1PINA

Pin1 peptidyl-prolyl cis-trans isomerase from homo sapiens
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
153
Chain Sequence
b'KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE
publication title Structural and functional analysis of the mitotic rotamase Pin1 suggests substrate recognition is phosphorylation dependent.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 42
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1998-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1pinA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1pinA02
4GGQA 1WR7A 2JZVA 3KABA 3KAFA 2YSGA 4R0XA 1TK7A 4FN2A 2AWGA 3M85A 1A7XA 4DIPA 1N1AA 1YW5A 1D7HA 2YSFA 4DRHA 2DMVA 1J4RA 1K9RA 3UI6A 3LE4A 3JYMA 3O5LA 1FKDA 4QT2A 2MF9A 3KCEA 1F8AB 2PPOA 3EY6A 4ITZA 2D9FA 3UQIA 5GPGA 3O5RA 3O5QA 4W9OA 1W26A 2MLZA 3O5PA 2FKEA 4MSPA 3NTPA 2MDIA 1NMVA 5HWBA 3KADA 4JFKA 4U84A 3I6CA 2KR7A 2ZQTA 1FKHA 1FKJA 2DG9A 1JNSA 1U79A 4LAXA 1FKKA 3O5OA 1FKGA 4ODKA 3RFWA 2MLYA 1JVWA 3JXVA 2LPVA 2K8IA 1QPLA 3O5JA 1NMWA 1PBKA 1F40A 2XP6A 4IQCA 4DRJA 2VCDA 2RUQA 3CNGA 4TW8A 5HKGA 5DIVA 3IK8A 4W9QA 1KT1A 3LUOA 2LKNA 2RSEA 3IKDA 2RE3A 1M5YA 1EG3A 1O6WA 2M2AA 4TYOA 4DRMA 2N87A 4JFLA 1YATA 2PV1A 2UZ5A 4N19A 2ZQVA 4DRIA 2DJYA 1BKFA 2MNTA 2XP3A 3NI6A 2M8JA 4J4OA 4TNSA 2LJ4A 4ODLA 3WH0A 4TW6A 4IQ2A 5DIUA 1Y0OA 2XPBA 2JX8A 2DG3A 1FAPA 2KGJA 4G2PA 1J4IA 2FAPA 2VN1A 4U86A 2EZ5W 3O5FA 1EYMA 1FKLA 3UQAA 4GIVA 3TCZA 4U85A 2F21A 3CGMA 1HXVA 3PRDA 3M7NA 2ZQUA 2KO7A 2XP9A 2BA1A 4QIBA 4ODQA 2PPPA 2DG4A 4DZ2A 1ROTA 3TDBA 2YSIA 4JFIA 3UI4A 4IPXA 1ZK6A 4G50A 3UI5A 4REXA 4J4NA 4O2TA 1ROUA 3UF8A 1D7JA 1JNTA 4TX0A 5BXJA 4JYSA 1FD9A 2E45A 4LAVA 4JFJA 2IF4A 5HTGA 4ODOA 1FKRA 2XP4A 4DRQA 3JYJA 3KZ7A 2ZR6A 1BL4A 1P5QA 5D75A 3VAWA 2PBCA 2M8IA 4ODPA 2ZR4A 3O5KA 1T11A 2DWVA 2LAJA 3KAHA 3OOBA 1EQ3A 4C02B 4JFMA 1Q6IA 2PPNA 2PV3A 5I98A 1QZ2A 3KAIA 2KXQA 1FKSA 1FKFA 1NSGA 5HW7A 5HW8A 4ODNA 1C9HA 2JMFA 3H9RB 2L4JA 2JV4A 1J6YA 2KI3A 4LAYA 1D6OA 2Q5AA 3GPKA 4DH0A 2XP8A 1I5HW 2OFNA 1L1PA 2RQSA 1D7IA 5HW6A 2RUCA 1FKTA 1B6CA 5B8IC 3FAPA 4FAPA 3L4HA 2RURA 2ITKA 4MGVA 5HWCA 3O5IA 1JMQA 1FKIA 3MDYB 4DRPA 5HUAA 2M3OW 2L2SA 3UQBA 4W9PA 2F2DA 5AHTA 2XP5A 2Y78A 3IHZA 4DRKA 1PINA 2KFWA 3TC5A 3O5MA 3PA7A 4BF8A 1EG4A 1WMVA 2XPAA 3IKGA 3O5EA 1QPFA 5CQ2A 3CGNA 2XP7A 1Q1CA 4DZ3A 2M08A 1TCOC 2LGOA 4LAWA 4ODRA 3ODKA 4DRNA 4E5RA 3B7XA 2ZQSA 4TW7A 2RUDA 3O5GA 4DT4A 5HT1A 3O5DA 2KE0A 5DITA 2YSBA 2ZAJA 3RGCA 1FKBA 2MLXA 1ZCNA 2M1IA 1Q6HA 2DK1A 1Q6UA 2YSHA 5J6EA 2F4EA 2DK7A 4ODMA 1FJDA 3KAGA 3PRBA 1R9HA 2ZR5A 2MPHA 1J4HA 2JXWA 4QT3A 2PV2A 3KACA 1KT0A 1K9QA 3NRKA 4DROA 4NNRA
chains in the Genus database with same CATH superfamily
