1PINA

Pin1 peptidyl-prolyl cis-trans isomerase from homo sapiens
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE
publication title Structural and functional analysis of the mitotic rotamase Pin1 suggests substrate recognition is phosphorylation dependent.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 42
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1998-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1pinA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1pinA02
2ZQVA 1F8AB 4TW6A 1NMWA 3RFWA 1NMVA 1KT1A 4JFIA 1EYMA 5I98A 2KO7A 1EQ3A 1J4IA 2F21A 3O5QA 2ZQUA 3O5PA 2MLYA 4N19A 1ZCNA 3KAFA 2EZ5W 1Y0OA 4W9PA 2XP8A 5DIUA 2LGOA 4JFKA 2DG9A 4C02B 2AWGA 5HW7A 2LPVA 2DG4A 3PRBA 4DZ3A 2XPBA 1FAPA 4J4OA 3GPKA 1C9HA 1QPLA 4G2PA 5HWBA 2LAJA 1FKGA 4LAYA 2FAPA 2F4EA 3UQIA 3JXVA 1FKIA 1YATA 3CGMA 5AHTA 4O2TA 4TW8A 3KCEA 2XP5A 4J4NA 2ZR4A 4JFLA 2DWVA 3O5GA 3KAIA 3PRDA 4JFMA 1J4RA 1Q6UA 1PBKA 4QT2A 4FAPA 3WH0A 5CQ2A 1A7XA 1ROUA 1FKHA 1J6YA 1D7HA 4NNRA 2FKEA 2PPNA 2PBCA 1R9HA 4DRPA 3UI4A 4DRIA 2LJ4A 4ODPA 3M85A 5J6EA 3H9RB 2RSEA 4IQ2A 4LAWA 4IPXA 4DZ2A 1Q6IA 4GIVA 1U79A 4W9QA 2MF9A 2YSFA 1FKDA 5HKGA 3IK8A 1Q6HA 4DRKA 3PA7A 1J4HA 1FKTA 2VCDA 2MLZA 2DK7A 1T11A 1FKLA 1FKBA 3O5JA 1BKFA 1I5HW 2DJYA 2DK1A 1FKJA 4LAVA 2ZQTA 5HT1A 3LUOA 2MLXA 4LAXA 3CGNA 5HWCA 5HUAA 4BF8A 3O5FA 3RGCA 4G50A 1F40A 2M3OW 2M8IA 2UZ5A 3KABA 4JYSA 2KE0A 2XP4A 5DIVA 1ZK6A 4DH0A 2F2DA 1EG4A 1FJDA 2VN1A 4ITZA 3IKDA 2M2AA 2PPPA 2RURA 2IF4A 3M7NA 2LKNA 1WR7A 3TC5A 2M08A 4DT4A 3O5RA 2ZR5A 2XPAA 2MPHA 3CNGA 3MDYB 4W9OA 1QZ2A 4ODRA 3O5MA 1WMVA 3EY6A 3VAWA 1FKSA 1NSGA 4ODKA 5GPGA 5B8IC 4DRHA 3TCZA 3KACA 1JNTA 2L4JA 2OFNA 4IQCA 3OOBA 3L4HA 2RE3A 3FAPA 2XP3A 4DRQA 1PINA 1EG3A 4JFJA 1L1PA 2ZAJA 4REXA 4U86A 1P5QA 2YSHA 3UI5A 3B7XA 1FKRA 2XP6A 2YSIA 2MNTA 3KZ7A 4TX0A 3UF8A 3UI6A 3O5OA 4DROA 2KR7A 2N87A 3NRKA 2KI3A 1FKFA 2ZR6A 2KGJA 2PV2A 4MSPA 3LE4A 2XP7A 5BXJA 4U84A 1B6CA 2RUDA 1TK7A 4E5RA 2E45A 3JYJA 1K9QA 3UQBA 1HXVA 4QT3A 4ODMA 3KADA 1M5YA 4FN2A 1BL4A 2JMFA 2DMVA 3KAHA 5D75A 4U85A 2MDIA 2ZQSA 2D9FA 3ODKA 2BA1A 1YW5A 3TDBA 2Y78A 3O5EA 3NTPA 4ODQA 2K8IA 3IKGA 4DRJA 4GGQA 2RUQA 5DITA 2YSGA 3JYMA 3O5IA 3KAGA 2RUCA 2JX8A 4DRMA 2DG3A 1Q1CA 2PPOA 1ROTA 4ODLA 1D7JA 5HW6A 1D7IA 4QIBA 2JV4A 2XP9A 4ODOA 3I6CA 4DIPA 2PV1A 4TW7A 1W26A 1FKKA 2RQSA 2M8JA 5HW8A 2ITKA 3O5DA 3O5LA 1JMQA 4R0XA 3NI6A 2PV3A 1K9RA 2Q5AA 4TYOA 2KFWA 4MGVA 1FD9A 1N1AA 3IHZA 1QPFA 5HTGA 2L2SA 2M1IA 4ODNA 2JXWA 1TCOC 1D6OA 1O6WA 3UQAA 4DRNA 1KT0A 2YSBA 3O5KA 4TNSA 2KXQA 2JZVA 1JVWA 1JNSA
chains in the Genus database with same CATH superfamily
