2DJYA

Solution structure of smurf2 ww3 domain-smad7 py peptide complex
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
42
structure length
42
Chain Sequence
GPLGSGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Smad ubiquitination regulatory factor 2
publication title An Expanded WW Domain Recognition Motif Revealed by the Interaction between Smad7 and the E3 Ubiquitin Ligase Smurf2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/signaling protein
total genus 3
structure length 42
sequence length 42
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2006-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2djyA01
3M85A 2ZQSA 1YW5A 2YSIA 2KXQA 2JMFA 2XP5A 3KAHA 3CNGA 2XPBA 2ZR5A 2RE3A 2ZQTA 3KAGA 4U86A 2YSGA 2XP4A 3KAIA 3KAFA 1NMVA 3L4HA 3KABA 2XP8A 2Q5AA 2XPAA 2F21A 1F8AB 2ITKA 3NTPA 1ZCNA 2ZR4A 2XP7A 2ZQVA 5AHTA 1JMQA 2YSBA 2ZR6A 5CQ2A 2M3OW 3ODKA 4U85A 2LAJA 2ZAJA 3OOBA 2JX8A 2XP9A 2BA1A 1WMVA 3TDBA 3WH0A 2XP6A 2ZQUA 1EG4A 2DK1A 1K9RA 2DK7A 3KADA 3LE4A 1EG3A 2MDIA 4U84A 1PINA 1WR7A 2DWVA 4REXA 1I5HW 2XP3A 2DJYA 3TC5A 3TCZA 1TK7A 2L4JA 2DMVA 2E45A 2M8IA 3M7NA 1K9QA 2YSFA 4E5RA 2EZ5W 2YSHA 3KCEA 4QIBA 2JXWA 1O6WA 2JV4A 2M8JA
chains in the Genus database with same CATH superfamily
3M85A 2ZQSA 5E65A 4A0UA 1YW5A 2YSIA 2KXQA 2JMFA 3LKXB 2XP5A 3KAHA 3PQHA 3CNGA 2XPBA 2ZR5A 2RE3A 5U47A 2ZQTA 3KAGA 4U86A 2YSGA 3MCBB 2XP4A 3KAIA 3LKXA 3KAFA 5E66A 1NMVA 3L4HA 3KABA 2XP8A 2Q5AA 2XPAA 2QRVA 5E5WA 2F21A 1F8AB 4GLXA 2ITKA 3NTPA 3MCBA 1ZCNA 3MQGA 2ZR4A 2XP7A 2ZQVA 5AHTA 1FLCA 1JMQA 2OWOA 2YAJB 2YSBA 2ZR6A 5CQ2A 2M3OW 2WADA 3MQHA 3ODKA 4U85A 4A0TA 2WAEA 2LAJA 2ZAJA 3OOBA 2JX8A 2XP9A 2BA1A 1WMVA 3TDBA 5E62A 3WH0A 2XP6A 2ZQUA 5E64A 1EG4A 2DK1A 1K9RA 2DK7A 3KADA 3LE4A 1EG3A 2MDIA 3FSCA 4U84A 1PINA 1WR7A 3FSBA 2DWVA 4REXA 1I5HW 2XP3A 2DJYA 3TC5A 3TCZA 1TK7A 2L4JA 2DMVA 2E45A 2M8IA 3M7NA 1K9QA 3FS8A 2YSFA 4E5RA 1TR8A 1RP5A 2EZ5W 2YSHA 3KCEA 4QIBA 2JXWA 1O6WA 2Y8NB 2JV4A 2M8JA
chains in the Genus database with same CATH topology
3M85A 2ZQSA 5E65A 4A0UA 1YW5A 2YSIA 2KXQA 2JMFA 3LKXB 2XP5A 3KAHA 3PQHA 3CNGA 2XPBA 2ZR5A 2RE3A 5U47A 2ZQTA 3KAGA 4U86A 2YSGA 3MCBB 2XP4A 3KAIA 3LKXA 3KAFA 5E66A 1NMVA 3L4HA 3KABA 2XP8A 2Q5AA 2XPAA 2QRVA 5E5WA 2F21A 1F8AB 4GLXA 2ITKA 3NTPA 3MCBA 1ZCNA 3MQGA 2ZR4A 2XP7A 2ZQVA 5AHTA 1FLCA 1JMQA 2OWOA 2YAJB 2YSBA 2ZR6A 5CQ2A 2M3OW 2WADA 3MQHA 3ODKA 4U85A 4A0TA 2WAEA 2LAJA 2ZAJA 3OOBA 2JX8A 2XP9A 2BA1A 1WMVA 3TDBA 5E62A 3WH0A 2XP6A 2ZQUA 5E64A 1EG4A 2DK1A 1K9RA 2DK7A 3KADA 3LE4A 1EG3A 2MDIA 3FSCA 4U84A 1PINA 1WR7A 3FSBA 2DWVA 4REXA 1I5HW 2XP3A 2DJYA 3TC5A 3TCZA 1TK7A 2L4JA 2DMVA 2E45A 2M8IA 3M7NA 1K9QA 3FS8A 2YSFA 4E5RA 1TR8A 1RP5A 2EZ5W 2YSHA 3KCEA 4QIBA 2JXWA 1O6WA 2Y8NB 2JV4A 2M8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M85 A;  2ZQS A;  1YW5 A;  2YSI A;  2KXQ A;  2JMF A;  2XP5 A;  3KAH A;  3CNG A;  2XPB A;  2ZR5 A;  2RE3 A;  2ZQT A;  3KAG A;  4U86 A;  2YSG A;  2XP4 A;  3KAI