1PINA

Pin1 peptidyl-prolyl cis-trans isomerase from homo sapiens
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of the mitotic rotamase Pin1 suggests substrate recognition is phosphorylation dependent.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE
total genus 42
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1998-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1pinA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1pinA02
2XPBA 2RURA 3KACA 4DRPA 4QIBA 1QPFA 4JYSA 4C02B 5AHTA 1D7JA 2XP4A 2MF9A 3JYJA 4W9PA 5D75A 4TW8A 1TK7A 2KXQA 2F2DA 3NRKA 4R0XA 4J4NA 4TW7A 1B6CA 1QZ2A 1FKIA 1BKFA 1C9HA 2YSFA 1TCOC 1KT1A 2LPVA 3O5IA 4U84A 1ZK6A 3GPKA 3O5PA 3VAWA 2PPPA 1R9HA 3M7NA 1Q6IA 1Q6UA 1FKFA 2KFWA 4ITZA 3O5GA 4DT4A 4DZ3A 3UF8A 2MNTA 2KO7A 4DH0A 2JV4A 1FKBA 2F21A 1U79A 4IQCA 4LAXA 4QT2A 2DK1A 1J4RA 4W9QA 1FD9A 5HUAA 4TYOA 3PA7A 2XP8A 2RUQA 4DRJA 5BXJA 2MPHA 4J4OA 1M5YA 4G50A 3ODKA 4O2TA 4DRMA 3M85A 1NSGA 3O5JA 2E45A 2KR7A 5HT1A 4DRNA 2DWVA 3EY6A 5HTGA 2VCDA 5HW8A 1EG4A 1JNSA 5GPGA 2L2SA 2PPNA 1K9QA 3PRBA 3B7XA 4DRIA 2ZQTA 4GGQA 2L4JA 2M1IA 1F40A 3L4HA 2XPAA 2MLYA 4FN2A 2ITKA 2LGOA 4ODNA 1PBKA 3TCZA 2JZVA 2N87A 3KAHA 4TW6A 1WR7A 5DITA 2ZQUA 3CGNA 2ZR5A 2ZR6A 3O5KA 4DROA 1F8AB 3O5DA 2XP3A 3UQBA 1EG3A 1NMVA 2XP9A 4U86A 2KI3A 2ZQSA 4G2PA 1ROTA 4GIVA 1YATA 2RUCA 4ODKA 2YSIA 4LAVA 3UQIA 2PPOA 4DZ2A 3O5QA 1T11A 2MLXA 2M8JA 3OOBA 3IK8A 3IKGA 1WMVA 1D7IA 2AWGA 3O5MA 4DRHA 5HW7A 5J6EA 2YSHA 1EQ3A 4DIPA 3O5RA 3JXVA 3IHZA 3PRDA 2OFNA 4REXA 1FAPA 1FKSA 3KABA 4ODMA 1PINA 3KAGA 3IKDA 4IPXA 1W26A 3JYMA 2LAJA 3TDBA 1K9RA 1FKDA 4MGVA 2UZ5A 3UI4A 5I98A 1FJDA 2YSGA 2D9FA 2ZAJA 1ZCNA 2XP5A 4U85A 2EZ5W 2PBCA 1D6OA 4LAYA 2F4EA 4MSPA 2RE3A 1FKTA 1FKRA 2RQSA 1I5HW 2DG9A 3I6CA 3FAPA 4JFMA 4JFLA 2ZR4A 2YSBA 1QPLA 3RFWA 4LAWA 1FKKA 1Y0OA 4DRKA 3NI6A 4BF8A 3O5LA 2KGJA 5B8IC 2JMFA 2RUDA 2XP7A 2MLZA 5HW6A 2Y78A 4ODLA 2FAPA 2KE0A 2VN1A 4JFJA 4E5RA 2DG3A 2DJYA 3KADA 2PV1A 3NTPA 1D7HA 1BL4A 5DIVA 5HKGA 5DIUA 2JX8A 1J6YA 1JMQA 1EYMA 4ODPA 4DRQA 1P5QA 4IQ2A 4N19A 4NNRA 2PV3A 4TNSA 4FAPA 5CQ2A 3CNGA 1KT0A 2FKEA 2M8IA 2LJ4A 2RSEA 4JFKA 2JXWA 1FKLA 4ODRA 4ODQA 3WH0A 4ODOA 3O5OA 4W9OA 1O6WA 3UQAA 1FKHA 3UI6A 5HWCA 3LE4A 3KAFA 3O5FA 2DK7A 5HWBA 3CGMA 1Q6HA 2DG4A 1Q1CA 2M2AA 3UI5A 2XP6A 3RGCA 1N1AA 2K8IA 1ROUA 2ZQVA 1J4IA 1J4HA 1NMWA 4JFIA 2M3OW 3TC5A 2LKNA 2PV2A 3MDYB 4QT3A 2MDIA 1FKGA 3KCEA 2DMVA 4TX0A 2BA1A 2Q5AA 3H9RB 1JNTA 3KZ7A 2IF4A 3LUOA 3O5EA 1L1PA 1HXVA 1FKJA 1JVWA 1YW5A 1A7XA 3KAIA 2M08A
chains in the Genus database with same CATH superfamily