4A0UA 2ZQVA 4NSBA 1OGGA 3PR9A 1F8AB 1LG1A 4TW6A 1NMWA 3RFWA 1NMVA 2WM0A 1LL7A 1KT1A 3FSBA 4JFIA 4URIA 1EYMA 4PTMA 1OWQA 5I98A 2KO7A 4MAVA 1EQ3A 1J4IA 4HBOA 1LL6A 1ITXA 2F21A 3O5QA 2ZQUA 3O5PA 2MLYA 4N19A 3ARVA 1ZCNA 3KAFA 1LL4A 2EZ5W 1Y0OA 1HKIA 4W9PA 1JNDA 2YBTA 2XP8A 4DWSC 1HJXA 5DIUA 3FSCA 2LGOA 4JFKA 2DG9A 2WLZA 4C02B 2AWGA 5HW7A 3MQHA 4IT4A 2LPVA 2DG4A 3PRBA 3AS1A 4DZ3A 2XPBA 3AS2A 1FAPA 4J4OA 3GPKA 1C9HA 2A3EA 1QPLA 3ALFA 3LKXA 4G2PA 2DSWA 4MPKA 5HWBA 2Y8NB 2PN0A 2LAJA 1FKGA 1JNEA 5E64A 5DEZA 4LAYA 3QOKA 1XHGA 3ARYA 2FAPA 2EULA 5GQBA 2F4EA 4Z2JA 3RM8A 3UQIA 3JXVA 4Z2GA 1FKIA 4P8VA 1YATA 3CGMA 5AHTA 3ARQA 4O2TA 3WL0A 4Z2IA 4TW8A 3AS3A 1EHNA 5DO2A 3KCEA 2XP5A 4J4NA 2DSUA 1H0IA 2ZR4A 4JFLA 2DWVA 3O5GA 3KAIA 3PRDA 4ML4A 4JFMA 5JH8A 1J4RA 4WKFA 4QZVB 1Q6UA 1NWSA 1EDQA 1PBKA 1FFQA 4QT2A 4FAPA 3WH0A 5CQ2A 1A7XA 1ROUA 3ARTA 1FKHA 4WKHA 1J6YA 2WADA 1E15A 1D7HA 2FKEA 4NNRA 2PPNA 2PBCA 2P4VA 1R9HA 5HBFA 3CHDA 4DRPA 3UI4A 4DRIA 1FFRA 2LJ4A 1W1TA 4DWSA 4ODPA 4WJXA 3M85A 5J6EA 3H9RB 2RSEA 4IQ2A 4LAWA 3WKZA 4IPXA 4DZ2A 1Q6IA 4GIVA 1U79A 4W9QA 5E66A 2WLYA 3B8SA 4P8WA 3LKXB 2MF9A 2YSFA 1FKDA 5HKGA 3WL1A 3IK8A 3BMBA 1Q6HA 4P8XA 3PA7A 1J4HA 1FKTA 4DRKA 3GTYX 3OA5A 2VCDA 4L72B 2MLZA 4WK9A 4MNLA 3WD2A 4AY1A 2DK7A 1HJVA 3ARPA 1T11A 2OLHA 1GRJA 1FKLA 1FKBA 1ZB5A 3FY1A 3O5JA 3AROA 5E62A 1BKFA 2A3AA 1ZU8A 1I5HW 1ZBWA 2DJYA 3WIJA 2DK1A 1FKJA 4LAVA 2B5UB 4L3NA 2ZQTA 5HT1A 3LUOA 2MLXA 4LAXA 3CGNA 1UR8A 1ZBVA 5HWCA 5HUAA 4BF8A 4WKAA 3O5FA 4ZPWR 1ZL1A 3RGCA 4G50A 4ZS6A 1LQ0A 1F40A 2WAEA 3EIPA 2M3OW 3GU0A 2M8IA 2UZ5A 1GPFA 3MCBA 3KABA 2IUZA 4JYSA 2KE0A 2XP4A 5DIVA 1ZK6A 4DH0A 2F2DA 1EG4A 1FJDA 2VN1A 4ITZA 4R5EA 3IKDA 2M2AA 4DWSB 1HJWA 2PPPA 2RURA 2IF4A 4Z2KA 3M7NA 2M08A 2LKNA 1WR7A 3TC5A 5U47A 2ZR5A 2MPHA 2XPAA 3O5RA 4DT4A 3CNGA 3MDYB 2ESCA 4W9OA 1QZ2A 2DT0A 4ODRA 3O5MA 2DSVA 1WMVA 3EY6A 3VAWA 3G6LA 1FKSA 1NSGA 2DSZA 4ODKA 5GPGA 1JVWA 5B8IC 1LJYA 2ETNA 4KR0B 4DRHA 3TCZA 3WQWA 5DF0A 3KACA 3MQGA 1JNTA 2L4JA 2OFNA 4IQCA 3OOBA 3L4HA 1E6PA 2RE3A 3ARSA 3FAPA 1X6NA 2G41A 1OGBA 4MNJA 2XP3A 1E6RA 4DRQA 3WD0A 4S3JA 1PINA 2B31A 3ARRA 1EG3A 3ARWA 1HKKA 3ALGA 1CTNA 4HARA 4JFJA 4XAKA 1L1PA 2ZAJA 4REXA 4U86A 2F23A 1FLCA 1P5QA 4GLXA 3CH9A 2YSHA 3WD3A 3UI5A 3B7XA 3B9AA 2G8ZA 1FKRA 2XP6A 2YSIA 1NWTA 2DT3A 1RP5A 2MNTA 3KZ7A 4TX0A 3UF8A 3UI6A 3W4RA 3O5OA 3FS8A 3AQUA 4DROA 2KR7A 2N87A 3NRKA 1O6IA 3G6MA 1NH6A 2KI3A 3B9DA 4MNKA 1FKFA 2FDMA 1GOIA 2ZR6A 2KGJA 2PV2A 3MCBB 4MSPA 3ARUA 3LE4A 2XP7A 5BXJA 4U84A 3AS0A 1B6CA 2RUDA 1TK7A 4E5RA 2E45A 1W9PA 3CHEA 1X6LA 4Q7NA 3JYJA 2YBUA 1K9QA 2QF8A 3UQBA 1HXVA 4QT3A 1JCHB 4A0TA 2A3BA 3PRAA 3RM4A 4ODMA 3KADA 1HKMA 3ARXA 1W1VA 4LGXA 1M5YA 1TFVA 1D2KA 4FN2A 1BL4A 2JMFA 1E6NA 2DMVA 3KAHA 5D75A 4U85A 2MDIA 2QRVA 2ZQSA 2D9FA 3ODKA 1GUVA 2O92A 2BA1A 4DWSD 1YW5A 2A3CA 3TDBA 5E5WA 2Y78A 3NTPA 3O5EA 4ODQA 2K8IA 4P8UA 3IKGA 4DRJA 4GGQA 4W5UA 1W9VA 3PQHA 5E65A 1NWRA 2RUQA 5DITA 2YSGA 3JYMA 3O5IA 3KAGA 3WQVA 2RUCA 2JX8A 4DRMA 1E6ZA 2DG3A 1Q1CA 1ZBKA 2DT1A 4Z2LA 2PPOA 1ROTA 4HBEA 4MNMA 4ODLA 1ZBCA 1D7JA 5HW6A 1W9UA 1HKJA 3WD1A 1LG2A 3CHFA 1D7IA 4QIBA 2OWOA 1K9TA 2JV4A 2XP9A 4ODOA 3I6CA 4Z2HA 2O9OA 1H0GA 2WK2A 1SR0A 3BXWA 4DIPA 1WAWA 2PV1A 1WB0A 4TW7A 1W26A 1FKKA 2RQSA 2M8JA 5GPRA 5HW8A 1EIBA 2ITKA 1W1PA 4S3KA 3O5DA 3O5LA 4MTVA 4WIWA 1JMQA 4R0XA 3FXYA 1SYTA 3NI6A 2PV3A 4Q22A 1K9RA 2Q5AA 4KQZA 1E44A 1WNOA 1E9LA 4TYOA 2KFWA 1RD6A 4MGVA 1FD9A 1N1AA 4NZCA 3RM9A 3IHZA 2YAJB 1QPFA 1XRVA 5HTGA 3CHCA 4IT6A 4ZPVR 3B9EA 2L2SA 2M1IA 1UR9A 4ODNA 2PI6A 2DPEA 3WD4A 2JXWA 1TCOC 4UDMA 1D6OA 1O6WA 3UQAA 1NWUA 4DRNA 1KT0A 1IX5A 2AOSA 2DT2A 2YSBA 3O5KA 4TNSA 4ZPTR 3RMEA 1KFWA 1W1YA 3CZ8A 2KXQA 2JZVA 3ARZA 1TR8A 1VF8A 1JNSA
