1PINA

Pin1 peptidyl-prolyl cis-trans isomerase from homo sapiens
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of the mitotic rotamase Pin1 suggests substrate recognition is phosphorylation dependent.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE
total genus 42
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1998-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1pinA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1pinA02
1D7IA 1FKKA 2M08A 1ZK6A 2JZVA 3KAFA 4DRKA 1TCOC 3KZ7A 1HXVA 3ODKA 3PRBA 2PPOA 3LUOA 2PPPA 1TK7A 3VAWA 2ZQSA 5HKGA 2ZR6A 4DROA 3UF8A 4DRQA 2ZQUA 2VN1A 2YSHA 4U85A 4TW6A 2XP4A 1JNTA 2FKEA 3O5OA 4ODNA 2OFNA 4TW7A 4W9PA 4BF8A 2LJ4A 4REXA 1YATA 2BA1A 4ODPA 2RURA 3I6CA 4TNSA 1FKBA 4U86A 1QPLA 3FAPA 2MLYA 1C9HA 2M8IA 1KT0A 3IKGA 1JMQA 3IKDA 4FN2A 2JMFA 2YSGA 1FJDA 2ZQTA 3RGCA 3O5FA 3NI6A 4ODKA 3M7NA 1QZ2A 4J4NA 2YSFA 2LPVA 2D9FA 1FKGA 2F21A 2DG3A 2PPNA 4JFKA 3O5RA 2RQSA 4QT3A 5CQ2A 1ROUA 1J4IA 2M2AA 4LAXA 3LE4A 4LAWA 3UQIA 1FKFA 1FKDA 1J6YA 2RE3A 1JVWA 1KT1A 4C02B 1Q1CA 1Q6HA 4DRMA 1D7HA 1FKJA 4DRJA 3L4HA 4J4OA 5HW6A 1FKHA 3KCEA 4DIPA 1NSGA 2N87A 4W9OA 4FAPA 2M1IA 1K9RA 2RUCA 3O5JA 3UI6A 1N1AA 2IF4A 5DIUA 3MDYB 2DJYA 2Y78A 2JV4A 1YW5A 2MNTA 1BL4A 3O5LA 3O5IA 4ODRA 2E45A 4G2PA 2M8JA 1Q6UA 3RFWA 3JYMA 4DRHA 1BKFA 2JXWA 1FKLA 2M3OW 1A7XA 5DITA 3OOBA 2XPBA 3M85A 3O5DA 3PA7A 1K9QA 3EY6A 2XP9A 3JYJA 1I5HW 4DZ2A 1NMWA 1FKIA 3PRDA 2XP3A 2MLXA 3O5EA 3TDBA 4JFMA 3O5GA 5HT1A 4ODOA 2YSBA 2DK7A 3B7XA 4IPXA 1ZCNA 1F40A 1O6WA 4R0XA 4QIBA 1EYMA 2LKNA 4ODLA 3KAGA 2F4EA 1WR7A 2XP5A 2DG4A 2F2DA 3UQBA 2KGJA 2L2SA 4TYOA 4MGVA 5GPGA 2KO7A 3UI5A 2RUQA 5HWCA 2KI3A 3O5MA 3CNGA 4JFIA 2DWVA 4LAVA 4DRNA 3O5PA 1D7JA 5BXJA 1EQ3A 3KAIA 3H9RB 4O2TA 4DT4A 1EG4A 2ITKA 2ZAJA 3WH0A 4E5RA 4ITZA 5HW8A 1F8AB 3TCZA 3O5QA 4IQCA 2XPAA 2MDIA 2PV2A 4TW8A 4DH0A 2JX8A 1ROTA 1T11A 2MPHA 4G50A 3TC5A 2VCDA 3JXVA 4GGQA 4TX0A 1J4RA 5HWBA 3O5KA 2DG9A 1Q6IA 1QPFA 1FAPA 5DIVA 2MLZA 5HTGA 2LGOA 2Q5AA 2L4JA 4QT2A 5I98A 4GIVA 3KADA 3KABA 2KXQA 3GPKA 2XP6A 1P5QA 2KFWA 3IHZA 3KACA 1FKSA 1WMVA 2KE0A 2XP8A 2KR7A 2PBCA 2UZ5A 4IQ2A 4LAYA 4DZ3A 1L1PA 1M5YA 4NNRA 4DRIA 1B6CA 2MF9A 1EG3A 1U79A 3KAHA 1W26A 4W9QA 2DMVA 4MSPA 1Y0OA 2AWGA 1FKTA 5B8IC 4U84A 3UQAA 2ZR5A 3NTPA 1FD9A 2FAPA 4DRPA 4ODQA 4JFJA 1PBKA 2PV3A 3NRKA 1FKRA 2LAJA 2YSIA 3IK8A 5J6EA 2PV1A 2K8IA 4JYSA 1JNSA 4ODMA 1PINA 2XP7A 1R9HA 3CGNA 5D75A 3UI4A 5HUAA 3CGMA 2RSEA 2DK1A 2EZ5W 5AHTA 1J4HA 1D6OA 1NMVA 2RUDA 4JFLA 5HW7A 2ZR4A 2ZQVA 4N19A
chains in the Genus database with same CATH superfamily