2XPBA 2RURA 1D2KA 4WKAA 5D75A 4TW8A 3NRKA 4R0XA 3WD1A 1QZ2A 1TFVA 3FS8A 3O5IA 3BMBA 1R9HA 2KFWA 4DT4A 1X6LA 3FY1A 2JV4A 4P8WA 1U79A 4W5UA 1NWRA 4URIA 2DK1A 3PA7A 2RUQA 2DT3A 4G50A 3O5JA 1NWUA 2VCDA 2L2SA 3PRBA 2L4JA 2M1IA 3GU0A 3QOKA 2MLYA 1ZL1A 2LGOA 2G41A 3RM8A 2WK2A 1PBKA 3TCZA 3B9EA 2ZQUA 1E6PA 1NWSA 4Z2HA 1FFQA 1ROTA 4LAVA 4DZ2A 5E66A 2MLXA 3IKGA 2EULA 3CZ8A 1ZBWA 4MNJA 4Z2KA 1ZBKA 2OFNA 2DSZA 4ODMA 4L72B 2O9OA 1W26A 3MCBB 3TDBA 1NWTA 1WAWA 1ZU8A 2DT2A 1K9RA 4MGVA 3CH9A 2ESCA 1FJDA 2D9FA 2ZAJA 1XRVA 3FSCA 2EZ5W 4LAYA 1D6OA 4MPKA 1FKTA 1I5HW 2ZR4A 1QPLA 3B9AA 3RFWA 3PR9A 4DWSB 1EDQA 5B8IC 3AQUA 3AROA 3AS0A 5HKGA 4P8VA 4MTVA 5DIUA 2JX8A 3WL0A 1J6YA 1P5QA 2PV3A 4TNSA 2M8IA 3WH0A 4W9OA 1SYTA 1FKHA 1OWQA 2A3BA 3O5FA 1Q6HA 4MAVA 3WD3A 1Q1CA 2M2AA 3UI5A 2OLHA 3RGCA 3GTYX 3WQVA 1J4HA 3ARQA 1HJXA 2Q5AA 3LKXB 3KZ7A 2FDMA 4AY1A 1UR9A 1L1PA 1JVWA 1A7XA 2M08A 1W9VA 1QPFA 1D7JA 3JYJA 4HARA 2KXQA 2F2DA 4J4NA 1B6CA 4DRPA 2YSFA 3VAWA 5U47A 4U84A 1ZK6A 3GPKA 4WIWA 1Q6UA 1FKFA 3O5GA 3UF8A 2MNTA 1O6IA 3WIJA 4TYOA 2DPEA 2YAJB 2P4VA 5E62A 2DWVA 3EY6A 1EG4A 3ARPA 5GPGA 1W9PA 1LJYA 4ML4A 5DEZA 3B7XA 4DRIA 4IT6A 4GGQA 3ARSA 2XPAA 1ZBVA 2ITKA 1OGBA 1SR0A 4TW6A 5DITA 1WB0A 1XHGA 4DROA 2F23A 3O5DA 2XP3A 5HBFA 5GQBA 3UQBA 1NMVA 4DWSA 1YATA 4ODKA 2YSIA 3ALGA 1T11A 3LKXA 2G8ZA 3O5MA 4DRHA 4MNKA 4DIPA 1OGGA 3JXVA 4L3NA 4REXA 3ARXA 3KABA 2WADA 1PINA 3IKDA 4IPXA 2DT0A 1E44A 5E65A 1K9TA 2UZ5A 3UI4A 2PBCA 4KR0B 3WL1A 1FKRA 1HJVA 2RE3A 3I6CA 4JFLA 3B9DA 2O92A 2KGJA 3WQWA 2JMFA 5E64A 4A0UA 3ALFA 2FAPA 4JFJA 3KADA 2AOSA 3ARUA 4WK9A 5DIVA 3EIPA 1JMQA 1EYMA 4DRQA 1RD6A 4N19A 5CQ2A 2LJ4A 2WM0A 1JCHB 4R5EA 4DH0A 2JXWA 1FKLA 4ODQA 1HKKA 4ODOA 1LG1A 2IUZA 1GRJA 3LE4A 5HWBA 3CGMA 4WJXA 2WAEA 2DT1A 2XP6A 3AS2A 2K8IA 3OA5A 1J4IA 1NMWA 2B5UB 2MDIA 4TX0A 2DMVA 5DO2A 3ARZA 1JNTA 1JNEA 3AS1A 1H0GA 2IF4A 4P8XA 4Q7NA 1FKJA 4NZCA 1GUVA 3KAIA 3JYMA 1W1TA 4QIBA 4JYSA 4C02B 3ARWA 4W9PA 2XP4A 2MF9A 4TW7A 1TCOC 1FKIA 1BKFA 1C9HA 2LPVA 4MNLA 3O5PA 2PPPA 1KFWA 3M7NA 1Q6IA 1E9LA 5HUAA 4W9QA 2PN0A 3ARVA 2QRVA 2XP8A 5BXJA 2MPHA 1WNOA 3ODKA 4DRMA 4WKFA 4DWSC 4DRNA 2KR7A 5HTGA 4ZS6A 5HW8A 1K9QA 1EHNA 2DSVA 2ZQTA 4ZPWR 3RM4A 4LGXA 4ODNA 2JZVA 3KAHA 1WR7A 3B8SA 4UDMA 3RMEA 3CGNA 1VF8A 2ZR5A 2ZR6A 2YBTA 3O5KA 1H0IA 2XP9A 4U86A 3BXWA 2KI3A 2ZQSA 4G2PA 2PI6A 3UQIA 5GPRA 3O5QA 1E6NA 1HKJA 3OOBA 1E6ZA 2AWGA 3CHFA 4Z2IA 5HW7A 1EQ3A 3AS3A 1LL7A 3PRDA 5JH8A 1FKDA 5I98A 1TR8A 3FSBA 1EIBA 1E6RA 1ZCNA 4WKHA 2XP5A 4U85A 3WD0A 4MSPA 2F4EA 2RQSA 2OWOA 4DRKA 3O5LA 1GPFA 3G6MA 2RUDA 2YBUA 2B31A 2XP7A 2MLZA 5HW6A 2Y78A 4ODLA 2VN1A 2KE0A 3ARTA 2PV1A 2DG3A 4E5RA 1JNDA 2DJYA 1HJWA 3NTPA 1BL4A 1FFRA 4Z2LA 3PQHA 1LL6A 4FAPA 2FKEA 3CNGA 4ODRA 4IT4A 3UQAA 3UI6A 4Z2JA 1ZBCA 4QZVB 1ROUA 2M3OW 3TC5A 2PV2A 3MDYB 4QT3A 4HBOA 2BA1A 3H9RB 3LUOA 1HXVA 3KCEA 2WLZA 1UR8A 4NSBA 3KACA 5AHTA 1TK7A 4ZPTR 4S3KA 4KQZA 1KT1A 3RM9A 4ITZA 4DZ3A 2KO7A 2WLYA 1FKBA 1FLCA 2F21A 1GOIA 4IQCA 4LAXA 4QT2A 1J4RA 1FD9A 4DRJA 2A3EA 4J4OA 3WKZA 3CHDA 1M5YA 3PRAA 4O2TA 3ARYA 3M85A 1NSGA 2E45A 5HT1A 3WD2A 4P8UA 1JNSA 3CHCA 2PPNA 1LL4A 3CHEA 1F40A 3L4HA 1E15A 1W9UA 2DSUA 4FN2A 3MQHA 1NH6A 2N87A 4GLXA 1LG2A 1ZB5A 1LQ0A 2A3CA 1F8AB 2A3AA 1EG3A 3G6LA 4GIVA 2ETNA 2RUCA 2PPOA 3MCBA 4S3JA 3ARRA 2M8JA 3IK8A 1WMVA 1D7IA 2YSHA 4PTMA 3O5RA 3IHZA 2QF8A 1FAPA 1FKSA 3KAGA 5E5WA 2LAJA 3W4RA 4Z2GA 2YSGA 1W1YA 1ITXA 1IX5A 1RP5A 4HBEA 4Q22A 2DG9A 3FAPA 4JFMA 2YSBA 1X6NA 4A0TA 1W1VA 4LAWA 5DF0A 1FKKA 1Y0OA 1W1PA 3NI6A 1HKIA 4BF8A 1HKMA 4DWSD 2DSWA 4ZPVR 1D7HA 4XAKA 4ODPA 5J6EA 4IQ2A 4NNRA 3WD4A 2RSEA 1KT0A 4JFKA 2Y8NB 1CTNA 3O5OA 1O6WA 5HWCA 3KAFA 2DK7A 3MQGA 2DG4A 1N1AA 3FXYA 2ZQVA 4JFIA 2LKNA 4MNMA 1FKGA 3O5EA 1YW5A