chains in the Genus database with same CATH topology
4A0UA 2ZQVA 4NSBA 1OGGA 3PR9A 1F8AB 1LG1A 4TW6A 1NMWA 3RFWA 1NMVA 2WM0A 1LL7A 1KT1A 3FSBA 4JFIA 4URIA 1EYMA 4PTMA 1OWQA 5I98A 2KO7A 4MAVA 1EQ3A 1J4IA 4HBOA 1LL6A 1ITXA 2F21A 3O5QA 2ZQUA 3O5PA 2MLYA 4N19A 3ARVA 1ZCNA 3KAFA 1LL4A 2EZ5W 1Y0OA 1HKIA 4W9PA 1JNDA 2YBTA 2XP8A 4DWSC 1HJXA 5DIUA 3FSCA 2LGOA 4JFKA 2DG9A 2WLZA 4C02B 2AWGA 5HW7A 3MQHA 4IT4A 2LPVA 2DG4A 3PRBA 3AS1A 4DZ3A 2XPBA 3AS2A 1FAPA 4J4OA 3GPKA 1C9HA 2A3EA 1QPLA 3ALFA 3LKXA 4G2PA 2DSWA 4MPKA 5HWBA 2Y8NB 2LAJA 1FKGA 1JNEA 5E64A 5DEZA 4LAYA 3QOKA 1XHGA 3ARYA 2FAPA 5GQBA 2F4EA 4Z2JA 3RM8A 3UQIA 3JXVA 4Z2GA 1FKIA 4P8VA 1YATA 3CGMA 5AHTA 3ARQA 4O2TA 3WL0A 4Z2IA 4TW8A 3AS3A 1EHNA 5DO2A 3KCEA 2XP5A 4J4NA 2DSUA 1H0IA 2ZR4A 4JFLA 2DWVA 3O5GA 3KAIA 3PRDA 4ML4A 4JFMA 5JH8A 1J4RA 4WKFA 4QZVB 1Q6UA 1NWSA 1EDQA 1PBKA 1FFQA 4QT2A 4FAPA 3WH0A 5CQ2A 1A7XA 1ROUA 3ARTA 1FKHA 4WKHA 1J6YA 2WADA 1E15A 1D7HA 2FKEA 4NNRA 2PPNA 2PBCA 1R9HA 5HBFA 3CHDA 4DRPA 3UI4A 4DRIA 1FFRA 2LJ4A 1W1TA 4DWSA 4ODPA 4WJXA 3M85A 5J6EA 3H9RB 2RSEA 4IQ2A 4LAWA 3WKZA 4IPXA 4DZ2A 1Q6IA 4GIVA 1U79A 4W9QA 5E66A 2WLYA 3B8SA 4P8WA 3LKXB 2MF9A 2YSFA 1FKDA 5HKGA 3WL1A 3IK8A 1Q6HA 4P8XA 3PA7A 1J4HA 1FKTA 4DRKA 3OA5A 2VCDA 4L72B 2MLZA 4WK9A 4MNLA 3WD2A 4AY1A 2DK7A 1HJVA 3ARPA 1T11A 2OLHA 1FKLA 1FKBA 1ZB5A 3FY1A 3O5JA 3AROA 5E62A 1BKFA 2A3AA 1ZU8A 1I5HW 1ZBWA 2DJYA 3WIJA 2DK1A 1FKJA 4LAVA 4L3NA 2ZQTA 5HT1A 3LUOA 2MLXA 4LAXA 3CGNA 1UR8A 1ZBVA 5HWCA 5HUAA 4BF8A 4WKAA 3O5FA 4ZPWR 1ZL1A 3RGCA 4G50A 4ZS6A 1LQ0A 1F40A 2WAEA 2M3OW 2M8IA 2UZ5A 1GPFA 3MCBA 3KABA 2IUZA 4JYSA 2KE0A 2XP4A 5DIVA 1ZK6A 4DH0A 2F2DA 1EG4A 1FJDA 2VN1A 4ITZA 4R5EA 3IKDA 2M2AA 4DWSB 1HJWA 2PPPA 2RURA 2IF4A 4Z2KA 3M7NA 2M08A 2LKNA 1WR7A 3TC5A 5U47A 2ZR5A 2MPHA 2XPAA 3O5RA 4DT4A 3CNGA 3MDYB 2ESCA 4W9OA 1QZ2A 2DT0A 4ODRA 3O5MA 2DSVA 1WMVA 3EY6A 3VAWA 3G6LA 1FKSA 1NSGA 2DSZA 4ODKA 5GPGA 1JVWA 5B8IC 1LJYA 4KR0B 4DRHA 3TCZA 3WQWA 5DF0A 3KACA 3MQGA 1JNTA 2L4JA 2OFNA 4IQCA 3OOBA 3L4HA 1E6PA 2RE3A 3ARSA 3FAPA 1X6NA 2G41A 1OGBA 4MNJA 2XP3A 1E6RA 4DRQA 3WD0A 4S3JA 1PINA 2B31A 3ARRA 1EG3A 3ARWA 1HKKA 3ALGA 1CTNA 4HARA 4JFJA 4XAKA 1L1PA 2ZAJA 4REXA 4U86A 1FLCA 1P5QA 4GLXA 3CH9A 2YSHA 3WD3A 3UI5A 3B7XA 3B9AA 2G8ZA 1FKRA 2XP6A 2YSIA 1NWTA 2DT3A 1RP5A 2MNTA 3KZ7A 4TX0A 3UF8A 3UI6A 3W4RA 3O5OA 3FS8A 3AQUA 4DROA 2KR7A 2N87A 3NRKA 1O6IA 3G6MA 1NH6A 2KI3A 3B9DA 4MNKA 1FKFA 2FDMA 1GOIA 2ZR6A 2KGJA 2PV2A 3MCBB 4MSPA 3ARUA 3LE4A 2XP7A 5BXJA 4U84A 3AS0A 1B6CA 2RUDA 1TK7A 4E5RA 2E45A 1W9PA 3CHEA 1X6LA 4Q7NA 3JYJA 2YBUA 1K9QA 2QF8A 3UQBA 1HXVA 4QT3A 4A0TA 2A3BA 3PRAA 3RM4A 4ODMA 3KADA 1HKMA 3ARXA 1W1VA 4LGXA 1M5YA 1TFVA 1D2KA 4FN2A 1BL4A 2JMFA 1E6NA 2DMVA 3KAHA 5D75A 4U85A 2MDIA 2QRVA 2ZQSA 2D9FA 3ODKA 1GUVA 