1EG4A

Structure of a dystrophin ww domain fragment in complex with a beta-dystroglycan peptide
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
260
structure length
260
Chain Sequence
b'PASQHFLSTSVQGPWERAISPNKVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-DYSTROGLYCAN
publication title Structure of a WW domain containing fragment of dystrophin in complex with beta-dystroglycan.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 93
structure length 260
sequence length 260
ec nomenclature
pdb deposition date 2000-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF09068 EF-hand_2 EF hand
A PF09069 EF-hand_3 EF-hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1eg4A03
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1eg4A04
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1eg4A01
3PATA 1MF8B 1N65A 1UP5A 2AAOA 4ORCB 1AK8A 1PSBA 1AHRA 4Q04A 5D69A 3CR5X 1WRKA 5JJGA 2DK1A 2SCPA 1K9QA 1QS7A 2BL0B 1CNPA 3NSOA 2FOTA 1AJ4A 2AUCA 1K9RA 3CR4X 3CWGA 4U8DA 3K21A 2ZR4A 2LVIA 1YUSA 2JTZA 2VRGA 1QX7A 3BUOB 2G9BA 5GQQC 5BPJA 1LINA 3KABA 5AHTA 1B7TY 2M97A 3O2PA 2LP2A 4ORBB 4WRIA 3I5GC 1L2OC 1OE9B 1B9AA 1R6PA 1CDLA 3SJSA 4CIDA 4OVNF 2DJYA 3RM1A 3TZ1A 1K9KA 2F3YA 2JQ6A 3I5HB 3FIAA 1PK0D 1UUSA 5DKNA 1ZOTB 3F45A 5AXIA 3KHEA 2RGIA 1XK4C 4BY4A 1J7OA 1KWOB 3KAHA 1MXLC 2KFFA 2Y4QA 3DVJA 2Y1MA 5JOLA 2MLEC 4MEWA 1SRAA 2H61A 2ZN9A 2M7LA 1WLMA 3TC5A 1RJVA 1SMGA 2ZNDA 2M49B 1YX8A 1A4PA 1MHOA 2KYCA 4C0JA 2YSHA 1CTRA 1J7QA 2KGRA 1XFUO 4MZLA 2ITKA 1KFUL 2WNDA 4C0LA 1F54A 4AQIA 1K93D 4DUQA 2KAVA 2JT8A 2M3WA 3CZTX 2Y1NA 4FTGA 4MLWA 1PINA 2JMFA 1QASA 4GAOA 1DF0B 5AEQA 4DS7A 3A4UB 1CLBA 3VRQA 3ZNIA 3SG7A 3JVTB 2KQYA 2MA2A 1PVBA 1CLLA 2WORA 1M39A 2BKIB 1LVCD 1O6WA 3L4HA 2PVBA 1UHKA 1B8RA 1KK7Z 3TUYB 3KADA 4YI9A 2XP7A 2BBNA 2JNFA 1WR7A 2K7CA 4A4BA 2FCDA 1G4YR 1BLQA 2XP4A 2L50A 1YURA 1XFYO 2F21A 2CBLA 1SKTA 1W7IB 1R2UA 1XFWO 1KSOA 3SIAA 3OOBA 3JTDB 1BODA 4XYNA 1S5GZ 2NLNA 1KK8C 4YRUA 1QATA 3AKBA 3M7NA 1TNQA 4TNCA 2KAXA 1NCZA 2EC6B 1F70A 1SL7A 1XFVO 4CPVA 1F55A 3BUMB 1JWDA 3O6BA 1E8AA 3KF9A 2XPBA 1S26D 2XP3A 1QJTA 2ISDA 1NCYA 3D0YB 2YSFA 1KFXL 2M0RA 4P2YB 2K7BA 2ZQVA 1K9PA 5AANA 3KEVA 2PRUA 2O60A 1D1OA 1NWDA 1QV1A 5B8IB 1NCXA 2WCFA 2ZAJA 4HRHA 2PSRA 1K2HA 2YSBA 1IG5A 1JF2A 1RROA 4GBAA 4NDDA 2BCBA 3CNGA 4NQGA 2ZR5A 2H61C 1QX5B 1AVSA 2EHBA 1SR6C 4BY5A 2M1UA 5I8NA 1QXPA 1KSMA 4F0ZB 3VRPA 1IGVA 4HRGA 2FJUB 1N0YA 2M8IA 4M2QA 1S5GY 2WC8A 1Q80A 2LAJA 2BL0C 1DT7B 1H8BA 4C0KA 4DCKA 1YX7A 5FYXA 4M2OA 4JQ0D 5CQ2A 1A03A 2LVKA 2JZIA 1OSAA 1NSHA 3SG2A 1UHIA 1MR8A 2K7OA 1BOCA 1IWQA 2F3ZA 1SK6D 2HQ8A 4YGEB 3AAJA 2WCBA 1PRWA 1IH0A 2K0JA 2KBMA 1ALVA 3IQQA 3EVRA 2CT9A 4PE4A 3VRRA 1GGZA 1B4CA 1SPYA 2LLTA 3OB2B 4QJ4B 1IJ5A 1NX3A 3I5HC 4MVFA 4DIRA 3BOWB 2XP5A 2LLUA 3IQOA 1SCMB 3EK7A 2M8UA 1A29A 1SR6B 1RWYA 1KWOC 2LANA 2LC5A 4D1EA 3WHUB 1MXEA 1RECA 1U5IB 1I5HW 1TK7A 1GQMA 4YBHB 1DMOA 1EL4A 5HLVA 1XVJA 1B1GA 2B1UA 2DK7A 2L4HA 2JOJA 3FWBA 4OV2A 4P5OE 1A75B 2R2IA 4ORAB 3NTPA 1N2DA 4U86A 4YGDB 2TN4A 1CKKA 1GJYA 2MJWB 2M29A 1CDNA 3AAKA 1TRFA 2KFHA 1K94A 3FS7A 1WLZA 1FI5A 2JRFA 1KQVA 1JFJA 1Y1XA 2Q91A 1S36A 2KHNA 2DMVA 3JVTC 3TDBA 2XP6A 2NCOA 3EVVA 1V1GA 3E3RA 3ZWHA 4YI8A 1BMOA 1B8LA 3SG4A 3TUYC 3BOWA 2OTGB 2GGZA 4PE1A 2CTNA 1CB1A 2JX8A 1DJGA 1KFUS 1XA5A 1F8AB 3I5IC 2KI6D 1WRZA 4YGBB 5KTYA 3OX6A 3PFVA 1SBJA 1SW8A 3D10A 4ICBA 1U5IA 2ZNEA 4AQJA 3NSLA 1V1FA 5J3XA 3JTDC 1NYAA 4E68A 2K8MB 2LHLA 2OS8C 5G08A 1CLMA 2I18A 1OQPA 1JBAA 1AUIB 1TNWA 1JFKA 2Q5AA 2JXWA 2EC6C 1A75A 2LUXA 1TNXA 2L51A 4MZKA 1CDPA 3LCPC 5IBWA 2EGDA 1TOPA 2CXJA 4PCWA 2ZQSA 1WY9A 3DVEA 2L5XB 1CFCA 1XYDA 1OOJA 1EG3A 1JMQA 2COLB 4MZJA 2F33A 2F2PA 2LLSA 3GK4X 2LMVA 1YW5A 3NSIA 1NX0A 1Y0VH 4A4CA 4XJKB 1QV0A 1S6CA 5CSIA 1TNPA 3CLNA 3I5IB 1LA3A 2MLFC 3DD4A 2BCAA 1CM4A 1K9UA 4GPLB 4I5JA 4MRXA 1BU3A 3PM8A 2QACA 1CFDA 4I5NB 3KAFA 2YSGA 2IS9A 1PSRA 2OS8B 1FW4A 1C07A 1BJFA 1KFXS 3LE4A 1UURA 3SIBA 4PHMA 1FPWA 3WNXB 1YVHA 1CMFA 3GK1A 1JSAA 3DVKA 3M0WA 1K90D 1MUXA 4MRYA 1AP4A 2ZQUA 2LMTA 1DGUA 1F4QA 2JPTA 3EKJA 4MBEA 1OMDA 1HQVA 1M31A 2KSPA 1F8HA 2BECA 3NSKA 1JF0A 2JNXA 3HCMA 1NMVA 2A4JA 1FF1A 2E45A 3LLEA 1YR5A 1CDMA 2PASA 2KXQA 2KFGA 2M8JA 2D8NA 1SCMC 3IF7A 1MQ1A 2M1KB 4GGFA 2JTTA 4AOMA 2BE6A 3BUWB 4QJ3B 4U84A 2F8PA 4PHNA 4XJKA 2GGMA 4WQ3A 5CSFA 1DJHA 1RTP1 1TCOB 3BQ3A 1IKUA 1S6JA 2K61A 4MSPA 5F6TA 2KI6C 2JU0A 1LXFC 3GK2A 1NX1A 2OPOA 1ALWA 1H4BA 1NP8A 1FBVA 2DOQA 2MRDA 4L9MA 1SL8A 1TIZA 3LK0A 2L98A 1EG4A 2LVJA 3MSEB 2ZR6A 3KAGA 3CTNA 2EZ5W 2CCMA 1UHHA 3PN7B 2XPAA 2JT3A 3LK1A 4I5KA 1IQ5A 1HT9A 4WQ2A 1WDCB 2ZKMX 1MWNA 2M3OW 1YUTA 3TS5B 1BR4B 2FCEA 5HYDA 4GFTA 1AJ5A 1DJXA 3AKAA 1UWOA 1J55A 1PULA 1QVIZ 1J1EA 2BA1A 1WRLA 4I5LB 4PHKA 1VRKA 3ODKA 1QLSA 3CR2A 1SCVA 3EK4A 4PALA 2KYFA 3WXAA 5ER4X 1M45A 4YGCB 1DJYA 2OTGC 3TDZA 1G33A 1QIVA 1BG1A 1EH2A 4ETOA 1YUUA 2BKHB 2MHHA 2NZ0A 3KPXA 5K89A 1RK9A 2M7NA 4NDCA 3O4YA 1NX2A 1B8CA 2AMIA 1TTXA 2G2BA 3HX4A 3I5FB 4GUKA 1OZOA 3DF0B 1S6IA 1BR1B 2JULA 3SG3A 1SL9A 1RFJA 4GNKB 2LHIA 2NCPA 4CLNA 1LA0A 2L4IA 2KBIA 1IJ6A 1NIWA 1OMVA 4CFQA 1QVIY 1G8IA 1J1DA 1TCFA 2KAYA 1OMRA 1EJ3A 2LUCA 1JUOA 4GGFC 1SYMA 2KNEA 4OKHA 1JC2A 1W7JB 2L2EA 4YGAA 1ZUZA 5I2LA 2HQWA 2LNKA 3DVMA 2YSIA 2NXQA 2KDHA 1QLKA 1M63B 4UPGA 5I2QA 2KOTA 1GGWA 3TDIA 2ZN8A 3PALA 4GGNA 2JV4A 5TNCA 2O5GA 1S3PA 4PE0A 1J7RA 3TDUA 2KGBC 2JWWA 1DJIA 1XFZO 1KQMC 1SY9A 1YVLA 3H4SE 1C7WA 1UHJA 3DF0A 3BYAA 3OB1B 4CFRA 2F2OA 2QPTA 4PHJA 4M2PA 3FWCA 4R1EA 2MDIA 3WH0A 4QJ5B 1QIWA 1QX2A 1UHNA 4ZCVA 2I7AA 5KSZA 1Y1UA 1DVIA 1K96A 1EXRA 1YRUB 1BF5A 1M46A 1QTXA 4MN0A 4OCIA 1ZFSA 2GV5A 2ZQTA 2Q4UA 1DJZA 1K95A 2WOSA 3SG6A 1SNLA 1CMGA 2LVVA 3I5GB 1L2OB 2JC2A 1BT6A 3VRNA 5DKQA 1Y6WA 4N5XA 4U85A 1B47A 1TN4A 3PLFB 2RE3A 2XP8A 4N1GA 5KU1A 2HETA 1F4OA 2WCEA 3QRXA 4OR9B 1KQMB 1C7VA 2PMYA 2E30A 3OP0A 2K7DA 4FQOA 1LKJA 2LCPA 2HPSA 3PN7C 3CS1A 3NXAA 5AERA 2I94A 1WDCC 2MBXA 3A8RA 2KQ6A 3TS5C 1K8UA 5HKWA 3EKHA 1ZMZA 5DKRA 2ZRSA 2BE4A 1IQ3A 3KAIA 4IL1A 2JT0A 5ER5A 2DWVA 3VGOA 4JWQA 2L4JA 3PSRA 3SG5A 3BUNB 3BXKA 1S1EA 1DTLA 3GOFA 1OZSA 5PALA 1IRJA 1YRTB 2BCXA 1KCYA 2I2RE 3M85A 3ICBA 1F71A 2MAZA 2P6BB 1Y1AA 4N1FA 1ZACA 3OHMB 2KI4C 3OX5A 1CFPA 1A2XA 1DGVA 2ZRTA 1DF0A 3VROA 3EK8A 5HLOA 3I5FC 1KK7Y 1PALA 1PVAA 2XP9A 3O78A 1CFFA 1CM1A 1XK4A 2V53A 3CGAA 5CPVA 5CSJA 1FI6A 1NUBA 2JXCA 1XO5A 2CNPA 2PALA 4HREE 3TCZA 2HF5A 5AFPA 2LE9B 5HKZA 2K2AA 2ZFDA 2LV7A 1YTZC 1NPQA 1XFXO 1KK8B 1ODBA 2LAPA 4JPZB 4E5RA 4QIBA 4PDZA 4NDBA 2H2KA 3BUXB 4DRWA 2K2FA 3C1VA 5CSNA 3WHTB 1ZCNA 2BBMA 1L7ZA 4REXA 1WMVA 1B7TZ 4ZCUA 2M9GA 2E6WA 3RLZA 4USLA 2LMUA 2KI4B 5I2OA 2LP3A 4HSZA 5HKYA 1J7PA 3KCEA 2SASA 3KO0A 2L0PA 4PE7A 5D7FA 1X02A 3EVUA 3D0YA 2JXLA 1DJWA 3LL8B 2Y5IA 2LM5A
