1EG4A

Structure of a dystrophin ww domain fragment in complex with a beta-dystroglycan peptide
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
260
structure length
260
Chain Sequence
PASQHFLSTSVQGPWERAISPNKVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords BETA-DYSTROGLYCAN
publication title Structure of a WW domain containing fragment of dystrophin in complex with beta-dystroglycan.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 260
sequence length 260
ec nomenclature
pdb deposition date 2000-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF09068 EF-hand_2 EF hand
A PF09069 EF-hand_3 EF-hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1eg4A03
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1eg4A04
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1eg4A01
1OQPA 4C0LA 2DOQA 1JF2A 2CTNA 3JVTC 2OS8C 3HCMA 3NSOA 2DK1A 1F71A 1TIZA 1SKTA 1DGUA 4MZJA 2ZRTA 3TUYB 2R2IA 2PVBA 1AP4A 3BUXB 2LMTA 1IGVA 2KGBC 5D69A 1KK8B 1MXLC 2HPSA 2LV7A 3LE4A 2KFHA 2G9BA 2B1UA 5I8NA 2KXQA 1B8RA 2NCOA 2I2RE 3FS7A 2DK7A 1SR6C 2WORA 4OCIA 2WCBA 4I5KA 1CFPA 4OKHA 1TN4A 2K61A 4MSPA 2TN4A 4IL1A 3LCPC 1BR1B 3NSIA 4CLNA 2GV5A 1XA5A 2ZN9A 1IJ5A 5JJGA 1OMVA 2AAOA 2K7CA 1PSBA 1Y1XA 4PE0A 1J7PA 1RTP1 1JFJA 1OMRA 2MAZA 2L51A 1C7VA 1XFXO 4JWQA 2GGMA 2NXQA 1B7TZ 5I2LA 3LK0A 1UHJA 3PN7C 4ORAB 2I94A 2LVKA 2KGRA 1J55A 1L2OC 1OMDA 1YRTB 2I18A 1NP8A 1N2DA 5AEQA 2JRFA 2AMIA 1RWYA 5KU1A 5KTYA 1K9RA 1DJYA 1WRZA 5TNCA 1KFUL 3GK1A 1ZFSA 1N0YA 3DVJA 2KFFA 2KYCA 2K0JA 2OTGB 4OR9B 3DVKA 5CSFA 3KEVA 2IS9A 2F3ZA 1XFUO 3GOFA 2PMYA 3BUMB 1UWOA 2L4HA 3D10A 1J7RA 2LVIA 1DMOA 2D8NA 4M2OA 2JWWA 4NQGA 1KFXL 1KSMA 2LHIA 4L9MA 4PHMA 2KAYA 2LC5A 5GQQC 2BKHB 2CNPA 3CGAA 2M3OW 2M9GA 2WCEA 4YI8A 1QIVA 1B8CA 1NX2A 2PRUA 3LL8B 3C1VA 1CDLA 1L7ZA 5AFPA 2KQ6A 2SASA 2HQWA 2K7DA 3CR5X 5HKZA 4MBEA 2PSRA 4QJ3B 1K9KA 2RE3A 3KAIA 1EG3A 1KCYA 2BE4A 1LVCD 1YTZC 1B47A 2M8UA 4XYNA 4MRXA 1C07A 4N1FA 1JWDA 2COLB 1AHRA 3EVVA 4AQJA 2JU0A 1FW4A 3NSLA 4AOMA 1CMFA 1Y1AA 2MJWB 4F0ZB 2ZRSA 3ZNIA 1AVSA 2KAVA 1F55A 2JT0A 1YW5A 4ORBB 2Q5AA 2MBXA 2WCFA 1H8BA 1K9PA 1TCOB 1UHKA 1SK6D 2JOJA 3I5GC 5J3XA 5KSZA 5ER5A 1KFUS 5JOLA 1NX0A 3L4HA 1EJ3A 1C7WA 1Y6WA 3OB2B 4WRIA 2KI6D 1KQMC 3TS5B 1I5HW 2ZQSA 2JC2A 2Q4UA 2BCBA 1UHHA 2Y5IA 2KBMA 1GGWA 1QX5B 1RFJA 1Y0VH 4ZCUA 1OE9B 2XP9A 1KFXS 4YI9A 1S6JA 2BBNA 1OZOA 1A2XA 2FOTA 4ZCVA 1QLSA 1R2UA 3AKBA 4PE4A 4M2QA 1K94A 2XPAA 1RROA 4MN0A 1XO5A 1PSRA 1UP5A 2E30A 3FWBA 3GK2A 1GGZA 1YVLA 2K8MB 4NDDA 1ODBA 2ZQTA 2FJUB 2F2OA 1PALA 2EC6C 2KHNA 1F4OA 3I5IC 5CSIA 1O6WA 3A8RA 1LXFC 1IKUA 1NMVA 2BE6A 1RK9A 2BA1A 5HKYA 1QXPA 2MRDA 1U5IA 2RGIA 1IG5A 1QJTA 1WLZA 2KI4B 3AAKA 3FWCA 2K7BA 3PSRA 2L4JA 4HSZA 1XYDA 3NXAA 1ALVA 2LLTA 3EKHA 2KYFA 4PHNA 4DRWA 1FPWA 1QVIZ 4N5XA 2F8PA 3EK4A 3FIAA 2JXLA 5PALA 3M7NA 1IRJA 1SCMB 1AUIB 1X02A 4FTGA 4AQIA 3EK8A 1QASA 3BOWA 3VRPA 1EL4A 2Y1NA 1XFWO 3SG6A 1A29A 1J7QA 5AANA 1B7TY 1XVJA 5BPJA 1OSAA 3TDUA 5AHTA 3ZWHA 5I2OA 1SY9A 2ISDA 4ORCB 3VRQA 2F21A 3OB1B 2LP3A 4PHKA 1BR4B 2L5XB 3LLEA 3WXAA 4P5OE 4JQ0D 2G2BA 1UHIA 1NCYA 1CMGA 2OTGC 4U86A 2ZAJA 1NSHA 1CNPA 3AKAA 5AERA 1F8HA 4ICBA 2XP5A 3OHMB 1PVAA 1S1EA 1K8UA 3OX5A 1BF5A 1TNWA 3O78A 4YGBB 2M97A 2LLUA 1YRUB 1YX8A 1YURA 2ZQUA 2JNXA 5B8IB 2JXCA 4YGCB 2DJYA 1WR7A 2ITKA 1J1EA 4OVNF 2ZR5A 3AAJA 4FQOA 2DMVA 1AK8A 1KQVA 2LAJA 3PM8A 2Q91A 2NCPA 4MEWA 2YSGA 3I5FB 1LA0A 4GUKA 2HF5A 1JFKA 2AUCA 2JTZA 3VRNA 1QLKA 4NDBA 1EH2A 2YSHA 3CR4X 2EHBA 3RLZA 4XJKA 5K89A 3WHTB 3JVTB 2M1KB 2OS8B 4U85A 1WDCC 1YR5A 4GAOA 2KAXA 4BY5A 3SIAA 4USLA 2PASA 1K95A 4MZKA 2M0RA 1TNPA 4PALA 1CFFA 4YGEB 3ODKA 1QX2A 5I2QA 1JSAA 3DVMA 3BQ3A 3EK7A 1CTRA 1SL8A 2LVVA 2ZKMX 2O5GA 1U5IB 1V1FA 2JZIA 1Q80A 1ZMZA 2QPTA 1KK7Z 1M31A 1ZACA 3JTDB 4CFRA 1A75A 1WMVA 5CSNA 2V53A 3SIBA 2CCMA 3M85A 1K9UA 1SR6B 2ZQVA 1YVHA 2KFGA 2BBMA 1JMQA 1K96A 1EG4A 3PALA 4MRYA 5CPVA 5HLVA 3WNXB 1S26D 2L2EA 3BOWB 4WQ3A 2K7OA 1QATA 3TDZA 1SYMA 1PULA 4YRUA 2M1UA 2MLFC 1MR8A 3KHEA 3I5HC 3SG2A 1BT6A 1KWOC 3PN7B 5CSJA 2NLNA 4JPZB 2JPTA 1TOPA 1G33A 1L2OB 2FCDA 1CDMA 1DF0A 1QV0A 2PALA 1JUOA 1J1DA 3EVUA 2LUCA 2OPOA 2H61C 2KNEA 3IQOA 2BL0C 2KI6C 2KOTA 2BKIB 4PE7A 4E5RA 1QVIY 1YUSA 2XP3A 1NCZA 3EKJA 1S3PA 1TNXA 4M2PA 1MF8B 2GGZA 4QJ4B 1MQ1A 1NX3A 1DTLA 1SRAA 1CFCA 1ZUZA 1FBVA 1YUTA 3TUYC 1SL7A 1IH0A 4CFQA 4C0KA 2YSBA 4ETOA 2FCEA 2LMVA 1KK8C 1S5GZ 2A4JA 4P2YB 1WRLA 1BJFA 2VRGA 1CB1A 1NPQA 4D1EA 1WRKA 4GGFC 1H4BA 4YBHB 3SJSA 2CT9A 1WLMA 1AJ4A 4N1GA 2ZFDA 3PATA 3RM1A 2YSIA 1GJYA 2MLEC 4I5NB 4PE1A 3SG7A 1JBAA 1F8AB 2NZ0A 3TCZA 2HQ8A 4XJKB 1TCFA 1CKKA 1M46A 1SPYA 2JTTA 2O60A 2WC8A 4WQ2A 2CXJA 2XP4A 1XFVO 1IQ5A 3CTNA 5ER4X 4DS7A 1RECA 1XFYO 2E6WA 2BCAA 2Y4QA 5D7FA 1DGVA 2JMFA 3PLFB 1V1GA 1DJHA 1XFZO 2JT8A 3WH0A 2LCPA 2LAPA 3OP0A 4A4BA 1QX7A 1CM1A 3I5GB 1ZCNA 1F4QA 3KAFA 1XK4C 1SBJA 1A75B 3SG4A 3SG5A 4C0JA 4DUQA 3I5FC 1CM4A 1KQMB 1YUUA 4HRGA 2XPBA 1UUSA 3TC5A 1FI5A 2KSPA 2LP2A 4DIRA 1SCVA 4HRHA 3CZTX 3O4YA 1W7JB 2LVJA 5G08A 4NDCA 3VGOA 4PDZA 4GPLB 3ICBA 4A4CA 3QRXA 1QIWA 5F6TA 3KAGA 1LA3A 4I5LB 1TTXA 3IQQA 4MVFA 1YX7A 2LNKA 1CLLA 3O2PA 1BG1A 2WOSA 1IJ6A 1DF0B 2EC6B 3A4UB 3I5IB 3JTDC 4BY4A 1CFDA 3OOBA 1KK7Y 1PINA 2JULA 2ZR4A 3MSEB 2LMUA 3F45A 2BECA 1NCXA 2ZNEA 5HKWA 1FF1A 2KDHA 2QACA 1F54A 2M8JA 2I7AA 1CLBA 1F70A 5FYXA 1Y1UA 1QV1A 4GGNA 4I5JA 3VROA 3BUNB 2JNFA 3KCEA 2EZ5W 1S6CA 2K2FA 1S6IA 1M63B 4GFTA 3TZ1A 1CLMA 2JQ6A 2JT3A 3M0WA 3OX6A 1BLQA 2YSFA 1IWQA 5CQ2A 3TS5C 1K93D 3SG3A 1E8AA 1RJVA 2ZN8A 1KSOA 1PK0D 3CWGA 1QTXA 4OV2A 1DT7B 1BOCA 1BODA 4U84A 4CIDA 3DF0A 3DD4A 4E68A 1DJXA 1DJIA 3NSKA 5HLOA 1J7OA 2H61A 2ZNDA 3GK4X 2EGDA 2M3WA 1MHOA 3D0YA 1A4PA 1R6PA 1TRFA 2BCXA 4PCWA 1DJGA 1A03A 1FI6A 1B9AA 2M29A 2DWVA 3H4SE 1S5GY 2F2PA 1SNLA 3EVRA 1MUXA 1DJWA 2H2KA 2M7NA 3DVEA 3NTPA 4QIBA 2LM5A 3E3RA 4TNCA 1JF0A 4R1EA 4U8DA 3VRRA 1NWDA 4DCKA 2KI4C 1K90D 3WHUB 3KABA 1ALWA 1W7IB 4GGFA 1UHNA 3HX4A 1IQ3A 2LUXA 1UURA 1MXEA 5IBWA 1D1OA 5DKQA 1SCMC 2P6BB 1CDNA 1B8LA 3LK1A 1NYAA 2KQYA 1MWNA 5DKNA 1QS7A 1B1GA 1NUBA 1B4CA 4CPVA 4HREE 4QJ5B 4UPGA 1TNQA 3BYAA 1WDCB 3IF7A 2JX8A 2L98A 5AXIA 2SCPA 1OZSA 3PFVA 5HYDA 3CR2A 1BU3A 2M49B 3CS1A 1NIWA 3KADA 3TDBA 1CDPA 1DJZA 3BXKA 1G4YR 2M7LA 3CLNA 2E45A 1LKJA 1SL9A 1SMGA 1WY9A 2MA2A 3KF9A 1XK4A 1PRWA 4YGDB 1LINA 2WNDA 2LHLA 3BUOB 3TDIA 2F33A 2LE9B 4Q04A 1N65A 1NX1A 1OOJA 1VRKA 1ZOTB 1G8IA 2F3YA 2MHHA 3O6BA 2LANA 2L4IA 2MDIA 2XP8A 1EXRA 1TK7A 3KAHA 2JV4A 1K9QA 1GQMA 1SW8A 1HT9A 1HQVA 1S36A 5DKRA 1AJ5A 4MZLA 2JXWA 2XP6A 4GNKB 2LLSA 2Y1MA 2L50A 3I5HB 3K21A 3BUWB 1KWOB 2M8IA 2ZR6A 3CNGA 4PHJA 2CBLA 4YGAA 3DF0B 1K2HA 2L0PA 4GBAA 4MLWA 2XP7A 2K2AA 3KO0A 2KBIA 1M39A 1PVBA 1BMOA 2HETA 2BL0B 1M45A 3D0YB 1JC2A 1DVIA 3KPXA 4REXA
