1PINA

Pin1 peptidyl-prolyl cis-trans isomerase from homo sapiens
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE
publication title Structural and functional analysis of the mitotic rotamase Pin1 suggests substrate recognition is phosphorylation dependent.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1998-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1pinA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1pinA02
1WMVA 2XP9A 3UI6A 2JXWA 1FAPA 2PV2A 4FN2A 1EQ3A 2YSBA 1JVWA 4DROA 4J4OA 2DG3A 3PA7A 5DIVA 4DIPA 2KE0A 1FKGA 4ODPA 2KO7A 3KACA 2DK7A 2XPAA 1K9RA 3GPKA 3KAGA 3KABA 3UQIA 2RUDA 2L4JA 4JFLA 1EYMA 4DH0A 1K9QA 1M5YA 2JV4A 1Q6HA 2XP8A 3KZ7A 3UQBA 2IF4A 4MGVA 2LPVA 1T11A 3LE4A 2VN1A 3ODKA 2D9FA 2M08A 4IPXA 1FKIA 1Q6UA 1TCOC 5DITA 5J6EA 4ITZA 4DRHA 3TCZA 3CNGA 4DRPA 2M2AA 3O5DA 4ODMA 5DIUA 2DMVA 2MLYA 4IQ2A 1U79A 2LKNA 3UI4A 4LAWA 2ZQSA 3TC5A 3JYJA 2M8JA 1B6CA 3RFWA 3O5FA 2MNTA 1J4HA 1EG3A 2ZQTA 3UI5A 4FAPA 4MSPA 1NMWA 2YSHA 1D7JA 1NMVA 2DWVA 1ZK6A 4JFMA 5D75A 4LAYA 4JFKA 4R0XA 3MDYB 3PRBA 2YSIA 1PBKA 3O5QA 1FKDA 2RURA 3I6CA 3KCEA 1FKTA 1HXVA 2YSFA 1A7XA 4W9QA 1FKRA 4U84A 1JNSA 2XP7A 2MLXA 2RUCA 1I5HW 2JZVA 1EG4A 3O5LA 2UZ5A 1ROUA 3EY6A 4REXA 1FKFA 3IK8A 2E45A 2MF9A 2M1IA 3L4HA 1KT1A 1Q1CA 2LGOA 4TNSA 4E5RA 2F2DA 1J4RA 3B7XA 1R9HA 4LAVA 4DZ2A 1FKBA 4ODQA 1FKHA 2BA1A 2KFWA 2JX8A 1YW5A 4TW7A 2ZR4A 3UQAA 1Y0OA 4J4NA 2ZQUA 2PPOA 2PBCA 3M7NA 5HUAA 3KAIA 2XP6A 2PPPA 4ODNA 3O5RA 4DZ3A 1FKJA 4QT3A 5I98A 1N1AA 4JFJA 2EZ5W 3IKGA 4N19A 1BKFA 1BL4A 2PPNA 4BF8A 4JYSA 2MDIA 3M85A 2FAPA 5B8IC 5HKGA 2M8IA 2ZR5A 2DK1A 1FD9A 1YATA 2MLZA 2ZR6A 1D7IA 5AHTA 3O5IA 4GIVA 2RSEA 1P5QA 2K8IA 2ZAJA 3O5OA 2LAJA 1F40A 4DT4A 2XP4A 2PV1A 1O6WA 3O5EA 2OFNA 4TW8A 1FKKA 4W9OA 5HWCA 2DG4A 3O5PA 2JMFA 4ODKA 3NRKA 1QPFA 2Q5AA 3NI6A 3JYMA 2RE3A 1TK7A 2DJYA 4ODOA 4QIBA 2FKEA 1ROTA 4U86A 2DG9A 3PRDA 1NSGA 3O5MA 4IQCA 1J6YA 2AWGA 1C9HA 2F4EA 1KT0A 3KAHA 5CQ2A 1FKSA 2MPHA 1WR7A 5GPGA 3UF8A 2F21A 2N87A 3O5JA 5HTGA 3JXVA 1F8AB 1D6OA 3IKDA 2LJ4A 3KADA 4O2TA 4JFIA 1PINA 1JNTA 3FAPA 3IHZA 2L2SA 2YSGA 1FKLA 2ZQVA 4U85A 3RGCA 4GGQA 1ZCNA 4ODRA 4LAXA 1FJDA 3CGNA 3H9RB 2KGJA 3NTPA 5HWBA 4DRMA 1D7HA 4DRNA 2ITKA 5HT1A 1Q6IA 5HW6A 2Y78A 2RUQA 3TDBA 2VCDA 4TW6A 2XPBA 4QT2A 4DRKA 4C02B 4TYOA 5HW8A 1W26A 3O5KA 4DRJA 4G2PA 5HW7A 1QPLA 1JMQA 3LUOA 2M3OW 4TX0A 4W9PA 1QZ2A 3O5GA 1L1PA 3OOBA 2PV3A 2KXQA 2KI3A 4DRQA 4NNRA 3KAFA 2XP3A 2XP5A 4G50A 4ODLA 3CGMA 1J4IA 4DRIA 2KR7A 3WH0A 5BXJA 2RQSA 3VAWA
chains in the Genus database with same CATH superfamily
1WMVA 3WD3A 2XP9A 3UI6A 2JXWA 4KQZA 1FAPA 2PV2A 4FN2A 1HJXA 3CHCA 1EQ3A 2YSBA 1JVWA 4DROA 4J4OA 2QF8A 1FFQA 3G6MA 5BXJA 2A3AA 2DG3A 3ARVA 3PA7A 5DIVA 4DIPA 2KE0A 3G6LA 1FKGA 4ODPA 2KO7A 2OLHA 3KACA 2DK7A 2XPAA 1K9RA 1EHNA 1W9UA 3WL1A 4QZVB 3GPKA 2FDMA 4WIWA 3KAGA 4Z2JA 1LJYA 3KABA 3UQIA 2RUDA 2L4JA 4JFLA 1HKMA 1EYMA 1GRJA 4DH0A 3B9EA 3WD0A 1K9QA 3ARXA 3CHDA 1M5YA 2JV4A 2PI6A 2WLYA 1Q6HA 3WKZA 2XP8A 3KZ7A 3UQBA 2IF4A 3RM9A 4MGVA 1ITXA 