QIB A;  1EG4 A;  3I5I C;  4ORB B;  1Y0V H;  2KI6 D;  1SNL A;  1B8L A;  2LLT A;  2OTG C;  3OP0 A;  3D0Y B;  5CSF A;  2JQ6 A;  3IQQ A;  1XA5 A;  2R2I A;  1GJY A;  2LMV A;  1KSO A;  1W7J B;  3LCP C;  1ZFS A;  1E8A A;  2JNX A;  2KFG A;  3HCM A;  2K8M B;  1TOP A;  4GUK A;  4WRI A;  3BOW B;  5ER4 X;  4A4C A;  5HYD A;  1IJ5 A;  5I8N A;  2DK1 A;  2JXL A;  3NSL A;  4PAL A;  4FQO A;  1KFX S;  2L0P A;  4PCW A;  4A0T A;  1BF5 A;  2LAN A;  4JQ0 D;  2KAV A;  2RGI A;  1YTZ C;  2CTN A;  1YUS A;  2CCM A;  2DK7 A;  2KHN A;  3MQH A;  2KBI A;  1RFJ A;  1PUL A;  1QLK A;  1Y1U A;  2AAO A;  2KBM A;  4CFQ A;  4ETO A;  1NUB A;  1UUR A;  1UHJ A;  1XFW O;  4TNC A;  4CFR A;  1YW5 A;  1MHO A;  3JVT B;  4PDZ A;  3KAD A;  1KFU S;  1WRL A;  2FCE A;  4YGA A;  4ZCU A;  3MQG A;  1G4Y R;  1K9U A;  4HRG A;  1KWO B;  3EVU A;  5KSZ A;  2XPA A;  3TZ1 A;  1KQM B;  3WNX B;  1SY9 A;  2PVB A;  1A75 B;  2BBN A;  1NWD A;  4N5X A;  2LHI A;  3E3R A;  4PE4 A;  1XFZ O;  4XJK A;  4ORC B;  1QX2 A;  1IJ6 A;  1CM4 A;  1WLM A;  5CSI A;  1SL7 A;  4NDC A;  1CB1 A;  1JBA A;  2JMF A;  1BG1 A;  3SG7 A;  4YBH B;  3BXK A;  3WHT B;  2LVK A;  1JFJ A;  4PHM A;  3SG5 A;  3TDU A;  4GLX A;  1M45 A;  2M49 B;  2M3W A;  2M29 A;  3LK0 A;  3PN7 C;  2M1K B;  3DVM A;  4PE7 A;  4YI8 A;  1B47 A;  4IL1 A;  2L4I A;  1SL8 A;  3MSE B;  3QRX A;  1RWY A;  2AMI A;  2KOT A;  2NLN A;  1DJW A;  3CR2 A;  1K96 A;  3CR4 X;  1XFX O;  3LKX B;  1TN4 A;  2M7N A;  1WLZ A;  3NSK A;  3I5H B;  4P5O E;  2KQY A;  2LHL A;  4MRY A;  3NSI A;  5I2Q A;  1EH2 A;  1F8A B;  1OZO A;  4F0Z B;  2KQ6 A;  3KAI A;  5E64 A;  1DJZ A;  1V1F A;  2DOQ A;  1QX5 B;  2F3Z A;  2NCO A;  1K2H A;  1AHR A;  1UHH A;  4YI9 A;  3I5G B;  2F8P A;  2HQ8 A;  1R2U A;  2ZNE A;  2ZAJ A;  1TR8 A;  2BCB A;  2KYF A;  4CID A;  3K21 A;  1NCZ A;  2GGM A;  4OV2 A;  3CLN A;  3EKH A;  1GQM A;  2XP6 A;  3TCZ A;  3ZNI A;  4OVN F;  2MAZ A;  4PE1 A;  3D10 A;  2ZQT A;  1YX7 A;  3TS5 B;  3KAG A;  3CGA A;  4ORA B;  2L2E A;  1QIV A;  1BLQ A;  2LV7 A;  1WMV A;  1KQM C;  2KSP A;  2BE4 A;  2WAD A;  1QVI Z;  1DTL A;  1A2X A;  1PSB A;  2LP3 A;  2KI4 B;  3DVK A;  1OMV A;  3PSR A;  5DKR A;  3I5I B;  1KK7 Y;  1TNX A;  1K9K A;  2BA1 A;  2YAJ B;  3CS1 A;  2JV4 A;  2WOR A;  1SL9 A;  2MLE C;  4PHJ A;  2OS8 C;  4MRX A;  1QAT A;  3RLZ A;  1F55 A;  1KK8 C;  3KEV A;  1K9P A;  3MCB B;  3GK1 A;  2JT0 A;  3RM1 A;  1DJX A;  3DD4 A;  2YSI A;  1JSA A;  1C7W A;  2KAX A;  2O5G A;  2QRV A;  2LLU A;  4N1G A;  5U47 A;  1NX3 A;  5JJG A;  2K7O A;  2WCE A;  