3CHEA 4GGQA 1LL4A 1WR7A 1OGGA 3ARTA 3RM9A 2JZVA 3KABA 4WKFA 1X6NA 3KAFA 2YSGA 4R0XA 1LJYA 1TK7A 2P4VA 4LGXA 4ML4A 4FN2A 2AWGA 2A3EA 3M85A 1HKMA 1A7XA 1E44A 4DIPA 3FS8A 1YW5A 2WAEA 1N1AA 1D7HA 2YSFA 4IT4A 4DRHA 2DMVA 1J4RA 1K9RA 3UI6A 3LE4A 3JYMA 3O5LA 2YBTA 1FKDA 4P8UA 4QT2A 2MF9A 1CTNA 3ARQA 1H0GA 3KCEA 1F8AB 2PPOA 5U47A 3EY6A 4ITZA 2D9FA 2A3BA 1NH6A 5GPGA 3UQIA 3O5RA 2DT0A 1RD6A 3O5QA 2ESCA 4W9OA 1W26A 1JNEA 2MLZA 3O5PA 2YAJB 5E5WA 4XAKA 2FKEA 4MSPA 1GOIA 5DO2A 4W5UA 3NTPA 2MDIA 1NMVA 5HWBA 3KADA 1E6RA 4JFKA 4U84A 3I6CA 4KQZA 2KR7A 1FFRA 2ZQTA 4WJXA 3ARYA 1FKHA 1FKJA 2DG9A 4URIA 1JNSA 1U79A 4LAXA 1FKKA 3O5OA 1FKGA 3MCBB 4ODKA 3CHDA 3WD3A 3RFWA 2DT3A 2MLYA 1JVWA 3JXVA 3FXYA 2LPVA 2K8IA 1QPLA 3O5JA 1NMWA 1PBKA 3B9DA 1JCHB 4ZPWR 2FDMA 1EDQA 1F40A 2XP6A 4IQCA 4DRJA 2VCDA 2RUQA 2PN0A 4Z2LA 1E6ZA 1H0IA 4Q7NA 3CNGA 4TW8A 5HKGA 5DIVA 1HKKA 4S3KA 4DWSB 3PRAA 1HJWA 3IK8A 4W9QA 1KT1A 3ARVA 3LUOA 1XHGA 5E65A 4ZPVR 2LKNA 2RSEA 3PR9A 2AOSA 1E6NA 4MNMA 4WKAA 2QF8A 4Z2IA 1FFQA 1ZL1A 3IKDA 2RE3A 4ZPTR 4R5EA 3ALFA 1M5YA 1X6LA 1OGBA 1UR9A 1LG2A 1EG3A 1E6PA 2OLHA 3ARUA 1O6WA 3WD4A 2M2AA 4TYOA 1XRVA 1GRJA 4DRMA 2Y8NB 2N87A 4JFLA 3LKXB 2WLZA 1YATA 2PV1A 2UZ5A 4N19A 3ARZA 3ARSA 2ZQVA 4DRIA 3G6MA 2DJYA 1BKFA 2MNTA 4Z2HA 4L3NA 5GQBA 1WNOA 1NWRA 2XP3A 3NI6A 1E15A 2M8JA 2A3AA 4J4OA 3AROA 2A3CA 4TNSA 2LJ4A 2WADA 4ODLA 3WH0A 1ZU8A 1ZBKA 1JNDA 3GU0A 4MNKA 4TW6A 3FSCA 4IQ2A 2DSWA 1W1YA 2WK2A 5DIUA 1Y0OA 2XPBA 2JX8A 1ZBCA 2DG3A 1FAPA 5E66A 2KGJA 1VF8A 4G2PA 1J4IA 2FAPA 1KFWA 2VN1A 4A0TA 4U86A 2EZ5W 3O5FA 3CH9A 1EYMA 1FKLA 3UQAA 4GIVA 4AY1A 3TCZA 4U85A 2F21A 3CGMA 3QOKA 1HXVA 4HBOA 3PRDA 4Q22A 1NWTA 3M7NA 2ZQUA 1WB0A 4DWSD 2KO7A 2XP9A 3AQUA 2BA1A 4QIBA 4ODQA 2PPPA 5DEZA 1RP5A 1EIBA 1W1VA 1W9VA 3RM4A 1SYTA 2DG4A 4DZ2A 1ROTA 4NZCA 4UDMA 3TDBA 2YSIA 4JFIA 5GPRA 3UI4A 4Z2JA 3AS1A 4IPXA 3AS2A 1ZK6A 4G50A 2DT2A 1W9UA 4GLXA 3UI5A 2B5UB 2DPEA 3OA5A 4REXA 4J4NA 3B9EA 3WD0A 4O2TA 1HKIA 4MNJA 1ROUA 2YBUA 3MQHA 3UF8A 2WM0A 1D7JA 1JNTA 4TX0A 5BXJA 4JYSA 1FD9A 2E45A 4LAVA 4JFJA 2IF4A 5HTGA 4ODOA 1FKRA 2G8ZA 2XP4A 3ARPA 4DRQA 3JYJA 3KZ7A 2ZR6A 2O9OA 1BL4A 4P8WA 2EULA 4MTVA 1IX5A 1P5QA 5D75A 1O6IA 3VAWA 4WK9A 2PBCA 2DSVA 2M8IA 4ODPA 2ZR4A 3FSBA 1ZB5A 3O5KA 3W4RA 1T11A 2DWVA 3EIPA 2LAJA 3B9AA 3KAHA 2DT1A 3OOBA 1HKJA 3WD1A 1EQ3A 3AS0A 3RM8A 4C02B 4JFMA 1Q6IA 1NWUA 4PTMA 3ARXA 4A0UA 2PPNA 2PV3A 3PQHA 1E9LA 5I98A 1QZ2A 3KAIA 2DSUA 3FY1A 4MPKA 2KXQA 1FKSA 1FKFA 1SR0A 2IUZA 4HBEA 1NSGA 3WQVA 5HW7A 5HW8A 4ODNA 1C9HA 2JMFA 3H9RB 2L4JA 2JV4A 1J6YA 2KI3A 4LAYA 2G41A 4P8VA 1W1PA 1D6OA 2Q5AA 3GPKA 3ARRA 4DH0A 1LL7A 5E64A 2WLYA 2XP8A 1I5HW 2OFNA 1L1PA 1LG1A 1LQ0A 4DWSA 5JH8A 3B8SA 2RQSA 3WKZA 1D7IA 4QZVB 2RUCA 1HJVA 5HW6A 1GUVA 1FKTA 1D2KA 4ZS6A 1B6CA 5B8IC 4MNLA 4Z2GA 3MQGA 4IT6A 4WKHA 3FAPA 4FAPA 3L4HA 1FLCA 4KR0B 2RURA 2ITKA 4MGVA 5HWCA 3O5IA 1JMQA 4P8XA 1FKIA 3MDYB 3WL0A 4DRPA 2M3OW 2O92A 5HUAA 1EHNA 2L2SA 3LKXA 2OWOA 2PI6A 3UQBA 4W9PA 1UR8A 2F2DA 3WIJA 1TFVA 4S3JA 5AHTA 2F23A 3WQWA 2XP5A 3WD2A 2Y78A 3AS3A 1OWQA 4HARA 3IHZA 4DRKA 1PINA 2KFWA 3TC5A 3CHCA 3O5MA 3PA7A 4BF8A 1EG4A 1WMVA 2XPAA 3BXWA 3IKGA 5HBFA 3O5EA 1QPFA 5CQ2A 3CGNA 2XP7A 1Q1CA 4DZ3A 2M08A 1LL6A 1TCOC 2LGOA 5E62A 4LAWA 4NSBA 4ODRA 3RMEA 3ODKA 1GPFA 4DRNA 4L72B 4E5RA 2B31A 3B7XA 2ETNA 1ITXA 2ZQSA 1ZBVA 4TW7A 2RUDA 3O5GA 5HT1A 4DT4A 3O5DA 2KE0A 5DITA 4Z2KA 2YSBA 3GTYX 3G6LA 2ZAJA 3RGCA 1FKBA 3BMBA 1W1TA 2MLXA 1ZCNA 3CHFA 1WAWA 4MAVA 2M1IA 1NWSA 5DF0A 1Q6HA 2DK1A 1Q6UA 2YSHA 5J6EA 3ARWA 2F4EA 2DK7A 4WIWA 1W9PA 4ODMA 1FJDA 1TR8A 3KAGA 1K9TA 3PRBA 1R9HA 1ZBWA 3CZ8A 2DSZA 2ZR5A 2MPHA 1HJXA 3MCBA 2QRVA 4DWSC 1J4HA 2JXWA 4QT3A 2PV2A 3KACA 1KT0A 3ALGA 1K9QA 3NRKA 4DROA 4NNRA 3WL1A