1D7IA 1LG2A 1HJVA 2ETNA 1ZK6A 3KZ7A 5GPRA 3VAWA 3UF8A 5E65A 3ARRA 2XP4A 1JNTA 2FKEA 4ODNA 2OFNA 2LJ4A 4L72B 2RURA 3I6CA 4KQZA 1ZBVA 3IKDA 4MNMA 2YSGA 1CTNA 4ODKA 4S3JA 3B9EA 1WNOA 2DT2A 2F21A 5DF0A 2PPNA 4DWSB 4QT3A 3AS0A 3CHDA 1ROUA 4LAXA 4P8UA 3UQIA 1FKDA 3MCBB 2RE3A 3G6LA 1Q6HA 2A3CA 4DRJA 3WD0A 1LG1A 4ZPVR 1TR8A 1NSGA 4W9OA 3FXYA 3O5JA 4IT4A 4NSBA 3MDYB 4Z2GA 4ODRA 1H0IA 2E45A 3WKZA 3RFWA 2M8JA 4ZS6A 1BKFA 3AS2A 1LQ0A 5DITA 4R5EA 1WAWA 1HJWA 3PRDA 2XP3A 4NZCA 1HKKA 4IPXA 3WQVA 1ZCNA 4AY1A 4QIBA 3ARQA 2DG4A 2L2SA 2DSVA 5GPGA 5HWCA 2KO7A 3FSCA 2DSUA 4JFIA 2QF8A 3AS1A 2OLHA 4P8XA 1EQ3A 1XRVA 4O2TA 4E5RA 2XPAA 5E64A 4DH0A 3ARWA 2JX8A 1LL6A 4GGQA 1J4RA 1K9TA 1QPFA 1FAPA 4QT2A 3KADA 3ARPA 3CH9A 3KACA 1WMVA 1JNEA 4IQ2A 2G8ZA 3MCBA 3KAHA 4MSPA 3WD4A 1PBKA 2PV3A 2LAJA 1GPFA 2B31A 1W1VA 5D75A 5DEZA 3CGMA 2EZ5W 2WLZA 5HW7A 4Z2JA 4PTMA 1XHGA 2L4JA 2M08A 1FKKA 3KAFA 1HJXA 2PPOA 4MAVA 1TK7A 2ZQUA 2PI6A 2VN1A 1JNDA 3GU0A 4U85A 4BF8A 1GOIA 4WJXA 4ODPA 2BA1A 3LKXA 1QPLA 4FN2A 1RP5A 2M8IA 1KT0A 3IKGA 4LGXA 3RGCA 3O5FA 3NI6A 1EHNA 3CZ8A 2YBTA 2DG3A 1NWSA 2RQSA 3WD3A 3ARUA 4LAWA 1FKFA 1E6ZA 4Q7NA 1E6NA 1HKJA 1FKHA 3PR9A 2N87A 4KR0B 1O6IA 3RMEA 3RM4A 3W4RA 2DT3A 1FFQA 3EIPA 2DJYA 2Y78A 2A3AA 3ARTA 3G6MA 5E5WA 3JYMA 5GQBA 1VF8A 2Y8NB 4WKAA 1LJYA 2XPBA 3B8SA 3O5DA 3CHFA 3EY6A 4DZ2A 1FKIA 1TFVA 3O5EA 2MLXA 3TDBA 3O5GA 1UR8A 4HARA 5E62A 1O6WA 4R0XA 2LKNA 3WL1A 1WR7A 1SYTA 2A3BA 3UQBA 2WK2A 2KGJA 4MGVA 3UI5A 3O5MA 4LAVA 1HKIA 4DRNA 3O5PA 1NWRA 4XAKA 4DWSC 5BXJA 1IX5A 1EG4A 1E44A 1W1YA 4ITZA 3ARYA 3O5QA 2MDIA 1ROTA 1T11A 1LL7A 2MPHA 4Z2KA 1KFWA 1Q6IA 5DIVA 2LGOA 5U47A 5I98A 3KABA 3GPKA 1NH6A 2KFWA 1EIBA 3IHZA 1FKSA 3FS8A 1EG3A 1U79A 1W26A 5B8IC 1Y0OA 4ML4A 1FKTA 3WQWA 3NTPA 4DRPA 1W9PA 4JFJA 2DT0A 1FKRA 2YSIA 3IK8A 5J6EA 2K8IA 3WD2A 3PRAA 1RD6A 4DWSD 1GRJA 2DK1A 2O92A 5AHTA 2RUDA 4JFLA 4ZPTR 2ZR4A 4N19A 1EDQA 4DRKA 1TCOC 1NWTA 4Z2LA 3LUOA 3ALGA 5HKGA 2ZR6A 4DROA 2WM0A 3WIJA 4DRQA 3BXWA 2YSHA 2WLYA 3O5OA 4TW7A 4REXA 3ALFA 2WADA 3FAPA 2MLYA 1JMQA 2O9OA 1FJDA 3OA5A 3M7NA 4MNLA 3ARZA 3RM9A 2LPVA 2D9FA 1FKGA 2IUZA 4JFKA 3FY1A 1J4IA 2F23A 3LE4A 1JVWA 3WD1A 4QZVB 1ZBWA 4DRMA 1D7HA 3L4HA 4MNKA 3CHCA 1K9RA 3ARSA 5DIUA 2JV4A 1YW5A 4G2PA 2DPEA 1FFRA 1ZBCA 4HBOA 2JXWA 3OOBA 3RM8A 3M85A 3AROA 2XP9A 1I5HW 1NMWA 4JFMA 5HT1A 1FLCA 4ODOA 2YSBA 3B7XA 4IT6A 1F40A 1EYMA 2F4EA 2F2DA 4TYOA 1UR9A 2RUQA 2WAEA 2DWVA 1E6PA 2YAJB 2ITKA 3WH0A 3TCZA 4Z2HA 4IQCA 1GUVA 5JH8A 4G50A 3TC5A 5HWBA 2DG9A 1W9VA 2Q5AA 3BMBA 2KXQA 2XP6A 3ARVA 2PBCA 2KR7A 1L1PA 5HBFA 4NNRA 2MF9A 1E6RA 3AQUA 4W9QA 2DMVA 2AWGA 4U84A 2ZR5A 4ODQA 5E66A 2PV1A 4Z2IA 4MNJA 1R9HA 3CGNA 3MQGA 1E15A 1NWUA 5HUAA 2RSEA 1D6OA 3WL0A 4DT4A 1ZB5A 4GLXA 1E9LA 2ZQVA 4MTVA 2JZVA 1H0GA 1HXVA 3ODKA 3PRBA 4A0TA 1W9UA 2PPPA 2ZQSA 1ITXA 4W9PA 1D2KA 4TW6A 2YBUA 1YATA 4TNSA 1FKBA 4U86A 1C9HA 4P8WA 2JMFA 2ZQTA 4WIWA 4WKFA 1QZ2A 4J4NA 3MQHA 2YSFA 1W1PA 3O5RA 5CQ2A 2M2AA 1ZU8A 4W5UA 3QOKA 4L3NA 1J6YA 1KT1A 4S3KA 4C02B 1Q1CA 2PN0A 2A3EA 1FKJA 1ZBKA 4J4OA 5HW6A 3KCEA 4DIPA 1LL4A 4FAPA 2FDMA 2M1IA 2RUCA 3UI6A 4WKHA 1N1AA 4ZPWR 2IF4A 1OGBA 2MNTA 1BL4A 3O5LA 3O5IA 3B9AA 2DT1A 2DSWA 1Q6UA 4DRHA 2AOSA 1FKLA 2M3OW 1A7XA 2OWOA 3PA7A 1K9QA 3JYJA 2DSZA 3FSBA 1X6NA 3GTYX 2DK7A 1HKMA 2P4VA 3ARXA 1SR0A 1ZL1A 3KAGA 3CHEA 4ODLA 5DO2A 2XP5A 1WB0A 2KI3A 4URIA 3CNGA 3LKXB 1D7JA 3KAIA 3H9RB 2ZAJA 3AS3A 5HW8A 1F8AB 2EULA 2PV2A 2QRVA 4TW8A 2VCDA 3JXVA 4TX0A 3O5KA 4HBEA 2MLZA 5HTGA 2ESCA 1OWQA 4MPKA 4GIVA 1P5QA 4DWSA 2KE0A 2XP8A 4DZ3A 2UZ5A 4LAYA 1M5YA 4DRIA 1B6CA 3UQAA 1OGGA 1FD9A 2FAPA 4WK9A 3NRKA 2B5UB 4JYSA 1JNSA 4ODMA 1PINA 2XP7A 2G41A 3UI4A 4Q22A 4A0UA 3PQHA 1JCHB 1X6LA 1W1TA 4UDMA 4P8VA 1J4HA 1NMVA 3B9DA