chains in the Genus database with same CATH topology
2XPBA 2RURA 1D2KA 4WKAA 5D75A 4TW8A 3NRKA 4R0XA 3WD1A 1QZ2A 1TFVA 3FS8A 3O5IA 1R9HA 2KFWA 4DT4A 1X6LA 3FY1A 2JV4A 4P8WA 1U79A 4W5UA 1NWRA 4URIA 2DK1A 3PA7A 2RUQA 2DT3A 4G50A 3O5JA 1NWUA 2VCDA 2L2SA 3PRBA 2L4JA 2M1IA 3QOKA 2MLYA 1ZL1A 2LGOA 2G41A 3RM8A 2WK2A 1PBKA 3TCZA 3B9EA 2ZQUA 1E6PA 1NWSA 4Z2HA 1FFQA 1ROTA 4LAVA 4DZ2A 5E66A 2MLXA 3IKGA 3CZ8A 1ZBWA 4MNJA 4Z2KA 1ZBKA 2OFNA 2DSZA 4ODMA 4L72B 2O9OA 1W26A 3MCBB 3TDBA 1NWTA 1WAWA 1ZU8A 2DT2A 1K9RA 4MGVA 3CH9A 2ESCA 1FJDA 2D9FA 2ZAJA 1XRVA 3FSCA 2EZ5W 4LAYA 1D6OA 4MPKA 1FKTA 1I5HW 2ZR4A 1QPLA 3B9AA 3RFWA 3PR9A 4DWSB 1EDQA 5B8IC 3AQUA 3AROA 3AS0A 5HKGA 4P8VA 4MTVA 5DIUA 2JX8A 3WL0A 1J6YA 1P5QA 2PV3A 4TNSA 2M8IA 3WH0A 4W9OA 1SYTA 1FKHA 1OWQA 2A3BA 3O5FA 1Q6HA 4MAVA 3WD3A 1Q1CA 2M2AA 3UI5A 2OLHA 3RGCA 3WQVA 1J4HA 3ARQA 1HJXA 2Q5AA 3LKXB 3KZ7A 2FDMA 4AY1A 1UR9A 1L1PA 1JVWA 1A7XA 2M08A 1W9VA 1QPFA 1D7JA 3JYJA 4HARA 2KXQA 2F2DA 4J4NA 1B6CA 4DRPA 2YSFA 3VAWA 5U47A 4U84A 1ZK6A 3GPKA 4WIWA 1Q6UA 1FKFA 3O5GA 3UF8A 2MNTA 1O6IA 3WIJA 4TYOA 2DPEA 2YAJB 5E62A 2DWVA 3EY6A 1EG4A 3ARPA 5GPGA 1W9PA 1LJYA 4ML4A 5DEZA 3B7XA 4DRIA 4IT6A 4GGQA 3ARSA 2XPAA 1ZBVA 2ITKA 1OGBA 1SR0A 4TW6A 5DITA 1WB0A 1XHGA 4DROA 3O5DA 2XP3A 5HBFA 5GQBA 3UQBA 1NMVA 4DWSA 1YATA 4ODKA 2YSIA 3ALGA 1T11A 3LKXA 2G8ZA 3O5MA 4DRHA 4MNKA 4DIPA 1OGGA 3JXVA 4L3NA 4REXA 3ARXA 3KABA 2WADA 1PINA 3IKDA 4IPXA 2DT0A 5E65A 1K9TA 2UZ5A 3UI4A 2PBCA 4KR0B 3WL1A 1FKRA 1HJVA 2RE3A 3I6CA 4JFLA 3B9DA 2O92A 2KGJA 3WQWA 2JMFA 5E64A 4A0UA 3ALFA 2FAPA 4JFJA 3KADA 2AOSA 3ARUA 4WK9A 5DIVA 1JMQA 1EYMA 4DRQA 1RD6A 4N19A 5CQ2A 2LJ4A 2WM0A 4R5EA 4DH0A 2JXWA 1FKLA 4ODQA 1HKKA 4ODOA 1LG1A 2IUZA 3LE4A 5HWBA 3CGMA 4WJXA 2WAEA 2DT1A 2XP6A 3AS2A 2K8IA 3OA5A 1J4IA 1NMWA 2MDIA 4TX0A 2DMVA 5DO2A 3ARZA 1JNTA 1JNEA 3AS1A 1H0GA 2IF4A 4P8XA 4Q7NA 1FKJA 4NZCA 1GUVA 3KAIA 3JYMA 1W1TA 4QIBA 4JYSA 4C02B 3ARWA 4W9PA 2XP4A 2MF9A 4TW7A 1TCOC 1FKIA 1BKFA 1C9HA 2LPVA 4MNLA 3O5PA 2PPPA 1KFWA 3M7NA 1Q6IA 1E9LA 5HUAA 4W9QA 3ARVA 2QRVA 2XP8A 5BXJA 2MPHA 1WNOA 3ODKA 4DRMA 4WKFA 4DWSC 4DRNA 2KR7A 5HTGA 4ZS6A 5HW8A 1K9QA 1EHNA 2DSVA 2ZQTA 4ZPWR 3RM4A 4LGXA 4ODNA 2JZVA 3KAHA 1WR7A 3B8SA 3RMEA 3CGNA 1VF8A 2ZR5A 2ZR6A 2YBTA 3O5KA 1H0IA 2XP9A 4U86A 3BXWA 2KI3A 2ZQSA 4G2PA 2PI6A 3UQIA 5GPRA 3O5QA 1E6NA 1HKJA 3OOBA 1E6ZA 2AWGA 3CHFA 4Z2IA 5HW7A 1EQ3A 3AS3A 1LL7A 3PRDA 5JH8A 1FKDA 5I98A 1TR8A 3FSBA 1EIBA 1E6RA 1ZCNA 4WKHA 2XP5A 4U85A 3WD0A 4MSPA 2F4EA 2RQSA 2OWOA 4DRKA 3O5LA 1GPFA 3G6MA 2RUDA 2YBUA 2B31A 2XP7A 2MLZA 5HW6A 2Y78A 4ODLA 2VN1A 2KE0A 3ARTA 2PV1A 2DG3A 4E5RA 1JNDA 2DJYA 1HJWA 3NTPA 1BL4A 1FFRA 4Z2LA 3PQHA 1LL6A 4FAPA 2FKEA 3CNGA 4ODRA 4IT4A 3UQAA 3UI6A 4Z2JA 1ZBCA 4QZVB 1ROUA 2M3OW 3TC5A 2PV2A 3MDYB 4QT3A 4HBOA 2BA1A 3H9RB 3LUOA 1HXVA 