chains in the Genus database with same CATH topology
3CHEA 4GGQA 1LL4A 1WR7A 1OGGA 3ARTA 3RM9A 2JZVA 3KABA 4WKFA 1X6NA 3KAFA 2YSGA 4R0XA 1LJYA 1TK7A 4LGXA 4ML4A 4FN2A 2AWGA 2A3EA 3M85A 1HKMA 1A7XA 4DIPA 3FS8A 1YW5A 2WAEA 1N1AA 1D7HA 2YSFA 4IT4A 4DRHA 2DMVA 1J4RA 1K9RA 3UI6A 3LE4A 3JYMA 3O5LA 2YBTA 1FKDA 4P8UA 4QT2A 2MF9A 1CTNA 3ARQA 1H0GA 3KCEA 1F8AB 2PPOA 5U47A 3EY6A 4ITZA 2D9FA 2A3BA 1NH6A 5GPGA 3UQIA 3O5RA 2DT0A 1RD6A 3O5QA 2ESCA 4W9OA 1W26A 1JNEA 2MLZA 3O5PA 2YAJB 5E5WA 4XAKA 2FKEA 4MSPA 1GOIA 5DO2A 4W5UA 3NTPA 2MDIA 1NMVA 5HWBA 3KADA 1E6RA 4JFKA 4U84A 3I6CA 4KQZA 2KR7A 1FFRA 2ZQTA 4WJXA 3ARYA 1FKHA 1FKJA 2DG9A 4URIA 1JNSA 1U79A 4LAXA 1FKKA 3O5OA 1FKGA 3MCBB 4ODKA 3CHDA 3WD3A 3RFWA 2DT3A 2MLYA 1JVWA 3JXVA 3FXYA 2LPVA 2K8IA 1QPLA 3O5JA 1NMWA 1PBKA 3B9DA 4ZPWR 2FDMA 1EDQA 1F40A 2XP6A 4IQCA 4DRJA 2VCDA 2RUQA 4Z2LA 1E6ZA 1H0IA 4Q7NA 3CNGA 4TW8A 5HKGA 5DIVA 1HKKA 4S3KA 4DWSB 3PRAA 1HJWA 3IK8A 4W9QA 1KT1A 3ARVA 3LUOA 1XHGA 5E65A 4ZPVR 2LKNA 2RSEA 3PR9A 2AOSA 1E6NA 4MNMA 4WKAA 2QF8A 4Z2IA 1FFQA 1ZL1A 3IKDA 2RE3A 4ZPTR 4R5EA 3ALFA 1M5YA 1X6LA 1OGBA 1UR9A 1LG2A 1EG3A 1E6PA 2OLHA 3ARUA 1O6WA 3WD4A 2M2AA 4TYOA 1XRVA 4DRMA 2Y8NB 2N87A 4JFLA 3LKXB 2WLZA 1YATA 2PV1A 2UZ5A 4N19A 3ARZA 3ARSA 2ZQVA 4DRIA 3G6MA 2DJYA 1BKFA 2MNTA 4Z2HA 4L3NA 5GQBA 1WNOA 1NWRA 2XP3A 3NI6A 1E15A 2M8JA 2A3AA 4J4OA 3AROA 2A3CA 4TNSA 2LJ4A 2WADA 4ODLA 3WH0A 1ZU8A 1ZBKA 1JNDA 4MNKA 4TW6A 3FSCA 4IQ2A 2DSWA 1W1YA 2WK2A 5DIUA 1Y0OA 2XPBA 2JX8A 1ZBCA 2DG3A 1FAPA 5E66A 2KGJA 1VF8A 4G2PA 1J4IA 2FAPA 1KFWA 2VN1A 4A0TA 4U86A 2EZ5W 3O5FA 3CH9A 1EYMA 1FKLA 3UQAA 4GIVA 4AY1A 3TCZA 4U85A 2F21A 3CGMA 3QOKA 1HXVA 4HBOA 3PRDA 4Q22A 1NWTA 3M7NA 2ZQUA 1WB0A 4DWSD 2KO7A 2XP9A 3AQUA 2BA1A 4QIBA 4ODQA 2PPPA 5DEZA 1RP5A 1EIBA 1W1VA 1W9VA 3RM4A 1SYTA 2DG4A 4DZ2A 1ROTA 4NZCA 3TDBA 2YSIA 4JFIA 5GPRA 3UI4A 4Z2JA 3AS1A 4IPXA 3AS2A 1ZK6A 4G50A 2DT2A 1W9UA 4GLXA 3UI5A 2DPEA 3OA5A 4REXA 4J4NA 3B9EA 3WD0A 4O2TA 1HKIA 4MNJA 1ROUA 2YBUA 3MQHA 3UF8A 2WM0A 1D7JA 1JNTA 4TX0A 5BXJA 4JYSA 1FD9A 2E45A 4LAVA 4JFJA 2IF4A 5HTGA 4ODOA 1FKRA 2G8ZA 2XP4A 3ARPA 4DRQA 3JYJA 3KZ7A 2ZR6A 2O9OA 1BL4A 4P8WA 4MTVA 1IX5A 1P5QA 5D75A 1O6IA 3VAWA 4WK9A 2PBCA 2DSVA 2M8IA 4ODPA 2ZR4A 3FSBA 1ZB5A 3O5KA 3W4RA 1T11A 2DWVA 2LAJA 3B9AA 3KAHA 2DT1A 3OOBA 1HKJA 3WD1A 1EQ3A 3AS0A 3RM8A 4C02B 4JFMA 1Q6IA 1NWUA 4PTMA 3ARXA 4A0UA 2PPNA 2PV3A 3PQHA 1E9LA 5I98A 1QZ2A 3KAIA 2DSUA 3FY1A 4MPKA 2KXQA 1FKSA 1FKFA 1SR0A 2IUZA 4HBEA 1NSGA 3WQVA 5HW7A 5HW8A 4ODNA 1C9HA 2JMFA 3H9RB 2L4JA 2JV4A 1J6YA 2KI3A 4LAYA 2G41A 4P8VA 1W1PA 1D6OA 2Q5AA 3GPKA 3ARRA 4DH0A 1LL7A 5E64A 2WLYA 2XP8A 1I5HW 2OFNA 1L1PA 1LG1A 1LQ0A 4DWSA 5JH8A 3B8SA 2RQSA 3WKZA 1D7IA 4QZVB 2RUCA 1HJVA 5HW6A 1GUVA 