chains in the Genus database with same CATH superfamily
3CZ0A 3PATA 1MF8B 1N65A 1UP5A 2AAOA 4ORCB 1AK8A 1PSBA 1AHRA 3NHIA 4Q04A 5D69A 3CR5X 1WRKA 5JJGA 2DK1A 2SCPA 1K9QA 1QS7A 2BL0B 1CNPA 3NSOA 2FOTA 1AJ4A 2AUCA 3SS3A 1DQEA 1K9RA 3CR4X 3CWGA 4U8DA 3K21A 2ZR4A 2LVIA 1DEKA 1YUSA 2JTZA 2VRGA 1QX7A 3BUOB 2G9BA 5GQQC 5BPJA 1LINA 3B87A 3KABA 5AHTA 1B7TY 2M97A 3DY9A 4A0UA 3O2PA 2LP2A 4ORBB 4WRIA 3LKXB 3I5GC 1L2OC 1OE9B 1B9AA 1R6PA 1CDLA 3SJSA 4CIDA 4OVNF 2DJYA 2QDIA 3R1VA 3RM1A 3TZ1A 1W9ZA 5HL1A 1K9KA 5I94A 2F3YA 2JQ6A 3I5HB 3FIAA 1PK0D 1UUSA 5DKNA 3MCBA 1ZOTB 3F45A 5AXIA 3KHEA 2RGIA 3BJHA 1XK4C 4BY4A 1J7OA 1KWOB 3KAHA 1MXLC 2KFFA 2WCLA 2Y4QA 3DVJA 2Y1MA 5JOLA 2MLEC 3CDNA 4MEWA 1SRAA 2H61A 2ZN9A 3NGVA 2M7LA 1WLMA 2QRVA 3TC5A 1RJVA 1SMGA 2ZNDA 3S0GA 2M49B 1YX8A 1A4PA 1MHOA 2KYCA 4C0JA 2YSHA 1CTRA 2KPHA 1J7QA 2KGRA 1XFUO 4MZLA 2ITKA 1KFUL 2WNDA 3FE6A 4C0LA 1F54A 4AQIA 1K93D 1DELA 4DUQA 2KAVA 2JT8A 2M3WA 4FQTA 3CZTX 2Y1NA 4FTGA 4MLWA 1PINA 2JMFA 1QASA 3S0EA 4GAOA 1DF0B 5AEQA 4DS7A 3A4UB 1CLBA 3VRQA 3LKXA 3ZNIA 3SG7A 3JVTB 2KQYA 2MA2A 1PVBA 1CLLA 2WORA 1M39A 2BKIB 1OOGA 1LVCD 3BFAA 1O6WA 2PVBA 3L4HA 1UHKA 1B8RA 1KK7Z 3TUYB 2P70A 3KADA 4YI9A 2XP7A 2BBNA 4JKTA 2JNFA 2WCJA 1WR7A 2K7CA 4A4BA 2FCDA 1G4YR 1BLQA 2XP4A 2L50A 1YURA 1XFYO 2F21A 1W7IB 1SKTA 2CBLA 1R2UA 1XFWO 1KSOA 3SIAA 3OOBA 3JTDB 1BODA 3FS8A 4XYNA 2P71A 1S5GZ 2NLNA 1KK8C 4YRUA 1QATA 3AKBA 3M7NA 1TNQA 4TNCA 2KAXA 1NCZA 2EC6B 1F70A 1SL7A 1XFVO 4CPVA 1F55A 3BUMB 1JWDA 3O6BA 5E5WA 1E8AA 3KF9A 1FLCA 2XPBA 3MQGA 2ERBA 1S26D 2XP3A 1QJTA 2ISDA 1NCYA 3D0YB 2YSFA 1KFXL 2M0RA 4P2YB 2K7BA 2ZQVA 1K9PA 5AANA 3KEVA 2PRUA 2O60A 1D1OA 1NWDA 1QV1A 5B8IB 5FI2A 1NCXA 2WCFA 5E66A 2ZAJA 4HRHA 2PSRA 4INWA 3BFBA 1QWVA 1IG5A 2QEBA 1JF2A 1RROA 4GBAA 4NDDA 1K2HA 2BCBA 3B7AA 3CNGA 4NQGA 2ZR5A 2H61C 1QX5B 1AVSA 1Z2CB 1SR6C 2EHBA 2M1UA 4BY5A 5I8NA 1ORGA 1QXPA 1KSMA 4F0ZB 3VRPA 1IGVA 4HRGA 2FJUB 1SSEB 1N0YA 2M8IA 4M2QA 1S5GY 2WC8A 2L5YA 1Q80A 2LAJA 2BL0C 1DT7B 1H8BA 4C0KA 4DCKA 1YX7A 5FYXA 4M2OA 4JQ0D 5CQ2A 1A03A 2LVKA 2JZIA 1OSAA 1NSHA 3SG2A 1UHIA 1MR8A 2K7OA 1BOCA 1IWQA 2F3ZA 1SK6D 2HQ8A 4YGEB 3R1OA 3AAJA 2WCBA 1PRWA 1IH0A 2K0JA 3MCBB 2OWOA 2KBMA 1ALVA 3IQQA 3EVRA 2CT9A 4PE4A 3VRRA 1GGZA 2PYQA 1B4CA 1SPYA 2LLTA 5E65A 1GM0A 3OB2B 4QJ4B 2K60A 3Q8IA 1IJ5A 1NX3A 3I5HC 4MVFA 4DIRA 3BOWB 2XP5A 2LLUA 3IQOA 1SCMB 3EK7A 2M8UA 1A29A 1SR6B 1RWYA 1KWOC 2LANA 2LC5A 2QEHA 4D1EA 3WHUB 1MXEA 1RECA 1U5IB 1I5HW 1TK7A 1GQMA 4YBHB 1DMOA 1EL4A 5HLVA 1XVJA 1B1GA 2B1UA 2DK7A 2L4HA 2JOJA 3FWBA 3N7HA 4OV2A 4P5OE 1A75B 2R2IA 4ORAB 3NTPA 1N2DA 4U86A 1TR8A 4YGDB 2TN4A 1CKKA 1GJYA 3FE9A 2MJWB 2M29A 1CDNA 3AAKA 1TRFA 2KFHA 1K94A 3FS7A 1WLZA 1DC1A 2JRFA 1FI5A 5FI7A 1JFJA 1KQVA 1Y1XA 2Q91A 1S36A 2KHNA 2DMVA 3JVTC 3TDBA 1TWOA 2XP6A 2NCOA 3EVVA 1V1GA 3E3RA 3ZWHA 4YI8A 1BMOA 1B8LA 3SG4A 3TUYC 3BOWA 2OTGB 2GGZA 4PE1A 2CTNA 1CB1A 2JX8A 1DJGA 1KFUS 1XA5A 1F8AB 3I5IC 3L47A 1RP5A 3SS5A 2KI6D 1WRZA 4YGBB 5KTYA 3OX6A 1TUJA 3PFVA 1SBJA 1SW8A 3D10A 4ICBA 1U5IA 2ZNEA 5D3OA 3NSLA 1V1FA 4AQJA 5J3XA 3JTDC 1NYAA 4E68A 2K8MB 2LHLA 2OS8C 3B88A 5EL2A 1CLMA 5G08A 2I18A 1OQPA 2KLDA 1AUIB 1TNWA 2QEOA 1JBAA 1JFKA 3DXLA 2Q5AA 2JXWA 2EC6C 1A75A 2LUXA 1TNXA 2L51A 4MZKA 1CDPA 3LCPC 5IBWA 2EGDA 1TOPA 2CXJA 4PCWA 2ZQSA 1WY9A 3DVEA 2L5XB 1CFCA 1XYDA 1OOJA 2PQLA 1EG3A 3O4XA 1JMQA 2COLB 4MZJA 2YSBA 2F33A 2F2PA 2LLSA 3GK4X 2LMVA 1YW5A 3NSIA 1OW4A 1NX0A 1Y0VH 4A4CA 4XJKB 1QV0A 1S6CA 5CSIA 1TNPA 3CLNA 3I5IB 1LA3A 2MLFC 3DD4A 2BCAA 5E62A 1CM4A 1K9UA 4GPLB 3QMEA 4I5JA 4MRXA 1BU3A 2BAPA 2H8VA 3PM8A 3FSBA 2QACA 1CFDA 4I5NB 3KAFA 2YSGA 2IS9A 1PSRA 2OS8B 1FW4A 1C07A 1BJFA 1XFRA 1KFXS 3LE4A 1UURA 4PT1A 2FJYA 3SIBA 3EG5B 4PHMA 1FPWA 3WNXB 1YVHA 3B6XA 1CMFA 3FSCA 3GK1A 1JSAA 3DVKA 3M0WA 1K90D 1MUXA 4MRYA 1AP4A 2ZQUA 2LMTA 1DGUA 3CZ1A 1F4QA 2JPTA 3EKJA 4MBEA 1OMDA 1HQVA 1M31A 2KSPA 1F8HA 2BECA 2WCKA 3NSKA 1JF0A 2JNXA 3HCMA 3S0FA 1NMVA 4GLXA 2A4JA 3S0DA 1FF1A 2E45A 3LLEA 1YR5A 2WAEA 1CDMA 2PASA 2KXQA 2KLEA 2KFGA 2M8JA 2D8NA 1SCMC 3L4LA 3IF7A 1MQ1A 2M1KB 4GGFA 2JTTA 4AOMA 2BE6A 3BUWB 4QJ3B 4U84A 2F8PA 4PHNA 4XJKA 2GGMA 4WQ3A 1TUZA 1DJHA 1RTP1 1TCOB 3BQ3A 5CSFA 1S6JA 2K61A 4MSPA 1IKUA 3BFHA 5F6TA 2KI6C 3CABA 2JU0A 1LXFC 3GK2A 1NX1A 2OPOA 1ALWA 1H4BA 1NP8A 1FBVA 2DOQA 2WC6A 2MRDA 3CYZA 4L9MA 1SL8A 1TIZA 1C3ZA 3LK0A 2L98A 1EG4A 2LVJA 3MSEB 2ZR6A 3KAGA 3CTNA 2EZ5W 2CCMA 1UHHA 3PN7B 2XPAA 2JT3A 3LK1A 4I5KA 1IQ5A 1HT9A 4WQ2A 1WDCB 2ZKMX 1MWNA 2M3OW 1YUTA 3TS5B 1BR4B 2FCEA 5HYDA 4GFTA 1AJ5A 1DJXA 3AKAA 3NHTA 3IVTA 1UWOA 1C3YA 1J55A 1PULA 1QVIZ 1J1EA 4IJ7A 1WRLA 1LS8A 2BA1A 4I5LB 4PHKA 1VRKA 3ODKA 1QLSA 3CR2A 1SCVA 3EK4A 3PJIA 4PALA 2KYFA 3WXAA 3D73A 5ER4X 1M45A 4YGCB 1DJYA 2OTGC 3TDZA 1G33A 1QIVA 1BG1A 1EH2A 4ETOA 1YUUA 2BKHB 2MHHA 2NZ0A 3KPXA 1Z4HA 5K89A 1RK9A 2M7NA 4NDCA 3O4YA 1NX2A 1B8CA 2AMIA 1TTXA 2G2BA 3HX4A 3I5FB 4GUKA 1OZOA 3DF0B 1S6IA 1BR1B 2JULA 3UO9A 3SG3A 4JD9A 1SL9A 1RFJA 3V2LA 4GNKB 3SS4A 2LHIA 2NCPA 4CLNA 1LA0A 2L4IA 2KBIA 1IJ6A 1NIWA 1OMVA 4CFQA 1QVIY 1G8IA 2WCMA 1T14A 3MQHA 1J1DA 1TCFA 2KAYA 1OMRA 1EJ3A 2LUCA 1JUOA 4GGFC 1SYMA 2KNEA 4OKHA 5DICA 1JC2A 1W7JB 3DYEA 2L2EA 3D78A 4YGAA 1ZUZA 3L4AA 5FI6A 2HQWA 2LNKA 5I2LA 3DVMA 2YSIA 1OOFA 2NXQA 2KDHA 1QLKA 1M63B 3D76A 3FE8A 4UPGA 5I2QA 2KOTA 1GGWA 3TDIA 2ZN8A 3PALA 4GGNA 2JV4A 3S0AA 5TNCA 2O5GA 1S3PA 4PE0A 