2YAJB 4AY1A 4DWSB 2LPVA 4Z2GA 1T11A 4IT6A 3LE4A 1LG1A 2VN1A 4NSBA 1HJVA 4WKAA 3ODKA 5E65A 4DWSD 1ZBWA 3FS8A 2D9FA 3RM8A 4MAVA 2M08A 4IPXA 2YBTA 4MNJA 1FKIA 1Q6UA 1TCOC 3RM4A 1HKIA 3W4RA 3WD4A 5DITA 5J6EA 4ITZA 1NWTA 4DRHA 3TCZA 3CNGA 4DRPA 2M2AA 3O5DA 3BMBA 1W1TA 1KFWA 4ODMA 5DIUA 2O92A 2DMVA 2MLYA 4IQ2A 1UR8A 1U79A 5E64A 1LG2A 1JNEA 4DWSA 2LKNA 3UI4A 3WQWA 1SYTA 4LAWA 2ZQSA 1ZBVA 2ETNA 3TC5A 4S3JA 5U47A 3JYJA 2DSVA 2M8JA 1B6CA 4P8VA 3RFWA 1TFVA 1H0IA 3O5FA 1W1PA 2WK2A 3FSBA 2MNTA 1J4HA 1E6ZA 1EG3A 2ZQTA 2EULA 3UI5A 4FAPA 3FXYA 3CHFA 3MCBB 4MSPA 1ZL1A 1NMWA 2DT0A 4XAKA 3WD2A 2YSHA 1D7JA 1NMVA 2DWVA 1ZK6A 3ARQA 2DSWA 4JFMA 5D75A 4LAYA 2A3EA 4Z2LA 4JFKA 2P4VA 4R0XA 3MDYB 4IT4A 3PRBA 2YSIA 1PBKA 1X6LA 3O5QA 1FKDA 4A0TA 2RURA 3I6CA 3KCEA 1XHGA 1FKTA 1EIBA 4HBOA 1OGGA 3PQHA 1HXVA 2YSFA 1A7XA 4W9QA 1FKRA 4LGXA 3CHEA 4ZPWR 4U84A 1JNSA 3MCBA 4ZPVR 2XP7A 3AS1A 2MLXA 2RUCA 1I5HW 2JZVA 1EG4A 3O5LA 2UZ5A 4MTVA 4MNMA 3FY1A 1ROUA 3EY6A 4DWSC 4REXA 4HBEA 3WQVA 1FKFA 3IK8A 2E45A 2MF9A 2M1IA 1TR8A 3L4HA 1KT1A 1Q1CA 2LGOA 1FLCA 4TNSA 4Z2IA 4E5RA 2F2DA 1VF8A 1ZBCA 1J4RA 3B7XA 1R9HA 3BXWA 1NWUA 4LAVA 4DZ2A 1FKBA 4ODQA 1FKHA 2BA1A 2KFWA 2JX8A 2B31A 4P8XA 1YW5A 1ZBKA 2PN0A 4TW7A 2ZR4A 3UQAA 1Y0OA 4J4NA 2ZQUA 2PPOA 2PBCA 4L72B 4HARA 3M7NA 5HUAA 3KAIA 2XP6A 3PRAA 1W9PA 1W1YA 2PPPA 4ODNA 3O5RA 5DF0A 1FKJA 4DZ3A 4QT3A 1GOIA 5I98A 1N1AA 4MPKA 5GQBA 4JFJA 2EZ5W 3IKGA 4N19A 2DT2A 1BKFA 1BL4A 2PPNA 3AQUA 4BF8A 4JYSA 2AOSA 1LL7A 2DSUA 1E6RA 2MDIA 3OA5A 4PTMA 3B8SA 2WAEA 3M85A 1HJWA 2WM0A 1NWRA 2FAPA 5B8IC 5HKGA 4WKHA 2WLZA 4A0UA 2M8IA 3AS2A 2ZR5A 2DK1A 5GPRA 4S3KA 1FD9A 1CTNA 1YATA 2MLZA 3ARTA 1O6IA 1OGBA 1RP5A 2ZR6A 3WIJA 1D2KA 4Z2KA 1IX5A 1D7IA 5AHTA 2QRVA 3O5IA 4GIVA 1NWSA 1P5QA 2K8IA 2RSEA 2ZAJA 4WKFA 3O5OA 2LAJA 3MQGA 1F40A 1LL4A 4KR0B 4DT4A 5JH8A 1GPFA 2WADA 2XP4A 1NH6A 5E66A 2OWOA 2PV1A 3ARZA 1O6WA 3O5EA 2DT1A 2OFNA 4TW8A 1FKKA 4W9OA 5HWCA 4Q7NA 4UDMA 2DG4A 2G41A 3O5PA 2JMFA 1JCHB 4ODKA 3NRKA 1QPFA 1HKKA 3LKXB 3ARYA 2Q5AA 5DO2A 4URIA 3NI6A 1XRVA 3JYMA 2RE3A 3B9DA 3AS3A 3PR9A 1TK7A 2DJYA 4ODOA 2Y8NB 4QIBA 2FKEA 1ROTA 4U86A 2DG9A 3PRDA 1NSGA 4WJXA 3O5MA 4P8WA 3ALGA 4IQCA 1J6YA 2AWGA 2YBUA 3GU0A 1C9HA 2F4EA 1HKJA 1KT0A 3KAHA 4Z2HA 5CQ2A 1FKSA 1E15A 2B5UB 2MPHA 3FSCA 1WR7A 3ARUA 1UR9A 1W9VA 5GPGA 4ZS6A 1E44A 3UF8A 2F21A 4NZCA 2N87A 3O5JA 5HTGA 3JXVA 3MQHA 3LKXA 3B9AA 1F8AB 1D6OA 1JNDA 3IKDA 2LJ4A 2G8ZA 1ZU8A 2DPEA 3KADA 4O2TA 4JFIA 1PINA 1WNOA 1OWQA 4ZPTR 1JNTA 4MNLA 3FAPA 1LL6A 3IHZA 2L2SA 2YSGA 1FKLA 2ZQVA 2IUZA 4U85A 3RGCA 4GGQA 1ZCNA 4ODRA 5E5WA 2DSZA 4LAXA 1FJDA 4L3NA 3CGNA 3H9RB 3GTYX 2KGJA 3NTPA 1E6NA 5HWBA 4DRMA 1RD6A 1GUVA 1D7HA 4DRNA 2ITKA 5HT1A 1Q6IA 4W5UA 5HW6A 2Y78A 1W1VA 2RUQA 3TDBA 2VCDA 4Q22A 4TW6A 2XPBA 4QT2A 4DRKA 4C02B 4TYOA 1X6NA 1LQ0A 2A3BA 5HW8A 2ESCA 3CH9A 1W26A 3O5KA 4DRJA 4G2PA 5HW7A 5E62A 1QPLA 1K9TA 3AROA 3ALFA 1JMQA 3LUOA 4R5EA 2M3OW 1WAWA 4TX0A 3WD1A 4W9PA 1QZ2A 3WL0A 1H0GA 1ZB5A 5DEZA 3O5GA 1L1PA 4MNKA 5HBFA 2O9OA 3OOBA 2PV3A 2KXQA 2KI3A 3AS0A 1FFRA 3ARRA 3QOKA 4DRQA 4NNRA 4WK9A 3KAFA 2XP3A 3ARWA 2XP5A 4G50A 2A3CA 4ODLA 3CGMA 1J4IA 1SR0A 1WB0A 3RMEA 3ARSA 1E9LA 4ML4A 2DT3A 1EDQA 4DRIA 3EIPA 1E6PA 3ARPA 2KR7A 3WH0A 2F23A 3CZ8A 4P8UA 2RQSA 4GLXA 3VAWA
chains in the Genus database with same CATH topology
1WMVA 3WD3A 2XP9A 3UI6A 2JXWA 4KQZA 1FAPA 2PV2A 4FN2A 1HJXA 3CHCA 1EQ3A 2YSBA 1JVWA 4DROA 4J4OA 2QF8A 1FFQA 3G6MA 5BXJA 2A3AA 2DG3A 3ARVA 3PA7A 5DIVA 4DIPA 2KE0A 3G6LA 1FKGA 4ODPA 2KO7A 2OLHA 3KACA 2DK7A 2XPAA 1K9RA 1EHNA 1W9UA 3WL1A 4QZVB 3GPKA 2FDMA 4WIWA 3KAGA 4Z2JA 1LJYA 3KABA 3UQIA 2RUDA 2L4JA 4JFLA 1HKMA 1EYMA 4DH0A 3B9EA 3WD0A 1K9QA 3ARXA 3CHDA 1M5YA 2JV4A 2PI6A 2WLYA 1Q6HA 3WKZA 2XP8A 3KZ7A 3UQBA 2IF4A 3RM9A 4MGVA 1ITXA 2YAJB 4AY1A 4DWSB 2LPVA 4Z2GA 1T11A 4IT6A 3LE4A 1LG1A 2VN1A 4NSBA 1HJVA 4WKAA 3ODKA 5E65A 4DWSD 1ZBWA 3FS8A 2D9FA 3RM8A 4MAVA 2M08A 4IPXA 2YBTA 4MNJA 1FKIA 1Q6UA 1TCOC 3RM4A 1HKIA 3W4RA 3WD4A 5DITA 5J6EA 4ITZA 1NWTA 4DRHA 3TCZA 3CNGA 4DRPA 2M2AA 3O5DA 1W1TA 1KFWA 4ODMA 5DIUA 2O92A 2DMVA 2MLYA 4IQ2A 1UR8A 1U79A 5E64A 1LG2A 1JNEA 4DWSA 2LKNA 3UI4A 3WQWA 1SYTA 4LAWA 2ZQSA 1ZBVA 3TC5A 4S3JA 5U47A 3JYJA 2DSVA 2M8JA 1B6CA 4P8VA 3RFWA 1TFVA 1H0IA 3O5FA 1W1PA 2WK2A 3FSBA 2MNTA 1J4HA 1E6ZA 1EG3A 2ZQTA 3UI5A 4FAPA 3FXYA 3CHFA 3MCBB 4MSPA 1ZL1A 1NMWA 2DT0A 4XAKA 3WD2A 2YSHA 1D7JA 1NMVA 2DWVA 1ZK6A 3ARQA 2DSWA 4JFMA 5D75A 4LAYA 2A3EA 4Z2LA 4JFKA 4R0XA 3MDYB 4IT4A 3PRBA 2YSIA 1PBKA 1X6LA 3O5QA 1FKDA 4A0TA 2RURA 3I6CA 3KCEA 1XHGA 1FKTA 1EIBA 4HBOA 1OGGA 3PQHA 1HXVA 2YSFA 1A7XA 4W9QA 1FKRA 4LGXA 3CHEA 4ZPWR 4U84A 1JNSA 3MCBA 4ZPVR 2XP7A 3AS1A 2MLXA 2RUCA 1I5HW 2JZVA 1EG4A 3O5LA 2UZ5A 4MTVA 4MNMA 3FY1A 1ROUA 3EY6A 4DWSC 4REXA 4HBEA 3WQVA 1FKFA 3IK8A 2E45A 2MF9A 2M1IA 1TR8A 3L4HA 1KT1A 1Q1CA 2LGOA 1FLCA 4TNSA 4Z2IA 4E5RA 2F2DA 1VF8A 1ZBCA 1J4RA 3B7XA 1R9HA 3BXWA 1NWUA 4LAVA 4DZ2A 1FKBA 4ODQA 1FKHA 2BA1A 2KFWA 2JX8A 2B31A 4P8XA 1YW5A 1ZBKA 4TW7A 2ZR4A 3UQAA 1Y0OA 4J4NA 2ZQUA 2PPOA 2PBCA 4L72B 4HARA 3M7NA 5HUAA 3KAIA 2XP6A 3PRAA 1W9PA 1W1YA 2PPPA 4ODNA 3O5RA 5DF0A 1FKJA 4DZ3A 4QT3A 1GOIA 5I98A 1N1AA 4MPKA 5GQBA 4JFJA 2EZ5W 3IKGA 4N19A 2DT2A 1BKFA 1BL4A 2PPNA 3AQUA 4BF8A 4JYSA 2AOSA 1LL7A 2DSUA 1E6RA 2MDIA 3OA5A 4PTMA 3B8SA 2WAEA 3M85A 1HJWA 2WM0A 1NWRA 2FAPA 5B8IC 5HKGA 4WKHA 2WLZA 4A0UA 2M8IA 3AS2A 2ZR5A 2DK1A 5GPRA 4S3KA 1FD9A 1CTNA 1YATA 2MLZA 3ARTA 1O6IA 1OGBA 1RP5A 2ZR6A 3WIJA 1D2KA 4Z2KA 1IX5A 1D7IA 5AHTA 2QRVA 3O5IA 4GIVA 1NWSA 1P5QA 2K8IA 2RSEA 2ZAJA 4WKFA 3O5OA 2LAJA 3MQGA 1F40A 1LL4A 4KR0B 4DT4A 5JH8A 1GPFA 2WADA 2XP4A 1NH6A 5E66A 2OWOA 2PV1A 3ARZA 1O6WA 3O5EA 2DT1A 2OFNA 4TW8A 1FKKA 4W9OA 5HWCA 4Q7NA 2DG4A 2G41A 3O5PA 2JMFA 4ODKA 3NRKA 1QPFA 1HKKA 3LKXB 3ARYA 2Q5AA 5DO2A 4URIA 3NI6A 1XRVA 3JYMA 2RE3A 3B9DA 3AS3A 3PR9A 1TK7A 2DJYA 4ODOA 2Y8NB 4QIBA 2FKEA 1ROTA 4U86A 2DG9A 3PRDA 1NSGA 4WJXA 3O5MA 4P8WA 3ALGA 4IQCA 1J6YA 2AWGA 2YBUA 1C9HA 2F4EA 1HKJA 1KT0A 3KAHA 4Z2HA 5CQ2A 1FKSA 1E15A 2MPHA 3FSCA 1WR7A 3ARUA 1UR9A 1W9VA 5GPGA 4ZS6A 3UF8A 2F21A 4NZCA 2N87A 3O5JA 5HTGA 3JXVA 