1FKTA 1D2KA 4ZS6A 1B6CA 5B8IC 4MNLA 4Z2GA 3MQGA 4IT6A 4WKHA 3FAPA 4FAPA 3L4HA 1FLCA 4KR0B 2RURA 2ITKA 4MGVA 5HWCA 3O5IA 1JMQA 4P8XA 1FKIA 3MDYB 3WL0A 4DRPA 2M3OW 2O92A 5HUAA 1EHNA 2L2SA 3LKXA 2OWOA 2PI6A 3UQBA 4W9PA 1UR8A 2F2DA 3WIJA 1TFVA 4S3JA 5AHTA 3WQWA 2XP5A 3WD2A 2Y78A 3AS3A 1OWQA 4HARA 3IHZA 4DRKA 1PINA 2KFWA 3TC5A 3CHCA 3O5MA 3PA7A 4BF8A 1EG4A 1WMVA 2XPAA 3BXWA 3IKGA 5HBFA 3O5EA 1QPFA 5CQ2A 3CGNA 2XP7A 1Q1CA 4DZ3A 2M08A 1LL6A 1TCOC 2LGOA 5E62A 4LAWA 4NSBA 4ODRA 3RMEA 3ODKA 1GPFA 4DRNA 4L72B 4E5RA 2B31A 3B7XA 1ITXA 2ZQSA 1ZBVA 4TW7A 2RUDA 3O5GA 5HT1A 4DT4A 3O5DA 2KE0A 5DITA 4Z2KA 2YSBA 3G6LA 2ZAJA 3RGCA 1FKBA 1W1TA 2MLXA 1ZCNA 3CHFA 1WAWA 4MAVA 2M1IA 1NWSA 5DF0A 1Q6HA 2DK1A 1Q6UA 2YSHA 5J6EA 3ARWA 2F4EA 2DK7A 4WIWA 1W9PA 4ODMA 1FJDA 1TR8A 3KAGA 1K9TA 3PRBA 1R9HA 1ZBWA 3CZ8A 2DSZA 2ZR5A 2MPHA 1HJXA 3MCBA 2QRVA 4DWSC 1J4HA 2JXWA 4QT3A 2PV2A 3KACA 1KT0A 3ALGA 1K9QA 3NRKA 4DROA 4NNRA 3WL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GGQ A;  1WR7 A;  2JZV A;  3KAB A;  3KAF A;  2YSG A;  4R0X A;  1TK7 A;  4FN2 A;  2AWG A;  3M85 A;  1A7X A;  4DIP A;  1N1A A;  1YW5 A;  1D7H A;  2YSF A;  4DRH A;  2DMV A;  1J4R A;  1K9R A;  3UI6 A;  3LE4 A;  3JYM A;  3O5L A;  1FKD A;  4QT2 A;  2MF9 A;  3KCE A;  1F8A B;  2PPO A;  3EY6 A;  4ITZ A;  2D9F A;  3UQI A;  5GPG A;  3O5R A;  3O5Q A;  4W9O A;  1W26 A;  2MLZ A;  3O5P A;  2FKE A;  4MSP A;  3NTP A;  2MDI A;  1NMV A;  5HWB A;  3KAD A;  4JFK A;  4U84 A;  3I6C A;  2KR7 A;  2ZQT A;  1FKH A;  1FKJ A;  2DG9 A;  1JNS A;  1U79 A;  4LAX A;  1FKK A;  3O5O A;  1FKG A;  4ODK A;  3RFW A;  2MLY A;  1JVW A;  3JXV A;  2LPV A;  2K8I A;  1QPL A;  3O5J A;  1NMW A;  1PBK A;  1F40 A;  2XP6 A;  4IQC A;  4DRJ A;  2VCD A;  2RUQ A;  3CNG A;  4TW8 A;  5HKG A;  5DIV A;  3IK8 A;  4W9Q A;  1KT1 A;  3LUO A;  2LKN A;  2RSE A;  3IKD A;  2RE3 A;  1M5Y A;  1EG3 A;  1O6W A;  2M2A A;  4TYO A;  4DRM A;  2N87 A;  4JFL A;  1YAT A;  2PV1 A;  2UZ5 A;  4N19 A;  2ZQV A;  4DRI A;  2DJY A;  1BKF A;  2MNT A;  2XP3 A;  3NI6 A;  2M8J A;  4J4O A;  4TNS A;  2LJ4 A;  4ODL A;  3WH0 A;  4TW6 A;  4IQ2 A;  5DIU A;  1Y0O A;  2XPB A;  2JX8 A;  2DG3 A;  1FAP A;  2KGJ A;  4G2P A;  1J4I A;  2FAP A;  2VN1 A;  4U86 A;  2EZ5 W;  3O5F A;  1EYM A;  1FKL A;  3UQA A;  4GIV A;  3TCZ A;  4U85 A;  2F21 A;  3CGM A;  1HXV A;  3PRD A;  3M7N A;  2ZQU A;  2KO7 A;  2XP9 A;  2BA1 A;  4QIB A;  4ODQ A;  2PPP A;  2DG4 A;  4DZ2 A;  1ROT A;  3TDB A;  2YSI A;  4JFI A;  3UI4 A;  4IPX A;  1ZK6 A;  4G50 A;  3UI5 A;  4REX A;  4J4N A;  4O2T A;  1ROU A;  3UF8 A;  1D7J A;  1JNT A;  4TX0 A;  5BXJ A;  4JYS A;  1FD9 A;  2E45 A;  4LAV A;  4JFJ A;  2IF4 A;  5HTG A;  4ODO A;  1FKR A;  2XP4 A;  4DRQ A;  3JYJ A;  3KZ7 A;  2ZR6 A;  1BL4 A;  1P5Q A;  5D75 A;  3VAW A;  2PBC A;  2M8I A;  4ODP A;  2ZR4 A;  3O5K A;  1T11 A;  2DWV A;  2LAJ A;  3KAH A;  3OOB A;  1EQ3 A;  4C02 B;  4JFM A;  1Q6I A;  2PPN A;  2PV3 A;  5I98 A;  1QZ2 A;  3KAI A;  2KXQ A;  1FKS A;  1FKF A;  1NSG A;  5HW7 A;  5HW8 A;  4ODN A;  1C9H A;  2JMF A;  3H9R B;  2L4J A;  2JV4 A;  1J6Y A;  2KI3 A;  4LAY A;  1D6O A;  2Q5A A;  3GPK A;  4DH0 A;  2XP8 A;  1I5H W;  2OFN A;  1L1P A;  2RQS A;  1D7I A;  5HW6 A;  2RUC A;  1FKT A;  1B6C A;  5B8I C;  3FAP A;  4FAP A;  3L4H A;  2RUR A;  2ITK A;  4MGV A;  5HWC A;  3O5I A;  1JMQ A;  1FKI A;  3MDY B;  4DRP A;  5HUA A;  2M3O W;  2L2S A;  3UQB A;  4W9P A;  2F2D A;  5AHT A;  2XP5 A;  2Y78 A;  3IHZ A;  4DRK A;  1PIN A;  2KFW A;  3TC5 A;  3O5M A;  3PA7 A;  4BF8 A;  1EG4 A;  1WMV A;  2XPA A;  3IKG A;  3O5E A;  1QPF A;  5CQ2 A;  3CGN A;  2XP7 A;  1Q1C A;  4DZ3 A;  2M08 A;  1TCO C;  2LGO A;  4LAW A;  4ODR A;  3ODK A;  4DRN A;  4E5R A;  3B7X A;  2ZQS A;  4TW7 A;  2RUD A;  3O5G A;  4DT4 A;  5HT1 A;  3O5D A;  2KE0 A;  5DIT A;  2YSB A;  2ZAJ A;  3RGC A;  1FKB A;  2MLX A;  1ZCN A;  2M1I A;  1Q6H A;  2DK1 A;  1Q6U A;  2YSH A;  5J6E A;  2F4E A;  2DK7 A;  4ODM A;  1FJD A;  3KAG A;  3PRB A;  1R9H A;  2ZR5 A;  2MPH A;  1J4H A;  2JXW A;  4QT3 A;  2PV2 A;  3KAC A;  1KT0 A;  1K9Q A;  3NRK A;  4DRO A;  4NNR A; 
#chains in the Genus database with same CATH topology
 3CHE A;  4GGQ A;  1LL4 A;  1WR7 A;  1OGG A;  3ART A;  3RM9 A;  2JZV A;  3KAB A;  4WKF A;  1X6N A;  3KAF A;  2YSG A;  4R0X A;  1LJY A;  1TK7 A;  2P4V A;  4LGX A;  4ML4 A;  4FN2 A;  2AWG A;  2A3E A;  3M85 A;  1HKM A;  1A7X A;  1E44 A;  4DIP A;  3FS8 A;  1YW5 A;  2WAE A;  1N1A A;  1D7H A;  2YSF A;  4IT4 A;  4DRH A;  2DMV A;  1J4R A;  1K9R A;  3UI6 A;  3LE4 A;  3JYM A;  3O5L A;  2YBT A;  1FKD A;  4P8U A;  4QT2 A;  2MF9 A;  1CTN A;  3ARQ A;  1H0G A;  3KCE A;  1F8A B;  2PPO A;  5U47 A;  3EY6 A;  4ITZ A;  2D9F A;  2A3B A;  1NH6 A;  5GPG A;  3UQI A;  3O5R A;  2DT0 A;  1RD6 A;  3O5Q A;  2ESC A;  4W9O A;  1W26 A;  1JNE A;  2MLZ A;  3O5P A;  2YAJ B;  5E5W A;  4XAK A;  2FKE A;  4MSP A;  1GOI A;  5DO2 A;  4W5U A;  3NTP A;  2MDI A;  1NMV A;  5HWB A;  3KAD A;  1E6R A;  4JFK A;  4U84 A;  3I6C A;  4KQZ A;  2KR7 A;  1FFR A;  2ZQT A;  4WJX A;  3ARY A;  1FKH A;  1FKJ A;  2DG9 A;  4URI A;  1JNS A;  1U79 A;  4LAX A;  1FKK A;  3O5O A;  1FKG A;  3MCB B;  4ODK A;  3CHD A;  3WD3 A;  3RFW A;  2DT3 A;  2MLY A;  1JVW A;  3JXV A;  3FXY A;  2LPV A;  2K8I A;  1QPL A;  3O5J A;  1NMW A;  1PBK A;  3B9D A;  1JCH B;  4ZPW R;  2FDM A;  1EDQ A;  1F40 A;  2XP6 A;  4IQC A;  4DRJ A;  2VCD A;  2RUQ A;  2PN0 A;  4Z2L A;  1E6Z A;  1H0I A;  4Q7N A;  3CNG A;  4TW8 A;  5HKG A;  5DIV A;  1HKK A;  4S3K A;  4DWS B;  3PRA A;  1HJW A;  3IK8 A;  4W9Q A;  1KT1 A;  3ARV A;  3LUO A;  1XHG A;  5E65 A;  4ZPV R;  2LKN A;  2RSE A;  3PR9 A;  2AOS A;  1E6N A;  4MNM A;  4WKA A;  2QF8 A;  4Z2I A;  1FFQ A;  1ZL1 A;  3IKD A;  2RE3 A;  4ZPT R;  4R5E A;  3ALF A;  1M5Y A;  1X6L A;  1OGB A;  1UR9 A;  1LG2 A;  1EG3 A;  1E6P A;  2OLH A;  3ARU A;  1O6W A;  3WD4 A;  2M2A A;  4TYO A;  1XRV A;  1GRJ A;  4DRM A;  2Y8N B;  2N87 A;  4JFL A;  3LKX B;  2WLZ A;  1YAT A;  2PV1 A;  2UZ5 A;  4N19 A;  3ARZ A;  3ARS A;  2ZQV A;  4DRI A;  3G6M A;  2DJY A;  1BKF A;  2MNT A;  4Z2H A;  4L3N A;  5GQB A;  1WNO A;  1NWR A;  2XP3 A;  