chains in the Genus database with same CATH superfamily
1OQPA 4C0LA 1BG1A 2DOQA 1JF2A 2CTNA 3JVTC 2OS8C 3HCMA 3NSOA 2DK1A 1F71A 1TIZA 4GLXA 1SKTA 1DGUA 4MZJA 2ZRTA 3TUYB 2KPHA 2R2IA 2PVBA 5FI7A 1AP4A 3BUXB 2LMTA 1IGVA 2KGBC 5D69A 1KK8B 1MXLC 2HPSA 2LV7A 3LE4A 2KFHA 2G9BA 2B1UA 5I8NA 2KXQA 1B8RA 3D73A 3MQGA 2NCOA 2I2RE 3FS7A 2DK7A 1SR6C 2WORA 4OCIA 2WCBA 4I5KA 1CFPA 4OKHA 1TN4A 2K61A 4MSPA 2TN4A 4IL1A 3LCPC 1BR1B 3NSIA 4CLNA 4INWA 2GV5A 1XA5A 2ZN9A 1IJ5A 5JJGA 1OMVA 2AAOA 2K7CA 1PSBA 1Y1XA 4PE0A 1J7PA 1RTP1 1JFJA 1OMRA 2MAZA 2L51A 1C7VA 1OOIX 1XFXO 4JWQA 2GGMA 2NXQA 1B7TZ 5I2LA 3LK0A 1UHJA 3PN7C 4ORAB 2I94A 2LVKA 2KGRA 1J55A 1T14A 3Q8IA 1L2OC 1OMDA 1YRTB 2I18A 1NP8A 1N2DA 1DEKA 5AEQA 2JRFA 2AMIA 1RWYA 3FE6A 5KU1A 5KTYA 1DJYA 1K9RA 3R1PA 1WRZA 5TNCA 3NHTA 1KFUL 3GK1A 1ZFSA 1N0YA 3DVJA 2KFFA 2KYCA 2K0JA 2OTGB 4OR9B 3DVKA 5CSFA 3KEVA 3LKXB 2IS9A 2F3ZA 2QEVA 1XFUO 3GOFA 2PMYA 3BUMB 1UWOA 2L4HA 3D10A 1J7RA 2LVIA 1DMOA 2D8NA 4M2OA 2JWWA 3L4AA 4NQGA 1KFXL 1KSMA 2LHIA 1XFRA 4L9MA 2KAYA 2LC5A 4PHMA 3L47A 1OOGA 5GQQC 2BKHB 2CNPA 3CGAA 2M3OW 2M9GA 2WCEA 4YI8A 1QIVA 1B8CA 1NX2A 2PRUA 3LL8B 3C1VA 1CDLA 1L7ZA 5AFPA 2KQ6A 2SASA 2HQWA 2K7DA 3CR5X 3CZ0A 5HKZA 4MBEA 2PSRA 4QJ3B 1K9KA 3KPXA 2RE3A 3KAIA 1EG3A 1KCYA 2BE4A 1LVCD 1YTZC 1B47A 2M8UA 4XYNA 4MRXA 1C07A 4N1FA 1JWDA 2COLB 1AHRA 3EVVA 3S0FA 4AQJA 4IJ7A 2JU0A 1FW4A 3NSLA 4AOMA 1CMFA 1Y1AA 2MJWB 2WCLA 4F0ZB 2ZRSA 3ZNIA 1AVSA 2KAVA 5HL1A 1F55A 3SS3A 2JT0A 1YW5A 4ORBB 2Q5AA 2MBXA 2WCFA 1H8BA 1K9PA 1TCOB 1UHKA 1SK6D 2JOJA 3I5GC 5J3XA 5KSZA 5ER5A 1KFUS 5JOLA 1NX0A 3L4HA 1EJ3A 2L5YA 1C7WA 1Y6WA 3OB2B 4WRIA 2KI6D 1KQMC 3TS5B 1I5HW 2ZQSA 2JC2A 2Q4UA 2BCBA 1UHHA 2Y5IA 2KBMA 1GGWA 1QX5B 1RFJA 3DZTA 1Y0VH 4ZCUA 1OE9B 2XP9A 1KFXS 4YI9A 1S6JA 2BBNA 1OZOA 4A0UA 5EL2A 1A2XA 2FOTA 5FI6A 4ZCVA 1QLSA 1R2UA 3AKBA 3B88A 4PE4A 4M2QA 1K94A 2XPAA 1RROA 2WCJA 4MN0A 3PQHA 1XO5A 1PSRA 1UP5A 3S0GA 2E30A 3FWBA 3RZSA 3GK2A 1GGZA 1YVLA 2K8MB 4NDDA 1OOHA 1ODBA 2ZQTA 2FJUB 2F2OA 1PALA 2EC6C 2KHNA 1F4OA 3I5IC 5CSIA 1O6WA 3A8RA 1LXFC 1IKUA 1NMVA 2BE6A 1RK9A 2BA1A 5HKYA 1QXPA 2MRDA 1U5IA 2RGIA 1IG5A 1QJTA 1WLZA 2KI4B 3AAKA 3FWCA 2K7BA 3PSRA 2L4JA 4HSZA 1XYDA 3NXAA 1ALVA 2LLTA 3EKHA 2KYFA 4PHNA 4DRWA 1FPWA 1QVIZ 4N5XA 2F8PA 3EK4A 3FIAA 2JXLA 5PALA 3M7NA 3S0DA 1IRJA 1SCMB 1AUIB 1X02A 4FTGA 4AQIA 3EK8A 1QASA 2YAJB 3BOWA 2WCKA 3VRPA 1EL4A 2Y1NA 3OBVA 1XFWO 3SG6A 1A29A 1J7QA 5AANA 1B7TY 1XVJA 5BPJA 4F7FA 3S0BA 1OSAA 3TDUA 5AHTA 3ZWHA 5I2OA 1SY9A 2ISDA 4ORCB 3VRQA 2F21A 3OB1B 2LP3A 4PHKA 4INXA 1BR4B 2L5XB 3LLEA 3WXAA 4P5OE 1C3ZA 2G2BA 4JQ0D 1UHIA 1NCYA 1CMGA 2OTGC 3CZ2A 2P70A 2WAEA 4U86A 2ZAJA 1NSHA 2BNXA 1CNPA 2WCHA 3AKAA 5AERA 1F8HA 2QDIA 3EG5B 4ICBA 2XP5A 3OHMB 1PVAA 1S1EA 1K8UA 3OX5A 3PM2A 1BF5A 1TNWA 3O78A 4YGBB 2M97A 2LLUA 1YRUB 1YX8A 1YURA 2ZQUA 3SS5A 2JNXA 5B8IB 2JXCA 4YGCB 2DJYA 1WR7A 2ITKA 1J1EA 2JPOA 2P71A 4OVNF 2ZR5A 3AAJA 4FQOA 2DMVA 1AK8A 1KQVA 2LAJA 3PM8A 2Q91A 2NCPA 2ERBA 4MEWA 2YSGA 3I5FB 1LA0A 4GUKA 2HF5A 3NGVA 1JFKA 3S0EA 2AUCA 5DICA 2JTZA 3V2LA 1QLKA 4NDBA 3VRNA 1EH2A 1Z4HA 2YSHA 3CR4X 2EHBA 3RLZA 4XJKA 5K89A 3WHTB 3JVTB 2M1KB 2OS8B 4OZDA 4U85A 1WDCC 1YR5A 4GAOA 2KAXA 4BY5A 1OOFA 3SIAA 4USLA 2PASA 1K95A 4MZKA 2M0RA 1TNPA 4PALA 1CFFA 4YGEB 3ODKA 1QX2A 5I2QA 1JSAA 3DVMA 3BQ3A 3EK7A 1CTRA 1SL8A 2LVVA 2ZKMX 2O5GA 1U5IB 1V1FA 2JZIA 1Q80A 1ZMZA 2QPTA 1KK7Z 1M31A 1ZACA 3JTDB 4CFRA 1A75A 1WMVA 5CSNA 2V53A 3SIBA 2CCMA 3M85A 1K9UA 1SR6B 3FE8A 1TR8A 2ZQVA 1YVHA 2KFGA 2BBMA 1JMQA 3D74A 1K96A 1EG4A 3CZ1A 2KLEA 3PALA 3UO9A 4MRYA 3B87A 4JD9A 5CPVA 5HLVA 3WNXB 1S26D 2L2EA 3BOWB 3D78A 1GM0A 4WQ3A 2K7OA 1QATA 3TDZA 1SYMA 1PULA 4YRUA 5I94A 2M1UA 2MLFC 2QEOA 1MR8A 3KHEA 3I5HC 3SG2A 2Y8NB 1BT6A 1KWOC 3PN7B 5CSJA 3MQHA 2NLNA 4JPZB 2JPTA 1TOPA 1G33A 1L2OB 2FCDA 2L2CA 3FS8A 1CDMA 1DF0A 1QV0A 2PALA 1JUOA 1J1DA 3EVUA 2LUCA 2OPOA 2H61C 2KNEA 3IQOA 2BL0C 2KI6C 5E62A 2KOTA 2BKIB 4PE7A 4E5RA 1QVIY 1YUSA 2XP3A 1NCZA 3EKJA 1S3PA 1TNXA 1TUJA 4M2PA 1MF8B 2GGZA 4QJ4B 1MQ1A 1NX3A 1DTLA 1SRAA 1CFCA 1ZUZA 1FBVA 5E64A 3BFBA 1YUTA 3TUYC 1SL7A 1IH0A 4CFQA 4C0KA 2YSBA 4ETOA 2FCEA 2LMVA 1KK8C 1S5GZ 2A4JA 4P2YB 3R1VA 3FSBA 1WRLA 3BFAA 1BJFA 1IIOA 2VRGA 3CYZA 1NPQA 4D1EA 1WRKA 4GGFC 1CB1A 1H4BA 4YBHB 1TUZA 3QMEA 3SJSA 2CT9A 1WLMA 5D3OA 1AJ4A 4N1GA 2ZFDA 3BJHA 1W9ZA 3PATA 2KLDA 3RM1A 2YSIA 1GJYA 2MLEC 4I5NB 4PE1A 3SG7A 1JBAA 1F8AB 2NZ0A 2PYQA 2HQ8A 3TCZA 4XJKB 1TCFA 1CKKA 1M46A 1SPYA 2JTTA 2O60A 2WC8A 4WQ2A 2CXJA 4A0TA 2XP4A 1XFVO 1IQ5A 3CTNA 3R72A 5ER4X 4DS7A 1RECA 1XFYO 2QEHA 2E6WA 2BCAA 2Y4QA 5D7FA 1DGVA 3L4LA 2JMFA 3PLFB 1V1GA 1DJHA 1XFZO 2JT8A 5E5WA 2LCPA 3WH0A 2LAPA 3OP0A 5FI2A 4A4BA 1DELA 1QX7A 1CM1A 3I5GB 2OWOA 1ZCNA 1F4QA 3KAFA 1XK4C 1SBJA 3B7AA 1A75B 3SG4A 3SG5A 4C0JA 2K60A 4DUQA 3I5FC 2WADA 1CM4A 1KQMB 1YUUA 1RP5A 3DXLA 4HRGA 2WC6A 1UUSA 2XPBA 3TC5A 1FI5A 2KSPA 2LP2A 4DIRA 1SCVA 4HRHA 3FSCA 3CZTX 3O4YA 1W7JB 2LVJA 3SS4A 5G08A 4NDCA 3VGOA 4PDZA 4GPLB 1DQEA 3ICBA 3QRXA 4A4CA 1QIWA 5F6TA 3KAGA 1LA3A 4I5LB 1TTXA 3IQQA 4MVFA 1YX7A 2LNKA 1DC1A 1CLLA 3O2PA 3CDNA 2WOSA 1IJ6A 1DF0B 1ORGA 2EC6B 3A4UB 3I5IB 3JTDC 3K1EA 4BY4A 1CFDA 2QRVA 3OOBA 1KK7Y 3UNWA 1PINA 2JULA 2ZR4A 3MSEB 1JC2A 2LMUA 1Z2CB 2BECA 3F45A 1NCXA 2ZNEA 5HKWA 1FF1A 2KDHA 2QACA 1F54A 2GTEA 2M8JA 2I7AA 1CLBA 1F70A 5FYXA 1Y1UA 1QV1A 4GGNA 3D76A 3IVTA 4I5JA 3VROA 3S0AA 3BUNB 