1J7RA 3TDUA 4A0TA 2KGBC 2JWWA 1DJIA 1XFZO 3OBVA 1KQMC 1SY9A 1YVLA 3H4SE 1C7WA 1UHJA 3DF0A 3BYAA 3OB1B 3DZTA 4CFRA 2F2OA 2QPTA 4PHJA 3D77A 4M2PA 3FWCA 4R1EA 2MDIA 3WH0A 4QJ5B 1QIWA 3D74A 1QX2A 3R1PA 1UHNA 4ZCVA 2I7AA 5KSZA 2L2CA 1Y1UA 1DVIA 1K96A 1EXRA 3R72A 1YRUB 1BF5A 1M46A 1QTXA 2WADA 5E64A 4MN0A 4OCIA 1ZFSA 2GV5A 2ZQTA 2Q4UA 1DJZA 1K95A 2WOSA 3SG6A 1SNLA 1CMGA 2LVVA 3I5GB 1L2OB 2WC5A 3UNWA 2JC2A 1BT6A 3VRNA 5DKQA 1Y6WA 4N5XA 4U85A 3CZ2A 1B47A 1TN4A 3K1EA 3PLFB 2RE3A 2XP8A 4N1GA 5KU1A 2HETA 1F4OA 2WCEA 3QRXA 4OR9B 1KQMB 1C7VA 4KYNA 2PMYA 3PM2A 2E30A 2BNXA 3OP0A 2K7DA 4FQOA 1LKJA 2LCPA 2HPSA 2QEVA 3PN7C 1OOIX 5U47A 3CS1A 3NXAA 5AERA 2I94A 1WDCC 2MBXA 3A8RA 2KQ6A 3TS5C 1K8UA 4OZDA 5HKWA 3EKHA 1ZMZA 5DKRA 2ZRSA 2BE4A 2YGUA 1IQ3A 4IL1A 3KAIA 2JT0A 5ER5A 2DWVA 3VGOA 4JWQA 2L4JA 3PSRA 3SG5A 3BUNB 3BXKA 2JPOA 1IIOA 1S1EA 1DTLA 3GOFA 2WCHA 1OZSA 5PALA 1IRJA 3RZSA 1YRTB 2BCXA 1KCYA 2I2RE 3M85A 3ICBA 1F71A 2MAZA 2P6BB 1Y1AA 4N1FA 1ZACA 3OHMB 2KI4C 3OX5A 1CFPA 1A2XA 1DGVA 3VB1A 2ZRTA 1DF0A 3VROA 3EK8A 3PQHA 5HLOA 3I5FC 1KK7Y 1PALA 1PVAA 2XP9A 3O78A 1CFFA 1CM1A 1XK4A 2V53A 3CGAA 5CPVA 5CSJA 1FI6A 1NUBA 2JXCA 1XO5A 1P28A 2CNPA 2PALA 4HREE 3TCZA 2HF5A 5AFPA 3B86A 2LE9B 4INXA 5HKZA 2YAJB 2K2AA 2ZFDA 2LV7A 1YTZC 1NPQA 2GTEA 1XFXO 1KK8B 1ODBA 3OGNA 2LAPA 4JPZB 4E5RA 4QIBA 4PDZA 4NDBA 2H2KA 3BUXB 4DRWA 2K2FA 1OOHA 3C1VA 5CSNA 4F7FA 3WHTB 1ZCNA 2BBMA 1L7ZA 4REXA 1WMVA 1B7TZ 4ZCUA 2M9GA 2E6WA 3RLZA 4USLA 2LMUA 2KI4B 3S0BA 3D75A 5I2OA 2LP3A 4HSZA 5HKYA 1J7PA 3KCEA 2SASA 3KO0A 2L0PA 4PE7A 5D7FA 1X02A 3EVUA 2Y8NB 3D0YA 2JXLA 1DJWA 3LL8B 2Y5IA 2LM5A
chains in the Genus database with same CATH topology
3PATA 1MF8B 1N65A 1UP5A 2AAOA 4ORCB 1AK8A 1PSBA 1AHRA 4Q04A 5D69A 3CR5X 1WRKA 5JJGA 2DK1A 2SCPA 1K9QA 1QS7A 2BL0B 1CNPA 3NSOA 2FOTA 1AJ4A 2AUCA 1K9RA 3CR4X 3CWGA 4U8DA 3K21A 2ZR4A 2LVIA 1YUSA 2JTZA 2VRGA 1QX7A 3BUOB 2G9BA 5GQQC 5BPJA 1LINA 3KABA 5AHTA 1B7TY 2M97A 4A0UA 3O2PA 2LP2A 4ORBB 4WRIA 3LKXB 3I5GC 1L2OC 1OE9B 1B9AA 1R6PA 1CDLA 3SJSA 4CIDA 4OVNF 2DJYA 3RM1A 3TZ1A 1K9KA 2F3YA 2JQ6A 3I5HB 3FIAA 1PK0D 1UUSA 5DKNA 3MCBA 1ZOTB 3F45A 5AXIA 3KHEA 2RGIA 1XK4C 4BY4A 1J7OA 1KWOB 3KAHA 1MXLC 2KFFA 2Y4QA 3DVJA 2Y1MA 5JOLA 2MLEC 4MEWA 1SRAA 2H61A 2ZN9A 2M7LA 1WLMA 2QRVA 3TC5A 1RJVA 1SMGA 2ZNDA 2M49B 1YX8A 1A4PA 1MHOA 2KYCA 4C0JA 2YSHA 1CTRA 1J7QA 2KGRA 1XFUO 4MZLA 2ITKA 1KFUL 2WNDA 4C0LA 1F54A 4AQIA 1K93D 4DUQA 2KAVA 2JT8A 2M3WA 3CZTX 2Y1NA 4FTGA 4MLWA 1PINA 2JMFA 1QASA 4GAOA 1DF0B 5AEQA 4DS7A 3A4UB 1CLBA 3VRQA 3LKXA 3ZNIA 3SG7A 3JVTB 2KQYA 2MA2A 1PVBA 1CLLA 2WORA 1M39A 2BKIB 1LVCD 1O6WA 3L4HA 2PVBA 1UHKA 1B8RA 1KK7Z 3TUYB 3KADA 4YI9A 2XP7A 2BBNA 2JNFA 1WR7A 2K7CA 4A4BA 2FCDA 1G4YR 1BLQA 2XP4A 2L50A 1YURA 1XFYO 2F21A 2CBLA 1SKTA 1W7IB 1R2UA 1XFWO 1KSOA 3SIAA 3OOBA 3JTDB 1BODA 3FS8A 4XYNA 1S5GZ 2NLNA 1KK8C 4YRUA 1QATA 3AKBA 3M7NA 1TNQA 4TNCA 2KAXA 1NCZA 2EC6B 1F70A 1SL7A 1XFVO 4CPVA 1F55A 3BUMB 1JWDA 3O6BA 5E5WA 1E8AA 3KF9A 1FLCA 2XPBA 3MQGA 1S26D 2XP3A 1QJTA 2ISDA 1NCYA 3D0YB 2YSFA 1KFXL 2M0RA 4P2YB 2K7BA 2ZQVA 1K9PA 5AANA 3KEVA 2PRUA 2O60A 1D1OA 1NWDA 1QV1A 5B8IB 1NCXA 2WCFA 5E66A 2ZAJA 4HRHA 2PSRA 1K2HA 2YSBA 1IG5A 1JF2A 1RROA 4GBAA 4NDDA 2BCBA 3CNGA 4NQGA 2ZR5A 2H61C 1QX5B 1AVSA 2EHBA 1SR6C 4BY5A 2M1UA 5I8NA 1QXPA 1KSMA 4F0ZB 3VRPA 1IGVA 4HRGA 2FJUB 1N0YA 2M8IA 4M2QA 1S5GY 2WC8A 1Q80A 2LAJA 2BL0C 1DT7B 1H8BA 4C0KA 4DCKA 1YX7A 5FYXA 4M2OA 4JQ0D 5CQ2A 1A03A 2LVKA 2JZIA 1OSAA 1NSHA 3SG2A 1UHIA 1MR8A 2K7OA 1BOCA 1IWQA 2F3ZA 1SK6D 2HQ8A 4YGEB 3AAJA 2WCBA 1PRWA 1IH0A 2K0JA 3MCBB 2OWOA 2KBMA 1ALVA 3IQQA 3EVRA 2CT9A 4PE4A 3VRRA 1GGZA 1B4CA 1SPYA 2LLTA 5E65A 3OB2B 4QJ4B 1IJ5A 1NX3A 3I5HC 4MVFA 4DIRA 3BOWB 2XP5A 2LLUA 3IQOA 1SCMB 3EK7A 2M8UA 1A29A 1SR6B 1RWYA 1KWOC 2LANA 2LC5A 4D1EA 3WHUB 1MXEA 1RECA 1U5IB 1I5HW 1TK7A 1GQMA 4YBHB 1DMOA 1EL4A 5HLVA 1XVJA 1B1GA 2B1UA 2DK7A 2L4HA 2JOJA 3FWBA 4OV2A 4P5OE 1A75B 2R2IA 4ORAB 3NTPA 1N2DA 4U86A 1TR8A 4YGDB 2TN4A 1CKKA 1GJYA 2MJWB 2M29A 1CDNA 3AAKA 1TRFA 2KFHA 1K94A 3FS7A 1WLZA 1FI5A 2JRFA 1KQVA 1JFJA 1Y1XA 2Q91A 1S36A 2KHNA 2DMVA 3JVTC 3TDBA 2XP6A 2NCOA 3EVVA 1V1GA 3E3RA 3ZWHA 4YI8A 1BMOA 1B8LA 3SG4A 3TUYC 3BOWA 2OTGB 2GGZA 4PE1A 2CTNA 1CB1A 2JX8A 1DJGA 1KFUS 1XA5A 1F8AB 3I5IC 1RP5A 2KI6D 1WRZA 4YGBB 5KTYA 3OX6A 3PFVA 1SBJA 1SW8A 3D10A 4ICBA 1U5IA 2ZNEA 4AQJA 3NSLA 1V1FA 5J3XA 3JTDC 1NYAA 4E68A 2K8MB 2LHLA 2OS8C 5G08A 1CLMA 2I18A 1OQPA 1JBAA 1AUIB 1TNWA 1JFKA 2Q5AA 2JXWA 2EC6C 1A75A 2LUXA 1TNXA 2L51A 4MZKA 1CDPA 3LCPC 5IBWA 2EGDA 1TOPA 2CXJA 4PCWA 2ZQSA 1WY9A 3DVEA 2L5XB 1CFCA 1XYDA 1OOJA 1EG3A 1JMQA 2COLB 4MZJA 2F33A 2F2PA 2LLSA 3GK4X 2LMVA 1YW5A 3NSIA 1NX0A 1Y0VH 4A4CA 4XJKB 1QV0A 1S6CA 5CSIA 1TNPA 3CLNA 3I5IB 1LA3A 2MLFC 3DD4A 2BCAA 5E62A 1CM4A 1K9UA 4GPLB 4I5JA 4MRXA 1BU3A 3PM8A 3FSBA 2QACA 1CFDA 4I5NB 3KAFA 2YSGA 2IS9A 1PSRA 2OS8B 1FW4A 1C07A 1BJFA 1KFXS 3LE4A 1UURA 3SIBA 4PHMA 1FPWA 3WNXB 1YVHA 1CMFA 3FSCA 3GK1A 1JSAA 3DVKA 3M0WA 1K90D 1MUXA 4MRYA 1AP4A 2ZQUA 2LMTA 1DGUA 1F4QA 2JPTA 3EKJA 4MBEA 1OMDA 1HQVA 1M31A 2KSPA 1F8HA 2BECA 3NSKA 1JF0A 2JNXA 3HCMA 1NMVA 4GLXA 2A4JA 1FF1A 2E45A 3LLEA 1YR5A 2WAEA 1CDMA 2PASA 2KXQA 2KFGA 2M8JA 2D8NA 1SCMC 3IF7A 1MQ1A 2M1KB 4GGFA 2JTTA 4AOMA 2BE6A 3BUWB 4QJ3B 4U84A 2F8PA 4PHNA 4XJKA 2GGMA 4WQ3A 5CSFA 1DJHA 1RTP1 1TCOB 3BQ3A 1IKUA 1S6JA 2K61A 4MSPA 5F6TA 2KI6C 2JU0A 1LXFC 3GK2A 1NX1A 2OPOA 1ALWA 1H4BA 1NP8A 1FBVA 2DOQA 2MRDA 4L9MA 1SL8A 1TIZA 3LK0A 2L98A 1EG4A 2LVJA 3MSEB 2ZR6A 3KAGA 3CTNA 2EZ5W 2CCMA 1UHHA 3PN7B 2XPAA 2JT3A 3LK1A 4I5KA 1IQ5A 1HT9A 4WQ2A 1WDCB 2ZKMX 1MWNA 2M3OW 1YUTA 3TS5B 1BR4B 2FCEA 5HYDA 4GFTA 1AJ5A 1DJXA 3AKAA 1UWOA 1J55A 1PULA 1QVIZ 1J1EA 2BA1A 1WRLA 4I5LB 4PHKA 1VRKA 3ODKA 1QLSA 3CR2A 1SCVA 3EK4A 4PALA 2KYFA 3WXAA 5ER4X 1M45A 4YGCB 1DJYA 2OTGC 3TDZA 1G33A 1QIVA 1BG1A 1EH2A 4ETOA 1YUUA 2BKHB 2MHHA 2NZ0A 3KPXA 5K89A 1RK9A 2M7NA 4NDCA 3O4YA 1NX2A 1B8CA 2AMIA 1TTXA 2G2BA 3HX4A 3I5FB 4GUKA 1OZOA 3DF0B 1S6IA 1BR1B 2JULA 3SG3A 1SL9A 1RFJA 4GNKB 2LHIA 2NCPA 4CLNA 1LA0A 2L4IA 2KBIA 1IJ6A 