3KCEA 2WLZA 1UR8A 4NSBA 3KACA 5AHTA 1TK7A 4ZPTR 4S3KA 4KQZA 1KT1A 3RM9A 4ITZA 4DZ3A 2KO7A 2WLYA 1FKBA 1FLCA 2F21A 1GOIA 4IQCA 4LAXA 4QT2A 1J4RA 1FD9A 4DRJA 2A3EA 4J4OA 3WKZA 3CHDA 1M5YA 3PRAA 4O2TA 3ARYA 3M85A 1NSGA 2E45A 5HT1A 3WD2A 4P8UA 1JNSA 3CHCA 2PPNA 1LL4A 3CHEA 1F40A 3L4HA 1E15A 1W9UA 2DSUA 4FN2A 3MQHA 1NH6A 2N87A 4GLXA 1LG2A 1ZB5A 1LQ0A 2A3CA 1F8AB 2A3AA 1EG3A 3G6LA 4GIVA 2RUCA 2PPOA 3MCBA 4S3JA 3ARRA 2M8JA 3IK8A 1WMVA 1D7IA 2YSHA 4PTMA 3O5RA 3IHZA 2QF8A 1FAPA 1FKSA 3KAGA 5E5WA 2LAJA 3W4RA 4Z2GA 2YSGA 1W1YA 1ITXA 1IX5A 1RP5A 4HBEA 4Q22A 2DG9A 3FAPA 4JFMA 2YSBA 1X6NA 4A0TA 1W1VA 4LAWA 5DF0A 1FKKA 1Y0OA 1W1PA 3NI6A 1HKIA 4BF8A 1HKMA 4DWSD 2DSWA 4ZPVR 1D7HA 4XAKA 4ODPA 5J6EA 4IQ2A 4NNRA 3WD4A 1KT0A 2RSEA 4JFKA 2Y8NB 1CTNA 3O5OA 1O6WA 5HWCA 3KAFA 2DK7A 3MQGA 2DG4A 1N1AA 3FXYA 2ZQVA 4JFIA 2LKNA 4MNMA 1FKGA 3O5EA 1YW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XPB A;  2RUR A;  3KAC A;  4DRP A;  4QIB A;  1QPF A;  4JYS A;  4C02 B;  5AHT A;  1D7J A;  2XP4 A;  2MF9 A;  3JYJ A;  4W9P A;  5D75 A;  4TW8 A;  1TK7 A;  2KXQ A;  2F2D A;  3NRK A;  4R0X A;  4J4N A;  4TW7 A;  1B6C A;  1QZ2 A;  1FKI A;  1BKF A;  1C9H A;  2YSF A;  1TCO C;  1KT1 A;  2LPV A;  3O5I A;  4U84 A;  1ZK6 A;  3GPK A;  3O5P A;  3VAW A;  2PPP A;  1R9H A;  3M7N A;  1Q6I A;  1Q6U A;  1FKF A;  2KFW A;  4ITZ A;  3O5G A;  4DT4 A;  4DZ3 A;  3UF8 A;  2MNT A;  2KO7 A;  4DH0 A;  2JV4 A;  1FKB A;  2F21 A;  1U79 A;  4IQC A;  4LAX A;  4QT2 A;  2DK1 A;  1J4R A;  4W9Q A;  1FD9 A;  5HUA A;  4TYO A;  3PA7 A;  2XP8 A;  2RUQ A;  4DRJ A;  5BXJ A;  2MPH A;  4J4O A;  1M5Y A;  4G50 A;  3ODK A;  4O2T A;  4DRM A;  3M85 A;  1NSG A;  3O5J A;  2E45 A;  2KR7 A;  5HT1 A;  4DRN A;  2DWV A;  3EY6 A;  5HTG A;  2VCD A;  5HW8 A;  1EG4 A;  1JNS A;  5GPG A;  2L2S A;  2PPN A;  1K9Q A;  3PRB A;  3B7X A;  4DRI A;  2ZQT A;  4GGQ A;  2L4J A;  2M1I A;  1F40 A;  3L4H A;  2XPA A;  2MLY A;  4FN2 A;  2ITK A;  2LGO A;  4ODN A;  1PBK A;  3TCZ A;  2JZV A;  2N87 A;  3KAH A;  4TW6 A;  1WR7 A;  5DIT A;  2ZQU A;  3CGN A;  2ZR5 A;  2ZR6 A;  3O5K A;  4DRO A;  1F8A B;  3O5D A;  2XP3 A;  3UQB A;  1EG3 A;  1NMV A;  2XP9 A;  4U86 A;  2KI3 A;  2ZQS A;  4G2P A;  1ROT A;  4GIV A;  1YAT A;  2RUC A;  4ODK A;  2YSI A;  4LAV A;  3UQI A;  2PPO A;  4DZ2 A;  3O5Q A;  1T11 A;  2MLX A;  2M8J A;  3OOB A;  3IK8 A;  3IKG A;  1WMV A;  1D7I A;  2AWG A;  3O5M A;  4DRH A;  5HW7 A;  5J6E A;  2YSH A;  1EQ3 A;  4DIP A;  3O5R A;  3JXV A;  3IHZ A;  3PRD A;  2OFN A;  4REX A;  1FAP A;  1FKS A;  3KAB A;  4ODM A;  1PIN A;  3KAG A;  3IKD A;  4IPX A;  1W26 A;  3JYM A;  2LAJ A;  3TDB A;  1K9R A;  1FKD A;  4MGV A;  2UZ5 A;  3UI4 A;  5I98 A;  1FJD A;  2YSG A;  2D9F A;  2ZAJ A;  1ZCN A;  2XP5 A;  4U85 A;  2EZ5 W;  2PBC A;  1D6O A;  4LAY A;  2F4E A;  4MSP A;  2RE3 A;  1FKT A;  1FKR A;  2RQS A;  1I5H W;  2DG9 A;  3I6C A;  3FAP A;  4JFM A;  4JFL A;  2ZR4 A;  2YSB A;  1QPL A;  3RFW A;  4LAW A;  1FKK A;  1Y0O A;  4DRK A;  3NI6 A;  4BF8 A;  3O5L A;  2KGJ A;  5B8I C;  2JMF A;  