3MQHA 3LKXA 3B9AA 1F8AB 1D6OA 1JNDA 3IKDA 2LJ4A 2G8ZA 1ZU8A 2DPEA 3KADA 4O2TA 4JFIA 1PINA 1WNOA 1OWQA 4ZPTR 1JNTA 4MNLA 3FAPA 1LL6A 3IHZA 2L2SA 2YSGA 1FKLA 2ZQVA 2IUZA 4U85A 3RGCA 4GGQA 1ZCNA 4ODRA 5E5WA 2DSZA 4LAXA 1FJDA 4L3NA 3CGNA 3H9RB 2KGJA 3NTPA 1E6NA 5HWBA 4DRMA 1RD6A 1GUVA 1D7HA 4DRNA 2ITKA 5HT1A 1Q6IA 4W5UA 5HW6A 2Y78A 1W1VA 2RUQA 3TDBA 2VCDA 4Q22A 4TW6A 2XPBA 4QT2A 4DRKA 4C02B 4TYOA 1X6NA 1LQ0A 2A3BA 5HW8A 2ESCA 3CH9A 1W26A 3O5KA 4DRJA 4G2PA 5HW7A 5E62A 1QPLA 1K9TA 3AROA 3ALFA 1JMQA 3LUOA 4R5EA 2M3OW 1WAWA 4TX0A 3WD1A 4W9PA 1QZ2A 3WL0A 1H0GA 1ZB5A 5DEZA 3O5GA 1L1PA 4MNKA 5HBFA 2O9OA 3OOBA 2PV3A 2KXQA 2KI3A 3AS0A 1FFRA 3ARRA 3QOKA 4DRQA 4NNRA 4WK9A 3KAFA 2XP3A 3ARWA 2XP5A 4G50A 2A3CA 4ODLA 3CGMA 1J4IA 1SR0A 1WB0A 3RMEA 3ARSA 1E9LA 4ML4A 2DT3A 1EDQA 4DRIA 1E6PA 3ARPA 2KR7A 3WH0A 3CZ8A 4P8UA 2RQSA 4GLXA 3VAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WMV A;  2XP9 A;  3UI6 A;  2JXW A;  1FAP A;  2PV2 A;  4FN2 A;  1EQ3 A;  2YSB A;  1JVW A;  4DRO A;  4J4O A;  2DG3 A;  3PA7 A;  5DIV A;  4DIP A;  2KE0 A;  1FKG A;  4ODP A;  2KO7 A;  3KAC A;  2DK7 A;  2XPA A;  1K9R A;  3GPK A;  3KAG A;  3KAB A;  3UQI A;  2RUD A;  2L4J A;  4JFL A;  1EYM A;  4DH0 A;  1K9Q A;  1M5Y A;  2JV4 A;  1Q6H A;  2XP8 A;  3KZ7 A;  3UQB A;  2IF4 A;  4MGV A;  2LPV A;  1T11 A;  3LE4 A;  2VN1 A;  3ODK A;  2D9F A;  2M08 A;  4IPX A;  1FKI A;  1Q6U A;  1TCO C;  5DIT A;  5J6E A;  4ITZ A;  4DRH A;  3TCZ A;  3CNG A;  4DRP A;  2M2A A;  3O5D A;  4ODM A;  5DIU A;  2DMV A;  2MLY A;  4IQ2 A;  1U79 A;  2LKN A;  3UI4 A;  4LAW A;  2ZQS A;  3TC5 A;  3JYJ A;  2M8J A;  1B6C A;  3RFW A;  3O5F A;  2MNT A;  1J4H A;  1EG3 A;  2ZQT A;  3UI5 A;  4FAP A;  4MSP A;  1NMW A;  2YSH A;  1D7J A;  1NMV A;  2DWV A;  1ZK6 A;  4JFM A;  5D75 A;  4LAY A;  4JFK A;  4R0X A;  3MDY B;  3PRB A;  2YSI A;  1PBK A;  3O5Q A;  1FKD A;  2RUR A;  3I6C A;  3KCE A;  1FKT A;  1HXV A;  2YSF A;  1A7X A;  4W9Q A;  1FKR A;  4U84 A;  1JNS A;  2XP7 A;  2MLX A;  2RUC A;  1I5H W;  2JZV A;  1EG4 A;  3O5L A;  2UZ5 A;  1ROU A;  3EY6 A;  4REX A;  1FKF A;  3IK8 A;  2E45 A;  2MF9 A;  2M1I A;  3L4H A;  1KT1 A;  1Q1C A;  2LGO A;  4TNS A;  4E5R A;  2F2D A;  1J4R A;  3B7X A;  1R9H A;  4LAV A;  4DZ2 A;  1FKB A;  4ODQ A;  1FKH A;  2BA1 A;  2KFW A;  2JX8 A;  1YW5 A;  4TW7 A;  2ZR4 A;  3UQA A;  1Y0O A;  4J4N A;  2ZQU A;  2PPO A;  2PBC A;  3M7N A;  5HUA A;  3KAI A;  2XP6 A;  2PPP A;  4ODN A;  3O5R A;  4DZ3 A;  1FKJ A;  4QT3 A;  5I98 A;  1N1A A;  4JFJ A;  2EZ5 W;  3IKG A;  4N19 A;  1BKF A;  1BL4 A;  2PPN A;  4BF8 A;  4JYS A;  2MDI A;  3M85 A;  2FAP A;  5B8I C;  5HKG A;  2M8I A;  2ZR5 A;  2DK1 A;  1FD9 A;  1YAT A;  2MLZ A;  2ZR6 A;  1D7I A;  5AHT A;  3O5I A;  4GIV A;  2RSE A;  1P5Q A;  2K8I A;  2ZAJ A;  3O5O A;  2LAJ A;  1F40 A;  4DT4 A;  2XP4 A;  2PV1 A;  1O6W A;  3O5E A;  2OFN A;  4TW8 A;  1FKK A;  4W9O A;  5HWC A;  2DG4 A;  3O5P A;  2JMF A;  4ODK A;  3NRK A;  1QPF A;  2Q5A A;  3NI6 A;  3JYM A;  2RE3 A;  1TK7 A;  2DJY A;  4ODO A;  4QIB A;  2FKE A;  