1NIWA 1OMVA 4CFQA 1QVIY 1G8IA 3MQHA 1J1DA 1TCFA 2KAYA 1OMRA 1EJ3A 2LUCA 1JUOA 4GGFC 1SYMA 2KNEA 4OKHA 1JC2A 1W7JB 2L2EA 4YGAA 1ZUZA 5I2LA 2HQWA 2LNKA 3DVMA 2YSIA 2NXQA 2KDHA 1QLKA 1M63B 4UPGA 5I2QA 2KOTA 1GGWA 3TDIA 2ZN8A 3PALA 4GGNA 2JV4A 5TNCA 2O5GA 1S3PA 4PE0A 1J7RA 3TDUA 4A0TA 2KGBC 2JWWA 1DJIA 1XFZO 1KQMC 1SY9A 1YVLA 3H4SE 1C7WA 1UHJA 3DF0A 3BYAA 3OB1B 4CFRA 2F2OA 2QPTA 4PHJA 4M2PA 3FWCA 4R1EA 2MDIA 3WH0A 4QJ5B 1QIWA 1QX2A 1UHNA 4ZCVA 2I7AA 5KSZA 1Y1UA 1DVIA 1K96A 1EXRA 1YRUB 1BF5A 1M46A 1QTXA 2WADA 5E64A 4MN0A 4OCIA 1ZFSA 2GV5A 2ZQTA 2Q4UA 1DJZA 1K95A 2WOSA 3SG6A 1SNLA 1CMGA 2LVVA 3I5GB 1L2OB 2JC2A 1BT6A 3VRNA 5DKQA 1Y6WA 4N5XA 4U85A 1B47A 1TN4A 3PLFB 2RE3A 2XP8A 4N1GA 5KU1A 2HETA 1F4OA 2WCEA 3QRXA 4OR9B 1KQMB 1C7VA 2PMYA 2E30A 3OP0A 2K7DA 4FQOA 1LKJA 2LCPA 2HPSA 3PN7C 5U47A 3CS1A 3NXAA 5AERA 2I94A 1WDCC 2MBXA 3A8RA 2KQ6A 3TS5C 1K8UA 5HKWA 3EKHA 1ZMZA 5DKRA 2ZRSA 2BE4A 1IQ3A 3KAIA 4IL1A 2JT0A 5ER5A 2DWVA 3VGOA 4JWQA 2L4JA 3PSRA 3SG5A 3BUNB 3BXKA 1S1EA 1DTLA 3GOFA 1OZSA 5PALA 1IRJA 1YRTB 2BCXA 1KCYA 2I2RE 3M85A 3ICBA 1F71A 2MAZA 2P6BB 1Y1AA 4N1FA 1ZACA 3OHMB 2KI4C 3OX5A 1CFPA 1A2XA 1DGVA 2ZRTA 1DF0A 3VROA 3EK8A 3PQHA 5HLOA 3I5FC 1KK7Y 1PALA 1PVAA 2XP9A 3O78A 1CFFA 1CM1A 1XK4A 2V53A 3CGAA 5CPVA 5CSJA 1FI6A 1NUBA 2JXCA 1XO5A 2CNPA 2PALA 4HREE 3TCZA 2HF5A 5AFPA 2LE9B 5HKZA 2YAJB 2K2AA 2ZFDA 2LV7A 1YTZC 1NPQA 1XFXO 1KK8B 1ODBA 2LAPA 4JPZB 4E5RA 4QIBA 4PDZA 4NDBA 2H2KA 3BUXB 4DRWA 2K2FA 3C1VA 5CSNA 3WHTB 1ZCNA 2BBMA 1L7ZA 4REXA 1WMVA 1B7TZ 4ZCUA 2M9GA 2E6WA 3RLZA 4USLA 2LMUA 2KI4B 5I2OA 2LP3A 4HSZA 5HKYA 1J7PA 3KCEA 2SASA 3KO0A 2L0PA 4PE7A 5D7FA 1X02A 3EVUA 2Y8NB 3D0YA 2JXLA 1DJWA 3LL8B 2Y5IA 2LM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PAT A;  1MF8 B;  1N65 A;  1UP5 A;  2AAO A;  4ORC B;  1AK8 A;  1PSB A;  1AHR A;  4Q04 A;  5D69 A;  3CR5 X;  1WRK A;  5JJG A;  2DK1 A;  2SCP A;  1K9Q A;  1QS7 A;  2BL0 B;  1CNP A;  3NSO A;  2FOT A;  1AJ4 A;  2AUC A;  1K9R A;  3CR4 X;  3CWG A;  4U8D A;  3K21 A;  2ZR4 A;  2LVI A;  1YUS A;  2JTZ A;  2VRG A;  1QX7 A;  3BUO B;  2G9B A;  5GQQ C;  5BPJ A;  1LIN A;  3KAB A;  5AHT A;  1B7T Y;  2M97 A;  3O2P A;  2LP2 A;  4ORB B;  4WRI A;  3I5G C;  1L2O C;  1OE9 B;  1B9A A;  1R6P A;  1CDL A;  3SJS A;  4CID A;  4OVN F;  2DJY A;  3RM1 A;  3TZ1 A;  1K9K A;  2F3Y A;  2JQ6 A;  3I5H B;  3FIA A;  1PK0 D;  1UUS A;  5DKN A;  1ZOT B;  3F45 A;  5AXI A;  3KHE A;  2RGI A;  1XK4 C;  4BY4 A;  1J7O A;  1KWO B;  3KAH A;  1MXL C;  2KFF A;  2Y4Q A;  3DVJ A;  2Y1M A;  5JOL A;  2MLE C;  4MEW A;  1SRA A;  2H61 A;  2ZN9 A;  2M7L A;  1WLM A;  3TC5 A;  1RJV A;  1SMG A;  2ZND A;  2M49 B;  1YX8 A;  1A4P A;  1MHO A;  2KYC A;  4C0J A;  2YSH A;  1CTR A;  1J7Q A;  2KGR A;  1XFU O;  4MZL A;  2ITK A;  1KFU L;  2WND A;  4C0L A;  1F54 A;  4AQI A;  1K93 D;  4DUQ A;  2KAV A;  2JT8 A;  2M3W A;  3CZT X;  2Y1N A;  4FTG A;  4MLW A;  1PIN A;  2JMF A;  1QAS A;  4GAO A;  1DF0 B;  5AEQ A;  4DS7 A;  3A4U B;  1CLB A;  3VRQ A;  3ZNI A;  3SG7 A;  3JVT B;  2KQY A;  2MA2 A;  1PVB A;  1CLL A;  2WOR A;  1M39 A;  2BKI B;  1LVC D;  1O6W A;  3L4H A;  2PVB A;  1UHK A;  1B8R A;  1KK7 Z;  3TUY B;  3KAD A;  4YI9 A;  2XP7 A;  2BBN A;  2JNF A;  1WR7 A;  2K7C A;  4A4B A;  2FCD A;  1G4Y R;  1BLQ A;  2XP4 A;  2L50 A;  1YUR A;  1XFY O;  2F21 A;  2CBL A;  1SKT A;  1W7I B;  1R2U A;  1XFW O;  1KSO A;  3SIA A;  3OOB A;  3JTD B;  1BOD A;  4XYN A;  1S5G Z;  2NLN A;  1KK8 C;  4YRU A;  1QAT A;  3AKB A;  3M7N A;  1TNQ A;  4TNC A;  2KAX A;  1NCZ A;  2EC6 B;  1F70 A;  1SL7 A;  1XFV O;  4CPV A;  1F55 A;  3BUM B;  1JWD A;  3O6B A;  1E8A A;  3KF9 A;  2XPB A;  1S26 D;  2XP3 A;  1QJT A;  2ISD A;  1NCY A;  3D0Y B;  2YSF A;  1KFX L;  2M0R A;  4P2Y B;  2K7B A;  2ZQV A;  1K9P A;  5AAN A;  3KEV A;  2PRU A;  2O60 A;  1D1O A;  1NWD A;  1QV1 A;  5B8I B;  1NCX A;  2WCF A;  2ZAJ A;  4HRH A;  2PSR A;  1K2H A;  2YSB A;  1IG5 A;  1JF2 A;  1RRO A;  4GBA A;  4NDD A;  2BCB A;  3CNG A;  4NQG A;  2ZR5 A;  2H61 C;  1QX5 B;  1AVS A;  2EHB A;  1SR6 C;  4BY5 A;  2M1U A;  5I8N A;  1QXP A;  1KSM A;  4F0Z B;  3VRP A;  1IGV A;  4HRG A;  2FJU B;  1N0Y A;  2M8I A;  4M2Q A;  1S5G Y;  2WC8 A;  1Q80 A;  2LAJ A;  2BL0 C;  1DT7 B;  1H8B A;  4C0K A;  4DCK A;  1YX7 A;  5FYX A;  4M2O A;  4JQ0 D;  5CQ2 A;  1A03 A;  2LVK A;  2JZI A;  1OSA A;  1NSH A;  3SG2 A;  1UHI A;  1MR8 A;  2K7O A;  1BOC A;  1IWQ A;  2F3Z A;  1SK6 D;  2HQ8 A;  4YGE B;  3AAJ A;  2WCB A;  1PRW A;  1IH0 A;  2K0J A;  2KBM A;  1ALV A;  3IQQ A;  3EVR A;  2CT9 A;  4PE4 A;  3VRR A;  1GGZ A;  1B4C A;  1SPY A;  2LLT A;  3OB2 B;  4QJ4 B;  1IJ5 A;  1NX3 A;  3I5H C;  4MVF A;  4DIR A;  3BOW B;  2XP5 A;  2LLU A;  3IQO A;  1SCM B;  3EK7 A;  2M8U A;  1A29 A;  1SR6 B;  1RWY A;  1KWO C;  2LAN A;  2LC5 A;  4D1E A;  3WHU B;  1MXE A;  1REC A;  1U5I B;  1I5H W;  1TK7 A;  1GQM A;  4YBH B;  1DMO A;  1EL4 A;  5HLV A;  1XVJ A;  1B1G A;  2B1U A;  2DK7 A;  2L4H A;  2JOJ A;  3FWB A;  4OV2 A;  4P5O E;  1A75 B;  2R2I A;  4ORA B;  3NTP A;  1N2D A;  4U86 A;  4YGD B;  2TN4 A;  1CKK A;  1GJY A;  2MJW B;  2M29 A;  1CDN A;  3AAK A;  1TRF A;  2KFH A;  1K94 A;  3FS7 A;  1WLZ A;  1FI5 A;  2JRF A;  1KQV A;  1JFJ A;  1Y1X A;  2Q91 A;  1S36 A;  2KHN A;  2DMV A;  3JVT C;  3TDB A;  2XP6 A;  2NCO A;  3EVV A;  1V1G A;  3E3R A;  3ZWH A;  4YI8 A;  1BMO A;  1B8L A;  3SG4 A;  3TUY C;  3BOW A;  2OTG B;  2GGZ A;  4PE1 A;  2CTN A;  1CB1 A;  2JX8 A;  1DJG A;  1KFU S;  1XA5 A;  1F8A B;  3I5I C;  2KI6 D;  1WRZ A;  4YGB B;  5KTY A;  3OX6 A;  3PFV A;  1SBJ A;  1SW8 A;  3D10 A;  4ICB A;  1U5I A;  2ZNE A;  4AQJ A;  3NSL A;  1V1F A;  5J3X A;  3JTD C;  1NYA A;  4E68 A;  2K8M B;  2LHL A;  2OS8 C;  5G08 A;  1CLM A;  2I18 A;  1OQP A;  1JBA A;  1AUI B;  1TNW A;  1JFK A;  2Q5A A;  2JXW A;  2EC6 C;  1A75 A;  2LUX A;  1TNX A;  2L51 A;  4MZK A;  1CDP A;  3LCP C;  5IBW A;  2EGD A;  1TOP A;  2CXJ A;  4PCW A;  2ZQS A;  1WY9 A;  3DVE A;  2L5X B;  1CFC A;  1XYD A;  1OOJ A;  1EG3 A;  1JMQ A;  2COL B;  4MZJ A;  2F33 A;  2F2P A;  2LLS A;  3GK4 X;  