2O92A 2BA1A 4DWSD 1YW5A 2A3CA 3TDBA 5E5WA 2Y78A 3NTPA 3O5EA 4ODQA 2K8IA 4P8UA 3IKGA 4DRJA 4GGQA 4W5UA 1W9VA 3PQHA 5E65A 1NWRA 2RUQA 5DITA 2YSGA 3JYMA 3O5IA 3KAGA 3WQVA 2RUCA 2JX8A 4DRMA 1E6ZA 2DG3A 1Q1CA 1ZBKA 2DT1A 4Z2LA 2PPOA 1ROTA 4HBEA 4MNMA 4ODLA 1ZBCA 1D7JA 5HW6A 1W9UA 1HKJA 3WD1A 1LG2A 3CHFA 1D7IA 4QIBA 2OWOA 1K9TA 2JV4A 2XP9A 4ODOA 3I6CA 4Z2HA 2O9OA 1H0GA 2WK2A 1SR0A 3BXWA 4DIPA 1WAWA 2PV1A 1WB0A 4TW7A 1W26A 1FKKA 2RQSA 2M8JA 5GPRA 5HW8A 1EIBA 2ITKA 1W1PA 4S3KA 3O5DA 3O5LA 4MTVA 4WIWA 1JMQA 4R0XA 3FXYA 1SYTA 3NI6A 2PV3A 4Q22A 1K9RA 2Q5AA 4KQZA 1WNOA 1E9LA 4TYOA 2KFWA 1RD6A 4MGVA 1FD9A 1N1AA 4NZCA 3RM9A 3IHZA 2YAJB 1QPFA 1XRVA 5HTGA 3CHCA 4IT6A 4ZPVR 3B9EA 2L2SA 2M1IA 1UR9A 4ODNA 2PI6A 2DPEA 3WD4A 2JXWA 1TCOC 1D6OA 1O6WA 3UQAA 1NWUA 4DRNA 1KT0A 1IX5A 2AOSA 2DT2A 2YSBA 3O5KA 4TNSA 4ZPTR 3RMEA 1KFWA 1W1YA 3CZ8A 2KXQA 2JZVA 3ARZA 1TR8A 1VF8A 1JNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZQV A;  1F8A B;  4TW6 A;  1NMW A;  3RFW A;  1NMV A;  1KT1 A;  4JFI A;  1EYM A;  5I98 A;  2KO7 A;  1EQ3 A;  1J4I A;  2F21 A;  3O5Q A;  2ZQU A;  3O5P A;  2MLY A;  4N19 A;  1ZCN A;  3KAF A;  2EZ5 W;  1Y0O A;  4W9P A;  2XP8 A;  5DIU A;  2LGO A;  4JFK A;  2DG9 A;  4C02 B;  2AWG A;  5HW7 A;  2LPV A;  2DG4 A;  3PRB A;  4DZ3 A;  2XPB A;  1FAP A;  4J4O A;  3GPK A;  1C9H A;  1QPL A;  4G2P A;  5HWB A;  2LAJ A;  1FKG A;  4LAY A;  2FAP A;  2F4E A;  3UQI A;  3JXV A;  1FKI A;  1YAT A;  3CGM A;  5AHT A;  4O2T A;  4TW8 A;  3KCE A;  2XP5 A;  4J4N A;  2ZR4 A;  4JFL A;  2DWV A;  3O5G A;  3KAI A;  3PRD A;  4JFM A;  1J4R A;  1Q6U A;  1PBK A;  4QT2 A;  4FAP A;  3WH0 A;  5CQ2 A;  1A7X A;  1ROU A;  1FKH A;  1J6Y A;  1D7H A;  4NNR A;  2FKE A;  2PPN A;  2PBC A;  1R9H A;  4DRP A;  3UI4 A;  4DRI A;  2LJ4 A;  4ODP A;  3M85 A;  5J6E A;  3H9R B;  2RSE A;  4IQ2 A;  4LAW A;  4IPX A;  4DZ2 A;  1Q6I A;  4GIV A;  1U79 A;  4W9Q A;  2MF9 A;  2YSF A;  1FKD A;  5HKG A;  3IK8 A;  1Q6H A;  4DRK A;  3PA7 A;  1J4H A;  1FKT A;  2VCD A;  2MLZ A;  2DK7 A;  1T11 A;  1FKL A;  1FKB A;  3O5J A;  1BKF A;  1I5H W;  2DJY A;  2DK1 A;  1FKJ A;  4LAV A;  2ZQT A;  5HT1 A;  3LUO A;  2MLX A;  4LAX A;  3CGN A;  5HWC A;  5HUA A;  4BF8 A;  3O5F A;  3RGC A;  4G50 A;  1F40 A;  2M3O W;  2M8I A;  2UZ5 A;  3KAB A;  4JYS A;  2KE0 A;  2XP4 A;  5DIV A;  1ZK6 A;  4DH0 A;  2F2D A;  1EG4 A;  1FJD A;  2VN1 A;  4ITZ A;  3IKD A;  2M2A A;  2PPP A;  2RUR A;  2IF4 A;  3M7N A;  2LKN A;  1WR7 A;  3TC5 A;  2M08 A;  4DT4 A;  3O5R A;  2ZR5 A;  2XPA A;  2MPH A;  3CNG A;  3MDY B;  4W9O A;  1QZ2 A;  4ODR A;  3O5M A;  1WMV A;  3EY6 A;  3VAW A;  1FKS A;  1NSG A;  4ODK A;  5GPG A;  5B8I C;  4DRH A;  3TCZ A;  3KAC A;  1JNT A;  2L4J A;  2OFN A;  4IQC A;  3OOB A;  3L4H A;  2RE3 A;  3FAP A;  2XP3 A;  4DRQ A;  1PIN A;  1EG3 A;  4JFJ A;  1L1P A;  2ZAJ A;  4REX A;  4U86 A;  1P5Q A;  2YSH A;  3UI5 A;  3B7X A;  1FKR A;  2XP6 A;  2YSI A;  2MNT A;  3KZ7 A;  4TX0 A;  3UF8 A;  3UI6 A;  3O5O A;  4DRO A;  2KR7 A;  2N87 A;  3NRK A;  2KI3 A;  1FKF A;  2ZR6 A;  2KGJ A;  2PV2 A;  4MSP A;  3LE4 A;  2XP7 A;  5BXJ A;  4U84 A;  1B6C A;  2RUD A;  1TK7 A;  4E5R A;  2E45 A;  3JYJ A;  1K9Q A;  3UQB A;  1HXV A;  4QT3 A;  4ODM A;  3KAD A;  1M5Y A;  4FN2 A;  1BL4 A;  2JMF A;  2DMV A;  3KAH A;  5D75 A;  4U85 A;  2MDI A;  2ZQS A;  2D9F A;  3ODK A;  2BA1 A;  1YW5 A;  3TDB A;  2Y78 A;  3O5E A;  3NTP A;  4ODQ A;  2K8I A;  3IKG A;  4DRJ A;  4GGQ A;  2RUQ A;  5DIT A;  2YSG A;  3JYM A;  3O5I A;  3KAG A;  2RUC A;  2JX8 A;  4DRM A;  2DG3 A;  1Q1C A;  2PPO A;  1ROT A;  4ODL A;  1D7J A;  5HW6 A;  1D7I A;  4QIB A;  2JV4 A;  2XP9 A;  4ODO A;  3I6C A;  4DIP A;  2PV1 A;  4TW7 A;  1W26 A;  1FKK A;  2RQS A;  2M8J A;  5HW8 A;  2ITK A;  3O5D A;  3O5L A;  1JMQ A;  4R0X A;  3NI6 A;  2PV3 A;  1K9R A;  2Q5A A;  4TYO A;  2KFW A;  4MGV A;  1FD9 A;  1N1A A;  3IHZ A;  1QPF A;  5HTG A;  2L2S A;  2M1I A;  4ODN A;  2JXW A;  1TCO C;  1D6O A;  1O6W A;  3UQA A;  4DRN A;  1KT0 A;  2YSB A;  3O5K A;  4TNS A;  2KXQ A;  2JZV A;  1JVW A;  1JNS A; 
#chains in the Genus database with same CATH topology
 4A0U A;  2ZQV A;  4NSB A;  1OGG A;  3PR9 A;  1F8A B;  1LG1 A;  4TW6 A;  1NMW A;  3RFW A;  1NMV A;  2WM0 A;  1LL7 A;  1KT1 A;  3FSB A;  4JFI A;  4URI A;  1EYM A;  4PTM A;  1OWQ A;  5I98 A;  2KO7 A;  4MAV A;  1EQ3 A;  1J4I A;  4HBO A;  1LL6 A;  1ITX A;  2F21 A;  3O5Q A;  2ZQU A;  3O5P A;  2MLY A;  4N19 A;  3ARV A;  1ZCN A;  3KAF A;  1LL4 A;  2EZ5 W;  1Y0O A;  1HKI A;  4W9P A;  1JND A;  2YBT A;  2XP8 A;  4DWS C;  1HJX A;  5DIU A;  3FSC A;  2LGO A;  4JFK A;  2DG9 A;  2WLZ A;  4C02 B;  2AWG A;  5HW7 A;  3MQH A;  4IT4 A;  2LPV A;  2DG4 A;  3PRB A;  3AS1 A;  4DZ3 A;  2XPB A;  3AS2 A;  1FAP A;  4J4O A;  3GPK A;  1C9H A;  2A3E A;  1QPL A;  3ALF A;  3LKX A;  4G2P A;  2DSW A;  4MPK A;  5HWB A;  2Y8N B;  2PN0 A;  2LAJ A;  1FKG A;  1JNE A;  5E64 A;  5DEZ A;  4LAY A;  3QOK A;  1XHG A;  3ARY A;  2FAP A;  2EUL A;  5GQB A;  2F4E A;  4Z2J A;  3RM8 A;  3UQI A;  3JXV A;  4Z2G A;  1FKI A;  4P8V A;  1YAT A;  3CGM A;  5AHT A;  3ARQ A;  4O2T A;  3WL0 A;  4Z2I A;  4TW8 A;  3AS3 A;  1EHN A;  5DO2 A;  3KCE A;  2XP5 A;  4J4N A;  2DSU A;  1H0I A;  2ZR4 A;  4JFL A;  2DWV A;  3O5G A;  3KAI A;  3PRD A;  4ML4 A;  4JFM A;  5JH8 A;  1J4R A;  4WKF A;  4QZV B;  1Q6U A;  1NWS A;  1EDQ A;  1PBK A;  1FFQ A;  4QT2 A;  4FAP A;  3WH0 A;  5CQ2 A;  1A7X A;  1ROU A;  3ART A;  1FKH A;  4WKH A;  1J6Y A;  2WAD A;  1E15 A;  1D7H A;  2FKE A;  4NNR A;  2PPN A;  2PBC A;  2P4V A;  1R9H A;  5HBF A;  3CHD A;  4DRP A;  3UI4 A;  4DRI A;  1FFR A;  2LJ4 A;  1W1T A;  4DWS A;  4ODP A;  4WJX A;  3M85 A;  5J6E A;  3H9R B;  2RSE A;  4IQ2 A;  4LAW A;  3WKZ A;  4IPX A;  4DZ2 A;  1Q6I A;  4GIV A;  1U79 A;  4W9Q A;  5E66 A;  2WLY A;  3B8S A;  4P8W A;  3LKX B;  2MF9 A;  2YSF A;  1FKD A;  5HKG A;  3WL1 A;  3IK8 A;  3BMB A;  1Q6H A;  4P8X A;  3PA7 A;  1J4H A;  1FKT A;  4DRK A;  3GTY X;  3OA5 A;  2VCD A;  4L72 B;  2MLZ A;  4WK9 A;  4MNL A;  3WD2 A;  4AY1 A;  2DK7 A;  1HJV A;  3ARP A;  1T11 A;  2OLH A;  1GRJ A;  1FKL A;  1FKB A;  1ZB5 A;  3FY1 