2RUD A;  2XP7 A;  2MLZ A;  5HW6 A;  2Y78 A;  4ODL A;  2FAP A;  2KE0 A;  2VN1 A;  4JFJ A;  4E5R A;  2DG3 A;  2DJY A;  3KAD A;  2PV1 A;  3NTP A;  1D7H A;  1BL4 A;  5DIV A;  5HKG A;  5DIU A;  2JX8 A;  1J6Y A;  1JMQ A;  1EYM A;  4ODP A;  4DRQ A;  1P5Q A;  4IQ2 A;  4N19 A;  4NNR A;  2PV3 A;  4TNS A;  4FAP A;  5CQ2 A;  3CNG A;  1KT0 A;  2FKE A;  2M8I A;  2LJ4 A;  2RSE A;  4JFK A;  2JXW A;  1FKL A;  4ODR A;  4ODQ A;  3WH0 A;  4ODO A;  3O5O A;  4W9O A;  1O6W A;  3UQA A;  1FKH A;  3UI6 A;  5HWC A;  3LE4 A;  3KAF A;  3O5F A;  2DK7 A;  5HWB A;  3CGM A;  1Q6H A;  2DG4 A;  1Q1C A;  2M2A A;  3UI5 A;  2XP6 A;  3RGC A;  1N1A A;  2K8I A;  1ROU A;  2ZQV A;  1J4I A;  1J4H A;  1NMW A;  4JFI A;  2M3O W;  3TC5 A;  2LKN A;  2PV2 A;  3MDY B;  4QT3 A;  2MDI A;  1FKG A;  3KCE A;  2DMV A;  4TX0 A;  2BA1 A;  2Q5A A;  3H9R B;  1JNT A;  3KZ7 A;  2IF4 A;  3LUO A;  3O5E A;  1L1P A;  1HXV A;  1FKJ A;  1JVW A;  1YW5 A;  1A7X A;  3KAI A;  2M08 A; 
#chains in the Genus database with same CATH topology
 2XPB A;  2RUR A;  1D2K A;  4WKA A;  5D75 A;  4TW8 A;  3NRK A;  4R0X A;  3WD1 A;  1QZ2 A;  1TFV A;  3FS8 A;  3O5I A;  3BMB A;  1R9H A;  2KFW A;  4DT4 A;  1X6L A;  3FY1 A;  2JV4 A;  4P8W A;  1U79 A;  4W5U A;  1NWR A;  4URI A;  2DK1 A;  3PA7 A;  2RUQ A;  2DT3 A;  4G50 A;  3O5J A;  1NWU A;  2VCD A;  2L2S A;  3PRB A;  2L4J A;  2M1I A;  3GU0 A;  3QOK A;  2MLY A;  1ZL1 A;  2LGO A;  2G41 A;  3RM8 A;  2WK2 A;  1PBK A;  3TCZ A;  3B9E A;  2ZQU A;  1E6P A;  1NWS A;  4Z2H A;  1FFQ A;  1ROT A;  4LAV A;  4DZ2 A;  5E66 A;  2MLX A;  3IKG A;  2EUL A;  3CZ8 A;  1ZBW A;  4MNJ A;  4Z2K A;  1ZBK A;  2OFN A;  2DSZ A;  4ODM A;  4L72 B;  2O9O A;  1W26 A;  3MCB B;  3TDB A;  1NWT A;  1WAW A;  1ZU8 A;  2DT2 A;  1K9R A;  4MGV A;  3CH9 A;  2ESC A;  1FJD A;  2D9F A;  2ZAJ A;  1XRV A;  3FSC A;  2EZ5 W;  4LAY A;  1D6O A;  4MPK A;  1FKT A;  1I5H W;  2ZR4 A;  1QPL A;  3B9A A;  3RFW A;  3PR9 A;  4DWS B;  1EDQ A;  5B8I C;  3AQU A;  3ARO A;  3AS0 A;  5HKG A;  4P8V A;  4MTV A;  5DIU A;  2JX8 A;  3WL0 A;  1J6Y A;  1P5Q A;  2PV3 A;  4TNS A;  2M8I A;  3WH0 A;  4W9O A;  1SYT A;  1FKH A;  1OWQ A;  2A3B A;  3O5F A;  1Q6H A;  4MAV A;  3WD3 A;  1Q1C A;  2M2A A;  3UI5 A;  2OLH A;  3RGC A;  3GTY X;  3WQV A;  1J4H A;  3ARQ A;  1HJX A;  2Q5A A;  3LKX B;  3KZ7 A;  2FDM A;  4AY1 A;  1UR9 A;  1L1P A;  1JVW A;  1A7X A;  2M08 A;  1W9V A;  1QPF A;  1D7J A;  3JYJ A;  4HAR A;  2KXQ A;  2F2D A;  4J4N A;  1B6C A;  4DRP A;  2YSF A;  3VAW A;  5U47 A;  4U84 A;  1ZK6 A;  3GPK A;  4WIW A;  1Q6U A;  1FKF A;  3O5G A;  3UF8 A;  2MNT A;  1O6I A;  3WIJ A;  4TYO A;  2DPE A;  2YAJ B;  2P4V A;  5E62 A;  2DWV A;  3EY6 A;  1EG4 A;  3ARP A;  5GPG A;  1W9P A;  1LJY A;  4ML4 A;  5DEZ A;  3B7X A;  4DRI A;  4IT6 A;  4GGQ A;  3ARS A;  2XPA A;  1ZBV A;  2ITK A;  1OGB A;  1SR0 A;  4TW6 A;  5DIT A;  1WB0 A;  1XHG A;  4DRO A;  2F23 A;  3O5D A;  2XP3 A;  5HBF A;  5GQB A;  3UQB A;  1NMV A;  4DWS A;  1YAT A;  4ODK A;  2YSI A;  3ALG A;  1T11 A;  3LKX A;  2G8Z A;  3O5M A;  