2LMV A;  1YW5 A;  3NSI A;  1NX0 A;  1Y0V H;  4A4C A;  4XJK B;  1QV0 A;  1S6C A;  5CSI A;  1TNP A;  3CLN A;  3I5I B;  1LA3 A;  2MLF C;  3DD4 A;  2BCA A;  1CM4 A;  1K9U A;  4GPL B;  4I5J A;  4MRX A;  1BU3 A;  3PM8 A;  2QAC A;  1CFD A;  4I5N B;  3KAF A;  2YSG A;  2IS9 A;  1PSR A;  2OS8 B;  1FW4 A;  1C07 A;  1BJF A;  1KFX S;  3LE4 A;  1UUR A;  3SIB A;  4PHM A;  1FPW A;  3WNX B;  1YVH A;  1CMF A;  3GK1 A;  1JSA A;  3DVK A;  3M0W A;  1K90 D;  1MUX A;  4MRY A;  1AP4 A;  2ZQU A;  2LMT A;  1DGU A;  1F4Q A;  2JPT A;  3EKJ A;  4MBE A;  1OMD A;  1HQV A;  1M31 A;  2KSP A;  1F8H A;  2BEC A;  3NSK A;  1JF0 A;  2JNX A;  3HCM A;  1NMV A;  2A4J A;  1FF1 A;  2E45 A;  3LLE A;  1YR5 A;  1CDM A;  2PAS A;  2KXQ A;  2KFG A;  2M8J A;  2D8N A;  1SCM C;  3IF7 A;  1MQ1 A;  2M1K B;  4GGF A;  2JTT A;  4AOM A;  2BE6 A;  3BUW B;  4QJ3 B;  4U84 A;  2F8P A;  4PHN A;  4XJK A;  2GGM A;  4WQ3 A;  5CSF A;  1DJH A;  1RTP 1;  1TCO B;  3BQ3 A;  1IKU A;  1S6J A;  2K61 A;  4MSP A;  5F6T A;  2KI6 C;  2JU0 A;  1LXF C;  3GK2 A;  1NX1 A;  2OPO A;  1ALW A;  1H4B A;  1NP8 A;  1FBV A;  2DOQ A;  2MRD A;  4L9M A;  1SL8 A;  1TIZ A;  3LK0 A;  2L98 A;  1EG4 A;  2LVJ A;  3MSE B;  2ZR6 A;  3KAG A;  3CTN A;  2EZ5 W;  2CCM A;  1UHH A;  3PN7 B;  2XPA A;  2JT3 A;  3LK1 A;  4I5K A;  1IQ5 A;  1HT9 A;  4WQ2 A;  1WDC B;  2ZKM X;  1MWN A;  2M3O W;  1YUT A;  3TS5 B;  1BR4 B;  2FCE A;  5HYD A;  4GFT A;  1AJ5 A;  1DJX A;  3AKA A;  1UWO A;  1J55 A;  1PUL A;  1QVI Z;  1J1E A;  2BA1 A;  1WRL A;  4I5L B;  4PHK A;  1VRK A;  3ODK A;  1QLS A;  3CR2 A;  1SCV A;  3EK4 A;  4PAL A;  2KYF A;  3WXA A;  5ER4 X;  1M45 A;  4YGC B;  1DJY A;  2OTG C;  3TDZ A;  1G33 A;  1QIV A;  1BG1 A;  1EH2 A;  4ETO A;  1YUU A;  2BKH B;  2MHH A;  2NZ0 A;  3KPX A;  5K89 A;  1RK9 A;  2M7N A;  4NDC A;  3O4Y A;  1NX2 A;  1B8C A;  2AMI A;  1TTX A;  2G2B A;  3HX4 A;  3I5F B;  4GUK A;  1OZO A;  3DF0 B;  1S6I A;  1BR1 B;  2JUL A;  3SG3 A;  1SL9 A;  1RFJ A;  4GNK B;  2LHI A;  2NCP A;  4CLN A;  1LA0 A;  2L4I A;  2KBI A;  1IJ6 A;  1NIW A;  1OMV A;  4CFQ A;  1QVI Y;  1G8I A;  1J1D A;  1TCF A;  2KAY A;  1OMR A;  1EJ3 A;  2LUC A;  1JUO A;  4GGF C;  1SYM A;  2KNE A;  4OKH A;  1JC2 A;  1W7J B;  2L2E A;  4YGA A;  1ZUZ A;  5I2L A;  2HQW A;  2LNK A;  3DVM A;  2YSI A;  2NXQ A;  2KDH A;  1QLK A;  1M63 B;  4UPG A;  5I2Q A;  2KOT A;  1GGW A;  3TDI A;  2ZN8 A;  3PAL A;  4GGN A;  2JV4 A;  5TNC A;  2O5G A;  1S3P A;  4PE0 A;  1J7R A;  3TDU A;  2KGB C;  2JWW A;  1DJI A;  1XFZ O;  1KQM C;  1SY9 A;  1YVL A;  3H4S E;  1C7W A;  1UHJ A;  3DF0 A;  3BYA A;  3OB1 B;  4CFR A;  2F2O A;  2QPT A;  4PHJ A;  4M2P A;  3FWC A;  4R1E A;  2MDI A;  3WH0 A;  4QJ5 B;  1QIW A;  1QX2 A;  1UHN A;  4ZCV A;  2I7A A;  5KSZ A;  1Y1U A;  1DVI A;  1K96 A;  1EXR A;  1YRU B;  1BF5 A;  1M46 A;  1QTX A;  4MN0 A;  4OCI A;  1ZFS A;  2GV5 A;  2ZQT A;  2Q4U A;  1DJZ A;  1K95 A;  2WOS A;  3SG6 A;  1SNL A;  1CMG A;  2LVV A;  3I5G B;  1L2O B;  2JC2 A;  1BT6 A;  3VRN A;  5DKQ A;  1Y6W A;  4N5X A;  4U85 A;  1B47 A;  1TN4 A;  3PLF B;  2RE3 A;  2XP8 A;  4N1G A;  5KU1 A;  2HET A;  1F4O A;  2WCE A;  3QRX A;  4OR9 B;  1KQM B;  1C7V A;  2PMY A;  2E30 A;  3OP0 A;  2K7D A;  4FQO A;  1LKJ A;  2LCP A;  2HPS A;  3PN7 C;  3CS1 A;  3NXA A;  5AER A;  2I94 A;  1WDC C;  2MBX A;  3A8R A;  2KQ6 A;  3TS5 C;  1K8U A;  5HKW A;  3EKH A;  1ZMZ A;  5DKR A;  2ZRS A;  2BE4 A;  1IQ3 A;  3KAI A;  4IL1 A;  2JT0 A;  5ER5 A;  2DWV A;  3VGO A;  4JWQ A;  2L4J A;  3PSR A;  3SG5 A;  3BUN B;  3BXK A;  1S1E A;  1DTL A;  3GOF A;  1OZS A;  5PAL A;  1IRJ A;  1YRT B;  2BCX A;  1KCY A;  2I2R E;  3M85 A;  3ICB A;  1F71 A;  2MAZ A;  2P6B B;  1Y1A A;  4N1F A;  1ZAC A;  3OHM B;  2KI4 C;  3OX5 A;  1CFP A;  1A2X A;  1DGV A;  2ZRT A;  1DF0 A;  3VRO A;  3EK8 A;  5HLO A;  3I5F C;  1KK7 Y;  1PAL A;  1PVA A;  2XP9 A;  3O78 A;  1CFF A;  1CM1 A;  1XK4 A;  2V53 A;  3CGA A;  5CPV A;  5CSJ A;  1FI6 A;  1NUB A;  2JXC A;  1XO5 A;  2CNP A;  2PAL A;  4HRE E;  3TCZ A;  2HF5 A;  5AFP A;  2LE9 B;  5HKZ A;  2K2A A;  2ZFD A;  2LV7 A;  1YTZ C;  1NPQ A;  1XFX O;  1KK8 B;  1ODB A;  2LAP A;  4JPZ B;  4E5R A;  4QIB A;  4PDZ A;  4NDB A;  2H2K A;  3BUX B;  4DRW A;  2K2F A;  3C1V A;  5CSN A;  3WHT B;  1ZCN A;  2BBM A;  1L7Z A;  4REX A;  1WMV A;  1B7T Z;  4ZCU A;  2M9G A;  2E6W A;  3RLZ A;  4USL A;  2LMU A;  2KI4 B;  5I2O A;  2LP3 A;  4HSZ A;  5HKY A;  1J7P A;  3KCE A;  2SAS A;  3KO0 A;  2L0P A;  4PE7 A;  5D7F A;  1X02 A;  3EVU A;  3D0Y A;  2JXL A;  1DJW A;  3LL8 B;  2Y5I A;  2LM5 A; 
#chains in the Genus database with same CATH topology
 3CZ0 A;  3PAT A;  1MF8 B;  1N65 A;  1UP5 A;  2AAO A;  4ORC B;  1AK8 A;  1PSB A;  1AHR A;  3NHI A;  4Q04 A;  5D69 A;  3CR5 X;  1WRK A;  5JJG A;  2DK1 A;  2SCP A;  1K9Q A;  1QS7 A;  2BL0 B;  1CNP A;  3NSO A;  2FOT A;  1AJ4 A;  2AUC A;  3SS3 A;  1DQE A;  1K9R A;  3CR4 X;  3CWG A;  4U8D A;  3K21 A;  2ZR4 A;  2LVI A;  1DEK A;  1YUS A;  2JTZ A;  2VRG A;  1QX7 A;  3BUO B;  2G9B A;  5GQQ C;  5BPJ A;  1LIN A;  3B87 A;  3KAB A;  5AHT A;  1B7T Y;  2M97 A;  3DY9 A;  4A0U A;  3O2P A;  2LP2 A;  4ORB B;  4WRI A;  3LKX B;  3I5G C;  1L2O C;  1OE9 B;  1B9A A;  1R6P A;  1CDL A;  3SJS A;  4CID A;  4OVN F;  2DJY A;  2QDI A;  3R1V A;  3RM1 A;  3TZ1 A;  1W9Z A;  5HL1 A;  1K9K A;  5I94 A;  2F3Y A;  2JQ6 A;  3I5H B;  3FIA A;  1PK0 D;  1UUS A;  5DKN A;  3MCB A;  1ZOT B;  3F45 A;  5AXI A;  3KHE A;  2RGI A;  3BJH A;  1XK4 C;  4BY4 A;  1J7O A;  1KWO B;  3KAH A;  1MXL C;  2KFF A;  2WCL A;  2Y4Q A;  3DVJ A;  2Y1M A;  5JOL A;  2MLE C;  3CDN A;  4MEW A;  1SRA A;  2H61 A;  2ZN9 A;  3NGV A;  2M7L A;  1WLM A;  2QRV A;  3TC5 A;  1RJV A;  1SMG A;  2ZND A;  3S0G A;  2M49 B;  1YX8 A;  1A4P A;  1MHO A;  2KYC A;  4C0J A;  2YSH A;  1CTR A;  2KPH A;  1J7Q A;  2KGR A;  1XFU O;  4MZL A;  2ITK A;  1KFU L;  2WND A;  3FE6 A;  4C0L A;  1F54 A;  4AQI A;  1K93 D;  1DEL A;  4DUQ A;  2KAV A;  2JT8 A;  2M3W A;  4FQT A;  3CZT X;  2Y1N A;  4FTG A;  4MLW A;  1PIN A;  2JMF A;  1QAS A;  3S0E A;  4GAO A;  1DF0 B;  5AEQ A;  4DS7 A;  3A4U B;  1CLB A;  3VRQ A;  3LKX A;  3ZNI A;  3SG7 A;  3JVT B;  2KQY A;  2MA2 A;  1PVB A;  1CLL A;  2WOR A;  1M39 A;  2BKI B;  1OOG A;  1LVC D;  3BFA A;  1O6W A;  2PVB A;  3L4H A;  1UHK A;  1B8R A;  1KK7 Z;  3TUY B;  2P70 A;  3KAD A;  4YI9 A;  2XP7 A;  2BBN A;  4JKT A;  2JNF A;  2WCJ A;  1WR7 A;  2K7C A;  4A4B A;  2FCD A;  1G4Y R;  1BLQ A;  2XP4 A;  2L50 A;  1YUR A;  1XFY O;  2F21 A;  1W7I B;  1SKT A;  2CBL A;  1R2U A;  1XFW O;  1KSO A;  3SIA A;  3OOB A;  3JTD B;  1BOD A;  3FS8 A;  4XYN A;  2P71 A;  1S5G Z;  2NLN A;  1KK8 C;  4YRU A;  1QAT A;  3AKB A;  3M7N A;  1TNQ A;  4TNC A;  2KAX A;  1NCZ A;  2EC6 B;  1F70 A;  1SL7 A;  1XFV O;  4CPV A;  1F55 A;  3BUM B;  1JWD A;  3O6B A;  5E5W A;  1E8A A;  3KF9 A;  1FLC A;  2XPB A;  3MQG A;  2ERB A;  1S26 D;  2XP3 A;  1QJT A;  2ISD A;  1NCY A;  3D0Y B;  2YSF A;  1KFX L;  2M0R A;  4P2Y B;  2K7B A;  2ZQV A;  1K9P A;  5AAN A;  3KEV A;  2PRU A;  2O60 A;  1D1O A;  1NWD A;  1QV1 A;  5B8I B;  5FI2 A;  1NCX A;  2WCF A;  5E66 A;  2ZAJ A;  4HRH A;  2PSR A;  4INW A;  3BFB A;  1QWV A;  1IG5 A;  2QEB A;  1JF2 A;  1RRO A;  4GBA A;  4NDD A;  1K2H A;  2BCB A;  3B7A A;  3CNG A;  4NQG A;  2ZR5 A;  2H61 C;  1QX5 B;  1AVS A;  1Z2C B;  1SR6 C;  2EHB A;  2M1U A;  4BY5 A;  5I8N A;  1ORG A;  1QXP A;  1KSM A;  4F0Z B;  3VRP A;  1IGV A;  4HRG A;  2FJU B;  1SSE B;  1N0Y A;  2M8I A;  4M2Q A;  1S5G Y;  2WC8 A;  2L5Y A;  1Q80 A;  2LAJ A;  2BL0 C;  1DT7 B;  1H8B A;  4C0K A;  4DCK A;  1YX7 A;  5FYX A;  4M2O A;  4JQ0 D;  5CQ2 A;  1A03 A;  2LVK A;  2JZI A;  1OSA A;  1NSH A;  3SG2 A;  1UHI A;  1MR8 A;  2K7O A;  1BOC A;  1IWQ A;  2F3Z A;  1SK6 D;  2HQ8 A;  4YGE B;  3R1O A;  3AAJ A;  2WCB A;  1PRW A;  1IH0 A;  2K0J A;  3MCB B;  2OWO A;  2KBM A;  1ALV A;  3IQQ A;  3EVR A;  2CT9 A;  4PE4 A;  3VRR A;  1GGZ A;  2PYQ A;  1B4C A;  1SPY A;  2LLT A;  5E65 A;  1GM0 A;  3OB2 B;  4QJ4 B;  2K60 A;  3Q8I A;  1IJ5 A;  1NX3 A;  3I5H C;  4MVF A;  4DIR A;  3BOW B;  2XP5 A;  2LLU A;  3IQO A;  1SCM B;  3EK7 A;  2M8U A;  1A29 A;  1SR6 B;  1RWY A;  1KWO C;  2LAN A;  2LC5 A;  2QEH A;  4D1E A;  3WHU B;  1MXE A;  1REC A;  1U5I B;  1I5H W;  1TK7 A;  1GQM A;  4YBH B;  1DMO A;  1EL4 A;  5HLV A;  1XVJ A;  1B1G A;  2B1U A;  2DK7 A;  2L4H A;  2JOJ A;  3FWB A;  3N7H A;  4OV2 A;  4P5O E;  1A75 B;  2R2I A;  4ORA B;  3NTP A;  1N2D A;  4U86 A;  1TR8 A;  4YGD B;  2TN4 A;  1CKK A;  1GJY A;  3FE9 A;  2MJW B;  2M29 A;  1CDN A;  3AAK A;  1TRF A;  2KFH A;  1K94 A;  3FS7 A;  1WLZ A;  1DC1 A;  2JRF A;  1FI5 A;  5FI7 A;  1JFJ A;  1KQV A;  1Y1X A;  2Q91 A;  1S36 A;  2KHN A;  2DMV A;  3JVT C;  3TDB A;  1TWO A;  2XP6 A;  2NCO A;  3EVV A;  1V1G A;  3E3R A;  3ZWH A;  4YI8 A;  1BMO A;  1B8L A;  3SG4 A;  3TUY C;  3BOW A;  2OTG B;  2GGZ A;  4PE1 A;  2CTN A;  1CB1 A;  2JX8 A;  1DJG A;  1KFU S;  1XA5 A;  1F8A B;  3I5I C;  3L47 A;  1RP5 A;  3SS5 A;  2KI6 D;  1WRZ A;  4YGB B;  5KTY A;  3OX6 A;  1TUJ A;  3PFV A;  1SBJ A;  1SW8 A;  3D10 A;  4ICB A;  1U5I A;  2ZNE A;  5D3O A;  3NSL A;  1V1F A;  4AQJ A;  5J3X A;  3JTD C;  1NYA A;  4E68 A;  2K8M B;  2LHL A;  2OS8 C;  3B88 A;  5EL2 A;  1CLM A;  5G08 A;  2I18 A;  1OQP A;  2KLD A;  1AUI B;  1TNW A;  2QEO A;  1JBA A;  1JFK A;  3DXL A;  2Q5A A;  2JXW A;  2EC6 C;  1A75 A;  2LUX A;  1TNX A;  2L51 A;  4MZK A;  1CDP A;  3LCP C;  5IBW A;  2EGD A;  1TOP A;  2CXJ A;  4PCW A;  2ZQS A;  1WY9 A;  3DVE A;  2L5X B;  1CFC A;  1XYD A;  1OOJ A;  2PQL A;  1EG3 A;  3O4X A;  1JMQ A;  2COL B;  4MZJ A;  2YSB A;  2F33 A;  2F2P A;  2LLS A;  3GK4 X;  2LMV A;  1YW5 A;  3NSI A;  1OW4 A;  1NX0 A;  1Y0V H;  4A4C A;  4XJK B;  1QV0 A;  1S6C A;  5CSI A;  1TNP A;  3CLN A;  3I5I B;  1LA3 A;  2MLF C;  3DD4 A;  2BCA A;  5E62 A;  1CM4 A;  1K9U A;  4GPL B;  3QME A;  4I5J A;  4MRX A;  1BU3 A;  2BAP A;  2H8V A;  3PM8 A;  3FSB A;  2QAC A;  1CFD A;  4I5N B;  3KAF A;  2YSG A;  2IS9 A;  1PSR A;  2OS8 B;  1FW4 A;  1C07 A;  1BJF A;  1XFR A;  1KFX S;  3LE4 A;  1UUR A;  4PT1 A;  2FJY A;  3SIB A;  3EG5 B;  4PHM A;  1FPW A;  3WNX B;  1YVH A;  3B6X A;  1CMF A;  3FSC A;  3GK1 A;  1JSA A;  3DVK A;  3M0W A;  1K90 D;  1MUX A;  4MRY A;  1AP4 A;  2ZQU A;  2LMT A;  1DGU A;  3CZ1 A;  1F4Q A;  2JPT A;  3EKJ A;  4MBE A;  1OMD A;  1HQV A;  1M31 A;  2KSP A;  1F8H A;  2BEC A;  2WCK A;  3NSK A;  1JF0 A;  2JNX A;  3HCM A;  3S0F A;  1NMV A;  4GLX A;  2A4J A;  3S0D A;  1FF1 A;  2E45 A;  3LLE A;  1YR5 A;  2WAE A;  1CDM A;  2PAS A;  2KXQ A;  2KLE A;  2KFG A;  2M8J A;  2D8N A;  1SCM C;  3L4L A;  3IF7 A;  1MQ1 A;  2M1K B;  4GGF A;  2JTT A;  4AOM A;  2BE6 A;  3BUW B;  4QJ3 B;  4U84 A;  2F8P A;  4PHN A;  4XJK A;  2GGM A;  4WQ3 A;  1TUZ A;  1DJH A;  1RTP 1;  1TCO B;  3BQ3 A;  5CSF A;  1S6J A;  2K61 A;  4MSP A;  1IKU A;  3BFH A;  5F6T A;  2KI6 C;  3CAB A;  2JU0 A;  1LXF C;  3GK2 A;  1NX1 A;  2OPO A;  1ALW A;  1H4B A;  1NP8 A;  1FBV A;  2DOQ A;  2WC6 A;  2MRD A;  3CYZ A;  4L9M A;  1SL8 A;  1TIZ A;  1C3Z A;  3LK0 A;  2L98 A;  1EG4 A;  2LVJ A;  3MSE B;  2ZR6 A;  3KAG A;  3CTN A;  2EZ5 W;  2CCM A;  1UHH A;  3PN7 B;  2XPA A;  2JT3 A;  3LK1 A;  4I5K A;  1IQ5 A;  1HT9 A;  4WQ2 A;  1WDC B;  2ZKM X;  1MWN A;  2M3O W;  1YUT A;  3TS5 B;  1BR4 B;  2FCE A;  5HYD A;  4GFT A;  1AJ5 A;  1DJX A;  3AKA A;  3NHT A;  3IVT A;  1UWO A;  1C3Y A;  1J55 A;  1PUL A;  1QVI Z;  1J1E A;  4IJ7 A;  1WRL A;  1LS8 A;  2BA1 A;  4I5L B;  4PHK A;  1VRK A;  3ODK A;  1QLS A;  3CR2 A;  1SCV A;  3EK4 A;  3PJI A;  4PAL A;  2KYF A;  3WXA A;  3D73 A;  5ER4 X;  1M45 A;  4YGC B;  1DJY A;  2OTG C;  3TDZ A;  1G33 A;  1QIV A;  1BG1 A;  1EH2 A;  4ETO A;  1YUU A;  2BKH B;  2MHH A;  2NZ0 A;  3KPX A;  1Z4H A;  5K89 A;  1RK9 A;  2M7N A;  4NDC A;  3O4Y A;  1NX2 A;  1B8C A;  2AMI A;  1TTX A;  2G2B A;  3HX4 A;  3I5F B;  4GUK A;  1OZO A;  3DF0 B;  1S6I A;  1BR1 B;  2JUL A;  3UO9 A;  3SG3 A;  4JD9 A;  1SL9 A;  1RFJ A;  3V2L A;  4GNK B;  3SS4 A;  2LHI A;  2NCP A;  4CLN A;  1LA0 A;  2L4I A;  2KBI A;  1IJ6 A;  1NIW A;  1OMV A;  4CFQ A;  1QVI Y;  1G8I A;  2WCM A;  1T14 A;  3MQH A;  