A;  3O5J A;  3ARO A;  5E62 A;  1BKF A;  2A3A A;  1ZU8 A;  1I5H W;  1ZBW A;  2DJY A;  3WIJ A;  2DK1 A;  1FKJ A;  4LAV A;  2B5U B;  4L3N A;  2ZQT A;  5HT1 A;  3LUO A;  2MLX A;  4LAX A;  3CGN A;  1UR8 A;  1ZBV A;  5HWC A;  5HUA A;  4BF8 A;  4WKA A;  3O5F A;  4ZPW R;  1ZL1 A;  3RGC A;  4G50 A;  4ZS6 A;  1LQ0 A;  1F40 A;  2WAE A;  3EIP A;  2M3O W;  3GU0 A;  2M8I A;  2UZ5 A;  1GPF A;  3MCB A;  3KAB A;  2IUZ A;  4JYS A;  2KE0 A;  2XP4 A;  5DIV A;  1ZK6 A;  4DH0 A;  2F2D A;  1EG4 A;  1FJD A;  2VN1 A;  4ITZ A;  4R5E A;  3IKD A;  2M2A A;  4DWS B;  1HJW A;  2PPP A;  2RUR A;  2IF4 A;  4Z2K A;  3M7N A;  2M08 A;  2LKN A;  1WR7 A;  3TC5 A;  5U47 A;  2ZR5 A;  2MPH A;  2XPA A;  3O5R A;  4DT4 A;  3CNG A;  3MDY B;  2ESC A;  4W9O A;  1QZ2 A;  2DT0 A;  4ODR A;  3O5M A;  2DSV A;  1WMV A;  3EY6 A;  3VAW A;  3G6L A;  1FKS A;  1NSG A;  2DSZ A;  4ODK A;  5GPG A;  1JVW A;  5B8I C;  1LJY A;  2ETN A;  4KR0 B;  4DRH A;  3TCZ A;  3WQW A;  5DF0 A;  3KAC A;  3MQG A;  1JNT A;  2L4J A;  2OFN A;  4IQC A;  3OOB A;  3L4H A;  1E6P A;  2RE3 A;  3ARS A;  3FAP A;  1X6N A;  2G41 A;  1OGB A;  4MNJ A;  2XP3 A;  1E6R A;  4DRQ A;  3WD0 A;  4S3J A;  1PIN A;  2B31 A;  3ARR A;  1EG3 A;  3ARW A;  1HKK A;  3ALG A;  1CTN A;  4HAR A;  4JFJ A;  4XAK A;  1L1P A;  2ZAJ A;  4REX A;  4U86 A;  2F23 A;  1FLC A;  1P5Q A;  4GLX A;  3CH9 A;  2YSH A;  3WD3 A;  3UI5 A;  3B7X A;  3B9A A;  2G8Z A;  1FKR A;  2XP6 A;  2YSI A;  1NWT A;  2DT3 A;  1RP5 A;  2MNT A;  3KZ7 A;  4TX0 A;  3UF8 A;  3UI6 A;  3W4R A;  3O5O A;  3FS8 A;  3AQU A;  4DRO A;  2KR7 A;  2N87 A;  3NRK A;  1O6I A;  3G6M A;  1NH6 A;  2KI3 A;  3B9D A;  4MNK A;  1FKF A;  2FDM A;  1GOI A;  2ZR6 A;  2KGJ A;  2PV2 A;  3MCB B;  4MSP A;  3ARU A;  3LE4 A;  2XP7 A;  5BXJ A;  4U84 A;  3AS0 A;  1B6C A;  2RUD A;  1TK7 A;  4E5R A;  2E45 A;  1W9P A;  3CHE A;  1X6L A;  4Q7N A;  3JYJ A;  2YBU A;  1K9Q A;  2QF8 A;  3UQB A;  1HXV A;  4QT3 A;  1JCH B;  4A0T A;  2A3B A;  3PRA A;  3RM4 A;  4ODM A;  3KAD A;  1HKM A;  3ARX A;  1W1V A;  4LGX A;  1M5Y A;  1TFV A;  1D2K A;  4FN2 A;  1BL4 A;  2JMF A;  1E6N A;  2DMV A;  3KAH A;  5D75 A;  4U85 A;  2MDI A;  2QRV A;  2ZQS A;  2D9F A;  3ODK A;  1GUV A;  2O92 A;  2BA1 A;  4DWS D;  1YW5 A;  2A3C A;  3TDB A;  5E5W A;  2Y78 A;  3NTP A;  3O5E A;  4ODQ A;  2K8I A;  4P8U A;  3IKG A;  4DRJ A;  4GGQ A;  4W5U A;  1W9V A;  3PQH A;  5E65 A;  1NWR A;  2RUQ A;  5DIT A;  2YSG A;  3JYM A;  3O5I A;  3KAG A;  3WQV A;  2RUC A;  2JX8 A;  4DRM A;  1E6Z A;  2DG3 A;  1Q1C A;  1ZBK A;  2DT1 A;  4Z2L A;  2PPO A;  1ROT A;  4HBE A;  4MNM A;  4ODL A;  1ZBC A;  1D7J A;  5HW6 A;  1W9U A;  1HKJ A;  3WD1 A;  1LG2 A;  3CHF A;  1D7I A;  4QIB A;  2OWO A;  1K9T A;  2JV4 A;  2XP9 A;  4ODO A;  3I6C A;  4Z2H A;  2O9O A;  1H0G A;  2WK2 A;  1SR0 A;  3BXW A;  4DIP A;  1WAW A;  2PV1 A;  1WB0 A;  4TW7 A;  1W26 A;  1FKK A;  2RQS A;  2M8J A;  5GPR A;  5HW8 A;  1EIB A;  2ITK A;  1W1P A;  4S3K A;  3O5D A;  3O5L A;  4MTV A;  4WIW A;  1JMQ A;  4R0X A;  3FXY A;  1SYT A;  3NI6 A;  2PV3 A;  