chains in the Genus database with same CATH topology
1D7IA 1LG2A 1HJVA 1ZK6A 3KZ7A 5GPRA 3VAWA 3UF8A 5E65A 3ARRA 2XP4A 1JNTA 2FKEA 4ODNA 2OFNA 2LJ4A 4L72B 2RURA 3I6CA 4KQZA 1ZBVA 3IKDA 4MNMA 2YSGA 1CTNA 4ODKA 4S3JA 3B9EA 1WNOA 2DT2A 2F21A 5DF0A 2PPNA 4DWSB 4QT3A 3AS0A 3CHDA 1ROUA 4LAXA 4P8UA 3UQIA 1FKDA 3MCBB 2RE3A 3G6LA 1Q6HA 2A3CA 4DRJA 3WD0A 1LG1A 4ZPVR 1TR8A 1NSGA 4W9OA 3FXYA 3O5JA 4IT4A 4NSBA 3MDYB 4Z2GA 4ODRA 1H0IA 2E45A 3WKZA 3RFWA 2M8JA 4ZS6A 1BKFA 3AS2A 1LQ0A 5DITA 4R5EA 1WAWA 1HJWA 3PRDA 2XP3A 4NZCA 1HKKA 4IPXA 3WQVA 1ZCNA 4AY1A 4QIBA 3ARQA 2DG4A 2L2SA 2DSVA 5GPGA 5HWCA 2KO7A 3FSCA 2DSUA 4JFIA 2QF8A 3AS1A 2OLHA 4P8XA 1EQ3A 1XRVA 4O2TA 4E5RA 2XPAA 5E64A 4DH0A 3ARWA 2JX8A 1LL6A 4GGQA 1J4RA 1K9TA 1QPFA 1FAPA 4QT2A 3KADA 3ARPA 3CH9A 3KACA 1WMVA 1JNEA 4IQ2A 2G8ZA 3MCBA 3KAHA 4MSPA 3WD4A 1PBKA 2PV3A 2LAJA 1GPFA 2B31A 1W1VA 5D75A 5DEZA 3CGMA 2EZ5W 2WLZA 5HW7A 4Z2JA 4PTMA 1XHGA 2L4JA 2M08A 1FKKA 3KAFA 1HJXA 2PPOA 4MAVA 1TK7A 2ZQUA 2PI6A 2VN1A 1JNDA 4U85A 4BF8A 1GOIA 4WJXA 4ODPA 2BA1A 3LKXA 1QPLA 4FN2A 1RP5A 2M8IA 1KT0A 3IKGA 4LGXA 3RGCA 3O5FA 3NI6A 1EHNA 3CZ8A 2YBTA 2DG3A 1NWSA 2RQSA 3WD3A 3ARUA 4LAWA 1FKFA 1E6ZA 4Q7NA 1E6NA 1HKJA 1FKHA 3PR9A 2N87A 4KR0B 1O6IA 3RMEA 3RM4A 3W4RA 2DT3A 1FFQA 2DJYA 2Y78A 2A3AA 3ARTA 3G6MA 5E5WA 3JYMA 5GQBA 1VF8A 2Y8NB 4WKAA 1LJYA 2XPBA 3B8SA 3O5DA 3CHFA 3EY6A 4DZ2A 1FKIA 1TFVA 3O5EA 2MLXA 3TDBA 3O5GA 1UR8A 4HARA 5E62A 1O6WA 4R0XA 2LKNA 3WL1A 1WR7A 1SYTA 2A3BA 3UQBA 2WK2A 2KGJA 4MGVA 3UI5A 3O5MA 4LAVA 1HKIA 4DRNA 3O5PA 1NWRA 4XAKA 4DWSC 5BXJA 1IX5A 1EG4A 1W1YA 4ITZA 3ARYA 3O5QA 2MDIA 1ROTA 1T11A 1LL7A 2MPHA 4Z2KA 1KFWA 1Q6IA 5DIVA 2LGOA 5U47A 5I98A 3KABA 3GPKA 1NH6A 2KFWA 1EIBA 3IHZA 1FKSA 3FS8A 1EG3A 1U79A 1W26A 5B8IC 1Y0OA 4ML4A 1FKTA 3WQWA 3NTPA 4DRPA 1W9PA 4JFJA 2DT0A 1FKRA 2YSIA 3IK8A 5J6EA 2K8IA 3WD2A 3PRAA 1RD6A 4DWSD 2DK1A 2O92A 5AHTA 2RUDA 4JFLA 4ZPTR 2ZR4A 4N19A 1EDQA 4DRKA 1TCOC 1NWTA 4Z2LA 3LUOA 3ALGA 5HKGA 2ZR6A 4DROA 2WM0A 3WIJA 4DRQA 3BXWA 2YSHA 2WLYA 3O5OA 4TW7A 4REXA 3ALFA 2WADA 3FAPA 2MLYA 1JMQA 2O9OA 1FJDA 3OA5A 3M7NA 4MNLA 3ARZA 3RM9A 2LPVA 2D9FA 1FKGA 2IUZA 4JFKA 3FY1A 1J4IA 3LE4A 1JVWA 3WD1A 4QZVB 1ZBWA 4DRMA 1D7HA 3L4HA 4MNKA 3CHCA 1K9RA 3ARSA 5DIUA 2JV4A 1YW5A 4G2PA 2DPEA 1FFRA 1ZBCA 4HBOA 2JXWA 3OOBA 3RM8A 3M85A 3AROA 2XP9A 1I5HW 1NMWA 4JFMA 5HT1A 1FLCA 4ODOA 2YSBA 3B7XA 4IT6A 1F40A 1EYMA 2F4EA 2F2DA 4TYOA 1UR9A 2RUQA 2WAEA 2DWVA 1E6PA 2YAJB 2ITKA 3WH0A 3TCZA 4Z2HA 4IQCA 1GUVA 5JH8A 4G50A 3TC5A 5HWBA 2DG9A 1W9VA 2Q5AA 2KXQA 2XP6A 3ARVA 2PBCA 2KR7A 1L1PA 5HBFA 4NNRA 2MF9A 1E6RA 3AQUA 4W9QA 2DMVA 2AWGA 4U84A 2ZR5A 4ODQA 5E66A 2PV1A 4Z2IA 4MNJA 1R9HA 3CGNA 3MQGA 1E15A 1NWUA 5HUAA 2RSEA 1D6OA 3WL0A 4DT4A 1ZB5A 4GLXA 1E9LA 2ZQVA 4MTVA 2JZVA 1H0GA 1HXVA 3ODKA 3PRBA 4A0TA 1W9UA 2PPPA 