2DJYA

Solution structure of smurf2 ww3 domain-smad7 py peptide complex
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
42
structure length
42
Chain Sequence
GPLGSGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase/signaling protein
molecule keywords Smad ubiquitination regulatory factor 2
publication title An Expanded WW Domain Recognition Motif Revealed by the Interaction between Smad7 and the E3 Ubiquitin Ligase Smurf2.
pubmed doi rcsb
source organism Homo sapiens
total genus 3
structure length 42
sequence length 42
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2006-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2djyA01
4U85A 4REXA 1K9QA 2DJYA 1ZCNA 2M3OW 2ITKA 2F21A 2XPAA 2JXWA 2DMVA 3OOBA 2ZR4A 2YSBA 3LE4A 2XP5A 2M8JA 2XP9A 5AHTA 2LAJA 3TC5A 2XP4A 1K9RA 2YSFA 2JMFA 2XP8A 3KAGA 5CQ2A 2EZ5W 2YSGA 3KAHA 2XP6A 1TK7A 1JMQA 4QIBA 3TDBA 1NMVA 3KAIA 2M8IA 2RE3A 1O6WA 1I5HW 2DK7A 3ODKA 3CNGA 2KXQA 2ZAJA 4U86A 2XPBA 2XP3A 2ZQUA 1WR7A 3M7NA 1EG4A 2JX8A 3KADA 2L4JA 2DK1A 1YW5A 2YSIA 3L4HA 1PINA 2ZQVA 2ZQTA 3KABA 2BA1A 1F8AB 1WMVA 2JV4A 2ZR5A 2Q5AA 2MDIA 3KCEA 4E5RA 3NTPA 2DWVA 3TCZA 3KAFA 2ZR6A 4U84A 3M85A 2E45A 2YSHA 1EG3A 2ZQSA 2XP7A 3WH0A
chains in the Genus database with same CATH superfamily
4U85A 4REXA 1K9QA 2DJYA 1RP5A 1ZCNA 2M3OW 2ITKA 2F21A 5E65A 2XPAA 2JXWA 2DMVA 3OOBA 2ZR4A 2YSBA 3LE4A 2XP5A 5E64A 2Y8NB 2M8JA 2XP9A 5AHTA 2LAJA 3TC5A 2XP4A 1K9RA 3MQHA 2YSFA 3FSCA 2JMFA 2XP8A 3KAGA 5CQ2A 2EZ5W 5U47A 2YSGA 3KAHA 2XP6A 1TR8A 4A0TA 1TK7A 1JMQA 4QIBA 3TDBA 2OWOA 1NMVA 5E66A 3KAIA 2M8IA 2RE3A 3LKXB 1O6WA 1I5HW 2DK7A 3ODKA 3CNGA 2KXQA 2ZAJA 3MCBA 4U86A 2XPBA 4A0UA 2WAEA 2XP3A 2ZQUA 5E62A 1WR7A 2WADA 3M7NA 1EG4A 2JX8A 3KADA 3FSBA 2L4JA 2DK1A 4GLXA 5E5WA 1YW5A 2YSIA 1FLCA 3L4HA 3PQHA 3MQGA 3MCBB 1PINA 2ZQVA 2ZQTA 2QRVA 3KABA 2YAJB 2BA1A 1F8AB 1WMVA 3FS8A 2JV4A 2ZR5A 2Q5AA 2MDIA 3KCEA 4E5RA 3NTPA 2DWVA 3TCZA 3KAFA 2ZR6A 4U84A 3M85A 2E45A 2YSHA 3LKXA 1EG3A 2ZQSA 2XP7A 3WH0A
chains in the Genus database with same CATH topology
4U85A 4REXA 1K9QA 2DJYA 1RP5A 1ZCNA 2M3OW 2ITKA 2F21A 5E65A 2XPAA 2JXWA 2DMVA 3OOBA 2ZR4A 2YSBA 3LE4A 2XP5A 5E64A 2Y8NB 2M8JA 2XP9A 5AHTA 2LAJA 3TC5A 2XP4A 1K9RA 3MQHA 2YSFA 3FSCA 2JMFA 2XP8A 3KAGA 5CQ2A 2EZ5W 5U47A 2YSGA 3KAHA 2XP6A 1TR8A 4A0TA 1TK7A 1JMQA 4QIBA 3TDBA 2OWOA 1NMVA 5E66A 3KAIA 2M8IA 2RE3A 3LKXB 1O6WA 1I5HW 2DK7A 3ODKA 3CNGA 2KXQA 2ZAJA 3MCBA 4U86A 2XPBA 4A0UA 2WAEA 2XP3A 2ZQUA 5E62A 1WR7A 2WADA 3M7NA 1EG4A 2JX8A 3KADA 3FSBA 2L4JA 2DK1A 4GLXA 5E5WA 1YW5A 2YSIA 1FLCA 3L4HA 3PQHA 3MQGA 3MCBB 1PINA 2ZQVA 2ZQTA 2QRVA 3KABA 2YAJB 2BA1A 1F8AB 1WMVA 3FS8A 2JV4A 2ZR5A 2Q5AA 2MDIA 3KCEA 4E5RA 3NTPA 2DWVA 3TCZA 3KAFA 2ZR6A 4U84A 3M85A 2E45A 2YSHA 3LKXA 1EG3A 2ZQSA 2XP7A 3WH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U85 A;  4REX A;  1K9Q A;  2DJY A;  1ZCN A;  2M3O W;  2ITK A;  2F21 A;  2XPA A;  2JXW A;  2DMV A;  3OOB A;  2ZR4 A;  2YSB A;  3LE4 A;  2XP5 A;  2M8J