2JNFA 3KCEA 3NHIA 1S6CA 2EZ5W 2K2FA 1S6IA 1M63B 4GFTA 3TZ1A 1CLMA 2JQ6A 2JT3A 2YGUA 3M0WA 3OX6A 4FQTA 1BLQA 2YSFA 1IWQA 5CQ2A 3TS5C 1K93D 3SG3A 1E8AA 1RJVA 5E65A 2ZN8A 1KSOA 1PK0D 3CWGA 1QTXA 4OV2A 1DT7B 1BOCA 1BODA 4U84A 4CIDA 3DF0A 3DD4A 3DYEA 4E68A 2BAPA 2WCMA 1DJXA 1DJIA 3NSKA 5HLOA 1J7OA 2H61A 3MCBA 2ZNDA 3GK4X 1LS8A 2EGDA 2M3WA 1MHOA 3D0YA 1A4PA 1R6PA 1TRFA 3FE9A 2BCXA 4PCWA 1DJGA 1A03A 1FI6A 1B9AA 2M29A 2DWVA 3H4SE 1P28A 1S5GY 2F2PA 1SNLA 3D77A 3EVRA 1MUXA 1DJWA 2H2KA 2M7NA 3DVEA 3NTPA 4QIBA 2LM5A 4PT1A 3E3RA 4TNCA 1JF0A 4R1EA 4U8DA 3VRRA 1NWDA 3N7HA 4DCKA 2KI4C 1K90D 4JKTA 3WHUB 3BFHA 3KABA 1ALWA 1OW4A 1W7IB 3PJIA 2PQLA 4GGFA 1UHNA 2FJYA 3HX4A 1IQ3A 2LUXA 1UURA 1MXEA 5IBWA 1D1OA 5DKQA 1SCMC 2P6BB 1CDNA 4KYNA 1B8LA 3LK1A 1NYAA 2KQYA 1MWNA 5DKNA 1QS7A 1B1GA 1NUBA 3O4XA 1B4CA 4CPVA 4HREE 4QJ5B 4UPGA 1TNQA 3BYAA 1C3YA 1WDCB 3IF7A 2JX8A 2L98A 5AXIA 1FLCA 2SCPA 1OZSA 3PFVA 5HYDA 3CR2A 1BU3A 2M49B 3CS1A 1NIWA 3KADA 3TDBA 1CDPA 1DJZA 3BXKA 1G4YR 2M7LA 3CLNA 3R1OA 2E45A 1LKJA 1SL9A 1SMGA 1WY9A 2MA2A 3KF9A 1XK4A 1PRWA 4YGDB 1LINA 2WNDA 2LHLA 3B86A 3BUOB 2F33A 2LE9B 4Q04A 1N65A 3TDIA 5E66A 1TWOA 1SSEB 1NX1A 1OOJA 1VRKA 2QEBA 1ZOTB 1G8IA 2F3YA 2MHHA 3O6BA 2LANA 2L4IA 2MDIA 2XP8A 1EXRA 1TK7A 3LKXA 2H8VA 3KAHA 2JV4A 1K9QA 1GQMA 1SW8A 1HT9A 1HQVA 1S36A 2WC5A 5DKRA 1AJ5A 4MZLA 2JXWA 2XP6A 4GNKB 2LLSA 2Y1MA 5U47A 3B6XA 2L50A 3I5HB 3K21A 3BUWB 1KWOB 2M8IA 3D75A 3DY9A 4PHJA 2ZR6A 3CNGA 2CBLA 4YGAA 3DF0B 1K2HA 2L0PA 4GBAA 4MLWA 2XP7A 2K2AA 3KO0A 2KBIA 1M39A 1PVBA 1BMOA 2HETA 3MCBB 2BL0B 3VB1A 1M45A 3D0YB 3CABA 1DVIA 1QWVA 3OGNA 4REXA
chains in the Genus database with same CATH topology
1OQPA 4C0LA 2DOQA 1JF2A 2CTNA 3JVTC 2OS8C 3HCMA 3NSOA 2DK1A 1F71A 1TIZA 4GLXA 1SKTA 1DGUA 4MZJA 2ZRTA 3TUYB 2R2IA 2PVBA 1AP4A 3BUXB 2LMTA 1IGVA 2KGBC 5D69A 1KK8B 1MXLC 2HPSA 2LV7A 3LE4A 2KFHA 2G9BA 2B1UA 5I8NA 2KXQA 1B8RA 3MQGA 2NCOA 2I2RE 3FS7A 2DK7A 1SR6C 2WORA 4OCIA 2WCBA 4I5KA 1CFPA 4OKHA 1TN4A 2K61A 4MSPA 2TN4A 4IL1A 3LCPC 1BR1B 3NSIA 4CLNA 2GV5A 1XA5A 2ZN9A 1IJ5A 5JJGA 1OMVA 2AAOA 2K7CA 1PSBA 1Y1XA 4PE0A 1J7PA 1RTP1 1JFJA 1OMRA 2MAZA 2L51A 1C7VA 1XFXO 4JWQA 2GGMA 2NXQA 1B7TZ 5I2LA 3LK0A 1UHJA 3PN7C 4ORAB 2I94A 2LVKA 2KGRA 1J55A 1L2OC 1OMDA 1YRTB 2I18A 1NP8A 1N2DA 5AEQA 2JRFA 2AMIA 1RWYA 5KU1A 5KTYA 1K9RA 1DJYA 1WRZA 5TNCA 1KFUL 3GK1A 1ZFSA 1N0YA 3DVJA 2KFFA 2KYCA 2K0JA 2OTGB 4OR9B 3DVKA 5CSFA 3KEVA 3LKXB 2IS9A 2F3ZA 1XFUO 3GOFA 2PMYA 3BUMB 1UWOA 2L4HA 3D10A 1J7RA 2LVIA 1DMOA 2D8NA 4M2OA 2JWWA 4NQGA 1KFXL 1KSMA 2LHIA 4L9MA 4PHMA 2KAYA 2LC5A 5GQQC 2BKHB 2CNPA 3CGAA 2M3OW 2M9GA 2WCEA 4YI8A 1QIVA 1B8CA 1NX2A 2PRUA 3LL8B 3C1VA 1CDLA 1L7ZA 5AFPA 2KQ6A 2SASA 2HQWA 2K7DA 3CR5X 5HKZA 4MBEA 2PSRA 4QJ3B 1K9KA 2RE3A 3KAIA 1EG3A 1KCYA 2BE4A 1LVCD 1YTZC 1B47A 2M8UA 4XYNA 4MRXA 1C07A 4N1FA 1JWDA 2COLB 1AHRA 3EVVA 4AQJA 2JU0A 1FW4A 3NSLA 4AOMA 1CMFA 1Y1AA 2MJWB 4F0ZB 2ZRSA 3ZNIA 1AVSA 2KAVA 1F55A 2JT0A 1YW5A 4ORBB 2Q5AA 2MBXA 2WCFA 1H8BA 1K9PA 1TCOB 1UHKA 1SK6D 2JOJA 3I5GC 5J3XA 5KSZA 5ER5A 1KFUS 5JOLA 1NX0A 3L4HA 1EJ3A 1C7WA 1Y6WA 3OB2B 4WRIA 2KI6D 1KQMC 3TS5B 1I5HW 2ZQSA 2JC2A 2Q4UA 2BCBA 1UHHA 2Y5IA 2KBMA 1GGWA 1QX5B 1RFJA 1Y0VH 4ZCUA 1OE9B 2XP9A 1KFXS 4YI9A 1S6JA 2BBNA 1OZOA 4A0UA 1A2XA 2FOTA 4ZCVA 1QLSA 1R2UA 3AKBA 4PE4A 4M2QA 1K94A 2XPAA 1RROA 4MN0A 3PQHA 1XO5A 1PSRA 1UP5A 2E30A 3FWBA 3GK2A 1GGZA 1YVLA 2K8MB 4NDDA 1ODBA 2ZQTA 2FJUB 2F2OA 1PALA 2EC6C 2KHNA 1F4OA 3I5IC 5CSIA 1O6WA 3A8RA 1LXFC 1IKUA 1NMVA 2BE6A 1RK9A 2BA1A 5HKYA 1QXPA 2MRDA 1U5IA 2RGIA 1IG5A 1QJTA 1WLZA 2KI4B 3AAKA 3FWCA 2K7BA 3PSRA 2L4JA 4HSZA 1XYDA 3NXAA 1ALVA 2LLTA 3EKHA 2KYFA 4PHNA 4DRWA 1FPWA 1QVIZ 4N5XA 2F8PA 3EK4A 3FIAA 2JXLA 5PALA 3M7NA 1IRJA 1SCMB 1AUIB 1X02A 4FTGA 4AQIA 3EK8A 1QASA 2YAJB 3BOWA 3VRPA 1EL4A 2Y1NA 1XFWO 3SG6A 1A29A 1J7QA 5AANA 1B7TY 1XVJA 5BPJA 1OSAA 3TDUA 5AHTA 3ZWHA 5I2OA 1SY9A 2ISDA 4ORCB 3VRQA 2F21A 3OB1B 2LP3A 4PHKA 1BR4B 2L5XB 3LLEA 3WXAA 4P5OE 4JQ0D 2G2BA 1UHIA 1NCYA 1CMGA 2OTGC 2WAEA 4U86A 2ZAJA 1NSHA 1CNPA 3AKAA 5AERA 1F8HA 4ICBA 2XP5A 3OHMB 1PVAA 1S1EA 1K8UA 3OX5A 1BF5A 1TNWA 3O78A 4YGBB 2M97A 2LLUA 1YRUB 1YX8A 1YURA 2ZQUA 2JNXA 5B8IB 2JXCA 4YGCB 2DJYA 1WR7A 2ITKA 1J1EA 4OVNF 2ZR5A 3AAJA 4FQOA 2DMVA 1AK8A 1KQVA 2LAJA 3PM8A 2Q91A 2NCPA 4MEWA 2YSGA 3I5FB 1LA0A 4GUKA 2HF5A 1JFKA 2AUCA 2JTZA 3VRNA 1QLKA 4NDBA 1EH2A 2YSHA 3CR4X 2EHBA 3RLZA 4XJKA 5K89A 3WHTB 3JVTB 2M1KB 2OS8B 4U85A 1WDCC 1YR5A 4GAOA 2KAXA 4BY5A 3SIAA 4USLA 2PASA 1K95A 4MZKA 2M0RA 1TNPA 4PALA 1CFFA 4YGEB 3ODKA 1QX2A 5I2QA 1JSAA 3DVMA 3BQ3A 3EK7A 1CTRA 1SL8A 2LVVA 2ZKMX 2O5GA 1U5IB 1V1FA 2JZIA 1Q80A 1ZMZA 2QPTA 1KK7Z 1M31A 1ZACA 3JTDB 4CFRA 1A75A 1WMVA 5CSNA 2V53A 3SIBA 2CCMA 3M85A 1K9UA 1SR6B 1TR8A 2ZQVA 1YVHA 2KFGA 2BBMA 1JMQA 1K96A 1EG4A 3PALA 4MRYA 5CPVA 5HLVA 3WNXB 1S26D 2L2EA 3BOWB 4WQ3A 2K7OA 1QATA 3TDZA 1SYMA 1PULA 4YRUA 2M1UA 2MLFC 1MR8A 3KHEA 3I5HC 3SG2A 2Y8NB 1BT6A 1KWOC 3PN7B 5CSJA 3MQHA 2NLNA 4JPZB 2JPTA 1TOPA 1G33A 1L2OB 2FCDA 3FS8A 1CDMA 1DF0A 1QV0A 2PALA 1JUOA 1J1DA 3EVUA 2LUCA 2OPOA 2H61C 2KNEA 3IQOA 2BL0C 2KI6C 5E62A 2KOTA 2BKIB 4PE7A 4E5RA 1QVIY 1YUSA 2XP3A 1NCZA 3EKJA 1S3PA 1TNXA 4M2PA 1MF8B 2GGZA 4QJ4B 1MQ1A 1NX3A 1DTLA 1SRAA 1CFCA 1ZUZA 1FBVA 5E64A 1YUTA 3TUYC 1SL7A 1IH0A 4CFQA 4C0KA 2YSBA 4ETOA 2FCEA 2LMVA 1KK8C 1S5GZ 2A4JA 4P2YB 3FSBA 1WRLA 1BJFA 2VRGA 1CB1A 1NPQA 4D1EA 1WRKA 4GGFC 1H4BA 4YBHB 3SJSA 2CT9A 1WLMA 1AJ4A 4N1GA 2ZFDA 3PATA 3RM1A 2YSIA 1GJYA 2MLEC 4I5NB 4PE1A 3SG7A 1JBAA 1F8AB 2NZ0A 3TCZA 2HQ8A 4XJKB 1TCFA 1CKKA 1M46A 1SPYA 2JTTA 2O60A 2WC8A 4WQ2A 2CXJA 4A0TA 2XP4A 1XFVO 1IQ5A 3CTNA 5ER4X 4DS7A 1RECA 1XFYO 2E6WA 2BCAA 2Y4QA 5D7FA 1DGVA 2JMFA 3PLFB 1V1GA 1DJHA 1XFZO 2JT8A 5E5WA 2LCPA 3WH0A 2LAPA 3OP0A 4A4BA 1QX7A 1CM1A 3I5GB 2OWOA 1ZCNA 1F4QA 3KAFA 1XK4C 1SBJA 1A75B 3SG4A 3SG5A 4C0JA 4DUQA 3I5FC 2WADA 1CM4A 1KQMB 1YUUA 1RP5A 4HRGA 2XPBA 1UUSA 3TC5A 1FI5A 2KSPA 2LP2A 4DIRA 1SCVA 4HRHA 3FSCA 3CZTX 3O4YA 1W7JB 2LVJA 5G08A 4NDCA 3VGOA 4PDZA 4GPLB 3ICBA 4A4CA 3QRXA 1QIWA 5F6TA 3KAGA 1LA3A 4I5LB 1TTXA 