2ZQSA 1ITXA 4W9PA 1D2KA 4TW6A 2YBUA 1YATA 4TNSA 1FKBA 4U86A 1C9HA 4P8WA 2JMFA 2ZQTA 4WIWA 4WKFA 1QZ2A 4J4NA 3MQHA 2YSFA 1W1PA 3O5RA 5CQ2A 2M2AA 1ZU8A 4W5UA 3QOKA 4L3NA 1J6YA 1KT1A 4S3KA 4C02B 1Q1CA 2A3EA 1FKJA 1ZBKA 4J4OA 5HW6A 3KCEA 4DIPA 1LL4A 4FAPA 2FDMA 2M1IA 2RUCA 3UI6A 4WKHA 1N1AA 4ZPWR 2IF4A 1OGBA 2MNTA 1BL4A 3O5LA 3O5IA 3B9AA 2DT1A 2DSWA 1Q6UA 4DRHA 2AOSA 1FKLA 2M3OW 1A7XA 2OWOA 3PA7A 1K9QA 3JYJA 2DSZA 3FSBA 1X6NA 2DK7A 1HKMA 3ARXA 1SR0A 1ZL1A 3KAGA 3CHEA 4ODLA 5DO2A 2XP5A 1WB0A 2KI3A 4URIA 3CNGA 3LKXB 1D7JA 3KAIA 3H9RB 2ZAJA 3AS3A 5HW8A 1F8AB 2PV2A 2QRVA 4TW8A 2VCDA 3JXVA 4TX0A 3O5KA 4HBEA 2MLZA 5HTGA 2ESCA 1OWQA 4MPKA 4GIVA 1P5QA 4DWSA 2KE0A 2XP8A 4DZ3A 2UZ5A 4LAYA 1M5YA 4DRIA 1B6CA 3UQAA 1OGGA 1FD9A 2FAPA 4WK9A 3NRKA 4JYSA 1JNSA 4ODMA 1PINA 2XP7A 2G41A 3UI4A 4Q22A 4A0UA 3PQHA 1X6LA 1W1TA 4P8VA 1J4HA 1NMVA 3B9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D7I A;  1FKK A;  2M08 A;  1ZK6 A;  2JZV A;  3KAF A;  4DRK A;  1TCO C;  3KZ7 A;  1HXV A;  3ODK A;  3PRB A;  2PPO A;  3LUO A;  2PPP A;  1TK7 A;  3VAW A;  2ZQS A;  5HKG A;  2ZR6 A;  4DRO A;  3UF8 A;  4DRQ A;  2ZQU A;  2VN1 A;  2YSH A;  4U85 A;  4TW6 A;  2XP4 A;  1JNT A;  2FKE A;  3O5O A;  4ODN A;  2OFN A;  4TW7 A;  4W9P A;  4BF8 A;  2LJ4 A;  4REX A;  1YAT A;  2BA1 A;  4ODP A;  2RUR A;  3I6C A;  4TNS A;  1FKB A;  4U86 A;  1QPL A;  3FAP A;  2MLY A;  1C9H A;  2M8I A;  1KT0 A;  3IKG A;  1JMQ A;  3IKD A;  4FN2 A;  2JMF A;  2YSG A;  1FJD A;  2ZQT A;  3RGC A;  3O5F A;  3NI6 A;  4ODK A;  3M7N A;  1QZ2 A;  4J4N A;  2YSF A;  2LPV A;  2D9F A;  1FKG A;  2F21 A;  2DG3 A;  2PPN A;  4JFK A;  3O5R A;  2RQS A;  4QT3 A;  5CQ2 A;  1ROU A;  1J4I A;  2M2A A;  4LAX A;  3LE4 A;  4LAW A;  3UQI A;  1FKF A;  1FKD A;  1J6Y A;  2RE3 A;  1JVW A;  1KT1 A;  4C02 B;  1Q1C A;  1Q6H A;  4DRM A;  1D7H A;  1FKJ A;  4DRJ A;  3L4H A;  4J4O A;  5HW6 A;  1FKH A;  3KCE A;  4DIP A;  1NSG A;  2N87 A;  4W9O A;  4FAP A;  2M1I A;  1K9R A;  2RUC A;  3O5J A;  3UI6 A;  1N1A A;  2IF4 A;  5DIU A;  3MDY B;  2DJY A;  2Y78 A;  2JV4 A;  1YW5 A;  2MNT A;  1BL4 A;  3O5L A;  3O5I A;  4ODR A;  2E45 A;  4G2P A;  2M8J A;  1Q6U A;  3RFW A;  3JYM A;  4DRH A;  1BKF A;  2JXW A;  1FKL A;  2M3O W;  1A7X A;  5DIT A;  3OOB A;  2XPB A;  3M85 A;  3O5D A;  3PA7 A;  1K9Q A;  3EY6 A;  2XP9 A;  3JYJ A;  1I5H W;  4DZ2 A;  1NMW A;  1FKI A;  3PRD A;  2XP3 A;  2MLX A;  3O5E A;  3TDB A;  4JFM A;  3O5G A;  5HT1 A;  4ODO A;  2YSB A;  2DK7 A;  3B7X A;  4IPX A;  1ZCN A;  1F40 A;  1O6W A;  4R0X A;  4QIB A;  1EYM A;  2LKN A;  4ODL A;  3KAG A;  2F4E A;  1WR7 A;  2XP5 A;  2DG4 A;  2F2D A;  3UQB A;  2KGJ A;  2L2S A;  4TYO A;  4MGV A;  5GPG A;  2KO7 A;  3UI5 A;  2RUQ A;  5HWC A;  2KI3 A;  3O5M A;  3CNG A;  4JFI A;  2DWV A;  4LAV A;  4DRN A;  3O5P A;  1D7J A;  5BXJ A;  1EQ3 A;  3KAI A;  3H9R B;  4O2T A;  4DT4 A;  1EG4 A;  2ITK A;  2ZAJ A;  3WH0 A;  4E5R A;  4ITZ A;  5HW8 A;  1F8A B;  3TCZ A;  3O5Q A;  4IQC A;  2XPA A;  2MDI A;  2PV2 A;  4TW8 A;  4DH0 A;  2JX8 A;  1ROT A;  