1J1D A;  1TCF A;  2KAY A;  1OMR A;  1EJ3 A;  2LUC A;  1JUO A;  4GGF C;  1SYM A;  2KNE A;  4OKH A;  5DIC A;  1JC2 A;  1W7J B;  3DYE A;  2L2E A;  3D78 A;  4YGA A;  1ZUZ A;  3L4A A;  5FI6 A;  2HQW A;  2LNK A;  5I2L A;  3DVM A;  2YSI A;  1OOF A;  2NXQ A;  2KDH A;  1QLK A;  1M63 B;  3D76 A;  3FE8 A;  4UPG A;  5I2Q A;  2KOT A;  1GGW A;  3TDI A;  2ZN8 A;  3PAL A;  4GGN A;  2JV4 A;  3S0A A;  5TNC A;  2O5G A;  1S3P A;  4PE0 A;  1J7R A;  3TDU A;  4A0T A;  2KGB C;  2JWW A;  1DJI A;  1XFZ O;  3OBV A;  1KQM C;  1SY9 A;  1YVL A;  3H4S E;  1C7W A;  1UHJ A;  3DF0 A;  3BYA A;  3OB1 B;  3DZT A;  4CFR A;  2F2O A;  2QPT A;  4PHJ A;  3D77 A;  4M2P A;  3FWC A;  4R1E A;  2MDI A;  3WH0 A;  4QJ5 B;  1QIW A;  3D74 A;  1QX2 A;  3R1P A;  1UHN A;  4ZCV A;  2I7A A;  5KSZ A;  2L2C A;  1Y1U A;  1DVI A;  1K96 A;  1EXR A;  3R72 A;  1YRU B;  1BF5 A;  1M46 A;  1QTX A;  2WAD A;  5E64 A;  4MN0 A;  4OCI A;  1ZFS A;  2GV5 A;  2ZQT A;  2Q4U A;  1DJZ A;  1K95 A;  2WOS A;  3SG6 A;  1SNL A;  1CMG A;  2LVV A;  3I5G B;  1L2O B;  2WC5 A;  3UNW A;  2JC2 A;  1BT6 A;  3VRN A;  5DKQ A;  1Y6W A;  4N5X A;  4U85 A;  3CZ2 A;  1B47 A;  1TN4 A;  3K1E A;  3PLF B;  2RE3 A;  2XP8 A;  4N1G A;  5KU1 A;  2HET A;  1F4O A;  2WCE A;  3QRX A;  4OR9 B;  1KQM B;  1C7V A;  4KYN A;  2PMY A;  3PM2 A;  2E30 A;  2BNX A;  3OP0 A;  2K7D A;  4FQO A;  1LKJ A;  2LCP A;  2HPS A;  2QEV A;  3PN7 C;  1OOI X;  5U47 A;  3CS1 A;  3NXA A;  5AER A;  2I94 A;  1WDC C;  2MBX A;  3A8R A;  2KQ6 A;  3TS5 C;  1K8U A;  4OZD A;  5HKW A;  3EKH A;  1ZMZ A;  5DKR A;  2ZRS A;  2BE4 A;  2YGU A;  1IQ3 A;  4IL1 A;  3KAI A;  2JT0 A;  5ER5 A;  2DWV A;  3VGO A;  4JWQ A;  2L4J A;  3PSR A;  3SG5 A;  3BUN B;  3BXK A;  2JPO A;  1IIO A;  1S1E A;  1DTL A;  3GOF A;  2WCH A;  1OZS A;  5PAL A;  1IRJ A;  3RZS A;  1YRT B;  2BCX A;  1KCY A;  2I2R E;  3M85 A;  3ICB A;  1F71 A;  2MAZ A;  2P6B B;  1Y1A A;  4N1F A;  1ZAC A;  3OHM B;  2KI4 C;  3OX5 A;  1CFP A;  1A2X A;  1DGV A;  3VB1 A;  2ZRT A;  1DF0 A;  3VRO A;  3EK8 A;  3PQH A;  5HLO A;  3I5F C;  1KK7 Y;  1PAL A;  1PVA A;  2XP9 A;  3O78 A;  1CFF A;  1CM1 A;  1XK4 A;  2V53 A;  3CGA A;  5CPV A;  5CSJ A;  1FI6 A;  1NUB A;  2JXC A;  1XO5 A;  1P28 A;  2CNP A;  2PAL A;  4HRE E;  3TCZ A;  2HF5 A;  5AFP A;  3B86 A;  2LE9 B;  4INX A;  5HKZ A;  2YAJ B;  2K2A A;  2ZFD A;  2LV7 A;  1YTZ C;  1NPQ A;  2GTE A;  1XFX O;  1KK8 B;  1ODB A;  3OGN A;  2LAP A;  4JPZ B;  4E5R A;  4QIB A;  4PDZ A;  4NDB A;  2H2K A;  3BUX B;  4DRW A;  2K2F A;  1OOH A;  3C1V A;  5CSN A;  4F7F A;  3WHT B;  1ZCN A;  2BBM A;  1L7Z A;  4REX A;  1WMV A;  1B7T Z;  4ZCU A;  2M9G A;  2E6W A;  3RLZ A;  4USL A;  2LMU A;  2KI4 B;  3S0B A;  3D75 A;  5I2O A;  2LP3 A;  4HSZ A;  5HKY A;  1J7P A;  3KCE A;  2SAS A;  3KO0 A;  2L0P A;  4PE7 A;  5D7F A;  1X02 A;  3EVU A;  2Y8N B;  3D0Y A;  2JXL A;  1DJW A;  3LL8 B;  2Y5I A;  2LM5 A; 
#chains in the Genus database with same CATH homology
 3PAT A;  1MF8 B;  1N65 A;  1UP5 A;  2AAO A;  4ORC B;  1AK8 A;  1PSB A;  1AHR A;  4Q04 A;  5D69 A;  3CR5 X;  1WRK A;  5JJG A;  2DK1 A;  2SCP A;  1K9Q A;  1QS7 A;  2BL0 B;  1CNP A;  3NSO A;  2FOT A;  1AJ4 A;  2AUC A;  1K9R A;  3CR4 X;  3CWG A;  4U8D A;  3K21 A;  2ZR4 A;  2LVI A;  1YUS A;  2JTZ A;  2VRG A;  1QX7 A;  3BUO B;  2G9B A;  5GQQ C;  5BPJ A;  1LIN A;  3KAB A;  5AHT A;  1B7T Y;  2M97 A;  4A0U A;  3O2P A;  2LP2 A;  4ORB B;  4WRI A;  3LKX B;  3I5G C;  1L2O C;  1OE9 B;  1B9A A;  1R6P A;  1CDL A;  3SJS A;  4CID A;  4OVN F;  2DJY A;  3RM1 A;  3TZ1 A;  1K9K A;  2F3Y A;  2JQ6 A;  3I5H B;  3FIA A;  1PK0 D;  1UUS A;  5DKN A;  3MCB A;  1ZOT B;  3F45 A;  5AXI A;  3KHE A;  2RGI A;  1XK4 C;  4BY4 A;  1J7O A;  1KWO B;  3KAH A;  1MXL C;  2KFF A;  2Y4Q A;  3DVJ A;  2Y1M A;  5JOL A;  2MLE C;  4MEW A;  1SRA A;  2H61 A;  2ZN9 A;  2M7L A;  1WLM A;  2QRV A;  3TC5 A;  1RJV A;  1SMG A;  2ZND A;  2M49 B;  1YX8 A;  1A4P A;  1MHO A;  2KYC A;  4C0J A;  2YSH A;  1CTR A;  1J7Q A;  2KGR A;  1XFU O;  4MZL A;  2ITK A;  1KFU L;  2WND A;  4C0L A;  1F54 A;  4AQI A;  1K93 D;  4DUQ A;  2KAV A;  2JT8 A;  2M3W A;  3CZT X;  2Y1N A;  4FTG A;  4MLW A;  1PIN A;  2JMF A;  1QAS A;  4GAO A;  1DF0 B;  5AEQ A;  4DS7 A;  3A4U B;  1CLB A;  3VRQ A;  3LKX A;  3ZNI A;  3SG7 A;  3JVT B;  2KQY A;  2MA2 A;  1PVB A;  1CLL A;  2WOR A;  1M39 A;  2BKI B;  1LVC D;  1O6W A;  3L4H A;  2PVB A;  1UHK A;  1B8R A;  1KK7 Z;  3TUY B;  3KAD A;  4YI9 A;  2XP7 A;  2BBN A;  2JNF A;  1WR7 A;  2K7C A;  4A4B A;  2FCD A;  1G4Y R;  1BLQ A;  2XP4 A;  2L50 A;  1YUR A;  1XFY O;  2F21 A;  2CBL A;  1SKT A;  1W7I B;  1R2U A;  1XFW O;  1KSO A;  3SIA A;  3OOB A;  3JTD B;  1BOD A;  3FS8 A;  4XYN A;  1S5G Z;  2NLN A;  1KK8 C;  4YRU A;  1QAT A;  3AKB A;  3M7N A;  1TNQ A;  4TNC A;  2KAX A;  1NCZ A;  2EC6 B;  1F70 A;  1SL7 A;  1XFV O;  4CPV A;  1F55 A;  3BUM B;  1JWD A;  3O6B A;  5E5W A;  1E8A A;  3KF9 A;  1FLC A;  2XPB A;  3MQG A;  1S26 D;  2XP3 A;  1QJT A;  2ISD A;  1NCY A;  3D0Y B;  2YSF A;  1KFX L;  2M0R A;  4P2Y B;  2K7B A;  2ZQV A;  1K9P A;  5AAN A;  3KEV A;  2PRU A;  2O60 A;  1D1O A;  1NWD A;  1QV1 A;  5B8I B;  1NCX A;  2WCF A;  5E66 A;  2ZAJ A;  4HRH A;  2PSR A;  1K2H A;  2YSB A;  1IG5 A;  1JF2 A;  1RRO A;  4GBA A;  4NDD A;  2BCB A;  3CNG A;  4NQG A;  2ZR5 A;  2H61 C;  1QX5 B;  1AVS A;  2EHB A;  1SR6 C;  4BY5 A;  2M1U A;  5I8N A;  1QXP A;  1KSM A;  4F0Z B;  3VRP A;  1IGV A;  4HRG A;  2FJU B;  1N0Y A;  2M8I A;  4M2Q A;  1S5G Y;  2WC8 A;  1Q80 A;  2LAJ A;  2BL0 C;  1DT7 B;  1H8B A;  4C0K A;  4DCK A;  1YX7 A;  5FYX A;  4M2O A;  4JQ0 D;  5CQ2 A;  1A03 A;  2LVK A;  2JZI A;  1OSA A;  1NSH A;  3SG2 A;  1UHI A;  1MR8 A;  2K7O A;  1BOC A;  1IWQ A;  2F3Z A;  1SK6 D;  2HQ8 A;  4YGE B;  3AAJ A;  2WCB A;  1PRW A;  1IH0 A;  2K0J A;  3MCB B;  2OWO A;  2KBM A;  1ALV A;  3IQQ A;  3EVR A;  2CT9 A;  4PE4 A;  3VRR A;  1GGZ A;  1B4C A;  1SPY A;  2LLT A;  5E65 A;  3OB2 B;  4QJ4 B;  1IJ5 A;  1NX3 A;  3I5H C;  4MVF A;  4DIR A;  3BOW B;  2XP5 A;  2LLU A;  3IQO A;  1SCM B;  3EK7 A;  2M8U A;  1A29 A;  