3IQQA 4MVFA 1YX7A 2LNKA 1CLLA 3O2PA 1BG1A 2WOSA 1IJ6A 1DF0B 2EC6B 3A4UB 3I5IB 3JTDC 2QRVA 4BY4A 1CFDA 3OOBA 1KK7Y 1PINA 2JULA 2ZR4A 3MSEB 2LMUA 3F45A 2BECA 1NCXA 2ZNEA 5HKWA 1FF1A 2KDHA 2QACA 1F54A 2M8JA 2I7AA 1CLBA 1F70A 5FYXA 1Y1UA 1QV1A 4GGNA 4I5JA 3VROA 3BUNB 2JNFA 3KCEA 2EZ5W 1S6CA 2K2FA 1S6IA 1M63B 4GFTA 3TZ1A 1CLMA 2JQ6A 2JT3A 3M0WA 3OX6A 1BLQA 2YSFA 1IWQA 5CQ2A 3TS5C 1K93D 3SG3A 1E8AA 1RJVA 5E65A 2ZN8A 1KSOA 1PK0D 3CWGA 1QTXA 4OV2A 1DT7B 1BOCA 1BODA 4U84A 4CIDA 3DF0A 3DD4A 4E68A 1DJXA 1DJIA 3NSKA 5HLOA 1J7OA 2H61A 3MCBA 2ZNDA 3GK4X 2EGDA 2M3WA 1MHOA 3D0YA 1A4PA 1R6PA 1TRFA 2BCXA 4PCWA 1DJGA 1A03A 1FI6A 1B9AA 2M29A 2DWVA 3H4SE 1S5GY 2F2PA 1SNLA 3EVRA 1MUXA 1DJWA 2H2KA 2M7NA 3DVEA 3NTPA 4QIBA 2LM5A 3E3RA 4TNCA 1JF0A 4R1EA 4U8DA 3VRRA 1NWDA 4DCKA 2KI4C 1K90D 3WHUB 3KABA 1ALWA 1W7IB 4GGFA 1UHNA 3HX4A 1IQ3A 2LUXA 1UURA 1MXEA 5IBWA 1D1OA 5DKQA 1SCMC 2P6BB 1CDNA 1B8LA 3LK1A 1NYAA 2KQYA 1MWNA 5DKNA 1QS7A 1B1GA 1NUBA 1B4CA 4CPVA 4HREE 4QJ5B 4UPGA 1TNQA 3BYAA 1WDCB 3IF7A 2JX8A 2L98A 5AXIA 1FLCA 2SCPA 1OZSA 3PFVA 5HYDA 3CR2A 1BU3A 2M49B 3CS1A 1NIWA 3KADA 3TDBA 1CDPA 1DJZA 3BXKA 1G4YR 2M7LA 3CLNA 2E45A 1LKJA 1SL9A 1SMGA 1WY9A 2MA2A 3KF9A 1XK4A 1PRWA 4YGDB 1LINA 2WNDA 2LHLA 3BUOB 3TDIA 2F33A 2LE9B 4Q04A 1N65A 5E66A 1NX1A 1OOJA 1VRKA 1ZOTB 1G8IA 2F3YA 2MHHA 3O6BA 2LANA 2L4IA 2MDIA 2XP8A 1EXRA 1TK7A 3LKXA 3KAHA 2JV4A 1K9QA 1GQMA 1SW8A 1HT9A 1HQVA 1S36A 5DKRA 1AJ5A 4MZLA 2JXWA 2XP6A 4GNKB 2LLSA 2Y1MA 5U47A 2L50A 3I5HB 3K21A 3BUWB 1KWOB 2M8IA 2ZR6A 3CNGA 4PHJA 2CBLA 4YGAA 3DF0B 1K2HA 2L0PA 4GBAA 4MLWA 2XP7A 2K2AA 3KO0A 2KBIA 1M39A 1PVBA 1BMOA 2HETA 3MCBB 2BL0B 1M45A 3D0YB 1JC2A 1DVIA 3KPXA 4REXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQP A;  4C0L A;  2DOQ A;  1JF2 A;  2CTN A;  3JVT C;  2OS8 C;  3HCM A;  3NSO A;  2DK1 A;  1F71 A;  1TIZ A;  1SKT A;  1DGU A;  4MZJ A;  2ZRT A;  3TUY B;  2R2I A;  2PVB A;  1AP4 A;  3BUX B;  2LMT A;  1IGV A;  2KGB C;  5D69 A;  1KK8 B;  1MXL C;  2HPS A;  2LV7 A;  3LE4 A;  2KFH A;  2G9B A;  2B1U A;  5I8N A;  2KXQ A;  1B8R A;  2NCO A;  2I2R E;  3FS7 A;  2DK7 A;  1SR6 C;  2WOR A;  4OCI A;  2WCB A;  4I5K A;  1CFP A;  4OKH A;  1TN4 A;  2K61 A;  4MSP A;  2TN4 A;  4IL1 A;  3LCP C;  1BR1 B;  3NSI A;  4CLN A;  2GV5 A;  1XA5 A;  2ZN9 A;  1IJ5 A;  5JJG A;  1OMV A;  2AAO A;  2K7C A;  1PSB A;  1Y1X A;  4PE0 A;  1J7P A;  1RTP 1;  1JFJ A;  1OMR A;  2MAZ A;  2L51 A;  1C7V A;  1XFX O;  4JWQ A;  2GGM A;  2NXQ A;  1B7T Z;  5I2L A;  3LK0 A;  1UHJ A;  3PN7 C;  4ORA B;  2I94 A;  2LVK A;  2KGR A;  1J55 A;  1L2O C;  1OMD A;  1YRT B;  2I18 A;  1NP8 A;  1N2D A;  5AEQ A;  2JRF A;  2AMI A;  1RWY A;  5KU1 A;  5KTY A;  1K9R A;  1DJY A;  1WRZ A;  5TNC A;  1KFU L;  3GK1 A;  1ZFS A;  1N0Y A;  3DVJ A;  2KFF A;  2KYC A;  2K0J A;  2OTG B;  4OR9 B;  3DVK A;  5CSF A;  3KEV A;  2IS9 A;  2F3Z A;  1XFU O;  3GOF A;  2PMY A;  3BUM B;  1UWO A;  2L4H A;  3D10 A;  1J7R A;  2LVI A;  1DMO A;  2D8N A;  4M2O A;  2JWW A;  4NQG A;  1KFX L;  1KSM A;  2LHI A;  4L9M A;  4PHM A;  2KAY A;  2LC5 A;  5GQQ C;  2BKH B;  2CNP A;  3CGA A;  2M3O W;  2M9G A;  2WCE A;  4YI8 A;  1QIV A;  1B8C A;  1NX2 A;  2PRU A;  3LL8 B;  3C1V A;  1CDL A;  1L7Z A;  5AFP A;  2KQ6 A;  2SAS A;  2HQW A;  2K7D A;  3CR5 X;  5HKZ A;  4MBE A;  2PSR A;  4QJ3 B;  1K9K A;  2RE3 A;  3KAI A;  1EG3 A;  1KCY A;  2BE4 A;  1LVC D;  1YTZ C;  1B47 A;  2M8U A;  4XYN A;  4MRX A;  1C07 A;  4N1F A;  1JWD A;  2COL B;  1AHR A;  3EVV A;  4AQJ A;  2JU0 A;  1FW4 A;  3NSL A;  4AOM A;  1CMF A;  1Y1A A;  2MJW B;  4F0Z B;  2ZRS A;  3ZNI A;  1AVS A;  2KAV A;  1F55 A;  2JT0 A;  1YW5 A;  4ORB B;  2Q5A A;  2MBX A;  2WCF A;  1H8B A;  1K9P A;  1TCO B;  1UHK A;  1SK6 D;  2JOJ A;  3I5G C;  5J3X A;  5KSZ A;  5ER5 A;  1KFU S;  5JOL A;  1NX0 A;  3L4H A;  1EJ3 A;  1C7W A;  1Y6W A;  3OB2 B;  4WRI A;  2KI6 D;  1KQM C;  3TS5 B;  1I5H W;  2ZQS A;  2JC2 A;  2Q4U A;  2BCB A;  1UHH A;  2Y5I A;  2KBM A;  1GGW A;  1QX5 B;  1RFJ A;  1Y0V H;  4ZCU A;  1OE9 B;  2XP9 A;  1KFX S;  4YI9 A;  1S6J A;  2BBN A;  1OZO A;  1A2X A;  2FOT A;  4ZCV A;  1QLS A;  1R2U A;  3AKB A;  4PE4 A;  4M2Q A;  1K94 A;  2XPA A;  1RRO A;  4MN0 A;  1XO5 A;  1PSR A;  1UP5 A;  2E30 A;  3FWB A;  3GK2 A;  1GGZ A;  1YVL A;  2K8M B;  4NDD A;  1ODB A;  2ZQT A;  2FJU B;  2F2O A;  1PAL A;  2EC6 C;  2KHN A;  1F4O A;  3I5I C;  5CSI A;  1O6W A;  3A8R A;  1LXF C;  1IKU A;  1NMV A;  2BE6 A;  1RK9 A;  2BA1 A;  5HKY A;  1QXP A;  2MRD A;  1U5I A;  2RGI A;  1IG5 A;  1QJT A;  1WLZ A;  2KI4 B;  3AAK A;  3FWC A;  2K7B A;  3PSR A;  2L4J A;  4HSZ A;  1XYD A;  3NXA A;  1ALV A;  2LLT A;  3EKH A;  2KYF A;  4PHN A;  4DRW A;  1FPW A;  1QVI Z;  4N5X A;  2F8P A;  3EK4 A;  3FIA A;  2JXL A;  5PAL A;  3M7N A;  1IRJ A;  1SCM B;  1AUI B;  1X02 A;  4FTG A;  4AQI A;  3EK8 A;  1QAS A;  3BOW A;  3VRP A;  1EL4 A;  2Y1N A;  1XFW O;  3SG6 A;  1A29 A;  1J7Q A;  5AAN A;  1B7T Y;  1XVJ A;  5BPJ A;  1OSA A;  3TDU A;  5AHT A;  3ZWH A;  5I2O A;  1SY9 A;  2ISD A;  4ORC B;  3VRQ A;  2F21 A;  3OB1 B;  2LP3 A;  4PHK A;  1BR4 B;  2L5X B;  3LLE A;  3WXA A;  4P5O E;  4JQ0 D;  2G2B A;  1UHI A;  1NCY A;  1CMG A;  2OTG C;  4U86 A;  2ZAJ A;  1NSH A;  1CNP A;  3AKA A;  5AER A;  1F8H A;  4ICB A;  2XP5 A;  3OHM B;  1PVA A;  1S1E A;  1K8U A;  3OX5 A;  1BF5 A;  1TNW A;  3O78 A;  4YGB B;  2M97 A;  2LLU A;  1YRU B;  1YX8 A;  1YUR A;  2ZQU A;  2JNX A;  5B8I B;  2JXC A;  4YGC B;  2DJY A;  1WR7 A;  2ITK A;  1J1E A;  4OVN F;  2ZR5 A;  3AAJ A;  4FQO A;  2DMV A;  1AK8 A;  1KQV A;  2LAJ A;  3PM8 A;  2Q91 A;  2NCP A;  4MEW A;  2YSG A;  3I5F B;  1LA0 A;  4GUK A;  2HF5 A;  1JFK A;  2AUC A;  2JTZ A;  3VRN A;  1QLK A;  4NDB A;  1EH2 A;  2YSH A;  3CR4 X;  2EHB A;  3RLZ A;  4XJK A;  5K89 A;  3WHT B;  3JVT B;  2M1K B;  2OS8 B;  4U85 A;  1WDC C;  1YR5 A;  4GAO A;  2KAX A;  4BY5 A;  3SIA A;  4USL A;  2PAS A;  1K95 A;  4MZK A;  2M0R A;  1TNP A;  4PAL A;  1CFF A;  4YGE B;  3ODK A;  1QX2 A;  5I2Q A;  1JSA A;  3DVM A;  3BQ3 A;  3EK7 A;  1CTR A;  1SL8 A;  2LVV A;  2ZKM