3NI6 A;  1E15 A;  2M8J A;  2A3A A;  4J4O A;  3ARO A;  2A3C A;  4TNS A;  2LJ4 A;  2WAD A;  4ODL A;  3WH0 A;  1ZU8 A;  1ZBK A;  1JND A;  3GU0 A;  4MNK A;  4TW6 A;  3FSC A;  4IQ2 A;  2DSW A;  1W1Y A;  2WK2 A;  5DIU A;  1Y0O A;  2XPB A;  2JX8 A;  1ZBC A;  2DG3 A;  1FAP A;  5E66 A;  2KGJ A;  1VF8 A;  4G2P A;  1J4I A;  2FAP A;  1KFW A;  2VN1 A;  4A0T A;  4U86 A;  2EZ5 W;  3O5F A;  3CH9 A;  1EYM A;  1FKL A;  3UQA A;  4GIV A;  4AY1 A;  3TCZ A;  4U85 A;  2F21 A;  3CGM A;  3QOK A;  1HXV A;  4HBO A;  3PRD A;  4Q22 A;  1NWT A;  3M7N A;  2ZQU A;  1WB0 A;  4DWS D;  2KO7 A;  2XP9 A;  3AQU A;  2BA1 A;  4QIB A;  4ODQ A;  2PPP A;  5DEZ A;  1RP5 A;  1EIB A;  1W1V A;  1W9V A;  3RM4 A;  1SYT A;  2DG4 A;  4DZ2 A;  1ROT A;  4NZC A;  4UDM A;  3TDB A;  2YSI A;  4JFI A;  5GPR A;  3UI4 A;  4Z2J A;  3AS1 A;  4IPX A;  3AS2 A;  1ZK6 A;  4G50 A;  2DT2 A;  1W9U A;  4GLX A;  3UI5 A;  2B5U B;  2DPE A;  3OA5 A;  4REX A;  4J4N A;  3B9E A;  3WD0 A;  4O2T A;  1HKI A;  4MNJ A;  1ROU A;  2YBU A;  3MQH A;  3UF8 A;  2WM0 A;  1D7J A;  1JNT A;  4TX0 A;  5BXJ A;  4JYS A;  1FD9 A;  2E45 A;  4LAV A;  4JFJ A;  2IF4 A;  5HTG A;  4ODO A;  1FKR A;  2G8Z A;  2XP4 A;  3ARP A;  4DRQ A;  3JYJ A;  3KZ7 A;  2ZR6 A;  2O9O A;  1BL4 A;  4P8W A;  2EUL A;  4MTV A;  1IX5 A;  1P5Q A;  5D75 A;  1O6I A;  3VAW A;  4WK9 A;  2PBC A;  2DSV A;  2M8I A;  4ODP A;  2ZR4 A;  3FSB A;  1ZB5 A;  3O5K A;  3W4R A;  1T11 A;  2DWV A;  3EIP A;  2LAJ A;  3B9A A;  3KAH A;  2DT1 A;  3OOB A;  1HKJ A;  3WD1 A;  1EQ3 A;  3AS0 A;  3RM8 A;  4C02 B;  4JFM A;  1Q6I A;  1NWU A;  4PTM A;  3ARX A;  4A0U A;  2PPN A;  2PV3 A;  3PQH A;  1E9L A;  5I98 A;  1QZ2 A;  3KAI A;  2DSU A;  3FY1 A;  4MPK A;  2KXQ A;  1FKS A;  1FKF A;  1SR0 A;  2IUZ A;  4HBE A;  1NSG A;  3WQV A;  5HW7 A;  5HW8 A;  4ODN A;  1C9H A;  2JMF A;  3H9R B;  2L4J A;  2JV4 A;  1J6Y A;  2KI3 A;  4LAY A;  2G41 A;  4P8V A;  1W1P A;  1D6O A;  2Q5A A;  3GPK A;  3ARR A;  4DH0 A;  1LL7 A;  5E64 A;  2WLY A;  2XP8 A;  1I5H W;  2OFN A;  1L1P A;  1LG1 A;  1LQ0 A;  4DWS A;  5JH8 A;  3B8S A;  2RQS A;  3WKZ A;  1D7I A;  4QZV B;  2RUC A;  1HJV A;  5HW6 A;  1GUV A;  1FKT A;  1D2K A;  4ZS6 A;  1B6C A;  5B8I C;  4MNL A;  4Z2G A;  3MQG A;  4IT6 A;  4WKH A;  3FAP A;  4FAP A;  3L4H A;  1FLC A;  4KR0 B;  2RUR A;  2ITK A;  4MGV A;  5HWC A;  3O5I A;  1JMQ A;  4P8X A;  1FKI A;  3MDY B;  3WL0 A;  4DRP A;  2M3O W;  2O92 A;  5HUA A;  1EHN A;  2L2S A;  3LKX A;  2OWO A;  2PI6 A;  3UQB A;  4W9P A;  1UR8 A;  2F2D A;  3WIJ A;  1TFV A;  4S3J A;  5AHT A;  2F23 A;  3WQW A;  2XP5 A;  3WD2 A;  2Y78 A;  3AS3 A;  1OWQ A;  4HAR A;  3IHZ A;  4DRK A;  1PIN A;  2KFW A;  3TC5 A;  3CHC A;  3O5M A;  3PA7 A;  4BF8 A;  1EG4 A;  1WMV A;  2XPA A;  3BXW A;  3IKG A;  5HBF A;  3O5E A;  1QPF A;  5CQ2 A;  3CGN A;  2XP7 A;  1Q1C A;  4DZ3 A;  2M08 A;  1LL6 A;  1TCO C;  2LGO A;  5E62 A;  4LAW A;  4NSB A;  4ODR A;  3RME A;  3ODK A;  1GPF A;  4DRN A;  4L72 B;  4E5R A;  2B31 A;  3B7X A;  2ETN A;  1ITX A;  2ZQS A;  1ZBV A;  4TW7 A;  2RUD A;  3O5G A;  5HT1 A;  