1ROT A;  4U86 A;  2DG9 A;  3PRD A;  1NSG A;  3O5M A;  4IQC A;  1J6Y A;  2AWG A;  1C9H A;  2F4E A;  1KT0 A;  3KAH A;  5CQ2 A;  1FKS A;  2MPH A;  1WR7 A;  5GPG A;  3UF8 A;  2F21 A;  2N87 A;  3O5J A;  5HTG A;  3JXV A;  1F8A B;  1D6O A;  3IKD A;  2LJ4 A;  3KAD A;  4O2T A;  4JFI A;  1PIN A;  1JNT A;  3FAP A;  3IHZ A;  2L2S A;  2YSG A;  1FKL A;  2ZQV A;  4U85 A;  3RGC A;  4GGQ A;  1ZCN A;  4ODR A;  4LAX A;  1FJD A;  3CGN A;  3H9R B;  2KGJ A;  3NTP A;  5HWB A;  4DRM A;  1D7H A;  4DRN A;  2ITK A;  5HT1 A;  1Q6I A;  5HW6 A;  2Y78 A;  2RUQ A;  3TDB A;  2VCD A;  4TW6 A;  2XPB A;  4QT2 A;  4DRK A;  4C02 B;  4TYO A;  5HW8 A;  1W26 A;  3O5K A;  4DRJ A;  4G2P A;  5HW7 A;  1QPL A;  1JMQ A;  3LUO A;  2M3O W;  4TX0 A;  4W9P A;  1QZ2 A;  3O5G A;  1L1P A;  3OOB A;  2PV3 A;  2KXQ A;  2KI3 A;  4DRQ A;  4NNR A;  3KAF A;  2XP3 A;  2XP5 A;  4G50 A;  4ODL A;  3CGM A;  1J4I A;  4DRI A;  2KR7 A;  3WH0 A;  5BXJ A;  2RQS A;  3VAW A; 
#chains in the Genus database with same CATH topology
 1WMV A;  3WD3 A;  2XP9 A;  3UI6 A;  2JXW A;  4KQZ A;  1FAP A;  2PV2 A;  4FN2 A;  1HJX A;  3CHC A;  1EQ3 A;  2YSB A;  1JVW A;  4DRO A;  4J4O A;  2QF8 A;  1FFQ A;  3G6M A;  5BXJ A;  2A3A A;  2DG3 A;  3ARV A;  3PA7 A;  5DIV A;  4DIP A;  2KE0 A;  3G6L A;  1FKG A;  4ODP A;  2KO7 A;  2OLH A;  3KAC A;  2DK7 A;  2XPA A;  1K9R A;  1EHN A;  1W9U A;  3WL1 A;  4QZV B;  3GPK A;  2FDM A;  4WIW A;  3KAG A;  4Z2J A;  1LJY A;  3KAB A;  3UQI A;  2RUD A;  2L4J A;  4JFL A;  1HKM A;  1EYM A;  1GRJ A;  4DH0 A;  3B9E A;  3WD0 A;  1K9Q A;  3ARX A;  3CHD A;  1M5Y A;  2JV4 A;  2PI6 A;  2WLY A;  1Q6H A;  3WKZ A;  2XP8 A;  3KZ7 A;  3UQB A;  2IF4 A;  3RM9 A;  4MGV A;  1ITX A;  2YAJ B;  4AY1 A;  4DWS B;  2LPV A;  4Z2G A;  1T11 A;  4IT6 A;  3LE4 A;  1LG1 A;  2VN1 A;  4NSB A;  1HJV A;  4WKA A;  3ODK A;  5E65 A;  4DWS D;  1ZBW A;  3FS8 A;  2D9F A;  3RM8 A;  4MAV A;  2M08 A;  4IPX A;  2YBT A;  4MNJ A;  1FKI A;  1Q6U A;  1TCO C;  3RM4 A;  1HKI A;  3W4R A;  3WD4 A;  5DIT A;  5J6E A;  4ITZ A;  1NWT A;  4DRH A;  3TCZ A;  3CNG A;  4DRP A;  2M2A A;  3O5D A;  3BMB A;  1W1T A;  1KFW A;  4ODM A;  5DIU A;  2O92 A;  2DMV A;  2MLY A;  4IQ2 A;  1UR8 A;  1U79 A;  5E64 A;  1LG2 A;  1JNE A;  4DWS A;  2LKN A;  3UI4 A;  3WQW A;  1SYT A;  4LAW A;  2ZQS A;  1ZBV A;  2ETN A;  3TC5 A;  4S3J A;  5U47 A;  3JYJ A;  2DSV A;  2M8J A;  1B6C A;  4P8V A;  3RFW A;  1TFV A;  1H0I A;  3O5F A;  1W1P A;  2WK2 A;  3FSB A;  2MNT A;  1J4H A;  1E6Z A;  1EG3 A;  2ZQT A;  2EUL A;  3UI5 A;  4FAP A;  3FXY A;  3CHF A;  3MCB B;  4MSP A;  1ZL1 A;  1NMW A;  2DT0 A;  4XAK A;  3WD2 A;  2YSH A;  1D7J A;  1NMV A;  2DWV A;  1ZK6 A;  3ARQ A;  2DSW A;  4JFM A;  5D75 A;  4LAY A;  2A3E A;  4Z2L A;  4JFK A;  2P4V A;  4R0X A;  3MDY B;  4IT4 A;  3PRB A;  2YSI A;  1PBK A;  1X6L A;  3O5Q A;  1FKD A;  4A0T A;  2RUR A;  3I6C A;  3KCE A;  1XHG A;  1FKT A;  1EIB A;  4HBO A;  1OGG A;  3PQH A;  1HXV A;  2YSF A;  1A7X A;  4W9Q A;  1FKR A;  4LGX A;  3CHE A;  4ZPW R;  4U84 A;  1JNS A;  3MCB