1T11 A;  2MPH A;  4G50 A;  3TC5 A;  2VCD A;  3JXV A;  4GGQ A;  4TX0 A;  1J4R A;  5HWB A;  3O5K A;  2DG9 A;  1Q6I A;  1QPF A;  1FAP A;  5DIV A;  2MLZ A;  5HTG A;  2LGO A;  2Q5A A;  2L4J A;  4QT2 A;  5I98 A;  4GIV A;  3KAD A;  3KAB A;  2KXQ A;  3GPK A;  2XP6 A;  1P5Q A;  2KFW A;  3IHZ A;  3KAC A;  1FKS A;  1WMV A;  2KE0 A;  2XP8 A;  2KR7 A;  2PBC A;  2UZ5 A;  4IQ2 A;  4LAY A;  4DZ3 A;  1L1P A;  1M5Y A;  4NNR A;  4DRI A;  1B6C A;  2MF9 A;  1EG3 A;  1U79 A;  3KAH A;  1W26 A;  4W9Q A;  2DMV A;  4MSP A;  1Y0O A;  2AWG A;  1FKT A;  5B8I C;  4U84 A;  3UQA A;  2ZR5 A;  3NTP A;  1FD9 A;  2FAP A;  4DRP A;  4ODQ A;  4JFJ A;  1PBK A;  2PV3 A;  3NRK A;  1FKR A;  2LAJ A;  2YSI A;  3IK8 A;  5J6E A;  2PV1 A;  2K8I A;  4JYS A;  1JNS A;  4ODM A;  1PIN A;  2XP7 A;  1R9H A;  3CGN A;  5D75 A;  3UI4 A;  5HUA A;  3CGM A;  2RSE A;  2DK1 A;  2EZ5 W;  5AHT A;  1J4H A;  1D6O A;  1NMV A;  2RUD A;  4JFL A;  5HW7 A;  2ZR4 A;  2ZQV A;  4N19 A; 
#chains in the Genus database with same CATH topology
 1D7I A;  1LG2 A;  1HJV A;  2ETN A;  1ZK6 A;  3KZ7 A;  5GPR A;  3VAW A;  3UF8 A;  5E65 A;  3ARR A;  2XP4 A;  1JNT A;  2FKE A;  4ODN A;  2OFN A;  2LJ4 A;  4L72 B;  2RUR A;  3I6C A;  4KQZ A;  1ZBV A;  3IKD A;  4MNM A;  2YSG A;  1CTN A;  4ODK A;  4S3J A;  3B9E A;  1WNO A;  2DT2 A;  2F21 A;  5DF0 A;  2PPN A;  4DWS B;  4QT3 A;  3AS0 A;  3CHD A;  1ROU A;  4LAX A;  4P8U A;  3UQI A;  1FKD A;  3MCB B;  2RE3 A;  3G6L A;  1Q6H A;  2A3C A;  4DRJ A;  3WD0 A;  1LG1 A;  4ZPV R;  1TR8 A;  1NSG A;  4W9O A;  3FXY A;  3O5J A;  4IT4 A;  4NSB A;  3MDY B;  4Z2G A;  4ODR A;  1H0I A;  2E45 A;  3WKZ A;  3RFW A;  2M8J A;  4ZS6 A;  1BKF A;  3AS2 A;  1LQ0 A;  5DIT A;  4R5E A;  1WAW A;  1HJW A;  3PRD A;  2XP3 A;  4NZC A;  1HKK A;  4IPX A;  3WQV A;  1ZCN A;  4AY1 A;  4QIB A;  3ARQ A;  2DG4 A;  2L2S A;  2DSV A;  5GPG A;  5HWC A;  2KO7 A;  3FSC A;  2DSU A;  4JFI A;  2QF8 A;  3AS1 A;  2OLH A;  4P8X A;  1EQ3 A;  1XRV A;  4O2T A;  4E5R A;  2XPA A;  5E64 A;  4DH0 A;  3ARW A;  2JX8 A;  1LL6 A;  4GGQ A;  1J4R A;  1K9T A;  1QPF A;  1FAP A;  4QT2 A;  3KAD A;  3ARP A;  3CH9 A;  3KAC A;  1WMV A;  1JNE A;  4IQ2 A;  2G8Z A;  3MCB A;  3KAH A;  4MSP A;  3WD4 A;  1PBK A;  2PV3 A;  2LAJ A;  1GPF A;  2B31 A;  1W1V A;  5D75 A;  5DEZ A;  3CGM A;  2EZ5 W;  2WLZ A;  5HW7 A;  4Z2J A;  4PTM A;  1XHG A;  2L4J A;  2M08 A;  1FKK A;  3KAF A;  1HJX A;  2PPO A;  4MAV A;  1TK7 A;  2ZQU A;  2PI6 A;  2VN1 A;  1JND A;  3GU0 A;  4U85 A;  4BF8 A;  1GOI A;  4WJX A;  4ODP A;  2BA1 A;  3LKX A;  1QPL A;  4FN2 A;  1RP5 A;  2M8I A;  1KT0 A;  3IKG A;  4LGX A;  3RGC A;  3O5F A;  3NI6 A;  1EHN A;  3CZ8 A;  2YBT A;  2DG3 A;  1NWS A;  2RQS A;  3WD3 A;  3ARU A;  4LAW A;  1FKF A;  1E6Z A;  4Q7N A;  1E6N A;  1HKJ A;  1FKH A;  3PR9 A;  2N87 A;  4KR0 B;  1O6I A;  3RME A;  3RM4 A;  3W4R A;  2DT3 A;  1FFQ A;  3EIP A;  2DJY A;  2Y78 A;  2A3A A;  3ART A;  3G6M A;  5E5W A;  3JYM A;  5GQB A;  1VF8 A;  2Y8N B;  4WKA A;  1LJY A;  2XPB A;  3B8S A;  3O5D A;  3CHF A;  3EY6 A;  