4DRH A;  4MNK A;  4DIP A;  1OGG A;  3JXV A;  4L3N A;  4REX A;  3ARX A;  3KAB A;  2WAD A;  1PIN A;  3IKD A;  4IPX A;  2DT0 A;  1E44 A;  5E65 A;  1K9T A;  2UZ5 A;  3UI4 A;  2PBC A;  4KR0 B;  3WL1 A;  1FKR A;  1HJV A;  2RE3 A;  3I6C A;  4JFL A;  3B9D A;  2O92 A;  2KGJ A;  3WQW A;  2JMF A;  5E64 A;  4A0U A;  3ALF A;  2FAP A;  4JFJ A;  3KAD A;  2AOS A;  3ARU A;  4WK9 A;  5DIV A;  3EIP A;  1JMQ A;  1EYM A;  4DRQ A;  1RD6 A;  4N19 A;  5CQ2 A;  2LJ4 A;  2WM0 A;  1JCH B;  4R5E A;  4DH0 A;  2JXW A;  1FKL A;  4ODQ A;  1HKK A;  4ODO A;  1LG1 A;  2IUZ A;  1GRJ A;  3LE4 A;  5HWB A;  3CGM A;  4WJX A;  2WAE A;  2DT1 A;  2XP6 A;  3AS2 A;  2K8I A;  3OA5 A;  1J4I A;  1NMW A;  2B5U B;  2MDI A;  4TX0 A;  2DMV A;  5DO2 A;  3ARZ A;  1JNT A;  1JNE A;  3AS1 A;  1H0G A;  2IF4 A;  4P8X A;  4Q7N A;  1FKJ A;  4NZC A;  1GUV A;  3KAI A;  3JYM A;  1W1T A;  4QIB A;  4JYS A;  4C02 B;  3ARW A;  4W9P A;  2XP4 A;  2MF9 A;  4TW7 A;  1TCO C;  1FKI A;  1BKF A;  1C9H A;  2LPV A;  4MNL A;  3O5P A;  2PPP A;  1KFW A;  3M7N A;  1Q6I A;  1E9L A;  5HUA A;  4W9Q A;  2PN0 A;  3ARV A;  2QRV A;  2XP8 A;  5BXJ A;  2MPH A;  1WNO A;  3ODK A;  4DRM A;  4WKF A;  4DWS C;  4DRN A;  2KR7 A;  5HTG A;  4ZS6 A;  5HW8 A;  1K9Q A;  1EHN A;  2DSV A;  2ZQT A;  4ZPW R;  3RM4 A;  4LGX A;  4ODN A;  2JZV A;  3KAH A;  1WR7 A;  3B8S A;  4UDM A;  3RME A;  3CGN A;  1VF8 A;  2ZR5 A;  2ZR6 A;  2YBT A;  3O5K A;  1H0I A;  2XP9 A;  4U86 A;  3BXW A;  2KI3 A;  2ZQS A;  4G2P A;  2PI6 A;  3UQI A;  5GPR A;  3O5Q A;  1E6N A;  1HKJ A;  3OOB A;  1E6Z A;  2AWG A;  3CHF A;  4Z2I A;  5HW7 A;  1EQ3 A;  3AS3 A;  1LL7 A;  3PRD A;  5JH8 A;  1FKD A;  5I98 A;  1TR8 A;  3FSB A;  1EIB A;  1E6R A;  1ZCN A;  4WKH A;  2XP5 A;  4U85 A;  3WD0 A;  4MSP A;  2F4E A;  2RQS A;  2OWO A;  4DRK A;  3O5L A;  1GPF A;  3G6M A;  2RUD A;  2YBU A;  2B31 A;  2XP7 A;  2MLZ A;  5HW6 A;  2Y78 A;  4ODL A;  2VN1 A;  2KE0 A;  3ART A;  2PV1 A;  2DG3 A;  4E5R A;  1JND A;  2DJY A;  1HJW A;  3NTP A;  1BL4 A;  1FFR A;  4Z2L A;  3PQH A;  1LL6 A;  4FAP A;  2FKE A;  3CNG A;  4ODR A;  4IT4 A;  3UQA A;  3UI6 A;  4Z2J A;  1ZBC A;  4QZV B;  1ROU A;  2M3O W;  3TC5 A;  2PV2 A;  3MDY B;  4QT3 A;  4HBO A;  2BA1 A;  3H9R B;  3LUO A;  1HXV A;  3KCE A;  2WLZ A;  1UR8 A;  4NSB A;  3KAC A;  5AHT A;  1TK7 A;  4ZPT R;  4S3K A;  4KQZ A;  1KT1 A;  3RM9 A;  4ITZ A;  4DZ3 A;  2KO7 A;  2WLY A;  1FKB A;  1FLC A;  2F21 A;  1GOI A;  4IQC A;  4LAX A;  4QT2 A;  1J4R A;  1FD9 A;  4DRJ A;  2A3E A;  4J4O A;  3WKZ A;  3CHD A;  1M5Y A;  3PRA A;  4O2T A;  3ARY A;  3M85 A;  1NSG A;  2E45 A;  5HT1 A;  3WD2 A;  4P8U A;  1JNS A;  3CHC A;  2PPN A;  1LL4 A;  3CHE A;  1F40 A;  3L4H A;  1E15 A;  1W9U A;  2DSU A;  4FN2 A;  3MQH A;  1NH6 A;  2N87 A;  4GLX A;  1LG2 A;  1ZB5 A;  1LQ0 A;  2A3C A;  1F8A B;  2A3A A;  1EG3 A;  3G6L A;  4GIV A;  2ETN A;  2RUC A;  2PPO A;  3MCB A;  4S3J A;  3ARR A;  2M8J A;  3IK8 A;  1WMV A;  1D7I A;  2YSH A;  4PTM A;  3O5R A;  3IHZ A;  2QF8 A;  1FAP A;  1FKS A;  3KAG A;  5E5W A;  2LAJ A;  