A;  4ZPV R;  2XP7 A;  3AS1 A;  2MLX A;  2RUC A;  1I5H W;  2JZV A;  1EG4 A;  3O5L A;  2UZ5 A;  4MTV A;  4MNM A;  3FY1 A;  1ROU A;  3EY6 A;  4DWS C;  4REX A;  4HBE A;  3WQV A;  1FKF A;  3IK8 A;  2E45 A;  2MF9 A;  2M1I A;  1TR8 A;  3L4H A;  1KT1 A;  1Q1C A;  2LGO A;  1FLC A;  4TNS A;  4Z2I A;  4E5R A;  2F2D A;  1VF8 A;  1ZBC A;  1J4R A;  3B7X A;  1R9H A;  3BXW A;  1NWU A;  4LAV A;  4DZ2 A;  1FKB A;  4ODQ A;  1FKH A;  2BA1 A;  2KFW A;  2JX8 A;  2B31 A;  4P8X A;  1YW5 A;  1ZBK A;  2PN0 A;  4TW7 A;  2ZR4 A;  3UQA A;  1Y0O A;  4J4N A;  2ZQU A;  2PPO A;  2PBC A;  4L72 B;  4HAR A;  3M7N A;  5HUA A;  3KAI A;  2XP6 A;  3PRA A;  1W9P A;  1W1Y A;  2PPP A;  4ODN A;  3O5R A;  5DF0 A;  1FKJ A;  4DZ3 A;  4QT3 A;  1GOI A;  5I98 A;  1N1A A;  4MPK A;  5GQB A;  4JFJ A;  2EZ5 W;  3IKG A;  4N19 A;  2DT2 A;  1BKF A;  1BL4 A;  2PPN A;  3AQU A;  4BF8 A;  4JYS A;  2AOS A;  1LL7 A;  2DSU A;  1E6R A;  2MDI A;  3OA5 A;  4PTM A;  3B8S A;  2WAE A;  3M85 A;  1HJW A;  2WM0 A;  1NWR A;  2FAP A;  5B8I C;  5HKG A;  4WKH A;  2WLZ A;  4A0U A;  2M8I A;  3AS2 A;  2ZR5 A;  2DK1 A;  5GPR A;  4S3K A;  1FD9 A;  1CTN A;  1YAT A;  2MLZ A;  3ART A;  1O6I A;  1OGB A;  1RP5 A;  2ZR6 A;  3WIJ A;  1D2K A;  4Z2K A;  1IX5 A;  1D7I A;  5AHT A;  2QRV A;  3O5I A;  4GIV A;  1NWS A;  1P5Q A;  2K8I A;  2RSE A;  2ZAJ A;  4WKF A;  3O5O A;  2LAJ A;  3MQG A;  1F40 A;  1LL4 A;  4KR0 B;  4DT4 A;  5JH8 A;  1GPF A;  2WAD A;  2XP4 A;  1NH6 A;  5E66 A;  2OWO A;  2PV1 A;  3ARZ A;  1O6W A;  3O5E A;  2DT1 A;  2OFN A;  4TW8 A;  1FKK A;  4W9O A;  5HWC A;  4Q7N A;  4UDM A;  2DG4 A;  2G41 A;  3O5P A;  2JMF A;  1JCH B;  4ODK A;  3NRK A;  1QPF A;  1HKK A;  3LKX B;  3ARY A;  2Q5A A;  5DO2 A;  4URI A;  3NI6 A;  1XRV A;  3JYM A;  2RE3 A;  3B9D A;  3AS3 A;  3PR9 A;  1TK7 A;  2DJY A;  4ODO A;  2Y8N B;  4QIB A;  2FKE A;  1ROT A;  4U86 A;  2DG9 A;  3PRD A;  1NSG A;  4WJX A;  3O5M A;  4P8W A;  3ALG A;  4IQC A;  1J6Y A;  2AWG A;  2YBU A;  3GU0 A;  1C9H A;  2F4E A;  1HKJ A;  1KT0 A;  3KAH A;  4Z2H A;  5CQ2 A;  1FKS A;  1E15 A;  2B5U B;  2MPH A;  3FSC A;  1WR7 A;  3ARU A;  1UR9 A;  1W9V A;  5GPG A;  4ZS6 A;  1E44 A;  3UF8 A;  2F21 A;  4NZC A;  2N87 A;  3O5J A;  5HTG A;  3JXV A;  3MQH A;  3LKX A;  3B9A A;  1F8A B;  1D6O A;  1JND A;  3IKD A;  2LJ4 A;  2G8Z A;  1ZU8 A;  2DPE A;  3KAD A;  4O2T A;  4JFI A;  1PIN A;  1WNO A;  1OWQ A;  4ZPT R;  1JNT A;  4MNL A;  3FAP A;  1LL6 A;  3IHZ A;  2L2S A;  2YSG A;  1FKL A;  2ZQV A;  2IUZ A;  4U85 A;  3RGC A;  4GGQ A;  1ZCN A;  4ODR A;  5E5W A;  2DSZ A;  4LAX A;  1FJD A;  4L3N A;  3CGN A;  3H9R B;  3GTY X;  2KGJ A;  3NTP A;  1E6N A;  5HWB A;  4DRM A;  1RD6 A;  1GUV A;  1D7H A;  4DRN A;  2ITK A;  5HT1 A;  1Q6I A;  4W5U A;  5HW6 A;  2Y78 A;  1W1V A;  2RUQ A;  3TDB A;  2VCD A;  4Q22 A;  4TW6 A;  2XPB A;  4QT2 A;  4DRK A;  4C02 B;  4TYO A;  1X6N A;  1LQ0 A;  2A3B A;  5HW8 A;  2ESC A;  3CH9 A;  1W26 A;  3O5K A;  4DRJ A;  4G2P A;  5HW7 A;  5E62 A;  1QPL A;  1K9T A;  3ARO A;  3ALF A;  1JMQ A;  3LUO A;  4R5E