4Q22 A;  1K9R A;  2Q5A A;  4KQZ A;  1E44 A;  1WNO A;  1E9L A;  4TYO A;  2KFW A;  1RD6 A;  4MGV A;  1FD9 A;  1N1A A;  4NZC A;  3RM9 A;  3IHZ A;  2YAJ B;  1QPF A;  1XRV A;  5HTG A;  3CHC A;  4IT6 A;  4ZPV R;  3B9E A;  2L2S A;  2M1I A;  1UR9 A;  4ODN A;  2PI6 A;  2DPE A;  3WD4 A;  2JXW A;  1TCO C;  4UDM A;  1D6O A;  1O6W A;  3UQA A;  1NWU A;  4DRN A;  1KT0 A;  1IX5 A;  2AOS A;  2DT2 A;  2YSB A;  3O5K A;  4TNS A;  4ZPT R;  3RME A;  1KFW A;  1W1Y A;  3CZ8 A;  2KXQ A;  2JZV A;  3ARZ A;  1TR8 A;  1VF8 A;  1JNS A; 
#chains in the Genus database with same CATH homology
 4A0U A;  2ZQV A;  4NSB A;  1OGG A;  3PR9 A;  1F8A B;  1LG1 A;  4TW6 A;  1NMW A;  3RFW A;  1NMV A;  2WM0 A;  1LL7 A;  1KT1 A;  3FSB A;  4JFI A;  4URI A;  1EYM A;  4PTM A;  1OWQ A;  5I98 A;  2KO7 A;  4MAV A;  1EQ3 A;  1J4I A;  4HBO A;  1LL6 A;  1ITX A;  2F21 A;  3O5Q A;  2ZQU A;  3O5P A;  2MLY A;  4N19 A;  3ARV A;  1ZCN A;  3KAF A;  1LL4 A;  2EZ5 W;  1Y0O A;  1HKI A;  4W9P A;  1JND A;  2YBT A;  2XP8 A;  4DWS C;  1HJX A;  5DIU A;  3FSC A;  2LGO A;  4JFK A;  2DG9 A;  2WLZ A;  4C02 B;  2AWG A;  5HW7 A;  3MQH A;  4IT4 A;  2LPV A;  2DG4 A;  3PRB A;  3AS1 A;  4DZ3 A;  2XPB A;  3AS2 A;  1FAP A;  4J4O A;  3GPK A;  1C9H A;  2A3E A;  1QPL A;  3ALF A;  3LKX A;  4G2P A;  2DSW A;  4MPK A;  5HWB A;  2Y8N B;  2LAJ A;  1FKG A;  1JNE A;  5E64 A;  5DEZ A;  4LAY A;  3QOK A;  1XHG A;  3ARY A;  2FAP A;  5GQB A;  2F4E A;  4Z2J A;  3RM8 A;  3UQI A;  3JXV A;  4Z2G A;  1FKI A;  4P8V A;  1YAT A;  3CGM A;  5AHT A;  3ARQ A;  4O2T A;  3WL0 A;  4Z2I A;  4TW8 A;  3AS3 A;  1EHN A;  5DO2 A;  3KCE A;  2XP5 A;  4J4N A;  2DSU A;  1H0I A;  2ZR4 A;  4JFL A;  2DWV A;  3O5G A;  3KAI A;  3PRD A;  4ML4 A;  4JFM A;  5JH8 A;  1J4R A;  4WKF A;  4QZV B;  1Q6U A;  1NWS A;  1EDQ A;  1PBK A;  1FFQ A;  4QT2 A;  4FAP A;  3WH0 A;  5CQ2 A;  1A7X A;  1ROU A;  3ART A;  1FKH A;  4WKH A;  1J6Y A;  2WAD A;  1E15 A;  1D7H A;  2FKE A;  4NNR A;  2PPN A;  2PBC A;  1R9H A;  5HBF A;  3CHD A;  4DRP A;  3UI4 A;  4DRI A;  1FFR A;  2LJ4 A;  1W1T A;  4DWS A;  4ODP A;  4WJX A;  3M85 A;  5J6E A;  3H9R B;  2RSE A;  4IQ2 A;  4LAW A;  3WKZ A;  4IPX A;  4DZ2 A;  1Q6I A;  4GIV A;  1U79 A;  4W9Q A;  5E66 A;  2WLY A;  3B8S A;  4P8W A;  3LKX B;  2MF9 A;  2YSF A;  1FKD A;  5HKG A;  3WL1 A;  3IK8 A;  1Q6H A;  4P8X A;  3PA7 A;  1J4H A;  1FKT A;  4DRK A;  3OA5 A;  2VCD A;  4L72 B;  2MLZ A;  4WK9 A;  4MNL A;  3WD2 A;  4AY1 A;  2DK7 A;  1HJV A;  3ARP A;  1T11 A;  2OLH A;  1FKL A;  1FKB A;  1ZB5 A;  3FY1 A;  3O5J A;  3ARO A;  5E62 A;  1BKF A;  2A3A A;  1ZU8 A;  1I5H W;  1ZBW A;  2DJY A;  3WIJ A;  2DK1 A;  1FKJ A;  4LAV A;  4L3N A;  2ZQT A;  5HT1 A;  3LUO A;  2MLX A;  4LAX A;  3CGN A;  1UR8 A;  1ZBV A;  5HWC A;  5HUA A;  4BF8 A;  4WKA A;  3O5F A;  4ZPW R;  1ZL1 A;  3RGC A;  4G50 A;  4ZS6 A;  1LQ0 A;  1F40 A;  2WAE A;  2M3O W;  2M8I A;  2UZ5 A;  1GPF A;  3MCB A;  3KAB A;  2IUZ A;  4JYS A;  2KE0 A;  2XP4 A;  5DIV A;  1ZK6 A;  4DH0 A;  2F2D A;  1EG4 A;  1FJD A;  2VN1 A;  4ITZ A;  4R5E