4DT4 A;  3O5D A;  2KE0 A;  5DIT A;  4Z2K A;  2YSB A;  3GTY X;  3G6L A;  2ZAJ A;  3RGC A;  1FKB A;  3BMB A;  1W1T A;  2MLX A;  1ZCN A;  3CHF A;  1WAW A;  4MAV A;  2M1I A;  1NWS A;  5DF0 A;  1Q6H A;  2DK1 A;  1Q6U A;  2YSH A;  5J6E A;  3ARW A;  2F4E A;  2DK7 A;  4WIW A;  1W9P A;  4ODM A;  1FJD A;  1TR8 A;  3KAG A;  1K9T A;  3PRB A;  1R9H A;  1ZBW A;  3CZ8 A;  2DSZ A;  2ZR5 A;  2MPH A;  1HJX A;  3MCB A;  2QRV A;  4DWS C;  1J4H A;  2JXW A;  4QT3 A;  2PV2 A;  3KAC A;  1KT0 A;  3ALG A;  1K9Q A;  3NRK A;  4DRO A;  4NNR A;  3WL1 A; 
#chains in the Genus database with same CATH homology
 3CHE A;  4GGQ A;  1LL4 A;  1WR7 A;  1OGG A;  3ART A;  3RM9 A;  2JZV A;  3KAB A;  4WKF A;  1X6N A;  3KAF A;  2YSG A;  4R0X A;  1LJY A;  1TK7 A;  4LGX A;  4ML4 A;  4FN2 A;  2AWG A;  2A3E A;  3M85 A;  1HKM A;  1A7X A;  4DIP A;  3FS8 A;  1YW5 A;  2WAE A;  1N1A A;  1D7H A;  2YSF A;  4IT4 A;  4DRH A;  2DMV A;  1J4R A;  1K9R A;  3UI6 A;  3LE4 A;  3JYM A;  3O5L A;  2YBT A;  1FKD A;  4P8U A;  4QT2 A;  2MF9 A;  1CTN A;  3ARQ A;  1H0G A;  3KCE A;  1F8A B;  2PPO A;  5U47 A;  3EY6 A;  4ITZ A;  2D9F A;  2A3B A;  1NH6 A;  5GPG A;  3UQI A;  3O5R A;  2DT0 A;  1RD6 A;  3O5Q A;  2ESC A;  4W9O A;  1W26 A;  1JNE A;  2MLZ A;  3O5P A;  2YAJ B;  5E5W A;  4XAK A;  2FKE A;  4MSP A;  1GOI A;  5DO2 A;  4W5U A;  3NTP A;  2MDI A;  1NMV A;  5HWB A;  3KAD A;  1E6R A;  4JFK A;  4U84 A;  3I6C A;  4KQZ A;  2KR7 A;  1FFR A;  2ZQT A;  4WJX A;  3ARY A;  1FKH A;  1FKJ A;  2DG9 A;  4URI A;  1JNS A;  1U79 A;  4LAX A;  1FKK A;  3O5O A;  1FKG A;  3MCB B;  4ODK A;  3CHD A;  3WD3 A;  3RFW A;  2DT3 A;  2MLY A;  1JVW A;  3JXV A;  3FXY A;  2LPV A;  2K8I A;  1QPL A;  3O5J A;  1NMW A;  1PBK A;  3B9D A;  4ZPW R;  2FDM A;  1EDQ A;  1F40 A;  2XP6 A;  4IQC A;  4DRJ A;  2VCD A;  2RUQ A;  4Z2L A;  1E6Z A;  1H0I A;  4Q7N A;  3CNG A;  4TW8 A;  5HKG A;  5DIV A;  1HKK A;  4S3K A;  4DWS B;  3PRA A;  1HJW A;  3IK8 A;  4W9Q A;  1KT1 A;  3ARV A;  3LUO A;  1XHG A;  5E65 A;  4ZPV R;  2LKN A;  2RSE A;  3PR9 A;  2AOS A;  1E6N A;  4MNM A;  4WKA A;  2QF8 A;  4Z2I A;  1FFQ A;  1ZL1 A;  3IKD A;  2RE3 A;  4ZPT R;  4R5E A;  3ALF A;  1M5Y A;  1X6L A;  1OGB A;  1UR9 A;  1LG2 A;  1EG3 A;  1E6P A;  2OLH A;  3ARU A;  1O6W A;  3WD4 A;  2M2A A;  4TYO A;  1XRV A;  4DRM A;  2Y8N B;  2N87 A;  4JFL A;  3LKX B;  2WLZ A;  1YAT A;  2PV1 A;  2UZ5 A;  4N19 A;  3ARZ A;  3ARS A;  2ZQV A;  4DRI A;  3G6M A;  2DJY A;  1BKF A;  2MNT A;  4Z2H A;  4L3N A;  5GQB A;  1WNO A;  1NWR A;  2XP3 A;  3NI6 A;  1E15 A;  2M8J A;  2A3A A;  4J4O A;  3ARO A;  2A3C A;  4TNS A;  2LJ4 A;  2WAD A;  4ODL A;  3WH0 A;  1ZU8 A;  1ZBK A;  1JND A;  4MNK A;  4TW6 A;  3FSC A;  4IQ2 A;  2DSW A;  1W1Y A;  2WK2 A;  5DIU A;  1Y0O A;  2XPB A;  2JX8 A;  1ZBC A;  2DG3 A;  1FAP A;  5E66 A;  2KGJ A;  1VF8 A;  4G2P A;  1J4I A;  2FAP A;  1KFW A;  2VN1 A;  4A0T A;  4U86 A;  2EZ5 W;  3O5F A;  3CH9 A;  1EYM A;  1FKL A;  3UQA A;  4GIV A;  4AY1 A;  3TCZ A;  4U85 A;  2F21 A;  3CGM A;  3QOK A;  1HXV A;  4HBO A;  3PRD A;  4Q22 