4DZ2 A;  1FKI A;  1TFV A;  3O5E A;  2MLX A;  3TDB A;  3O5G A;  1UR8 A;  4HAR A;  5E62 A;  1O6W A;  4R0X A;  2LKN A;  3WL1 A;  1WR7 A;  1SYT A;  2A3B A;  3UQB A;  2WK2 A;  2KGJ A;  4MGV A;  3UI5 A;  3O5M A;  4LAV A;  1HKI A;  4DRN A;  3O5P A;  1NWR A;  4XAK A;  4DWS C;  5BXJ A;  1IX5 A;  1EG4 A;  1E44 A;  1W1Y A;  4ITZ A;  3ARY A;  3O5Q A;  2MDI A;  1ROT A;  1T11 A;  1LL7 A;  2MPH A;  4Z2K A;  1KFW A;  1Q6I A;  5DIV A;  2LGO A;  5U47 A;  5I98 A;  3KAB A;  3GPK A;  1NH6 A;  2KFW A;  1EIB A;  3IHZ A;  1FKS A;  3FS8 A;  1EG3 A;  1U79 A;  1W26 A;  5B8I C;  1Y0O A;  4ML4 A;  1FKT A;  3WQW A;  3NTP A;  4DRP A;  1W9P A;  4JFJ A;  2DT0 A;  1FKR A;  2YSI A;  3IK8 A;  5J6E A;  2K8I A;  3WD2 A;  3PRA A;  1RD6 A;  4DWS D;  1GRJ A;  2DK1 A;  2O92 A;  5AHT A;  2RUD A;  4JFL A;  4ZPT R;  2ZR4 A;  4N19 A;  1EDQ A;  4DRK A;  1TCO C;  1NWT A;  4Z2L A;  3LUO A;  3ALG A;  5HKG A;  2ZR6 A;  4DRO A;  2WM0 A;  3WIJ A;  4DRQ A;  3BXW A;  2YSH A;  2WLY A;  3O5O A;  4TW7 A;  4REX A;  3ALF A;  2WAD A;  3FAP A;  2MLY A;  1JMQ A;  2O9O A;  1FJD A;  3OA5 A;  3M7N A;  4MNL A;  3ARZ A;  3RM9 A;  2LPV A;  2D9F A;  1FKG A;  2IUZ A;  4JFK A;  3FY1 A;  1J4I A;  2F23 A;  3LE4 A;  1JVW A;  3WD1 A;  4QZV B;  1ZBW A;  4DRM A;  1D7H A;  3L4H A;  4MNK A;  3CHC A;  1K9R A;  3ARS A;  5DIU A;  2JV4 A;  1YW5 A;  4G2P A;  2DPE A;  1FFR A;  1ZBC A;  4HBO A;  2JXW A;  3OOB A;  3RM8 A;  3M85 A;  3ARO A;  2XP9 A;  1I5H W;  1NMW A;  4JFM A;  5HT1 A;  1FLC A;  4ODO A;  2YSB A;  3B7X A;  4IT6 A;  1F40 A;  1EYM A;  2F4E A;  2F2D A;  4TYO A;  1UR9 A;  2RUQ A;  2WAE A;  2DWV A;  1E6P A;  2YAJ B;  2ITK A;  3WH0 A;  3TCZ A;  4Z2H A;  4IQC A;  1GUV A;  5JH8 A;  4G50 A;  3TC5 A;  5HWB A;  2DG9 A;  1W9V A;  2Q5A A;  3BMB A;  2KXQ A;  2XP6 A;  3ARV A;  2PBC A;  2KR7 A;  1L1P A;  5HBF A;  4NNR A;  2MF9 A;  1E6R A;  3AQU A;  4W9Q A;  2DMV A;  2AWG A;  4U84 A;  2ZR5 A;  4ODQ A;  5E66 A;  2PV1 A;  4Z2I A;  4MNJ A;  1R9H A;  3CGN A;  3MQG A;  1E15 A;  1NWU A;  5HUA A;  2RSE A;  1D6O A;  3WL0 A;  4DT4 A;  1ZB5 A;  4GLX A;  1E9L A;  2ZQV A;  4MTV A;  2JZV A;  1H0G A;  1HXV A;  3ODK A;  3PRB A;  4A0T A;  1W9U A;  2PPP A;  2ZQS A;  1ITX A;  4W9P A;  1D2K A;  4TW6 A;  2YBU A;  1YAT A;  4TNS A;  1FKB A;  4U86 A;  1C9H A;  4P8W A;  2JMF A;  2ZQT A;  4WIW A;  4WKF A;  1QZ2 A;  4J4N A;  3MQH A;  2YSF A;  1W1P A;  3O5R A;  5CQ2 A;  2M2A A;  1ZU8 A;  4W5U A;  3QOK A;  4L3N A;  1J6Y A;  1KT1 A;  4S3K A;  4C02 B;  1Q1C A;  2PN0 A;  2A3E A;  1FKJ A;  1ZBK A;  4J4O A;  5HW6 A;  3KCE A;  4DIP A;  1LL4 A;  4FAP A;  2FDM A;  2M1I A;  2RUC A;  3UI6 A;  4WKH A;  1N1A A;  4ZPW R;  2IF4 A;  1OGB A;  2MNT A;  1BL4 A;  3O5L A;  3O5I A;  3B9A A;  2DT1 A;  2DSW A;  1Q6U A;  4DRH A;  2AOS A;  1FKL A;  2M3O W;  1A7X A;  2OWO A;  3PA7 A;  1K9Q A;  3JYJ A;  2DSZ A;  3FSB A;  1X6N A;  3GTY X;  2DK7 A;  1HKM A;  2P4V A;  3ARX A;  1SR0 A;  1ZL1 A;  3KAG A;  3CHE A;  4ODL A;  5DO2 A;  2XP5 A;  1WB0 A;  2KI3 A;  4URI A;  3CNG A;  3LKX B;  1D7J A;  