A;  2M3O W;  1WAW A;  4TX0 A;  3WD1 A;  4W9P A;  1QZ2 A;  3WL0 A;  1H0G A;  1ZB5 A;  5DEZ A;  3O5G A;  1L1P A;  4MNK A;  5HBF A;  2O9O A;  3OOB A;  2PV3 A;  2KXQ A;  2KI3 A;  3AS0 A;  1FFR A;  3ARR A;  3QOK A;  4DRQ A;  4NNR A;  4WK9 A;  3KAF A;  2XP3 A;  3ARW A;  2XP5 A;  4G50 A;  2A3C A;  4ODL A;  3CGM A;  1J4I A;  1SR0 A;  1WB0 A;  3RME A;  3ARS A;  1E9L A;  4ML4 A;  2DT3 A;  1EDQ A;  4DRI A;  3EIP A;  1E6P A;  3ARP A;  2KR7 A;  3WH0 A;  2F23 A;  3CZ8 A;  4P8U A;  2RQS A;  4GLX A;  3VAW A; 
#chains in the Genus database with same CATH homology
 1WMV A;  3WD3 A;  2XP9 A;  3UI6 A;  2JXW A;  4KQZ A;  1FAP A;  2PV2 A;  4FN2 A;  1HJX A;  3CHC A;  1EQ3 A;  2YSB A;  1JVW A;  4DRO A;  4J4O A;  2QF8 A;  1FFQ A;  3G6M A;  5BXJ A;  2A3A A;  2DG3 A;  3ARV A;  3PA7 A;  5DIV A;  4DIP A;  2KE0 A;  3G6L A;  1FKG A;  4ODP A;  2KO7 A;  2OLH A;  3KAC A;  2DK7 A;  2XPA A;  1K9R A;  1EHN A;  1W9U A;  3WL1 A;  4QZV B;  3GPK A;  2FDM A;  4WIW A;  3KAG A;  4Z2J A;  1LJY A;  3KAB A;  3UQI A;  2RUD A;  2L4J A;  4JFL A;  1HKM A;  1EYM A;  4DH0 A;  3B9E A;  3WD0 A;  1K9Q A;  3ARX A;  3CHD A;  1M5Y A;  2JV4 A;  2PI6 A;  2WLY A;  1Q6H A;  3WKZ A;  2XP8 A;  3KZ7 A;  3UQB A;  2IF4 A;  3RM9 A;  4MGV A;  1ITX A;  2YAJ B;  4AY1 A;  4DWS B;  2LPV A;  4Z2G A;  1T11 A;  4IT6 A;  3LE4 A;  1LG1 A;  2VN1 A;  4NSB A;  1HJV A;  4WKA A;  3ODK A;  5E65 A;  4DWS D;  1ZBW A;  3FS8 A;  2D9F A;  3RM8 A;  4MAV A;  2M08 A;  4IPX A;  2YBT A;  4MNJ A;  1FKI A;  1Q6U A;  1TCO C;  3RM4 A;  1HKI A;  3W4R A;  3WD4 A;  5DIT A;  5J6E A;  4ITZ A;  1NWT A;  4DRH A;  3TCZ A;  3CNG A;  4DRP A;  2M2A A;  3O5D A;  1W1T A;  1KFW A;  4ODM A;  5DIU A;  2O92 A;  2DMV A;  2MLY A;  4IQ2 A;  1UR8 A;  1U79 A;  5E64 A;  1LG2 A;  1JNE A;  4DWS A;  2LKN A;  3UI4 A;  3WQW A;  1SYT A;  4LAW A;  2ZQS A;  1ZBV A;  3TC5 A;  4S3J A;  5U47 A;  3JYJ A;  2DSV A;  2M8J A;  1B6C A;  4P8V A;  3RFW A;  1TFV A;  1H0I A;  3O5F A;  1W1P A;  2WK2 A;  3FSB A;  2MNT A;  1J4H A;  1E6Z A;  1EG3 A;  2ZQT A;  3UI5 A;  4FAP A;  3FXY A;  3CHF A;  3MCB B;  4MSP A;  1ZL1 A;  1NMW A;  2DT0 A;  4XAK A;  3WD2 A;  2YSH A;  1D7J A;  1NMV A;  2DWV A;  1ZK6 A;  3ARQ A;  2DSW A;  4JFM A;  5D75 A;  4LAY A;  2A3E A;  4Z2L A;  4JFK A;  4R0X A;  3MDY B;  4IT4 A;  3PRB A;  2YSI A;  1PBK A;  1X6L A;  3O5Q A;  1FKD A;  4A0T A;  2RUR A;  3I6C A;  3KCE A;  1XHG A;  1FKT A;  1EIB A;  4HBO A;  1OGG A;  3PQH A;  1HXV A;  2YSF A;  1A7X A;  4W9Q A;  1FKR A;  4LGX A;  3CHE A;  4ZPW R;  4U84 A;  1JNS A;  3MCB A;  4ZPV R;  2XP7 A;  3AS1 A;  2MLX A;  2RUC A;  1I5H W;  2JZV A;  1EG4 A;  3O5L A;  2UZ5 A;  4MTV A;  4MNM A;  3FY1 A;  1ROU A;  3EY6 A;  4DWS C;  4REX A;  4HBE A;  3WQV A;  1FKF A;  3IK8 A;  2E45 A;  2MF9 A;  2M1I A;  1TR8 A;  3L4H A;  1KT1 A;  1Q1C A;  2LGO A;  1FLC A;  4TNS A;  4Z2I A;  4E5R A;  2F2D A;  1VF8 A;  1ZBC A;  1J4R A;  3B7X A;  1R9H A;  3BXW A;  1NWU A;  4LAV A;  4DZ2 A;  1FKB A;  4ODQ A;  1FKH A;  2BA1 A;  2KFW A;  2JX8 A;  2B31 A;  4P8X A;  1YW5 