3I5H C;  1H4B A;  5CQ2 A;  1S6J A;  4U84 A;  1AJ5 A;  4DRW A;  1S1E A;  1SYM A;  2LC5 A;  2HET A;  2KI6 C;  2LCP A;  4USL A;  1U5I A;  3AAK A;  4YGD B;  2TN4 A;  2K2F A;  2Q4U A;  2Y8N B;  4U86 A;  1MXE A;  1CLB A;  1SMG A;  4MN0 A;  5CSJ A;  1SCM B;  2DWV A;  1NYA A;  1TTX A;  1WDC C;  1J7P A;  2ZRS A;  5AEQ A;  3CNG A;  1GGW A;  1DJH A;  3O6B A;  4GBA A;  1EXR A;  3GOF A;  2KXQ A;  1KFU L;  4C0K A;  2I7A A;  3BQ3 A;  3JTD C;  4WQ3 A;  2G9B A;  2H61 C;  4MLW A;  3BUM B;  5HKZ A;  1YRU B;  2LM5 A;  2ZQS A;  1XFU O;  1CDL A;  2XP8 A;  4HRH A;  1CDP A;  3OHM B;  4REX A;  2M0R A;  2LAP A;  3EK7 A;  4DS7 A;  3PN7 B;  2L5X B;  1ZCN A;  1EL4 A;  2JTZ A;  1RP5 A;  2WC8 A;  2HPS A;  3FWB A;  1XK4 C;  1SBJ A;  1YRT B;  2BCA A;  2XP3 A;  3SG2 A;  1M39 A;  2Y1N A;  2KAY A;  5HKY A;  2E30 A;  4M2P A;  3M7N A;  2GGZ A;  4JPZ B;  2PMY A;  2BE6 A;  1QS7 A;  1JMQ A;  3MCB A;  1HT9 A;  1M31 A;  2NXQ A;  3KO0 A;  2K61 A;  2KGR A;  2CBL A;  2LMT A;  3NSO A;  1F4O A;  4AOM A;  4L9M A;  5AER A;  5ER5 A;  4GGN A;  2L50 A;  1MF8 B;  2H2K A;  2MHH A;  1J7Q A;  1ALW A;  3KAH A;  2WND A;  1BR4 B;  3O78 A;  1REC A;  3DVE A;  2F21 A;  1MXL C;  1FW4 A;  1KCY A;  2JT3 A;  1J7O A;  2JC2 A;  1XYD A;  5E66 A;  3PLF B;  5G08 A;  3EVV A;  2ZR6 A;  2SAS A;  4OKH A;  4AQI A;  1K8U A;  4CLN A;  3M85 A;  1PIN A;  1RTP 1;  1Y1A A;  1SCM C;  2XP5 A;  2QPT A;  1DVI A;  1IG5 A;  1CNP A;  1F71 A;  3KAB A;  5HLV A;  1B7T Z;  5KU1 A;  4A4B A;  4BY4 A;  1DGU A;  4R1E A;  1AJ4 A;  1F70 A;  2Q5A A;  2BEC A;  1S5G Y;  1OSA A;  2JU0 A;  4I5J A;  4YGE B;  2OPO A;  1YUR A;  3O4Y A;  3WH0 A;  2OS8 B;  2M3O W;  1FPW A;  1KK8 B;  1K95 A;  3FIA A;  3IQO A;  4P2Y B;  3C1V A;  3CR5 X;  2Q91 A;  1JF2 A;  2KYC A;  4PE0 A;  2AUC A;  1UP5 A;  2F2O A;  1A29 A;  2F2P A;  4AQJ A;  3TC5 A;  5AAN A;  1JWD A;  2K2A A;  2EGD A;  2GV5 A;  3D0Y A;  1WRK A;  3WHU B;  1PRW A;  1KSM A;  4BY5 A;  3LL8 B;  1CFD A;  2JUL A;  5CSN A;  3VGO A;  4CPV A;  3BOW A;  2ZND A;  3NXA A;  1JFK A;  1XFY O;  4N1F A;  1LKJ A;  3VRR A;  1A03 A;  1TCF A;  1SRA A;  2MRD A;  2O60 A;  1H8B A;  1LVC D;  2WAE A;  2JZI A;  2FJU B;  1O6W A;  4PHK A;  4C0L A;  1WDC B;  1K90 D;  1N65 A;  5HLO A;  3SIB A;  2PAL A;  3CWG A;  1ZOT B;  2WCF A;  1BT6 A;  3I5F C;  3JTD B;  4GNK B;  2K7D A;  2RE3 A;  1PVB A;  2YSF A;  4D1E A;  2EZ5 W;  1SKT A;  4MBE A;  1VRK A;  1LIN A;  1BU3 A;  2COL B;  4NDB A;  3VRO A;  3DF0 B;  1RK9 A;  3EVR A;  1TNP A;  3A8R A;  1YUU A;  1YVL A;  2JNF A;  4GGF C;  