3W4R A;  4Z2G A;  2YSG A;  1W1Y A;  1ITX A;  1IX5 A;  1RP5 A;  4HBE A;  4Q22 A;  2DG9 A;  3FAP A;  4JFM A;  2YSB A;  1X6N A;  4A0T A;  1W1V A;  4LAW A;  5DF0 A;  1FKK A;  1Y0O A;  1W1P A;  3NI6 A;  1HKI A;  4BF8 A;  1HKM A;  4DWS D;  2DSW A;  4ZPV R;  1D7H A;  4XAK A;  4ODP A;  5J6E A;  4IQ2 A;  4NNR A;  3WD4 A;  2RSE A;  1KT0 A;  4JFK A;  2Y8N B;  1CTN A;  3O5O A;  1O6W A;  5HWC A;  3KAF A;  2DK7 A;  3MQG A;  2DG4 A;  1N1A A;  3FXY A;  2ZQV A;  4JFI A;  2LKN A;  4MNM A;  1FKG A;  3O5E A;  1YW5 A; 
#chains in the Genus database with same CATH homology
 2XPB A;  2RUR A;  1D2K A;  4WKA A;  5D75 A;  4TW8 A;  3NRK A;  4R0X A;  3WD1 A;  1QZ2 A;  1TFV A;  3FS8 A;  3O5I A;  1R9H A;  2KFW A;  4DT4 A;  1X6L A;  3FY1 A;  2JV4 A;  4P8W A;  1U79 A;  4W5U A;  1NWR A;  4URI A;  2DK1 A;  3PA7 A;  2RUQ A;  2DT3 A;  4G50 A;  3O5J A;  1NWU A;  2VCD A;  2L2S A;  3PRB A;  2L4J A;  2M1I A;  3QOK A;  2MLY A;  1ZL1 A;  2LGO A;  2G41 A;  3RM8 A;  2WK2 A;  1PBK A;  3TCZ A;  3B9E A;  2ZQU A;  1E6P A;  1NWS A;  4Z2H A;  1FFQ A;  1ROT A;  4LAV A;  4DZ2 A;  5E66 A;  2MLX A;  3IKG A;  3CZ8 A;  1ZBW A;  4MNJ A;  4Z2K A;  1ZBK A;  2OFN A;  2DSZ A;  4ODM A;  4L72 B;  2O9O A;  1W26 A;  3MCB B;  3TDB A;  1NWT A;  1WAW A;  1ZU8 A;  2DT2 A;  1K9R A;  4MGV A;  3CH9 A;  2ESC A;  1FJD A;  2D9F A;  2ZAJ A;  1XRV A;  3FSC A;  2EZ5 W;  4LAY A;  1D6O A;  4MPK A;  1FKT A;  1I5H W;  2ZR4 A;  1QPL A;  3B9A A;  3RFW A;  3PR9 A;  4DWS B;  1EDQ A;  5B8I C;  3AQU A;  3ARO A;  3AS0 A;  5HKG A;  4P8V A;  4MTV A;  5DIU A;  2JX8 A;  3WL0 A;  1J6Y A;  1P5Q A;  2PV3 A;  4TNS A;  2M8I A;  3WH0 A;  4W9O A;  1SYT A;  1FKH A;  1OWQ A;  2A3B A;  3O5F A;  1Q6H A;  4MAV A;  3WD3 A;  1Q1C A;  2M2A A;  3UI5 A;  2OLH A;  3RGC A;  3WQV A;  1J4H A;  3ARQ A;  1HJX A;  2Q5A A;  3LKX B;  3KZ7 A;  2FDM A;  4AY1 A;  1UR9 A;  1L1P A;  1JVW A;  1A7X A;  2M08 A;  1W9V A;  1QPF A;  1D7J A;  3JYJ A;  4HAR A;  2KXQ A;  2F2D A;  4J4N A;  1B6C A;  4DRP A;  2YSF A;  3VAW A;  5U47 A;  4U84 A;  1ZK6 A;  3GPK A;  4WIW A;  1Q6U A;  1FKF A;  3O5G A;  3UF8 A;  2MNT A;  1O6I A;  3WIJ A;  4TYO A;  2DPE A;  2YAJ B;  5E62 A;  2DWV A;  3EY6 A;  1EG4 A;  3ARP A;  5GPG A;  1W9P A;  1LJY A;  4ML4 A;  5DEZ A;  3B7X A;  4DRI A;  4IT6 A;  4GGQ A;  3ARS A;  2XPA A;  1ZBV A;  2ITK A;  1OGB A;  1SR0 A;  4TW6 A;  5DIT A;  1WB0 A;  1XHG A;  4DRO A;  3O5D A;  2XP3 A;  5HBF A;  5GQB A;  3UQB A;  1NMV A;  4DWS A;  1YAT A;  4ODK A;  2YSI A;  3ALG A;  1T11 A;  3LKX A;  2G8Z A;  3O5M A;  4DRH A;  4MNK A;  4DIP A;  1OGG A;  3JXV A;  4L3N A;  4REX A;  3ARX A;  3KAB A;  2WAD A;  1PIN A;  3IKD A;  4IPX A;  2DT0 A;  5E65 A;  1K9T A;  2UZ5 A;  3UI4 A;  2PBC A;  4KR0 B;  3WL1 A;  1FKR A;  1HJV A;  2RE3 A;  3I6C A;  4JFL A;  3B9D A;  2O92 A;  2KGJ A;  3WQW A;  2JMF A;  5E64 A;  4A0U A;  3ALF A;  2FAP A;  4JFJ A;  3KAD A;  2AOS A;  3ARU A;  4WK9 A;  5DIV A;  1JMQ A;  1EYM A;  4DRQ A;  1RD6 A;  4N19 A;  5CQ2 A;  2LJ4 A;  2WM0 A;  4R5E A;  4DH0 A;  2JXW A;  1FKL A;  4ODQ A;  1HKK A;  4ODO A;  1LG1 A;  2IUZ A;  3LE4 A;  5HWB A;  3CGM A;  4WJX A;  2WAE A;  2DT1 A;  2XP6 A;  3AS2 A;  2K8I A;  3OA5 A;  1J4I A;  1NMW A;  2MDI A;  4TX0 A;  2DMV A;  5DO2 A;  3ARZ A;  1JNT A;  1JNE A;  3AS1 A;  1H0G A;  2IF4 A;  4P8X A;  4Q7N A;  1FKJ A;  4NZC A;  1GUV A;  3KAI A;  3JYM A;  1W1T A;  4QIB A;  4JYS A;  4C02 B;  3ARW A;  4W9P A;  2XP4 A;  2MF9 A;  4TW7 A;  1TCO C;  1FKI A;  1BKF A;  1C9H A;  2LPV A;  4MNL A;  3O5P A;  2PPP A;  1KFW A;  3M7N A;  1Q6I A;  1E9L A;  5HUA A;  4W9Q A;  3ARV A;  2QRV A;  2XP8 A;  5BXJ A;  2MPH A;  1WNO A;  3ODK A;  4DRM A;  4WKF A;  4DWS C;  4DRN A;  2KR7 A;  5HTG A;  4ZS6 A;  5HW8 A;  1K9Q A;  1EHN A;  2DSV A;  2ZQT A;  4ZPW R;  3RM4 A;  4LGX A;  4ODN A;  2JZV A;  3KAH A;  1WR7 A;  3B8S A;  3RME A;  3CGN A;  1VF8 A;  2ZR5 A;  2ZR6 A;  2YBT A;  3O5K A;  1H0I A;  2XP9 A;  4U86 A;  3BXW A;  2KI3 A;  2ZQS A;  4G2P A;  2PI6 A;  3UQI A;  5GPR A;  3O5Q A;  1E6N A;  1HKJ A;  3OOB A;  1E6Z A;  2AWG A;  3CHF A;  4Z2I A;  5HW7 A;  1EQ3 A;  3AS3 A;  1LL7 A;  3PRD A;  5JH8 A;  1FKD A;  5I98 A;  1TR8 A;  3FSB A;  1EIB A;  1E6R A;  1ZCN A;  4WKH A;  2XP5 A;  4U85 A;  3WD0 A;  4MSP A;  2F4E A;  2RQS A;  2OWO A;  4DRK A;  3O5L A;  1GPF A;  3G6M A;  2RUD A;  2YBU A;  2B31 A;  2XP7 A;  2MLZ A;  5HW6 A;  2Y78 A;  4ODL A;  2VN1 A;  2KE0 A;  3ART A;  2PV1 A;  2DG3 A;  4E5R A;  1JND A;  2DJY A;  1HJW A;  3NTP A;  1BL4 A;  1FFR A;  4Z2L A;  3PQH A;  1LL6 A;  4FAP A;  2FKE A;  3CNG A;  4ODR A;  4IT4 A;  3UQA A;  3UI6 A;  4Z2J A;  1ZBC A;  4QZV B;  1ROU A;  2M3O W;  3TC5 A;  2PV2 A;  3MDY B;  4QT3 A;  4HBO A;  2BA1 A;  3H9R B;  3LUO A;  1HXV A;  3KCE A;  2WLZ A;  1UR8 A;  4NSB A;  3KAC A;  5AHT A;  1TK7 A;  4ZPT R;  4S3K A;  4KQZ A;  1KT1 A;  3RM9 A;  4ITZ A;  4DZ3 A;  2KO7 A;  2WLY A;  1FKB A;  1FLC A;  2F21 A;  1GOI A;  4IQC A;  4LAX A;  4QT2 A;  1J4R A;  1FD9 A;  4DRJ A;  2A3E A;  4J4O A;  3WKZ A;  3CHD A;  1M5Y A;  3PRA A;  4O2T A;  3ARY A;  3M85 A;  1NSG A;  2E45 A;  5HT1 A;  3WD2 A;  4P8U A;  1JNS A;  3CHC A;  2PPN A;  1LL4 A;  3CHE A;  1F40 A;  3L4H A;  1E15 A;  1W9U A;  2DSU A;  4FN2 A;  3MQH A;  1NH6 A;  2N87 A;  4GLX A;  1LG2 A;  1ZB5 A;  1LQ0 A;  2A3C A;  1F8A B;  2A3A A;  1EG3 A;  3G6L A;  4GIV A;  2RUC A;  2PPO A;  3MCB A;  4S3J A;  3ARR A;  2M8J A;  3IK8 A;  1WMV A;  1D7I A;  2YSH A;  4PTM A;  3O5R A;  3IHZ A;  2QF8 A;  1FAP A;  1FKS A;  3KAG A;  5E5W A;  2LAJ A;  3W4R A;  4Z2G A;  2YSG A;  1W1Y A;  1ITX A;  1IX5 A;  1RP5 A;  4HBE A;  4Q22 A;  2DG9 A;  3FAP A;  4JFM A;  2YSB A;  1X6N A;  4A0T A;  1W1V A;  4LAW A;  5DF0 A;  1FKK A;  1Y0O A;  1W1P A;  3NI6 A;  1HKI A;  4BF8 A;  1HKM A;  4DWS D;  2DSW A;  4ZPV R;  1D7H A;  4XAK A;  4ODP A;  5J6E A;  4IQ2 A;  4NNR A;  3WD4 A;  1KT0 A;  2RSE A;  4JFK A;  2Y8N B;  1CTN A;  3O5O A;  1O6W A;  5HWC A;  3KAF A;  2DK7 A;  3MQG A;  2DG4 A;  1N1A A;  3FXY A;  2ZQV A;  4JFI A;  2LKN A;  4MNM A;  1FKG A;  3O5E A;  1YW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...