3KAI A;  3H9R B;  2ZAJ A;  3AS3 A;  5HW8 A;  1F8A B;  2EUL A;  2PV2 A;  2QRV A;  4TW8 A;  2VCD A;  3JXV A;  4TX0 A;  3O5K A;  4HBE A;  2MLZ A;  5HTG A;  2ESC A;  1OWQ A;  4MPK A;  4GIV A;  1P5Q A;  4DWS A;  2KE0 A;  2XP8 A;  4DZ3 A;  2UZ5 A;  4LAY A;  1M5Y A;  4DRI A;  1B6C A;  3UQA A;  1OGG A;  1FD9 A;  2FAP A;  4WK9 A;  3NRK A;  2B5U B;  4JYS A;  1JNS A;  4ODM A;  1PIN A;  2XP7 A;  2G41 A;  3UI4 A;  4Q22 A;  4A0U A;  3PQH A;  1JCH B;  1X6L A;  1W1T A;  4UDM A;  4P8V A;  1J4H A;  1NMV A;  3B9D A; 
#chains in the Genus database with same CATH homology
 1D7I A;  1LG2 A;  1HJV A;  1ZK6 A;  3KZ7 A;  5GPR A;  3VAW A;  3UF8 A;  5E65 A;  3ARR A;  2XP4 A;  1JNT A;  2FKE A;  4ODN A;  2OFN A;  2LJ4 A;  4L72 B;  2RUR A;  3I6C A;  4KQZ A;  1ZBV A;  3IKD A;  4MNM A;  2YSG A;  1CTN A;  4ODK A;  4S3J A;  3B9E A;  1WNO A;  2DT2 A;  2F21 A;  5DF0 A;  2PPN A;  4DWS B;  4QT3 A;  3AS0 A;  3CHD A;  1ROU A;  4LAX A;  4P8U A;  3UQI A;  1FKD A;  3MCB B;  2RE3 A;  3G6L A;  1Q6H A;  2A3C A;  4DRJ A;  3WD0 A;  1LG1 A;  4ZPV R;  1TR8 A;  1NSG A;  4W9O A;  3FXY A;  3O5J A;  4IT4 A;  4NSB A;  3MDY B;  4Z2G A;  4ODR A;  1H0I A;  2E45 A;  3WKZ A;  3RFW A;  2M8J A;  4ZS6 A;  1BKF A;  3AS2 A;  1LQ0 A;  5DIT A;  4R5E A;  1WAW A;  1HJW A;  3PRD A;  2XP3 A;  4NZC A;  1HKK A;  4IPX A;  3WQV A;  1ZCN A;  4AY1 A;  4QIB A;  3ARQ A;  2DG4 A;  2L2S A;  2DSV A;  5GPG A;  5HWC A;  2KO7 A;  3FSC A;  2DSU A;  4JFI A;  2QF8 A;  3AS1 A;  2OLH A;  4P8X A;  1EQ3 A;  1XRV A;  4O2T A;  4E5R A;  2XPA A;  5E64 A;  4DH0 A;  3ARW A;  2JX8 A;  1LL6 A;  4GGQ A;  1J4R A;  1K9T A;  1QPF A;  1FAP A;  4QT2 A;  3KAD A;  3ARP A;  3CH9 A;  3KAC A;  1WMV A;  1JNE A;  4IQ2 A;  2G8Z A;  3MCB A;  3KAH A;  4MSP A;  3WD4 A;  1PBK A;  2PV3 A;  2LAJ A;  1GPF A;  2B31 A;  1W1V A;  5D75 A;  5DEZ A;  3CGM A;  2EZ5 W;  2WLZ A;  5HW7 A;  4Z2J A;  4PTM A;  1XHG A;  2L4J A;  2M08 A;  1FKK A;  3KAF A;  1HJX A;  2PPO A;  4MAV A;  1TK7 A;  2ZQU A;  2PI6 A;  2VN1 A;  1JND A;  4U85 A;  4BF8 A;  1GOI A;  4WJX A;  4ODP A;  2BA1 A;  3LKX A;  1QPL A;  4FN2 A;  1RP5 A;  2M8I A;  1KT0 A;  3IKG A;  4LGX A;  3RGC A;  3O5F A;  3NI6 A;  1EHN A;  3CZ8 A;  2YBT A;  2DG3 A;  1NWS A;  2RQS A;  3WD3 A;  3ARU A;  4LAW A;  1FKF A;  1E6Z A;  4Q7N A;  1E6N A;  1HKJ A;  1FKH A;  3PR9 A;  2N87 A;  4KR0 B;  1O6I A;  3RME A;  3RM4 A;  3W4R A;  2DT3 A;  1FFQ A;  2DJY A;  2Y78 A;  2A3A A;  3ART A;  3G6M A;  5E5W A;  3JYM A;  5GQB A;  1VF8 A;  2Y8N B;  4WKA A;  1LJY A;  2XPB A;  3B8S A;  3O5D A;  3CHF A;  3EY6 A;  4DZ2 A;  1FKI A;  1TFV A;  3O5E A;  2MLX A;  3TDB A;  3O5G A;  1UR8 A;  4HAR A;  5E62 A;  1O6W A;  4R0X A;  2LKN A;  3WL1 A;  1WR7 A;  1SYT A;  2A3B A;  3UQB A;  2WK2 A;  2KGJ A;  4MGV A;  3UI5 A;  3O5M A;  4LAV A;  1HKI A;  4DRN A;  3O5P A;  1NWR A;  4XAK A;  4DWS C;  5BXJ A;  1IX5 A;  1EG4 A;  1W1Y A;  4ITZ A;  3ARY A;  3O5Q A;  2MDI A;  1ROT A;  1T11 A;  1LL7 A;  2MPH A;  4Z2K A;  1KFW A;  1Q6I A;  5DIV A;  2LGO A;  5U47 A;  5I98 A;  3KAB A;  3GPK