X;  2O5G A;  1U5I B;  1V1F A;  2JZI A;  1Q80 A;  1ZMZ A;  2QPT A;  1KK7 Z;  1M31 A;  1ZAC A;  3JTD B;  4CFR A;  1A75 A;  1WMV A;  5CSN A;  2V53 A;  3SIB A;  2CCM A;  3M85 A;  1K9U A;  1SR6 B;  2ZQV A;  1YVH A;  2KFG A;  2BBM A;  1JMQ A;  1K96 A;  1EG4 A;  3PAL A;  4MRY A;  5CPV A;  5HLV A;  3WNX B;  1S26 D;  2L2E A;  3BOW B;  4WQ3 A;  2K7O A;  1QAT A;  3TDZ A;  1SYM A;  1PUL A;  4YRU A;  2M1U A;  2MLF C;  1MR8 A;  3KHE A;  3I5H C;  3SG2 A;  1BT6 A;  1KWO C;  3PN7 B;  5CSJ A;  2NLN A;  4JPZ B;  2JPT A;  1TOP A;  1G33 A;  1L2O B;  2FCD A;  1CDM A;  1DF0 A;  1QV0 A;  2PAL A;  1JUO A;  1J1D A;  3EVU A;  2LUC A;  2OPO A;  2H61 C;  2KNE A;  3IQO A;  2BL0 C;  2KI6 C;  2KOT A;  2BKI B;  4PE7 A;  4E5R A;  1QVI Y;  1YUS A;  2XP3 A;  1NCZ A;  3EKJ A;  1S3P A;  1TNX A;  4M2P A;  1MF8 B;  2GGZ A;  4QJ4 B;  1MQ1 A;  1NX3 A;  1DTL A;  1SRA A;  1CFC A;  1ZUZ A;  1FBV A;  1YUT A;  3TUY C;  1SL7 A;  1IH0 A;  4CFQ A;  4C0K A;  2YSB A;  4ETO A;  2FCE A;  2LMV A;  1KK8 C;  1S5G Z;  2A4J A;  4P2Y B;  1WRL A;  1BJF A;  2VRG A;  1CB1 A;  1NPQ A;  4D1E A;  1WRK A;  4GGF C;  1H4B A;  4YBH B;  3SJS A;  2CT9 A;  1WLM A;  1AJ4 A;  4N1G A;  2ZFD A;  3PAT A;  3RM1 A;  2YSI A;  1GJY A;  2MLE C;  4I5N B;  4PE1 A;  3SG7 A;  1JBA A;  1F8A B;  2NZ0 A;  3TCZ A;  2HQ8 A;  4XJK B;  1TCF A;  1CKK A;  1M46 A;  1SPY A;  2JTT A;  2O60 A;  2WC8 A;  4WQ2 A;  2CXJ A;  2XP4 A;  1XFV O;  1IQ5 A;  3CTN A;  5ER4 X;  4DS7 A;  1REC A;  1XFY O;  2E6W A;  2BCA A;  2Y4Q A;  5D7F A;  1DGV A;  2JMF A;  3PLF B;  1V1G A;  1DJH A;  1XFZ O;  2JT8 A;  3WH0 A;  2LCP A;  2LAP A;  3OP0 A;  4A4B A;  1QX7 A;  1CM1 A;  3I5G B;  1ZCN A;  1F4Q A;  3KAF A;  1XK4 C;  1SBJ A;  1A75 B;  3SG4 A;  3SG5 A;  4C0J A;  4DUQ A;  3I5F C;  1CM4 A;  1KQM B;  1YUU A;  4HRG A;  2XPB A;  1UUS A;  3TC5 A;  1FI5 A;  2KSP A;  2LP2 A;  4DIR A;  1SCV A;  4HRH A;  3CZT X;  3O4Y A;  1W7J B;  2LVJ A;  5G08 A;  4NDC A;  3VGO A;  4PDZ A;  4GPL B;  3ICB A;  4A4C A;  3QRX A;  1QIW A;  5F6T A;  3KAG A;  1LA3 A;  4I5L B;  1TTX A;  3IQQ A;  4MVF A;  1YX7 A;  2LNK A;  1CLL A;  3O2P A;  1BG1 A;  2WOS A;  1IJ6 A;  1DF0 B;  2EC6 B;  3A4U B;  3I5I B;  3JTD C;  4BY4 A;  1CFD A;  3OOB A;  1KK7 Y;  1PIN A;  2JUL A;  2ZR4 A;  3MSE B;  2LMU A;  3F45 A;  2BEC A;  1NCX A;  2ZNE A;  5HKW A;  1FF1 A;  2KDH A;  2QAC A;  1F54 A;  2M8J A;  2I7A A;  1CLB A;  1F70 A;  5FYX A;  1Y1U A;  1QV1 A;  4GGN A;  4I5J A;  3VRO A;  3BUN B;  2JNF A;  3KCE A;  2EZ5 W;  1S6C A;  2K2F A;  1S6I A;  1M63 B;  4GFT A;  3TZ1 A;  1CLM A;  2JQ6 A;  2JT3 A;  3M0W A;  3OX6 A;  1BLQ A;  2YSF A;  1IWQ A;  5CQ2 A;  3TS5 C;  1K93 D;  3SG3 A;  1E8A A;  1RJV A;  2ZN8 A;  1KSO A;  1PK0 D;  3CWG A;  1QTX A;  4OV2 A;  1DT7 B;  1BOC A;  1BOD A;  4U84 A;  4CID A;  3DF0 A;  3DD4 A;  4E68 A;  1DJX A;  1DJI A;  3NSK A;  5HLO A;  1J7O A;  2H61 A;  2ZND A;  3GK4 X;  2EGD A;  2M3W A;  1MHO A;  3D0Y A;  1A4P A;  1R6P A;  1TRF A;  2BCX A;  4PCW A;  1DJG A;  1A03 A;  1FI6 A;  1B9A A;  2M29 A;  2DWV A;  3H4S E;  1S5G Y;  2F2P A;  1SNL A;  3EVR A;  1MUX A;  1DJW A;  2H2K A;  2M7N A;  3DVE A;  3NTP A;  4QIB A;  2LM5 A;  3E3R A;  4TNC A;  1JF0 A;  4R1E A;  4U8D A;  3VRR A;  1NWD A;  4DCK A;  2KI4 C;  1K90 D;  3WHU B;  3KAB A;  1ALW A;  1W7I B;  4GGF A;  1UHN A;  3HX4 A;  1IQ3 A;  2LUX A;  1UUR A;  1MXE A;  5IBW A;  1D1O A;  5DKQ A;  1SCM C;  2P6B B;  1CDN A;  1B8L A;  3LK1 A;  1NYA A;  2KQY A;  1MWN A;  5DKN A;  1QS7 A;  1B1G A;  1NUB A;  1B4C A;  4CPV A;  4HRE E;  4QJ5 B;  4UPG A;  1TNQ A;  3BYA A;  1WDC B;  3IF7 A;  2JX8 A;  2L98 A;  5AXI A;  2SCP A;  1OZS A;  3PFV A;  5HYD A;  3CR2 A;  1BU3 A;  2M49 B;  3CS1 A;  1NIW A;  3KAD A;  3TDB A;  1CDP A;  1DJZ A;  3BXK A;  1G4Y R;  2M7L A;  3CLN A;  2E45 A;  1LKJ A;  1SL9 A;  1SMG A;  1WY9 A;  2MA2 A;  3KF9 A;  1XK4 A;  1PRW A;  4YGD B;  1LIN A;  2WND A;  2LHL A;  3BUO B;  3TDI A;  2F33 A;  2LE9 B;  4Q04 A;  1N65 A;  1NX1 A;  1OOJ A;  1VRK A;  1ZOT B;  1G8I A;  2F3Y A;  2MHH A;  3O6B A;  2LAN A;  2L4I A;  2MDI A;  2XP8 A;  1EXR A;  1TK7 A;  3KAH A;  2JV4 A;  1K9Q A;  1GQM A;  1SW8 A;  1HT9 A;  1HQV A;  1S36 A;  5DKR A;  1AJ5 A;  4MZL A;  2JXW A;  2XP6 A;  4GNK B;  2LLS A;  2Y1M A;  2L50 A;  3I5H B;  3K21 A;  3BUW B;  1KWO B;  2M8I A;  2ZR6 A;  3CNG A;  4PHJ A;  2CBL A;  4YGA A;  3DF0 B;  1K2H A;  2L0P A;  4GBA A;  4MLW A;  2XP7 A;  2K2A A;  3KO0 A;  2KBI A;  1M39 A;  1PVB A;  1BMO A;  2HET A;  2BL0 B;  1M45 A;  3D0Y B;  1JC2 A;  1DVI A;  3KPX A;  4REX A; 
#chains in the Genus database with same CATH topology
 1OQP A;  4C0L A;  1BG1 A;  2DOQ A;  1JF2 A;  2CTN A;  3JVT C;  2OS8 C;  3HCM A;  3NSO A;  2DK1 A;  1F71 A;  1TIZ A;  4GLX A;  1SKT A;  1DGU A;  4MZJ A;  2ZRT A;  3TUY B;  2KPH A;  2R2I A;  2PVB A;  5FI7 A;  1AP4 A;  3BUX B;  2LMT A;  1IGV A;  2KGB C;  5D69 A;  1KK8 B;  1MXL C;  2HPS A;  2LV7 A;  3LE4 A;  2KFH A;  2G9B A;  2B1U A;  5I8N A;  2KXQ A;  1B8R A;  3D73 A;  3MQG A;  2NCO A;  2I2R E;  3FS7 A;  2DK7 A;  1SR6 C;  2WOR A;  4OCI A;  2WCB A;  4I5K A;  1CFP A;  4OKH A;  1TN4 A;  2K61 A;  4MSP A;  2TN4 A;  4IL1 A;  3LCP C;  1BR1 B;  3NSI A;  4CLN A;  4INW A;  2GV5 A;  1XA5 A;  2ZN9 A;  1IJ5 A;  5JJG A;  1OMV A;  2AAO A;  2K7C A;  1PSB A;  1Y1X A;  4PE0 A;  1J7P A;  1RTP 1;  1JFJ A;  1OMR A;  2MAZ A;  2L51 A;  1C7V A;  1OOI X;  1XFX O;  4JWQ A;  2GGM A;  2NXQ A;  1B7T Z;  5I2L A;  3LK0 A;  1UHJ A;  3PN7 C;  4ORA B;  2I94 A;  2LVK A;  2KGR A;  1J55 A;  1T14 A;  3Q8I A;  1L2O C;  1OMD A;  1YRT B;  2I18 A;  1NP8 A;  1N2D A;  1DEK A;  5AEQ A;  2JRF A;  2AMI A;  1RWY A;  3FE6 A;  5KU1 A;  5KTY A;  1DJY A;  1K9R A;  3R1P A;  1WRZ A;  5TNC A;  3NHT A;  1KFU L;  3GK1 A;  1ZFS A;  1N0Y A;  3DVJ A;  2KFF A;  2KYC A;  2K0J A;  2OTG B;  4OR9 B;  3DVK A;  5CSF A;  3KEV A;  3LKX B;  2IS9 A;  2F3Z A;  2QEV A;  1XFU O;  3GOF A;  2PMY A;  3BUM B;  1UWO A;  2L4H A;  3D10 A;  1J7R A;  2LVI A;  1DMO A;  2D8N A;  4M2O A;  2JWW A;  3L4A A;  4NQG A;  1KFX L;  1KSM A;  2LHI A;  1XFR A;  