1MR8 A;  3CTN A;  1K93 D;  1A75 A;  3AKA A;  3FWC A;  3ICB A;  4E68 A;  2E45 A;  1SW8 A;  2PSR A;  1OE9 B;  2JTT A;  3BUX B;  2KGB C;  5K89 A;  2LE9 B;  1DGV A;  3KF9 A;  4U8D A;  1F4Q A;  1PVA A;  1OMR A;  2D8N A;  3EKJ A;  1LA0 A;  1TK7 A;  5I2O A;  3PQH A;  2I94 A;  1OOJ A;  2YSH A;  3KAF A;  4U85 A;  1CDM A;  1YR5 A;  4DUQ A;  2SCP A;  2MDI A;  4YGC B;  3DVJ A;  1A4P A;  1QV0 A;  1XO5 A;  4MVF A;  3LKX A;  2ZQV A;  1L2O C;  2Y4Q A;  2DMV A;  3SIA A;  1K9R A;  1QV1 A;  3CZT X;  2DJY A;  1QTX A;  2KDH A;  4QJ4 B;  1OZS A;  4MZL A;  1IH0 A;  1G8I A;  4QJ5 B;  2XP4 A;  2FCD A;  3SG6 A;  1J55 A;  2WCB A;  3EK4 A;  1UWO A;  4MZJ A;  2LNK A;  2Y1M A;  2YSB A;  1PAL A;  2M9G A;  2LVV A;  5KTY A;  1WR7 A;  4UPG A;  3VRN A;  1DF0 B;  2JX8 A;  1WRZ A;  2CT9 A;  1F8H A;  3FSC A;  1FI6 A;  1QVI Y;  3KHE A;  5E62 A;  1J1E A;  4HRE E;  1CLL A;  1W7I B;  1BR1 B;  3GK4 X;  4FTG A;  1J1D A;  1NCX A;  1SR6 C;  1UHN A;  2ISD A;  1V1G A;  1G33 A;  1WY9 A;  1IGV A;  3LK1 A;  3SJS A;  3FS7 A;  1C07 A;  5E5W A;  1BOD A;  5CPV A;  4XJK B;  2H61 A;  1AP4 A;  4A0U A;  2JXC A;  2ZKM X;  3HX4 A;  1M46 A;  2K0J A;  1N0Y A;  3DF0 A;  5B8I B;  1L7Z A;  1S3P A;  4HSZ A;  2VRG A;  2PRU A;  4E5R A;  3BUW B;  4OR9 B;  5J3X A;  3H4S E;  2K7C A;  3LE4 A;  1ODB A;  1YX8 A;  1NP8 A;  1MUX A;  1XK4 A;  5TNC A;  1DMO A;  1JC2 A;  2JWW A;  2ZFD A;  3F45 A;  2G2B A;  2M8J A;  4M2Q A;  3OOB A;  2ZR4 A;  1QLS A;  1RRO A;  1CDN A;  2ZQU A;  5PAL A;  1NSH A;  2XP9 A;  3L4H A;  2ZN8 A;  2A4J A;  2L51 A;  3WXA A;  1IKU A;  5DKQ A;  2JXW A;  5AXI A;  4M2O A;  2KFH A;  1XVJ A;  1PSR A;  3I5F B;  2KFF A;  2MBX A;  1B4C A;  1RJV A;  3FS8 A;  1AVS A;  2I2R E;  2P6B B;  2MLF C;  2LVJ A;  3ZWH A;  1CFF A;  2BL0 C;  1BOC A;  3PFV A;  1AK8 A;  4I5L B;  1DJG A;  1NX0 A;  5I2L A;  2M97 A;  1Y1X A;  1IQ3 A;  3BUN B;  2LLS A;  1QAS A;  2MJW B;  2CNP A;  5BPJ A;  1ZAC A;  2L4J A;  1DJY A;  1CMF A;  1CKK A;  1DF0 A;  3OX5 A;  3TUY C;  1QXP A;  2EC6 B;  1UHK A;  1KQV A;  3LLE A;  1M63 B;  2F33 A;  1CLM A;  2MA2 A;  5GQQ C;  4DIR A;  1F54 A;  3SG3 A;  2OWO A;  1IQ5 A;  1B1G A;  1IRJ A;  3BYA A;  5FYX A;  2NCP A;  5E65 A;  1KK7 Z;  4GAO A;  4MEW A;  3VRP A;  1NCY A;  5DKN A;  1L2O B;  4MZK A;  1B8C A;  1CM1 A;  1NX2 A;  1TIZ A;  2HQW A;  2PAS A;  1Q80 A;  2JOJ A;  4JWQ A;  1OQP A;  1SK6 D;  2BKI B;  1FI5 A;  4Q04 A;  3KPX A;  1NIW A;  1J7R A;  3IF7 A;  3ODK A;  2LP2 A;  1TNW A;  1U5I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...