A;  1NWT A;  3M7N A;  2ZQU A;  1WB0 A;  4DWS D;  2KO7 A;  2XP9 A;  3AQU A;  2BA1 A;  4QIB A;  4ODQ A;  2PPP A;  5DEZ A;  1RP5 A;  1EIB A;  1W1V A;  1W9V A;  3RM4 A;  1SYT A;  2DG4 A;  4DZ2 A;  1ROT A;  4NZC A;  3TDB A;  2YSI A;  4JFI A;  5GPR A;  3UI4 A;  4Z2J A;  3AS1 A;  4IPX A;  3AS2 A;  1ZK6 A;  4G50 A;  2DT2 A;  1W9U A;  4GLX A;  3UI5 A;  2DPE A;  3OA5 A;  4REX A;  4J4N A;  3B9E A;  3WD0 A;  4O2T A;  1HKI A;  4MNJ A;  1ROU A;  2YBU A;  3MQH A;  3UF8 A;  2WM0 A;  1D7J A;  1JNT A;  4TX0 A;  5BXJ A;  4JYS A;  1FD9 A;  2E45 A;  4LAV A;  4JFJ A;  2IF4 A;  5HTG A;  4ODO A;  1FKR A;  2G8Z A;  2XP4 A;  3ARP A;  4DRQ A;  3JYJ A;  3KZ7 A;  2ZR6 A;  2O9O A;  1BL4 A;  4P8W A;  4MTV A;  1IX5 A;  1P5Q A;  5D75 A;  1O6I A;  3VAW A;  4WK9 A;  2PBC A;  2DSV A;  2M8I A;  4ODP A;  2ZR4 A;  3FSB A;  1ZB5 A;  3O5K A;  3W4R A;  1T11 A;  2DWV A;  2LAJ A;  3B9A A;  3KAH A;  2DT1 A;  3OOB A;  1HKJ A;  3WD1 A;  1EQ3 A;  3AS0 A;  3RM8 A;  4C02 B;  4JFM A;  1Q6I A;  1NWU A;  4PTM A;  3ARX A;  4A0U A;  2PPN A;  2PV3 A;  3PQH A;  1E9L A;  5I98 A;  1QZ2 A;  3KAI A;  2DSU A;  3FY1 A;  4MPK A;  2KXQ A;  1FKS A;  1FKF A;  1SR0 A;  2IUZ A;  4HBE A;  1NSG A;  3WQV A;  5HW7 A;  5HW8 A;  4ODN A;  1C9H A;  2JMF A;  3H9R B;  2L4J A;  2JV4 A;  1J6Y A;  2KI3 A;  4LAY A;  2G41 A;  4P8V A;  1W1P A;  1D6O A;  2Q5A A;  3GPK A;  3ARR A;  4DH0 A;  1LL7 A;  5E64 A;  2WLY A;  2XP8 A;  1I5H W;  2OFN A;  1L1P A;  1LG1 A;  1LQ0 A;  4DWS A;  5JH8 A;  3B8S A;  2RQS A;  3WKZ A;  1D7I A;  4QZV B;  2RUC A;  1HJV A;  5HW6 A;  1GUV A;  1FKT A;  1D2K A;  4ZS6 A;  1B6C A;  5B8I C;  4MNL A;  4Z2G A;  3MQG A;  4IT6 A;  4WKH A;  3FAP A;  4FAP A;  3L4H A;  1FLC A;  4KR0 B;  2RUR A;  2ITK A;  4MGV A;  5HWC A;  3O5I A;  1JMQ A;  4P8X A;  1FKI A;  3MDY B;  3WL0 A;  4DRP A;  2M3O W;  2O92 A;  5HUA A;  1EHN A;  2L2S A;  3LKX A;  2OWO A;  2PI6 A;  3UQB A;  4W9P A;  1UR8 A;  2F2D A;  3WIJ A;  1TFV A;  4S3J A;  5AHT A;  3WQW A;  2XP5 A;  3WD2 A;  2Y78 A;  3AS3 A;  1OWQ A;  4HAR A;  3IHZ A;  4DRK A;  1PIN A;  2KFW A;  3TC5 A;  3CHC A;  3O5M A;  3PA7 A;  4BF8 A;  1EG4 A;  1WMV A;  2XPA A;  3BXW A;  3IKG A;  5HBF A;  3O5E A;  1QPF A;  5CQ2 A;  3CGN A;  2XP7 A;  1Q1C A;  4DZ3 A;  2M08 A;  1LL6 A;  1TCO C;  2LGO A;  5E62 A;  4LAW A;  4NSB A;  4ODR A;  3RME A;  3ODK A;  1GPF A;  4DRN A;  4L72 B;  4E5R A;  2B31 A;  3B7X A;  1ITX A;  2ZQS A;  1ZBV A;  4TW7 A;  2RUD A;  3O5G A;  5HT1 A;  4DT4 A;  3O5D A;  2KE0 A;  5DIT A;  4Z2K A;  2YSB A;  3G6L A;  2ZAJ A;  3RGC A;  1FKB A;  1W1T A;  2MLX A;  1ZCN A;  3CHF A;  1WAW A;  4MAV A;  2M1I A;  1NWS A;  5DF0 A;  1Q6H A;  2DK1 A;  1Q6U A;  2YSH A;  5J6E A;  3ARW A;  2F4E A;  2DK7 A;  4WIW A;  1W9P A;  4ODM A;  1FJD A;  1TR8 A;  3KAG A;  1K9T A;  3PRB A;  1R9H A;  1ZBW A;  3CZ8 A;  2DSZ A;  2ZR5 A;  2MPH A;  1HJX A;  3MCB A;  2QRV A;  4DWS C;  1J4H A;  2JXW A;  4QT3 A;  2PV2 A;  3KAC A;  1KT0 A;  3ALG A;  1K9Q A;  3NRK A;  4DRO A;  4NNR A;  3WL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...