A;  1ZBK A;  4TW7 A;  2ZR4 A;  3UQA A;  1Y0O A;  4J4N A;  2ZQU A;  2PPO A;  2PBC A;  4L72 B;  4HAR A;  3M7N A;  5HUA A;  3KAI A;  2XP6 A;  3PRA A;  1W9P A;  1W1Y A;  2PPP A;  4ODN A;  3O5R A;  5DF0 A;  1FKJ A;  4DZ3 A;  4QT3 A;  1GOI A;  5I98 A;  1N1A A;  4MPK A;  5GQB A;  4JFJ A;  2EZ5 W;  3IKG A;  4N19 A;  2DT2 A;  1BKF A;  1BL4 A;  2PPN A;  3AQU A;  4BF8 A;  4JYS A;  2AOS A;  1LL7 A;  2DSU A;  1E6R A;  2MDI A;  3OA5 A;  4PTM A;  3B8S A;  2WAE A;  3M85 A;  1HJW A;  2WM0 A;  1NWR A;  2FAP A;  5B8I C;  5HKG A;  4WKH A;  2WLZ A;  4A0U A;  2M8I A;  3AS2 A;  2ZR5 A;  2DK1 A;  5GPR A;  4S3K A;  1FD9 A;  1CTN A;  1YAT A;  2MLZ A;  3ART A;  1O6I A;  1OGB A;  1RP5 A;  2ZR6 A;  3WIJ A;  1D2K A;  4Z2K A;  1IX5 A;  1D7I A;  5AHT A;  2QRV A;  3O5I A;  4GIV A;  1NWS A;  1P5Q A;  2K8I A;  2RSE A;  2ZAJ A;  4WKF A;  3O5O A;  2LAJ A;  3MQG A;  1F40 A;  1LL4 A;  4KR0 B;  4DT4 A;  5JH8 A;  1GPF A;  2WAD A;  2XP4 A;  1NH6 A;  5E66 A;  2OWO A;  2PV1 A;  3ARZ A;  1O6W A;  3O5E A;  2DT1 A;  2OFN A;  4TW8 A;  1FKK A;  4W9O A;  5HWC A;  4Q7N A;  2DG4 A;  2G41 A;  3O5P A;  2JMF A;  4ODK A;  3NRK A;  1QPF A;  1HKK A;  3LKX B;  3ARY A;  2Q5A A;  5DO2 A;  4URI A;  3NI6 A;  1XRV A;  3JYM A;  2RE3 A;  3B9D A;  3AS3 A;  3PR9 A;  1TK7 A;  2DJY A;  4ODO A;  2Y8N B;  4QIB A;  2FKE A;  1ROT A;  4U86 A;  2DG9 A;  3PRD A;  1NSG A;  4WJX A;  3O5M A;  4P8W A;  3ALG A;  4IQC A;  1J6Y A;  2AWG A;  2YBU A;  1C9H A;  2F4E A;  1HKJ A;  1KT0 A;  3KAH A;  4Z2H A;  5CQ2 A;  1FKS A;  1E15 A;  2MPH A;  3FSC A;  1WR7 A;  3ARU A;  1UR9 A;  1W9V A;  5GPG A;  4ZS6 A;  3UF8 A;  2F21 A;  4NZC A;  2N87 A;  3O5J A;  5HTG A;  3JXV A;  3MQH A;  3LKX A;  3B9A A;  1F8A B;  1D6O A;  1JND A;  3IKD A;  2LJ4 A;  2G8Z A;  1ZU8 A;  2DPE A;  3KAD A;  4O2T A;  4JFI A;  1PIN A;  1WNO A;  1OWQ A;  4ZPT R;  1JNT A;  4MNL A;  3FAP A;  1LL6 A;  3IHZ A;  2L2S A;  2YSG A;  1FKL A;  2ZQV A;  2IUZ A;  4U85 A;  3RGC A;  4GGQ A;  1ZCN A;  4ODR A;  5E5W A;  2DSZ A;  4LAX A;  1FJD A;  4L3N A;  3CGN A;  3H9R B;  2KGJ A;  3NTP A;  1E6N A;  5HWB A;  4DRM A;  1RD6 A;  1GUV A;  1D7H A;  4DRN A;  2ITK A;  5HT1 A;  1Q6I A;  4W5U A;  5HW6 A;  2Y78 A;  1W1V A;  2RUQ A;  3TDB A;  2VCD A;  4Q22 A;  4TW6 A;  2XPB A;  4QT2 A;  4DRK A;  4C02 B;  4TYO A;  1X6N A;  1LQ0 A;  2A3B A;  5HW8 A;  2ESC A;  3CH9 A;  1W26 A;  3O5K A;  4DRJ A;  4G2P A;  5HW7 A;  5E62 A;  1QPL A;  1K9T A;  3ARO A;  3ALF A;  1JMQ A;  3LUO A;  4R5E A;  2M3O W;  1WAW A;  4TX0 A;  3WD1 A;  4W9P A;  1QZ2 A;  3WL0 A;  1H0G A;  1ZB5 A;  5DEZ A;  3O5G A;  1L1P A;  4MNK A;  5HBF A;  2O9O A;  3OOB A;  2PV3 A;  2KXQ A;  2KI3 A;  3AS0 A;  1FFR A;  3ARR A;  3QOK A;  4DRQ A;  4NNR A;  4WK9 A;  3KAF A;  2XP3 A;  3ARW A;  2XP5 A;  4G50 A;  2A3C A;  4ODL A;  3CGM A;  1J4I A;  1SR0 A;  1WB0 A;  3RME A;  3ARS A;  1E9L A;  4ML4 A;  2DT3 A;  1EDQ A;  4DRI A;  1E6P A;  3ARP A;  2KR7 A;  3WH0 A;  3CZ8 A;  4P8U A;  2RQS A;  4GLX A;  3VAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...