A;  3KAF A;  1NMV A;  3L4H A;  3KAB A;  2XP8 A;  2Q5A A;  2XPA A;  2F21 A;  1F8A B;  2ITK A;  3NTP A;  1ZCN A;  2ZR4 A;  2XP7 A;  2ZQV A;  5AHT A;  1JMQ A;  2YSB A;  2ZR6 A;  5CQ2 A;  2M3O W;  3ODK A;  4U85 A;  2LAJ A;  2ZAJ A;  3OOB A;  2JX8 A;  2XP9 A;  2BA1 A;  1WMV A;  3TDB A;  3WH0 A;  2XP6 A;  2ZQU A;  1EG4 A;  2DK1 A;  1K9R A;  2DK7 A;  3KAD A;  3LE4 A;  1EG3 A;  2MDI A;  4U84 A;  1PIN A;  1WR7 A;  2DWV A;  4REX A;  1I5H W;  2XP3 A;  2DJY A;  3TC5 A;  3TCZ A;  1TK7 A;  2L4J A;  2DMV A;  2E45 A;  2M8I A;  3M7N A;  1K9Q A;  2YSF A;  4E5R A;  2EZ5 W;  2YSH A;  3KCE A;  4QIB A;  2JXW A;  1O6W A;  2JV4 A;  2M8J A; 
#chains in the Genus database with same CATH topology
 3M85 A;  2ZQS A;  5E65 A;  4A0U A;  1YW5 A;  2YSI A;  2KXQ A;  2JMF A;  3LKX B;  2XP5 A;  3KAH A;  3PQH A;  3CNG A;  2XPB A;  2ZR5 A;  2RE3 A;  5U47 A;  2ZQT A;  3KAG A;  4U86 A;  2YSG A;  3MCB B;  2XP4 A;  3KAI A;  3LKX A;  3KAF A;  5E66 A;  1NMV A;  3L4H A;  3KAB A;  2XP8 A;  2Q5A A;  2XPA A;  2QRV A;  5E5W A;  2F21 A;  1F8A B;  4GLX A;  2ITK A;  3NTP A;  3MCB A;  1ZCN A;  3MQG A;  2ZR4 A;  2XP7 A;  2ZQV A;  5AHT A;  1FLC A;  1JMQ A;  2OWO A;  2YAJ B;  2YSB A;  2ZR6 A;  5CQ2 A;  2M3O W;  2WAD A;  3MQH A;  3ODK A;  4U85 A;  4A0T A;  2WAE A;  2LAJ A;  2ZAJ A;  3OOB A;  2JX8 A;  2XP9 A;  2BA1 A;  1WMV A;  3TDB A;  5E62 A;  3WH0 A;  2XP6 A;  2ZQU A;  5E64 A;  1EG4 A;  2DK1 A;  1K9R A;  2DK7 A;  3KAD A;  3LE4 A;  1EG3 A;  2MDI A;  3FSC A;  4U84 A;  1PIN A;  1WR7 A;  3FSB A;  2DWV A;  4REX A;  1I5H W;  2XP3 A;  2DJY A;  3TC5 A;  3TCZ A;  1TK7 A;  2L4J A;  2DMV A;  2E45 A;  2M8I A;  3M7N A;  1K9Q A;  3FS8 A;  2YSF A;  4E5R A;  1TR8 A;  1RP5 A;  2EZ5 W;  2YSH A;  3KCE A;  4QIB A;  2JXW A;  1O6W A;  2Y8N B;  2JV4 A;  2M8J A; 
#chains in the Genus database with same CATH homology
 3M85 A;  2ZQS A;  5E65 A;  4A0U A;  1YW5 A;  2YSI A;  2KXQ A;  2JMF A;  3LKX B;  2XP5 A;  3KAH A;  3PQH A;  3CNG A;  2XPB A;  2ZR5 A;  2RE3 A;  5U47 A;  2ZQT A;  3KAG A;  4U86 A;  2YSG A;  3MCB B;  2XP4 A;  3KAI A;  3LKX A;  3KAF A;  5E66 A;  1NMV A;  3L4H A;  3KAB A;  2XP8 A;  2Q5A A;  2XPA A;  2QRV A;  5E5W A;  2F21 A;  1F8A B;  4GLX A;  2ITK A;  3NTP A;  3MCB A;  1ZCN A;  3MQG A;  2ZR4 A;  2XP7 A;  2ZQV A;  5AHT A;  1FLC A;  1JMQ A;  2OWO A;  2YAJ B;  2YSB A;  2ZR6 A;  5CQ2 A;  2M3O W;  2WAD A;  3MQH A;  3ODK A;  4U85 A;  4A0T A;  2WAE A;  2LAJ A;  2ZAJ A;  3OOB A;  2JX8 A;  2XP9 A;  2BA1 A;  1WMV A;  3TDB A;  5E62 A;  3WH0 A;  2XP6 A;  2ZQU A;  5E64 A;  1EG4 A;  2DK1 A;  1K9R A;  2DK7 A;  3KAD A;  3LE4 A;  1EG3 A;  2MDI A;  3FSC A;  4U84 A;  1PIN A;  1WR7 A;  3FSB A;  2DWV A;  4REX A;  1I5H W;  2XP3 A;  2DJY A;  3TC5 A;  3TCZ A;  1TK7 A;  2L4J A;  2DMV A;  2E45 A;  2M8I A;  3M7N A;  1K9Q A;  3FS8 A;  2YSF A;  4E5R A;  1TR8 A;  1RP5 A;  2EZ5 W;  2YSH A;  3KCE A;  4QIB A;  2JXW A;  1O6W A;  2Y8N B;  2JV4 A;  2M8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...