4L9M A;  2KAY A;  2LC5 A;  4PHM A;  3L47 A;  1OOG A;  5GQQ C;  2BKH B;  2CNP A;  3CGA A;  2M3O W;  2M9G A;  2WCE A;  4YI8 A;  1QIV A;  1B8C A;  1NX2 A;  2PRU A;  3LL8 B;  3C1V A;  1CDL A;  1L7Z A;  5AFP A;  2KQ6 A;  2SAS A;  2HQW A;  2K7D A;  3CR5 X;  3CZ0 A;  5HKZ A;  4MBE A;  2PSR A;  4QJ3 B;  1K9K A;  3KPX A;  2RE3 A;  3KAI A;  1EG3 A;  1KCY A;  2BE4 A;  1LVC D;  1YTZ C;  1B47 A;  2M8U A;  4XYN A;  4MRX A;  1C07 A;  4N1F A;  1JWD A;  2COL B;  1AHR A;  3EVV A;  3S0F A;  4AQJ A;  4IJ7 A;  2JU0 A;  1FW4 A;  3NSL A;  4AOM A;  1CMF A;  1Y1A A;  2MJW B;  2WCL A;  4F0Z B;  2ZRS A;  3ZNI A;  1AVS A;  2KAV A;  5HL1 A;  1F55 A;  3SS3 A;  2JT0 A;  1YW5 A;  4ORB B;  2Q5A A;  2MBX A;  2WCF A;  1H8B A;  1K9P A;  1TCO B;  1UHK A;  1SK6 D;  2JOJ A;  3I5G C;  5J3X A;  5KSZ A;  5ER5 A;  1KFU S;  5JOL A;  1NX0 A;  3L4H A;  1EJ3 A;  2L5Y A;  1C7W A;  1Y6W A;  3OB2 B;  4WRI A;  2KI6 D;  1KQM C;  3TS5 B;  1I5H W;  2ZQS A;  2JC2 A;  2Q4U A;  2BCB A;  1UHH A;  2Y5I A;  2KBM A;  1GGW A;  1QX5 B;  1RFJ A;  3DZT A;  1Y0V H;  4ZCU A;  1OE9 B;  2XP9 A;  1KFX S;  4YI9 A;  1S6J A;  2BBN A;  1OZO A;  4A0U A;  5EL2 A;  1A2X A;  2FOT A;  5FI6 A;  4ZCV A;  1QLS A;  1R2U A;  3AKB A;  3B88 A;  4PE4 A;  4M2Q A;  1K94 A;  2XPA A;  1RRO A;  2WCJ A;  4MN0 A;  3PQH A;  1XO5 A;  1PSR A;  1UP5 A;  3S0G A;  2E30 A;  3FWB A;  3RZS A;  3GK2 A;  1GGZ A;  1YVL A;  2K8M B;  4NDD A;  1OOH A;  1ODB A;  2ZQT A;  2FJU B;  2F2O A;  1PAL A;  2EC6 C;  2KHN A;  1F4O A;  3I5I C;  5CSI A;  1O6W A;  3A8R A;  1LXF C;  1IKU A;  1NMV A;  2BE6 A;  1RK9 A;  2BA1 A;  5HKY A;  1QXP A;  2MRD A;  1U5I A;  2RGI A;  1IG5 A;  1QJT A;  1WLZ A;  2KI4 B;  3AAK A;  3FWC A;  2K7B A;  3PSR A;  2L4J A;  4HSZ A;  1XYD A;  3NXA A;  1ALV A;  2LLT A;  3EKH A;  2KYF A;  4PHN A;  4DRW A;  1FPW A;  1QVI Z;  4N5X A;  2F8P A;  3EK4 A;  3FIA A;  2JXL A;  5PAL A;  3M7N A;  3S0D A;  1IRJ A;  1SCM B;  1AUI B;  1X02 A;  4FTG A;  4AQI A;  3EK8 A;  1QAS A;  2YAJ B;  3BOW A;  2WCK A;  3VRP A;  1EL4 A;  2Y1N A;  3OBV A;  1XFW O;  3SG6 A;  1A29 A;  1J7Q A;  5AAN A;  1B7T Y;  1XVJ A;  5BPJ A;  4F7F A;  3S0B A;  1OSA A;  3TDU A;  5AHT A;  3ZWH A;  5I2O A;  1SY9 A;  2ISD A;  4ORC B;  3VRQ A;  2F21 A;  3OB1 B;  2LP3 A;  4PHK A;  4INX A;  1BR4 B;  2L5X B;  3LLE A;  3WXA A;  4P5O E;  1C3Z A;  2G2B A;  4JQ0 D;  1UHI A;  1NCY A;  1CMG A;  2OTG C;  3CZ2 A;  2P70 A;  2WAE A;  4U86 A;  2ZAJ A;  1NSH A;  2BNX A;  1CNP A;  2WCH A;  3AKA A;  5AER A;  1F8H A;  2QDI A;  3EG5 B;  4ICB A;  2XP5 A;  3OHM B;  1PVA A;  1S1E A;  1K8U A;  3OX5 A;  3PM2 A;  1BF5 A;  1TNW A;  3O78 A;  4YGB B;  2M97 A;  2LLU A;  1YRU B;  1YX8 A;  1YUR A;  2ZQU A;  3SS5 A;  2JNX A;  5B8I B;  2JXC A;  4YGC B;  2DJY A;  1WR7 A;  2ITK A;  1J1E A;  2JPO A;  2P71 A;  4OVN F;  2ZR5 A;  3AAJ A;  4FQO A;  2DMV A;  1AK8 A;  1KQV A;  2LAJ A;  3PM8 A;  2Q91 A;  2NCP A;  2ERB A;  4MEW A;  2YSG A;  3I5F B;  1LA0 A;  4GUK A;  2HF5 A;  3NGV A;  1JFK A;  3S0E A;  2AUC A;  5DIC A;  2JTZ A;  3V2L A;  1QLK A;  4NDB A;  3VRN A;  1EH2 A;  1Z4H A;  2YSH A;  3CR4 X;  2EHB A;  3RLZ A;  4XJK A;  5K89 A;  3WHT B;  3JVT B;  2M1K B;  2OS8 B;  4OZD A;  4U85 A;  1WDC C;  1YR5 A;  4GAO A;  2KAX A;  4BY5 A;  1OOF A;  3SIA A;  4USL A;  2PAS A;  1K95 A;  4MZK A;  2M0R A;  1TNP A;  4PAL A;  1CFF A;  4YGE B;  3ODK A;  1QX2 A;  5I2Q A;  1JSA A;  3DVM A;  3BQ3 A;  3EK7 A;  1CTR A;  1SL8 A;  2LVV A;  2ZKM X;  2O5G A;  1U5I B;  1V1F A;  2JZI A;  1Q80 A;  1ZMZ A;  2QPT A;  1KK7 Z;  1M31 A;  1ZAC A;  3JTD B;  4CFR A;  1A75 A;  1WMV A;  5CSN A;  2V53 A;  3SIB A;  2CCM A;  3M85 A;  1K9U A;  1SR6 B;  3FE8 A;  1TR8 A;  2ZQV A;  1YVH A;  2KFG A;  2BBM A;  1JMQ A;  3D74 A;  1K96 A;  1EG4 A;  3CZ1 A;  2KLE A;  3PAL A;  3UO9 A;  4MRY A;  3B87 A;  4JD9 A;  5CPV A;  5HLV A;  3WNX B;  1S26 D;  2L2E A;  3BOW B;  3D78 A;  1GM0 A;  4WQ3 A;  2K7O A;  1QAT A;  3TDZ A;  1SYM A;  1PUL A;  4YRU A;  5I94 A;  2M1U A;  2MLF C;  2QEO A;  1MR8 A;  3KHE A;  3I5H C;  3SG2 A;  2Y8N B;  1BT6 A;  1KWO C;  3PN7 B;  5CSJ A;  3MQH A;  2NLN A;  4JPZ B;  2JPT A;  1TOP A;  1G33 A;  1L2O B;  2FCD A;  2L2C A;  3FS8 A;  1CDM A;  1DF0 A;  1QV0 A;  2PAL A;  1JUO A;  1J1D A;  3EVU A;  2LUC A;  2OPO A;  2H61 C;  2KNE A;  3IQO A;  2BL0 C;  2KI6 C;  5E62 A;  2KOT A;  2BKI B;  4PE7 A;  4E5R A;  1QVI Y;  1YUS A;  2XP3 A;  1NCZ A;  3EKJ A;  1S3P A;  1TNX A;  1TUJ A;  4M2P A;  1MF8 B;  2GGZ A;  4QJ4 B;  1MQ1 A;  1NX3 A;  1DTL A;  1SRA A;  1CFC A;  1ZUZ A;  1FBV A;  5E64 A;  3BFB A;  1YUT A;  3TUY C;  1SL7 A;  1IH0 A;  4CFQ A;  4C0K A;  2YSB A;  4ETO A;  2FCE A;  2LMV A;  1KK8 C;  1S5G Z;  2A4J A;  4P2Y B;  3R1V A;  3FSB A;  1WRL A;  3BFA A;  1BJF A;  1IIO A;  2VRG A;  3CYZ A;  1NPQ A;  4D1E A;  1WRK A;  4GGF C;  1CB1 A;  1H4B A;  4YBH B;  1TUZ A;  3QME A;  3SJS A;  2CT9 A;  1WLM A;  5D3O A;  1AJ4 A;  4N1G A;  2ZFD A;  3BJH A;  1W9Z A;  3PAT A;  2KLD A;  3RM1 A;  2YSI A;  1GJY A;  2MLE C;  4I5N B;  4PE1 A;  3SG7 A;  1JBA A;  1F8A B;  2NZ0 A;  2PYQ A;  2HQ8 A;  3TCZ A;  4XJK B;  1TCF A;  1CKK A;  1M46 A;  1SPY A;  2JTT A;  2O60 A;  2WC8 A;  4WQ2 A;  2CXJ A;  4A0T A;  2XP4 A;  1XFV O;  1IQ5 A;  3CTN A;  3R72 A;  5ER4 X;  4DS7 A;  1REC A;  1XFY O;  2QEH A;  2E6W A;  2BCA A;  2Y4Q A;  5D7F A;  1DGV A;  3L4L A;  2JMF A;  3PLF B;  1V1G A;  1DJH A;  1XFZ O;  2JT8 A;  5E5W A;  2LCP A;  3WH0 A;  2LAP A;  3OP0 A;  5FI2 A;  4A4B A;  1DEL A;  1QX7 A;  1CM1 A;  3I5G B;  2OWO A;  1ZCN A;  1F4Q A;  3KAF A;  1XK4 C;  1SBJ A;  3B7A A;  1A75 B;  3SG4 A;  3SG5 A;  4C0J A;  2K60 A;  4DUQ A;  3I5F C;  2WAD A;  1CM4 A;  1KQM B;  1YUU A;  1RP5 A;  3DXL A;  4HRG A;  2WC6 A;  1UUS A;  2XPB A;  3TC5 A;  1FI5 A;  2KSP A;  2LP2 A;  4DIR A;  1SCV A;  4HRH A;  3FSC A;  3CZT X;  3O4Y A;  1W7J B;  2LVJ A;  3SS4 A;  5G08 A;  4NDC A;  3VGO A;  4PDZ A;  4GPL B;  1DQE A;  3ICB A;  3QRX A;  4A4C A;  1QIW A;  5F6T A;  3KAG A;  1LA3 A;  4I5L B;  1TTX A;  3IQQ A;  4MVF A;  1YX7 A;  2LNK A;  1DC1 A;  1CLL A;  3O2P