A;  3IKD A;  2M2A A;  4DWS B;  1HJW A;  2PPP A;  2RUR A;  2IF4 A;  4Z2K A;  3M7N A;  2M08 A;  2LKN A;  1WR7 A;  3TC5 A;  5U47 A;  2ZR5 A;  2MPH A;  2XPA A;  3O5R A;  4DT4 A;  3CNG A;  3MDY B;  2ESC A;  4W9O A;  1QZ2 A;  2DT0 A;  4ODR A;  3O5M A;  2DSV A;  1WMV A;  3EY6 A;  3VAW A;  3G6L A;  1FKS A;  1NSG A;  2DSZ A;  4ODK A;  5GPG A;  1JVW A;  5B8I C;  1LJY A;  4KR0 B;  4DRH A;  3TCZ A;  3WQW A;  5DF0 A;  3KAC A;  3MQG A;  1JNT A;  2L4J A;  2OFN A;  4IQC A;  3OOB A;  3L4H A;  1E6P A;  2RE3 A;  3ARS A;  3FAP A;  1X6N A;  2G41 A;  1OGB A;  4MNJ A;  2XP3 A;  1E6R A;  4DRQ A;  3WD0 A;  4S3J A;  1PIN A;  2B31 A;  3ARR A;  1EG3 A;  3ARW A;  1HKK A;  3ALG A;  1CTN A;  4HAR A;  4JFJ A;  4XAK A;  1L1P A;  2ZAJ A;  4REX A;  4U86 A;  1FLC A;  1P5Q A;  4GLX A;  3CH9 A;  2YSH A;  3WD3 A;  3UI5 A;  3B7X A;  3B9A A;  2G8Z A;  1FKR A;  2XP6 A;  2YSI A;  1NWT A;  2DT3 A;  1RP5 A;  2MNT A;  3KZ7 A;  4TX0 A;  3UF8 A;  3UI6 A;  3W4R A;  3O5O A;  3FS8 A;  3AQU A;  4DRO A;  2KR7 A;  2N87 A;  3NRK A;  1O6I A;  3G6M A;  1NH6 A;  2KI3 A;  3B9D A;  4MNK A;  1FKF A;  2FDM A;  1GOI A;  2ZR6 A;  2KGJ A;  2PV2 A;  3MCB B;  4MSP A;  3ARU A;  3LE4 A;  2XP7 A;  5BXJ A;  4U84 A;  3AS0 A;  1B6C A;  2RUD A;  1TK7 A;  4E5R A;  2E45 A;  1W9P A;  3CHE A;  1X6L A;  4Q7N A;  3JYJ A;  2YBU A;  1K9Q A;  2QF8 A;  3UQB A;  1HXV A;  4QT3 A;  4A0T A;  2A3B A;  3PRA A;  3RM4 A;  4ODM A;  3KAD A;  1HKM A;  3ARX A;  1W1V A;  4LGX A;  1M5Y A;  1TFV A;  1D2K A;  4FN2 A;  1BL4 A;  2JMF A;  1E6N A;  2DMV A;  3KAH A;  5D75 A;  4U85 A;  2MDI A;  2QRV A;  2ZQS A;  2D9F A;  3ODK A;  1GUV A;  2O92 A;  2BA1 A;  4DWS D;  1YW5 A;  2A3C A;  3TDB A;  5E5W A;  2Y78 A;  3NTP A;  3O5E A;  4ODQ A;  2K8I A;  4P8U A;  3IKG A;  4DRJ A;  4GGQ A;  4W5U A;  1W9V A;  3PQH A;  5E65 A;  1NWR A;  2RUQ A;  5DIT A;  2YSG A;  3JYM A;  3O5I A;  3KAG A;  3WQV A;  2RUC A;  2JX8 A;  4DRM A;  1E6Z A;  2DG3 A;  1Q1C A;  1ZBK A;  2DT1 A;  4Z2L A;  2PPO A;  1ROT A;  4HBE A;  4MNM A;  4ODL A;  1ZBC A;  1D7J A;  5HW6 A;  1W9U A;  1HKJ A;  3WD1 A;  1LG2 A;  3CHF A;  1D7I A;  4QIB A;  2OWO A;  1K9T A;  2JV4 A;  2XP9 A;  4ODO A;  3I6C A;  4Z2H A;  2O9O A;  1H0G A;  2WK2 A;  1SR0 A;  3BXW A;  4DIP A;  1WAW A;  2PV1 A;  1WB0 A;  4TW7 A;  1W26 A;  1FKK A;  2RQS A;  2M8J A;  5GPR A;  5HW8 A;  1EIB A;  2ITK A;  1W1P A;  4S3K A;  3O5D A;  3O5L A;  4MTV A;  4WIW A;  1JMQ A;  4R0X A;  3FXY A;  1SYT A;  3NI6 A;  2PV3 A;  4Q22 A;  1K9R A;  2Q5A A;  4KQZ A;  1WNO A;  1E9L A;  4TYO A;  2KFW A;  1RD6 A;  4MGV A;  1FD9 A;  1N1A A;  4NZC A;  3RM9 A;  3IHZ A;  2YAJ B;  1QPF A;  1XRV A;  5HTG A;  3CHC A;  4IT6 A;  4ZPV R;  3B9E A;  2L2S A;  2M1I A;  1UR9 A;  4ODN A;  2PI6 A;  2DPE A;  3WD4 A;  2JXW A;  1TCO C;  1D6O A;  1O6W A;  3UQA A;  1NWU A;  4DRN A;  1KT0 A;  1IX5 A;  2AOS A;  2DT2 A;  2YSB A;  3O5K A;  4TNS A;  4ZPT R;  3RME A;  1KFW A;  1W1Y A;  3CZ8 A;  2KXQ A;  2JZV A;  3ARZ A;  1TR8 A;  1VF8 A;  1JNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...