1WMVA

Solution structure of the second ww domain of wwox
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
54
structure length
54
Chain Sequence
GSAKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WW domain containing oxidoreductase
publication title Solution structure of the second WW domain of WWOX
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase, apoptosis
total genus 5
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2004-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1wmvA01
2LAJA 2XPBA 4U85A 3TDBA 1O6WA 3KADA 2DK1A 2JXWA 2DMVA 2XP4A 2ZQSA 2KXQA 1NMVA 3KCEA 2M8JA 3M7NA 4E5RA 1K9RA 2JX8A 1EG3A 2ZQVA 2YSFA 2M3OW 2Q5AA 3KAGA 2L4JA 2M8IA 2ZR5A 2XP7A 3CNGA 2ZR4A 3NTPA 2JV4A 2YSHA 1PINA 2ZQUA 4U86A 2XP5A 4QIBA 4REXA 2YSGA 3LE4A 5CQ2A 2YSBA 2XP8A 2ITKA 3TC5A 2DJYA 3KAIA 1JMQA 1I5HW 3L4HA 2DWVA 2BA1A 3KABA 3TCZA 1WR7A 1WMVA 2XP6A 2ZQTA 5AHTA 3M85A 2XP3A 2RE3A 2DK7A 1K9QA 3KAHA 1F8AB 4U84A 2YSIA 2ZR6A 2XP9A 3OOBA 2F21A 2XPAA 3KAFA 2ZAJA 1YW5A 1TK7A 2E45A 2MDIA 1ZCNA 3ODKA 1EG4A 3WH0A 2EZ5W 2JMFA
chains in the Genus database with same CATH superfamily
2LAJA 2XPBA 4U85A 3TDBA 1O6WA 5U47A 3KADA 3FSBA 2DK1A 2JXWA 2DMVA 2XP4A 1TR8A 2Y8NB 2ZQSA 3MCBA 2KXQA 1NMVA 3KCEA 2M8JA 4A0TA 3M7NA 4E5RA 1K9RA 2JX8A 1EG3A 2ZQVA 2YSFA 2M3OW 2Q5AA 3KAGA 2L4JA 2M8IA 2ZR5A 2QRVA 2XP7A 3CNGA 3MCBB 1RP5A 2ZR4A 3MQGA 3NTPA 5E5WA 2JV4A 2YSHA 1PINA 2ZQUA 4U86A 2XP5A 2WAEA 4QIBA 4REXA 2YSGA 3LE4A 3PQHA 5CQ2A 2YSBA 2XP8A 3MQHA 2ITKA 3TC5A 2DJYA 1FLCA 3KAIA 1JMQA 1I5HW 2WADA 3L4HA 2DWVA 2BA1A 3KABA 3TCZA 4A0UA 1WR7A 1WMVA 2XP6A 4GLXA 2ZQTA 5AHTA 5E66A 3M85A 2XP3A 2RE3A 5E62A 2YAJB 2OWOA 2DK7A 3FS8A 1K9QA 3KAHA 1F8AB 4U84A 3LKXA 3FSCA 2YSIA 2ZR6A 2XP9A 3OOBA 2F21A 2XPAA 3KAFA 2ZAJA 1YW5A 1TK7A 2E45A 5E65A 2MDIA 1ZCNA 3ODKA 1EG4A 5E64A 3WH0A 3LKXB 2EZ5W 2JMFA
chains in the Genus database with same CATH topology
2LAJA 2XPBA 4U85A 3TDBA 1O6WA 5U47A 3KADA 3FSBA 2DK1A 2JXWA 2DMVA 2XP4A 1TR8A 2Y8NB 2ZQSA 3MCBA 2KXQA 1NMVA 3KCEA 2M8JA 4A0TA 3M7NA 4E5RA 1K9RA 2JX8A 1EG3A 2ZQVA 2YSFA 2M3OW 2Q5AA 3KAGA 2L4JA 2M8IA 2ZR5A 2QRVA 2XP7A 3CNGA 3MCBB 1RP5A 2ZR4A 3MQGA 3NTPA 5E5WA 2JV4A 2YSHA 1PINA 2ZQUA 4U86A 2XP5A 2WAEA 4QIBA 4REXA 2YSGA 3LE4A 3PQHA 5CQ2A 2YSBA 2XP8A 3MQHA 2ITKA 3TC5A 2DJYA 1FLCA 3KAIA 1JMQA 1I5HW 2WADA 3L4HA 2DWVA 2BA1A 3KABA 3TCZA 4A0UA 1WR7A 1WMVA 2XP6A 4GLXA 2ZQTA 5AHTA 5E66A 3M85A 2XP3A 2RE3A 5E62A 2YAJB 2OWOA 2DK7A 3FS8A 1K9QA 3KAHA 1F8AB 4U84A 3LKXA 3FSCA 2YSIA 2ZR6A 2XP9A 3OOBA 2F21A 2XPAA 3KAFA 2ZAJA 1YW5A 1TK7A 2E45A 5E65A 2MDIA 1ZCNA 3ODKA 1EG4A 5E64A 3WH0A 3LKXB 2EZ5W 2JMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LAJ A;  2XPB A;  4U85 A;  3TDB A;  1O6W A;  3KAD A;  2DK1 A;  2JXW A;  2DMV A;  2XP4 A;  2ZQS A;  2KXQ A;  1NMV A;  3KCE A;  2M8J A;  3M7N A;  4E5R A;  1K9R A;  2JX8 A;  1EG3 A;  2ZQV A;  2YSF A;  2M3O W;  2Q5A A;  3KAG A;  2L4J A;  2M8I A;  2ZR5 A;  2XP7 A;  3CNG A;  2ZR4 A;  3NTP A;  2JV4 A;  2YSH A;  1PIN A;  2ZQU A;  4U86 A;  2XP5 A;  4QIB A;  4REX A;  2YSG A;  3LE4 A;  5CQ2 A;  2YSB A;  2XP8 A;  2ITK A;  3TC5 A;  2DJY A;  3KAI A;  1JMQ A;  1I5H W;  3L4H A;  2DWV A;  2BA1 A;  3KAB A;  3TCZ A;  1WR7 A;  1WMV A;  2XP6 A;  2ZQT A;  5AHT A;  3M85 A;  2XP3 A;  2RE3 A;  2DK7 A;  1K9Q A;  3KAH A;  1F8A B;  4U84 A;  2YSI A;  2ZR6 A;  2XP9 A;  3OOB A;  2F21 A;  2XPA A;  3KAF A;  2ZAJ A;  1YW5 A;  1TK7 A;  2E45 A;  2MDI A;  1ZCN A;  3ODK A;  1EG4 A;  3WH0 A;  2EZ5 W;  2JMF A; 
#chains in the Genus database with same CATH topology
 2LAJ A;  2XPB A;  4U85 A;  3TDB A;  1O6W A;  5U47 A;  3KAD A;  3FSB A;  2DK1 A;  2JXW A;  2DMV A;  2XP4 A;  1TR8 A;  2Y8N B;  2ZQS A;  3MCB A;  2KXQ A;  1NMV A;  3KCE A;  2M8J A;  4A0T A;  3M7N A;  4E5R A;  1K9R A;  2JX8 A;  1EG3 A;  2ZQV A;  2YSF A;  2M3O W;  2Q5A A;  3KAG A;  2L4J A;  2M8I A;  2ZR5 A;  2QRV A;  2XP7 A;  3CNG A;  3MCB B;  1RP5 A;  2ZR4 A;  3MQG A;  3NTP A;  5E5W A;  2JV4 A;  2YSH A;  1PIN A;  2ZQU A;  4U86 A;  2XP5 A;  2WAE A;  4QIB A;  4REX A;  2YSG A;  3LE4 A;  3PQH A;  5CQ2 A;  2YSB A;  2XP8 A;  3MQH A;  2ITK A;  3TC5 A;  2DJY A;  1FLC A;  3KAI A;  1JMQ A;  1I5H W;  2WAD A;  3L4H A;  2DWV A;  2BA1 A;  3KAB A;  3TCZ A;  4A0U A;  1WR7 A;  1WMV A;  2XP6 A;  4GLX A;  2ZQT A;  5AHT A;  5E66 A;  3M85 A;  2XP3 A;  2RE3 A;  5E62 A;  2YAJ B;  2OWO A;  2DK7 A;  3FS8 A;  1K9Q A;  3KAH A;  1F8A B;  4U84 A;  3LKX A;  3FSC A;  2YSI A;  2ZR6 A;  2XP9 A;  3OOB A;  2F21 A;  2XPA A;  3KAF A;  2ZAJ A;  1YW5 A;  1TK7 A;  2E45 A;  5E65 A;  2MDI A;  1ZCN A;  3ODK A;  1EG4 A;  5E64 A;  3WH0 A;  3LKX B;  2EZ5 W;  2JMF A; 
#chains in the Genus database with same CATH homology
 2LAJ A;  2XPB A;  4U85 A;  3TDB A;  1O6W A;  5U47 A;  3KAD A;  3FSB A;  2DK1 A;  2JXW A;  2DMV A;  2XP4 A;  1TR8 A;  2Y8N B;  2ZQS A;  3MCB A;  2KXQ A;  1NMV A;  3KCE A;  2M8J A;  4A0T A;  3M7N A;  4E5R A;  1K9R A;  2JX8 A;  1EG3 A;  2ZQV A;  2YSF A;  2M3O W;  2Q5A A;  3KAG A;  2L4J A;  2M8I A;  2ZR5 A;  2QRV A;  2XP7 A;  3CNG A;  3MCB B;  1RP5 A;  2ZR4 A;  3MQG A;  3NTP A;  5E5W A;  2JV4 A;  2YSH A;  1PIN A;  2ZQU A;  4U86 A;  2XP5 A;  2WAE A;  4QIB A;  4REX A;  2YSG A;  3LE4 A;  3PQH A;  5CQ2 A;  2YSB A;  2XP8 A;  3MQH A;  2ITK A;  3TC5 A;  2DJY A;  1FLC A;  3KAI A;  1JMQ A;  1I5H W;  2WAD A;  3L4H A;  2DWV A;  2BA1 A;  3KAB A;  3TCZ A;  4A0U A;  1WR7 A;  1WMV A;  2XP6 A;  4GLX A;  2ZQT A;  5AHT A;  5E66 A;  3M85 A;  2XP3 A;  2RE3 A;  5E62 A;  2YAJ B;  2OWO A;  2DK7 A;  3FS8 A;  1K9Q A;  3KAH A;  1F8A B;  4U84 A;  3LKX A;  3FSC A;  2YSI A;  2ZR6 A;  2XP9 A;  3OOB A;  2F21 A;  2XPA A;  3KAF A;  2ZAJ A;  1YW5 A;  1TK7 A;  2E45 A;  5E65 A;  2MDI A;  1ZCN A;  3ODK A;  1EG4 A;  5E64 A;  3WH0 A;  3LKX B;  2EZ5 W;  2JMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...