A;  3CDN A;  2WOS A;  1IJ6 A;  1DF0 B;  1ORG A;  2EC6 B;  3A4U B;  3I5I B;  3JTD C;  3K1E A;  4BY4 A;  1CFD A;  2QRV A;  3OOB A;  1KK7 Y;  3UNW A;  1PIN A;  2JUL A;  2ZR4 A;  3MSE B;  1JC2 A;  2LMU A;  1Z2C B;  2BEC A;  3F45 A;  1NCX A;  2ZNE A;  5HKW A;  1FF1 A;  2KDH A;  2QAC A;  1F54 A;  2GTE A;  2M8J A;  2I7A A;  1CLB A;  1F70 A;  5FYX A;  1Y1U A;  1QV1 A;  4GGN A;  3D76 A;  3IVT A;  4I5J A;  3VRO A;  3S0A A;  3BUN B;  2JNF A;  3KCE A;  3NHI A;  1S6C A;  2EZ5 W;  2K2F A;  1S6I A;  1M63 B;  4GFT A;  3TZ1 A;  1CLM A;  2JQ6 A;  2JT3 A;  2YGU A;  3M0W A;  3OX6 A;  4FQT A;  1BLQ A;  2YSF A;  1IWQ A;  5CQ2 A;  3TS5 C;  1K93 D;  3SG3 A;  1E8A A;  1RJV A;  5E65 A;  2ZN8 A;  1KSO A;  1PK0 D;  3CWG A;  1QTX A;  4OV2 A;  1DT7 B;  1BOC A;  1BOD A;  4U84 A;  4CID A;  3DF0 A;  3DD4 A;  3DYE A;  4E68 A;  2BAP A;  2WCM A;  1DJX A;  1DJI A;  3NSK A;  5HLO A;  1J7O A;  2H61 A;  3MCB A;  2ZND A;  3GK4 X;  1LS8 A;  2EGD A;  2M3W A;  1MHO A;  3D0Y A;  1A4P A;  1R6P A;  1TRF A;  3FE9 A;  2BCX A;  4PCW A;  1DJG A;  1A03 A;  1FI6 A;  1B9A A;  2M29 A;  2DWV A;  3H4S E;  1P28 A;  1S5G Y;  2F2P A;  1SNL A;  3D77 A;  3EVR A;  1MUX A;  1DJW A;  2H2K A;  2M7N A;  3DVE A;  3NTP A;  4QIB A;  2LM5 A;  4PT1 A;  3E3R A;  4TNC A;  1JF0 A;  4R1E A;  4U8D A;  3VRR A;  1NWD A;  3N7H A;  4DCK A;  2KI4 C;  1K90 D;  4JKT A;  3WHU B;  3BFH A;  3KAB A;  1ALW A;  1OW4 A;  1W7I B;  3PJI A;  2PQL A;  4GGF A;  1UHN A;  2FJY A;  3HX4 A;  1IQ3 A;  2LUX A;  1UUR A;  1MXE A;  5IBW A;  1D1O A;  5DKQ A;  1SCM C;  2P6B B;  1CDN A;  4KYN A;  1B8L A;  3LK1 A;  1NYA A;  2KQY A;  1MWN A;  5DKN A;  1QS7 A;  1B1G A;  1NUB A;  3O4X A;  1B4C A;  4CPV A;  4HRE E;  4QJ5 B;  4UPG A;  1TNQ A;  3BYA A;  1C3Y A;  1WDC B;  3IF7 A;  2JX8 A;  2L98 A;  5AXI A;  1FLC A;  2SCP A;  1OZS A;  3PFV A;  5HYD A;  3CR2 A;  1BU3 A;  2M49 B;  3CS1 A;  1NIW A;  3KAD A;  3TDB A;  1CDP A;  1DJZ A;  3BXK A;  1G4Y R;  2M7L A;  3CLN A;  3R1O A;  2E45 A;  1LKJ A;  1SL9 A;  1SMG A;  1WY9 A;  2MA2 A;  3KF9 A;  1XK4 A;  1PRW A;  4YGD B;  1LIN A;  2WND A;  2LHL A;  3B86 A;  3BUO B;  2F33 A;  2LE9 B;  4Q04 A;  1N65 A;  3TDI A;  5E66 A;  1TWO A;  1SSE B;  1NX1 A;  1OOJ A;  1VRK A;  2QEB A;  1ZOT B;  1G8I A;  2F3Y A;  2MHH A;  3O6B A;  2LAN A;  2L4I A;  2MDI A;  2XP8 A;  1EXR A;  1TK7 A;  3LKX A;  2H8V A;  3KAH A;  2JV4 A;  1K9Q A;  1GQM A;  1SW8 A;  1HT9 A;  1HQV A;  1S36 A;  2WC5 A;  5DKR A;  1AJ5 A;  4MZL A;  2JXW A;  2XP6 A;  4GNK B;  2LLS A;  2Y1M A;  5U47 A;  3B6X A;  2L50 A;  3I5H B;  3K21 A;  3BUW B;  1KWO B;  2M8I A;  3D75 A;  3DY9 A;  4PHJ A;  2ZR6 A;  3CNG A;  2CBL A;  4YGA A;  3DF0 B;  1K2H A;  2L0P A;  4GBA A;  4MLW A;  2XP7 A;  2K2A A;  3KO0 A;  2KBI A;  1M39 A;  1PVB A;  1BMO A;  2HET A;  3MCB B;  2BL0 B;  3VB1 A;  1M45 A;  3D0Y B;  3CAB A;  1DVI A;  1QWV A;  3OGN A;  4REX A; 
#chains in the Genus database with same CATH homology
 1OQP A;  4C0L A;  2DOQ A;  1JF2 A;  2CTN A;  3JVT C;  2OS8 C;  3HCM A;  3NSO A;  2DK1 A;  1F71 A;  1TIZ A;  4GLX A;  1SKT A;  1DGU A;  4MZJ A;  2ZRT A;  3TUY B;  2R2I A;  2PVB A;  1AP4 A;  3BUX B;  2LMT A;  1IGV A;  2KGB C;  5D69 A;  1KK8 B;  1MXL C;  2HPS A;  2LV7 A;  3LE4 A;  2KFH A;  2G9B A;  2B1U A;  5I8N A;  2KXQ A;  1B8R A;  3MQG A;  2NCO A;  2I2R E;  3FS7 A;  2DK7 A;  1SR6 C;  2WOR A;  4OCI A;  2WCB A;  4I5K A;  1CFP A;  4OKH A;  1TN4 A;  2K61 A;  4MSP A;  2TN4 A;  4IL1 A;  3LCP C;  1BR1 B;  3NSI A;  4CLN A;  2GV5 A;  1XA5 A;  2ZN9 A;  1IJ5 A;  5JJG A;  1OMV A;  2AAO A;  2K7C A;  1PSB A;  1Y1X A;  4PE0 A;  1J7P A;  1RTP 1;  1JFJ A;  1OMR A;  2MAZ A;  2L51 A;  1C7V A;  1XFX O;  4JWQ A;  2GGM A;  2NXQ A;  1B7T Z;  5I2L A;  3LK0 A;  1UHJ A;  3PN7 C;  4ORA B;  2I94 A;  2LVK A;  2KGR A;  1J55 A;  1L2O C;  1OMD A;  1YRT B;  2I18 A;  1NP8 A;  1N2D A;  5AEQ A;  2JRF A;  2AMI A;  1RWY A;  5KU1 A;  5KTY A;  1K9R A;  1DJY A;  1WRZ A;  5TNC A;  1KFU L;  3GK1 A;  1ZFS A;  1N0Y A;  3DVJ A;  2KFF A;  2KYC A;  2K0J A;  2OTG B;  4OR9 B;  3DVK A;  5CSF A;  3KEV A;  3LKX B;  2IS9 A;  2F3Z A;  1XFU O;  3GOF A;  2PMY A;  3BUM B;  1UWO A;  2L4H A;  3D10 A;  1J7R A;  2LVI A;  1DMO A;  2D8N A;  4M2O A;  2JWW A;  4NQG A;  1KFX L;  1KSM A;  2LHI A;  4L9M A;  4PHM A;  2KAY A;  2LC5 A;  5GQQ C;  2BKH B;  2CNP A;  3CGA A;  2M3O W;  2M9G A;  2WCE A;  4YI8 A;  1QIV A;  1B8C A;  1NX2 A;  2PRU A;  3LL8 B;  3C1V A;  1CDL A;  1L7Z A;  5AFP A;  2KQ6 A;  2SAS A;  2HQW A;  2K7D A;  3CR5 X;  5HKZ A;  4MBE A;  2PSR A;  4QJ3 B;  1K9K A;  2RE3 A;  3KAI A;  1EG3 A;  1KCY A;  2BE4 A;  1LVC D;  1YTZ C;  1B47 A;  2M8U A;  4XYN A;  4MRX A;  1C07 A;  4N1F A;  1JWD A;  2COL B;  1AHR A;  3EVV A;  4AQJ A;  2JU0 A;  1FW4 A;  3NSL A;  4AOM A;  1CMF A;  1Y1A A;  2MJW B;  4F0Z B;  2ZRS A;  3ZNI A;  1AVS A;  2KAV A;  1F55 A;  2JT0 A;  1YW5 A;  4ORB B;  2Q5A A;  2MBX A;  2WCF A;  1H8B A;  1K9P A;  1TCO B;  1UHK A;  1SK6 D;  2JOJ A;  3I5G C;  5J3X A;  5KSZ A;  5ER5 A;  1KFU S;  5JOL A;  1NX0 A;  3L4H A;  1EJ3 A;  1C7W A;  1Y6W A;  3OB2 B;  4WRI A;  2KI6 D;  1KQM C;  3TS5 B;  1I5H W;  2ZQS A;  2JC2 A;  2Q4U A;  2BCB A;  1UHH A;  2Y5I A;  2KBM A;  1GGW A;  1QX5 B;  1RFJ A;  1Y0V H;  4ZCU A;  1OE9 B;  2XP9 A;  1KFX S;  4YI9 A;  1S6J A;  2BBN A;  1OZO A;  4A0U A;  1A2X A;  2FOT A;  4ZCV A;  1QLS A;  1R2U A;  3AKB A;  4PE4 A;  4M2Q A;  1K94 A;  2XPA A;  1RRO A;  4MN0 A;  3PQH A;  1XO5 A;  1PSR A;  1UP5 A;  2E30 A;  3FWB A;  3GK2 A;  1GGZ A;  1YVL A;  2K8M B;  4NDD A;  1ODB A;  2ZQT A;  2FJU B;  2F2O A;  1PAL A;  2EC6 C;  2KHN A;  1F4O A;  3I5I C;  5CSI A;  1O6W A;  3A8R A;  1LXF C;  1IKU A;  1NMV A;  2BE6 A;  1RK9 A;  2BA1 A;  5HKY A;  1QXP A;  2MRD A;  1U5I A;  2RGI A;  1IG5 A;  1QJT A;  1WLZ A;  2KI4 B;  3AAK A;  3FWC A;  2K7B A;  3PSR A;  2L4J A;  4HSZ A;  1XYD A;  3NXA A;  1ALV A;  2LLT A;  3EKH A;  2KYF A;  4PHN A;  4DRW A;  1FPW A;  1QVI Z;  4N5X A;  2F8P A;  3EK4 A;  3FIA A;  2JXL A;  5PAL A;  3M7N A;  1IRJ A;  1SCM B;  1AUI B;  1X02 A;  4FTG A;  