A;  1NH6 A;  2KFW A;  1EIB A;  3IHZ A;  1FKS A;  3FS8 A;  1EG3 A;  1U79 A;  1W26 A;  5B8I C;  1Y0O A;  4ML4 A;  1FKT A;  3WQW A;  3NTP A;  4DRP A;  1W9P A;  4JFJ A;  2DT0 A;  1FKR A;  2YSI A;  3IK8 A;  5J6E A;  2K8I A;  3WD2 A;  3PRA A;  1RD6 A;  4DWS D;  2DK1 A;  2O92 A;  5AHT A;  2RUD A;  4JFL A;  4ZPT R;  2ZR4 A;  4N19 A;  1EDQ A;  4DRK A;  1TCO C;  1NWT A;  4Z2L A;  3LUO A;  3ALG A;  5HKG A;  2ZR6 A;  4DRO A;  2WM0 A;  3WIJ A;  4DRQ A;  3BXW A;  2YSH A;  2WLY A;  3O5O A;  4TW7 A;  4REX A;  3ALF A;  2WAD A;  3FAP A;  2MLY A;  1JMQ A;  2O9O A;  1FJD A;  3OA5 A;  3M7N A;  4MNL A;  3ARZ A;  3RM9 A;  2LPV A;  2D9F A;  1FKG A;  2IUZ A;  4JFK A;  3FY1 A;  1J4I A;  3LE4 A;  1JVW A;  3WD1 A;  4QZV B;  1ZBW A;  4DRM A;  1D7H A;  3L4H A;  4MNK A;  3CHC A;  1K9R A;  3ARS A;  5DIU A;  2JV4 A;  1YW5 A;  4G2P A;  2DPE A;  1FFR A;  1ZBC A;  4HBO A;  2JXW A;  3OOB A;  3RM8 A;  3M85 A;  3ARO A;  2XP9 A;  1I5H W;  1NMW A;  4JFM A;  5HT1 A;  1FLC A;  4ODO A;  2YSB A;  3B7X A;  4IT6 A;  1F40 A;  1EYM A;  2F4E A;  2F2D A;  4TYO A;  1UR9 A;  2RUQ A;  2WAE A;  2DWV A;  1E6P A;  2YAJ B;  2ITK A;  3WH0 A;  3TCZ A;  4Z2H A;  4IQC A;  1GUV A;  5JH8 A;  4G50 A;  3TC5 A;  5HWB A;  2DG9 A;  1W9V A;  2Q5A A;  2KXQ A;  2XP6 A;  3ARV A;  2PBC A;  2KR7 A;  1L1P A;  5HBF A;  4NNR A;  2MF9 A;  1E6R A;  3AQU A;  4W9Q A;  2DMV A;  2AWG A;  4U84 A;  2ZR5 A;  4ODQ A;  5E66 A;  2PV1 A;  4Z2I A;  4MNJ A;  1R9H A;  3CGN A;  3MQG A;  1E15 A;  1NWU A;  5HUA A;  2RSE A;  1D6O A;  3WL0 A;  4DT4 A;  1ZB5 A;  4GLX A;  1E9L A;  2ZQV A;  4MTV A;  2JZV A;  1H0G A;  1HXV A;  3ODK A;  3PRB A;  4A0T A;  1W9U A;  2PPP A;  2ZQS A;  1ITX A;  4W9P A;  1D2K A;  4TW6 A;  2YBU A;  1YAT A;  4TNS A;  1FKB A;  4U86 A;  1C9H A;  4P8W A;  2JMF A;  2ZQT A;  4WIW A;  4WKF A;  1QZ2 A;  4J4N A;  3MQH A;  2YSF A;  1W1P A;  3O5R A;  5CQ2 A;  2M2A A;  1ZU8 A;  4W5U A;  3QOK A;  4L3N A;  1J6Y A;  1KT1 A;  4S3K A;  4C02 B;  1Q1C A;  2A3E A;  1FKJ A;  1ZBK A;  4J4O A;  5HW6 A;  3KCE A;  4DIP A;  1LL4 A;  4FAP A;  2FDM A;  2M1I A;  2RUC A;  3UI6 A;  4WKH A;  1N1A A;  4ZPW R;  2IF4 A;  1OGB A;  2MNT A;  1BL4 A;  3O5L A;  3O5I A;  3B9A A;  2DT1 A;  2DSW A;  1Q6U A;  4DRH A;  2AOS A;  1FKL A;  2M3O W;  1A7X A;  2OWO A;  3PA7 A;  1K9Q A;  3JYJ A;  2DSZ A;  3FSB A;  1X6N A;  2DK7 A;  1HKM A;  3ARX A;  1SR0 A;  1ZL1 A;  3KAG A;  3CHE A;  4ODL A;  5DO2 A;  2XP5 A;  1WB0 A;  2KI3 A;  4URI A;  3CNG A;  3LKX B;  1D7J A;  3KAI A;  3H9R B;  2ZAJ A;  3AS3 A;  5HW8 A;  1F8A B;  2PV2 A;  2QRV A;  4TW8 A;  2VCD A;  3JXV A;  4TX0 A;  3O5K A;  4HBE A;  2MLZ A;  5HTG A;  2ESC A;  1OWQ A;  4MPK A;  4GIV A;  1P5Q A;  4DWS A;  2KE0 A;  2XP8 A;  4DZ3 A;  2UZ5 A;  4LAY A;  1M5Y A;  4DRI A;  1B6C A;  3UQA A;  1OGG A;  1FD9 A;  2FAP A;  4WK9 A;  3NRK A;  4JYS A;  1JNS A;  4ODM A;  1PIN A;  2XP7 A;  2G41 A;  3UI4 A;  4Q22 A;  4A0U A;  3PQH A;  1X6L A;  1W1T A;  4P8V A;  1J4H A;  1NMV A;  3B9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...