A;  2XP9 A;  5AHT A;  2LAJ A;  3TC5 A;  2XP4 A;  1K9R A;  2YSF A;  2JMF A;  2XP8 A;  3KAG A;  5CQ2 A;  2EZ5 W;  2YSG A;  3KAH A;  2XP6 A;  1TK7 A;  1JMQ A;  4QIB A;  3TDB A;  1NMV A;  3KAI A;  2M8I A;  2RE3 A;  1O6W A;  1I5H W;  2DK7 A;  3ODK A;  3CNG A;  2KXQ A;  2ZAJ A;  4U86 A;  2XPB A;  2XP3 A;  2ZQU A;  1WR7 A;  3M7N A;  1EG4 A;  2JX8 A;  3KAD A;  2L4J A;  2DK1 A;  1YW5 A;  2YSI A;  3L4H A;  1PIN A;  2ZQV A;  2ZQT A;  3KAB A;  2BA1 A;  1F8A B;  1WMV A;  2JV4 A;  2ZR5 A;  2Q5A A;  2MDI A;  3KCE A;  4E5R A;  3NTP A;  2DWV A;  3TCZ A;  3KAF A;  2ZR6 A;  4U84 A;  3M85 A;  2E45 A;  2YSH A;  1EG3 A;  2ZQS A;  2XP7 A;  3WH0 A; 
#chains in the Genus database with same CATH topology
 4U85 A;  4REX A;  1K9Q A;  2DJY A;  1RP5 A;  1ZCN A;  2M3O W;  2ITK A;  2F21 A;  5E65 A;  2XPA A;  2JXW A;  2DMV A;  3OOB A;  2ZR4 A;  2YSB A;  3LE4 A;  2XP5 A;  5E64 A;  2Y8N B;  2M8J A;  2XP9 A;  5AHT A;  2LAJ A;  3TC5 A;  2XP4 A;  1K9R A;  3MQH A;  2YSF A;  3FSC A;  2JMF A;  2XP8 A;  3KAG A;  5CQ2 A;  2EZ5 W;  5U47 A;  2YSG A;  3KAH A;  2XP6 A;  1TR8 A;  4A0T A;  1TK7 A;  1JMQ A;  4QIB A;  3TDB A;  2OWO A;  1NMV A;  5E66 A;  3KAI A;  2M8I A;  2RE3 A;  3LKX B;  1O6W A;  1I5H W;  2DK7 A;  3ODK A;  3CNG A;  2KXQ A;  2ZAJ A;  3MCB A;  4U86 A;  2XPB A;  4A0U A;  2WAE A;  2XP3 A;  2ZQU A;  5E62 A;  1WR7 A;  2WAD A;  3M7N A;  1EG4 A;  2JX8 A;  3KAD A;  3FSB A;  2L4J A;  2DK1 A;  4GLX A;  5E5W A;  1YW5 A;  2YSI A;  1FLC A;  3L4H A;  3PQH A;  3MQG A;  3MCB B;  1PIN A;  2ZQV A;  2ZQT A;  2QRV A;  3KAB A;  2YAJ B;  2BA1 A;  1F8A B;  1WMV A;  3FS8 A;  2JV4 A;  2ZR5 A;  2Q5A A;  2MDI A;  3KCE A;  4E5R A;  3NTP A;  2DWV A;  3TCZ A;  3KAF A;  2ZR6 A;  4U84 A;  3M85 A;  2E45 A;  2YSH A;  3LKX A;  1EG3 A;  2ZQS A;  2XP7 A;  3WH0 A; 
#chains in the Genus database with same CATH homology
 4U85 A;  4REX A;  1K9Q A;  2DJY A;  1RP5 A;  1ZCN A;  2M3O W;  2ITK A;  2F21 A;  5E65 A;  2XPA A;  2JXW A;  2DMV A;  3OOB A;  2ZR4 A;  2YSB A;  3LE4 A;  2XP5 A;  5E64 A;  2Y8N B;  2M8J A;  2XP9 A;  5AHT A;  2LAJ A;  3TC5 A;  2XP4 A;  1K9R A;  3MQH A;  2YSF A;  3FSC A;  2JMF A;  2XP8 A;  3KAG A;  5CQ2 A;  2EZ5 W;  5U47 A;  2YSG A;  3KAH A;  2XP6 A;  1TR8 A;  4A0T A;  1TK7 A;  1JMQ A;  4QIB A;  3TDB A;  2OWO A;  1NMV A;  5E66 A;  3KAI A;  2M8I A;  2RE3 A;  3LKX B;  1O6W A;  1I5H W;  2DK7 A;  3ODK A;  3CNG A;  2KXQ A;  2ZAJ A;  3MCB A;  4U86 A;  2XPB A;  4A0U A;  2WAE A;  2XP3 A;  2ZQU A;  5E62 A;  1WR7 A;  2WAD A;  3M7N A;  1EG4 A;  2JX8 A;  3KAD A;  3FSB A;  2L4J A;  2DK1 A;  4GLX A;  5E5W A;  1YW5 A;  2YSI A;  1FLC A;  3L4H A;  3PQH A;  3MQG A;  3MCB B;  1PIN A;  2ZQV A;  2ZQT A;  2QRV A;  3KAB A;  2YAJ B;  2BA1 A;  1F8A B;  1WMV A;  3FS8 A;  2JV4 A;  2ZR5 A;  2Q5A A;  2MDI A;  3KCE A;  4E5R A;  3NTP A;  2DWV A;  3TCZ A;  3KAF A;  2ZR6 A;  4U84 A;  3M85 A;  2E45 A;  2YSH A;  3LKX A;  1EG3 A;  2ZQS A;  2XP7 A;  3WH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...