4AQI A;  3EK8 A;  1QAS A;  2YAJ B;  3BOW A;  3VRP A;  1EL4 A;  2Y1N A;  1XFW O;  3SG6 A;  1A29 A;  1J7Q A;  5AAN A;  1B7T Y;  1XVJ A;  5BPJ A;  1OSA A;  3TDU A;  5AHT A;  3ZWH A;  5I2O A;  1SY9 A;  2ISD A;  4ORC B;  3VRQ A;  2F21 A;  3OB1 B;  2LP3 A;  4PHK A;  1BR4 B;  2L5X B;  3LLE A;  3WXA A;  4P5O E;  4JQ0 D;  2G2B A;  1UHI A;  1NCY A;  1CMG A;  2OTG C;  2WAE A;  4U86 A;  2ZAJ A;  1NSH A;  1CNP A;  3AKA A;  5AER A;  1F8H A;  4ICB A;  2XP5 A;  3OHM B;  1PVA A;  1S1E A;  1K8U A;  3OX5 A;  1BF5 A;  1TNW A;  3O78 A;  4YGB B;  2M97 A;  2LLU A;  1YRU B;  1YX8 A;  1YUR A;  2ZQU A;  2JNX A;  5B8I B;  2JXC A;  4YGC B;  2DJY A;  1WR7 A;  2ITK A;  1J1E A;  4OVN F;  2ZR5 A;  3AAJ A;  4FQO A;  2DMV A;  1AK8 A;  1KQV A;  2LAJ A;  3PM8 A;  2Q91 A;  2NCP A;  4MEW A;  2YSG A;  3I5F B;  1LA0 A;  4GUK A;  2HF5 A;  1JFK A;  2AUC A;  2JTZ A;  3VRN A;  1QLK A;  4NDB A;  1EH2 A;  2YSH A;  3CR4 X;  2EHB A;  3RLZ A;  4XJK A;  5K89 A;  3WHT B;  3JVT B;  2M1K B;  2OS8 B;  4U85 A;  1WDC C;  1YR5 A;  4GAO A;  2KAX A;  4BY5 A;  3SIA A;  4USL A;  2PAS A;  1K95 A;  4MZK A;  2M0R A;  1TNP A;  4PAL A;  1CFF A;  4YGE B;  3ODK A;  1QX2 A;  5I2Q A;  1JSA A;  3DVM A;  3BQ3 A;  3EK7 A;  1CTR A;  1SL8 A;  2LVV A;  2ZKM X;  2O5G A;  1U5I B;  1V1F A;  2JZI A;  1Q80 A;  1ZMZ A;  2QPT A;  1KK7 Z;  1M31 A;  1ZAC A;  3JTD B;  4CFR A;  1A75 A;  1WMV A;  5CSN A;  2V53 A;  3SIB A;  2CCM A;  3M85 A;  1K9U A;  1SR6 B;  1TR8 A;  2ZQV A;  1YVH A;  2KFG A;  2BBM A;  1JMQ A;  1K96 A;  1EG4 A;  3PAL A;  4MRY A;  5CPV A;  5HLV A;  3WNX B;  1S26 D;  2L2E A;  3BOW B;  4WQ3 A;  2K7O A;  1QAT A;  3TDZ A;  1SYM A;  1PUL A;  4YRU A;  2M1U A;  2MLF C;  1MR8 A;  3KHE A;  3I5H C;  3SG2 A;  2Y8N B;  1BT6 A;  1KWO C;  3PN7 B;  5CSJ A;  3MQH A;  2NLN A;  4JPZ B;  2JPT A;  1TOP A;  1G33 A;  1L2O B;  2FCD A;  3FS8 A;  1CDM A;  1DF0 A;  1QV0 A;  2PAL A;  1JUO A;  1J1D A;  3EVU A;  2LUC A;  2OPO A;  2H61 C;  2KNE A;  3IQO A;  2BL0 C;  2KI6 C;  5E62 A;  2KOT A;  2BKI B;  4PE7 A;  4E5R A;  1QVI Y;  1YUS A;  2XP3 A;  1NCZ A;  3EKJ A;  1S3P A;  1TNX A;  4M2P A;  1MF8 B;  2GGZ A;  4QJ4 B;  1MQ1 A;  1NX3 A;  1DTL A;  1SRA A;  1CFC A;  1ZUZ A;  1FBV A;  5E64 A;  1YUT A;  3TUY C;  1SL7 A;  1IH0 A;  4CFQ A;  4C0K A;  2YSB A;  4ETO A;  2FCE A;  2LMV A;  1KK8 C;  1S5G Z;  2A4J A;  4P2Y B;  3FSB A;  1WRL A;  1BJF A;  2VRG A;  1CB1 A;  1NPQ A;  4D1E A;  1WRK A;  4GGF C;  1H4B A;  4YBH B;  3SJS A;  2CT9 A;  1WLM A;  1AJ4 A;  4N1G A;  2ZFD A;  3PAT A;  3RM1 A;  2YSI A;  1GJY A;  2MLE C;  4I5N B;  4PE1 A;  3SG7 A;  1JBA A;  1F8A B;  2NZ0 A;  3TCZ A;  2HQ8 A;  4XJK B;  1TCF A;  1CKK A;  1M46 A;  1SPY A;  2JTT A;  2O60 A;  2WC8 A;  4WQ2 A;  2CXJ A;  4A0T A;  2XP4 A;  1XFV O;  1IQ5 A;  3CTN A;  5ER4 X;  4DS7 A;  1REC A;  1XFY O;  2E6W A;  2BCA A;  2Y4Q A;  5D7F A;  1DGV A;  2JMF A;  3PLF B;  1V1G A;  1DJH A;  1XFZ O;  2JT8 A;  5E5W A;  2LCP A;  3WH0 A;  2LAP A;  3OP0 A;  4A4B A;  1QX7 A;  1CM1 A;  3I5G B;  2OWO A;  1ZCN A;  1F4Q A;  3KAF A;  1XK4 C;  1SBJ A;  1A75 B;  3SG4 A;  3SG5 A;  4C0J A;  4DUQ A;  3I5F C;  2WAD A;  1CM4 A;  1KQM B;  1YUU A;  1RP5 A;  4HRG A;  2XPB A;  1UUS A;  3TC5 A;  1FI5 A;  2KSP A;  2LP2 A;  4DIR A;  1SCV A;  4HRH A;  3FSC A;  3CZT X;  3O4Y A;  1W7J B;  2LVJ A;  5G08 A;  4NDC A;  3VGO A;  4PDZ A;  4GPL B;  3ICB A;  4A4C A;  3QRX A;  1QIW A;  5F6T A;  3KAG A;  1LA3 A;  4I5L B;  1TTX A;  3IQQ A;  4MVF A;  1YX7 A;  2LNK A;  1CLL A;  3O2P A;  1BG1 A;  2WOS A;  1IJ6 A;  1DF0 B;  2EC6 B;  3A4U B;  3I5I B;  3JTD C;  2QRV A;  4BY4 A;  1CFD A;  3OOB A;  1KK7 Y;  1PIN A;  2JUL A;  2ZR4 A;  3MSE B;  2LMU A;  3F45 A;  2BEC A;  1NCX A;  2ZNE A;  5HKW A;  1FF1 A;  2KDH A;  2QAC A;  1F54 A;  2M8J A;  2I7A A;  1CLB A;  1F70 A;  5FYX A;  1Y1U A;  1QV1 A;  4GGN A;  4I5J A;  3VRO A;  3BUN B;  2JNF A;  3KCE A;  2EZ5 W;  1S6C A;  2K2F A;  1S6I A;  1M63 B;  4GFT A;  3TZ1 A;  1CLM A;  2JQ6 A;  2JT3 A;  3M0W A;  3OX6 A;  1BLQ A;  2YSF A;  1IWQ A;  5CQ2 A;  3TS5 C;  1K93 D;  3SG3 A;  1E8A A;  1RJV A;  5E65 A;  2ZN8 A;  1KSO A;  1PK0 D;  3CWG A;  1QTX A;  4OV2 A;  1DT7 B;  1BOC A;  1BOD A;  4U84 A;  4CID A;  3DF0 A;  3DD4 A;  4E68 A;  1DJX A;  1DJI A;  3NSK A;  5HLO A;  1J7O A;  2H61 A;  3MCB A;  2ZND A;  3GK4 X;  2EGD A;  2M3W A;  1MHO A;  3D0Y A;  1A4P A;  1R6P A;  1TRF A;  2BCX A;  4PCW A;  1DJG A;  1A03 A;  1FI6 A;  1B9A A;  2M29 A;  2DWV A;  3H4S E;  1S5G Y;  2F2P A;  1SNL A;  3EVR A;  1MUX A;  1DJW A;  2H2K A;  2M7N A;  3DVE A;  3NTP A;  4QIB A;  2LM5 A;  3E3R A;  4TNC A;  1JF0 A;  4R1E A;  4U8D A;  3VRR A;  1NWD A;  4DCK A;  2KI4 C;  1K90 D;  3WHU B;  3KAB A;  1ALW A;  1W7I B;  4GGF A;  1UHN A;  3HX4 A;  1IQ3 A;  2LUX A;  1UUR A;  1MXE A;  5IBW A;  1D1O A;  5DKQ A;  1SCM C;  2P6B B;  1CDN A;  1B8L A;  3LK1 A;  1NYA A;  2KQY A;  1MWN A;  5DKN A;  1QS7 A;  1B1G A;  1NUB A;  1B4C A;  4CPV A;  4HRE E;  4QJ5 B;  4UPG A;  1TNQ A;  3BYA A;  1WDC B;  3IF7 A;  2JX8 A;  2L98 A;  5AXI A;  1FLC A;  2SCP A;  1OZS A;  3PFV A;  5HYD A;  3CR2 A;  1BU3 A;  2M49 B;  3CS1 A;  1NIW A;  3KAD A;  3TDB A;  1CDP A;  1DJZ A;  3BXK A;  1G4Y R;  2M7L A;  3CLN A;  2E45 A;  1LKJ A;  1SL9 A;  1SMG A;  1WY9 A;  2MA2 A;  3KF9 A;  1XK4 A;  1PRW A;  4YGD B;  1LIN A;  2WND A;  2LHL A;  3BUO B;  3TDI A;  2F33 A;  2LE9 B;  4Q04 A;  1N65 A;  5E66 A;  1NX1 A;  1OOJ A;  1VRK A;  1ZOT B;  1G8I A;  2F3Y A;  2MHH A;  3O6B A;  2LAN A;  2L4I A;  2MDI A;  2XP8 A;  1EXR A;  1TK7 A;  3LKX A;  3KAH A;  2JV4 A;  1K9Q A;  1GQM A;  1SW8 A;  1HT9 A;  1HQV A;  1S36 A;  5DKR A;  1AJ5 A;  4MZL A;  2JXW A;  2XP6 A;  4GNK B;  2LLS A;  2Y1M A;  5U47 A;  2L50 A;  3I5H B;  3K21 A;  3BUW B;  1KWO B;  2M8I A;  2ZR6 A;  3CNG A;  4PHJ A;  2CBL A;  4YGA A;  3DF0 B;  1K2H A;  2L0P A;  4GBA A;  4MLW A;  2XP7 A;  2K2A A;  3KO0 A;  2KBI A;  1M39 A;  1PVB A;  1BMO A;  2HET A;  3MCB B;  2BL0 B;  1M45 A;  3D0Y B;  1JC2 A;  1DVI A;  3KPX A;  4REX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...