1SR6 B;  1RWY A;  1KWO C;  2LAN A;  2LC5 A;  4D1E A;  3WHU B;  1MXE A;  1REC A;  1U5I B;  1I5H W;  1TK7 A;  1GQM A;  4YBH B;  1DMO A;  1EL4 A;  5HLV A;  1XVJ A;  1B1G A;  2B1U A;  2DK7 A;  2L4H A;  2JOJ A;  3FWB A;  4OV2 A;  4P5O E;  1A75 B;  2R2I A;  4ORA B;  3NTP A;  1N2D A;  4U86 A;  1TR8 A;  4YGD B;  2TN4 A;  1CKK A;  1GJY A;  2MJW B;  2M29 A;  1CDN A;  3AAK A;  1TRF A;  2KFH A;  1K94 A;  3FS7 A;  1WLZ A;  1FI5 A;  2JRF A;  1KQV A;  1JFJ A;  1Y1X A;  2Q91 A;  1S36 A;  2KHN A;  2DMV A;  3JVT C;  3TDB A;  2XP6 A;  2NCO A;  3EVV A;  1V1G A;  3E3R A;  3ZWH A;  4YI8 A;  1BMO A;  1B8L A;  3SG4 A;  3TUY C;  3BOW A;  2OTG B;  2GGZ A;  4PE1 A;  2CTN A;  1CB1 A;  2JX8 A;  1DJG A;  1KFU S;  1XA5 A;  1F8A B;  3I5I C;  1RP5 A;  2KI6 D;  1WRZ A;  4YGB B;  5KTY A;  3OX6 A;  3PFV A;  1SBJ A;  1SW8 A;  3D10 A;  4ICB A;  1U5I A;  2ZNE A;  4AQJ A;  3NSL A;  1V1F A;  5J3X A;  3JTD C;  1NYA A;  4E68 A;  2K8M B;  2LHL A;  2OS8 C;  5G08 A;  1CLM A;  2I18 A;  1OQP A;  1JBA A;  1AUI B;  1TNW A;  1JFK A;  2Q5A A;  2JXW A;  2EC6 C;  1A75 A;  2LUX A;  1TNX A;  2L51 A;  4MZK A;  1CDP A;  3LCP C;  5IBW A;  2EGD A;  1TOP A;  2CXJ A;  4PCW A;  2ZQS A;  1WY9 A;  3DVE A;  2L5X B;  1CFC A;  1XYD A;  1OOJ A;  1EG3 A;  1JMQ A;  2COL B;  4MZJ A;  2F33 A;  2F2P A;  2LLS A;  3GK4 X;  2LMV A;  1YW5 A;  3NSI A;  1NX0 A;  1Y0V H;  4A4C A;  4XJK B;  1QV0 A;  1S6C A;  5CSI A;  1TNP A;  3CLN A;  3I5I B;  1LA3 A;  2MLF C;  3DD4 A;  2BCA A;  5E62 A;  1CM4 A;  1K9U A;  4GPL B;  4I5J A;  4MRX A;  1BU3 A;  3PM8 A;  3FSB A;  2QAC A;  1CFD A;  4I5N B;  3KAF A;  2YSG A;  2IS9 A;  1PSR A;  2OS8 B;  1FW4 A;  1C07 A;  1BJF A;  1KFX S;  3LE4 A;  1UUR A;  3SIB A;  4PHM A;  1FPW A;  3WNX B;  1YVH A;  1CMF A;  3FSC A;  3GK1 A;  1JSA A;  3DVK A;  3M0W A;  1K90 D;  1MUX A;  4MRY A;  1AP4 A;  2ZQU A;  2LMT A;  1DGU A;  1F4Q A;  2JPT A;  3EKJ A;  4MBE A;  1OMD A;  1HQV A;  1M31 A;  2KSP A;  1F8H A;  2BEC A;  3NSK A;  1JF0 A;  2JNX A;  3HCM A;  1NMV A;  4GLX A;  2A4J A;  1FF1 A;  2E45 A;  3LLE A;  1YR5 A;  2WAE A;  1CDM A;  2PAS A;  2KXQ A;  2KFG A;  2M8J A;  2D8N A;  1SCM C;  3IF7 A;  1MQ1 A;  2M1K B;  4GGF A;  2JTT A;  4AOM A;  2BE6 A;  3BUW B;  4QJ3 B;  4U84 A;  2F8P A;  4PHN A;  4XJK A;  2GGM A;  4WQ3 A;  5CSF A;  1DJH A;  1RTP 1;  1TCO B;  3BQ3 A;  1IKU A;  1S6J A;  2K61 A;  4MSP A;  5F6T A;  2KI6 C;  2JU0 A;  1LXF C;  3GK2 A;  1NX1 A;  2OPO A;  1ALW A;  1H4B A;  1NP8 A;  1FBV A;  2DOQ A;  2MRD A;  4L9M A;  1SL8 A;  1TIZ A;  3LK0 A;  2L98 A;  1EG4 A;  2LVJ A;  3MSE B;  2ZR6 A;  3KAG A;  3CTN A;  2EZ5 W;  2CCM A;  1UHH A;  3PN7 B;  2XPA A;  2JT3 A;  3LK1 A;  4I5K A;  1IQ5 A;  1HT9 A;  4WQ2 A;  1WDC B;  2ZKM X;  1MWN A;  2M3O W;  1YUT A;  3TS5 B;  1BR4 B;  2FCE A;  5HYD A;  4GFT A;  1AJ5 A;  1DJX A;  3AKA A;  1UWO A;  1J55 A;  1PUL A;  1QVI Z;  1J1E A;  2BA1 A;  1WRL A;  4I5L B;  4PHK A;  1VRK A;  3ODK A;  1QLS A;  3CR2 A;  1SCV A;  3EK4 A;  4PAL A;  2KYF A;  3WXA A;  5ER4 X;  1M45 A;  4YGC B;  1DJY A;  2OTG C;  3TDZ A;  1G33 A;  1QIV A;  1BG1 A;  1EH2 A;  4ETO A;  1YUU A;  2BKH B;  2MHH A;  2NZ0 A;  3KPX A;  5K89 A;  1RK9 A;  2M7N A;  4NDC A;  3O4Y A;  1NX2 A;  1B8C A;  2AMI A;  1TTX A;  2G2B A;  3HX4 A;  3I5F B;  4GUK A;  1OZO A;  3DF0 B;  1S6I A;  1BR1 B;  2JUL A;  3SG3 A;  1SL9 A;  1RFJ A;  4GNK B;  2LHI A;  2NCP A;  4CLN A;  1LA0 A;  2L4I A;  2KBI A;  1IJ6 A;  1NIW A;  1OMV A;  4CFQ A;  1QVI Y;  1G8I A;  3MQH A;  1J1D A;  1TCF A;  2KAY A;  1OMR A;  1EJ3 A;  2LUC A;  1JUO A;  4GGF C;  1SYM A;  2KNE A;  4OKH A;  1JC2 A;  1W7J B;  2L2E A;  4YGA A;  1ZUZ A;  5I2L A;  2HQW A;  2LNK A;  3DVM A;  2YSI A;  2NXQ A;  2KDH A;  1QLK A;  1M63 B;  4UPG A;  5I2Q A;  2KOT A;  1GGW A;  3TDI A;  2ZN8 A;  3PAL A;  4GGN A;  2JV4 A;  5TNC A;  2O5G A;  1S3P A;  4PE0 A;  1J7R A;  3TDU A;  4A0T A;  2KGB C;  2JWW A;  1DJI A;  1XFZ O;  1KQM C;  1SY9 A;  1YVL A;  3H4S E;  1C7W A;  1UHJ A;  3DF0 A;  3BYA A;  3OB1 B;  4CFR A;  2F2O A;  2QPT A;  4PHJ A;  4M2P A;  3FWC A;  4R1E A;  2MDI A;  3WH0 A;  4QJ5 B;  1QIW A;  1QX2 A;  1UHN A;  4ZCV A;  2I7A A;  5KSZ A;  1Y1U A;  1DVI A;  1K96 A;  1EXR A;  1YRU B;  1BF5 A;  1M46 A;  1QTX A;  2WAD A;  5E64 A;  4MN0 A;  4OCI A;  1ZFS A;  2GV5 A;  2ZQT A;  2Q4U A;  1DJZ A;  1K95 A;  2WOS A;  3SG6 A;  1SNL A;  1CMG A;  2LVV A;  3I5G B;  1L2O B;  2JC2 A;  1BT6 A;  3VRN A;  5DKQ A;  1Y6W A;  4N5X A;  4U85 A;  1B47 A;  1TN4 A;  3PLF B;  2RE3 A;  2XP8 A;  4N1G A;  5KU1 A;  2HET A;  1F4O A;  2WCE A;  3QRX A;  4OR9 B;  1KQM B;  1C7V A;  2PMY A;  2E30 A;  3OP0 A;  2K7D A;  4FQO A;  1LKJ A;  2LCP A;  2HPS A;  3PN7 C;  5U47 A;  3CS1 A;  3NXA A;  5AER A;  2I94 A;  1WDC C;  2MBX A;  3A8R A;  2KQ6 A;  3TS5 C;  1K8U A;  5HKW A;  3EKH A;  1ZMZ A;  5DKR A;  2ZRS A;  2BE4 A;  1IQ3 A;  3KAI A;  4IL1 A;  2JT0 A;  5ER5 A;  2DWV A;  3VGO A;  4JWQ A;  2L4J A;  3PSR A;  3SG5 A;  3BUN B;  3BXK A;  1S1E A;  1DTL A;  3GOF A;  1OZS A;  5PAL A;  1IRJ A;  1YRT B;  2BCX A;  1KCY A;  2I2R E;  3M85 A;  3ICB A;  1F71 A;  2MAZ A;  2P6B B;  1Y1A A;  4N1F A;  1ZAC A;  3OHM B;  2KI4 C;  3OX5 A;  1CFP A;  1A2X A;  1DGV A;  2ZRT A;  1DF0 A;  3VRO A;  3EK8 A;  3PQH A;  5HLO A;  3I5F C;  1KK7 Y;  1PAL A;  1PVA A;  2XP9 A;  3O78 A;  1CFF A;  1CM1 A;  1XK4 A;  2V53 A;  3CGA A;  5CPV A;  5CSJ A;  1FI6 A;  1NUB A;  2JXC A;  1XO5 A;  2CNP A;  2PAL A;  4HRE E;  3TCZ A;  2HF5 A;  5AFP A;  2LE9 B;  5HKZ A;  2YAJ B;  2K2A A;  2ZFD A;  2LV7 A;  1YTZ C;  1NPQ A;  1XFX O;  1KK8 B;  1ODB A;  2LAP A;  4JPZ B;  4E5R A;  4QIB A;  4PDZ A;  4NDB A;  2H2K A;  3BUX B;  4DRW A;  2K2F A;  3C1V A;  5CSN A;  3WHT B;  1ZCN A;  2BBM A;  1L7Z A;  4REX A;  1WMV A;  1B7T Z;  4ZCU A;  2M9G A;  2E6W A;  3RLZ A;  4USL A;  2LMU A;  2KI4 B;  5I2O A;  2LP3 A;  4HSZ A;  5HKY A;  1J7P A;  3KCE A;  2SAS A;  3KO0 A;  2L0P A;  4PE7 A;  5D7F A;  1X02 A;  3EVU A;  2Y8N B;  3D0Y A;  2JXL A;  1DJW A;  3LL8 B;  2Y5I A;  2LM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...