The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
3
|
sequence length |
42
|
structure length |
42
|
Chain Sequence |
GPLGSGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSAN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
An Expanded WW Domain Recognition Motif Revealed by the Interaction between Smad7 and the E3 Ubiquitin Ligase Smurf2.
pubmed doi rcsb |
molecule keywords |
Smad ubiquitination regulatory factor 2
|
molecule tags |
Ligase/signaling protein
|
source organism |
Homo sapiens
|
total genus |
3
|
structure length |
42
|
sequence length |
42
|
ec nomenclature |
ec
2.3.2.26: HECT-type E3 ubiquitin transferase. |
pdb deposition date | 2006-04-06 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00397 | WW | WW domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Single Sheet | Ubiquitin Ligase Nedd4; Chain: W; | Ubiquitin Ligase Nedd4; Chain: W; |
#chains in the Genus database with same CATH superfamily 2JXW A; 2F21 A; 3LE4 A; 2XP9 A; 1NMV A; 2YSG A; 2M3O W; 3NTP A; 1K9R A; 4REX A; 2M8I A; 2DK1 A; 2ITK A; 2DWV A; 3OOB A; 2YSB A; 1PIN A; 1I5H W; 2JV4 A; 3KCE A; 2LAJ A; 1K9Q A; 2KXQ A; 3KAD A; 5AHT A; 2YSH A; 2ZAJ A; 1JMQ A; 3TC5 A; 2ZQS A; 2XP8 A; 2ZQV A; 3TCZ A; 2XP6 A; 3KAB A; 2BA1 A; 3TDB A; 2EZ5 W; 2XP4 A; 3ODK A; 1O6W A; 2JMF A; 2XP3 A; 2Q5A A; 2RE3 A; 2YSF A; 1YW5 A; 2XPB A; 3CNG A; 1EG3 A; 2M8J A; 2ZR6 A; 1TK7 A; 3L4H A; 3KAF A; 4E5R A; 3KAI A; 4U84 A; 1F8A B; 2L4J A; 4U86 A; 2MDI A; 3KAH A; 1WR7 A; 2ZQT A; 3WH0 A; 2ZR5 A; 2E45 A; 2ZR4 A; 2XP7 A; 2DK7 A; 3KAG A; 3M85 A; 3M7N A; 4QIB A; 4U85 A; 1ZCN A; 2JX8 A; 2YSI A; 2XPA A; 2ZQU A; 1WMV A; 2XP5 A; 5CQ2 A; 1EG4 A; 2DJY A; 2DMV A; #chains in the Genus database with same CATH topology 1FLC A; 2JXW A; 3LKX A; 3MQH A; 2F21 A; 3LE4 A; 2XP9 A; 3FSB A; 1NMV A; 2YSG A; 3MCB B; 2M3O W; 3NTP A; 2YAJ B; 1K9R A; 4REX A; 2M8I A; 2DK1 A; 2ITK A; 2DWV A; 3OOB A; 2YSB A; 1PIN A; 2QRV A; 5U47 A; 1I5H W; 2JV4 A; 3KCE A; 2LAJ A; 1K9Q A; 2KXQ A; 3KAD A; 5AHT A; 5E62 A; 2YSH A; 2ZAJ A; 1JMQ A; 3TC5 A; 1RP5 A; 2ZQS A; 2XP8 A; 2ZQV A; 3TCZ A; 4A0U A; 2XP6 A; 3KAB A; 2BA1 A; 3LKX B; 3TDB A; 2EZ5 W; 2XP4 A; 1TR8 A; 3ODK A; 3PQH A; 1O6W A; 2JMF A; 2XP3 A; 2Q5A A; 3FSC A; 5E5W A; 2RE3 A; 2YSF A; 1YW5 A; 2XPB A; 3CNG A; 5E66 A; 1EG3 A; 2M8J A; 2ZR6 A; 5E64 A; 1TK7 A; 3L4H A; 3KAF A; 4E5R A; 3FS8 A; 3KAI A; 4U84 A; 1F8A B; 2L4J A; 4U86 A; 2MDI A; 3KAH A; 1WR7 A; 2ZQT A; 3WH0 A; 2WAD A; 2ZR5 A; 4GLX A; 2E45 A; 2ZR4 A; 2XP7 A; 4A0T A; 2DK7 A; 3MQG A; 3KAG A; 3M85 A; 3M7N A; 4QIB A; 2OWO A; 4U85 A; 1ZCN A; 2JX8 A; 2YSI A; 2XPA A; 2ZQU A; 1WMV A; 2XP5 A; 3MCB A; 5E65 A; 5CQ2 A; 1EG4 A; 2DJY A; 2DMV A; 2WAE A; 2Y8N B; #chains in the Genus database with same CATH homology 1FLC A; 2JXW A; 3LKX A; 3MQH A; 2F21 A; 3LE4 A; 2XP9 A; 3FSB A; 1NMV A; 2YSG A; 3MCB B; 2M3O W; 3NTP A; 2YAJ B; 1K9R A; 4REX A; 2M8I A; 2DK1 A; 2ITK A; 2DWV A; 3OOB A; 2YSB A; 1PIN A; 2QRV A; 5U47 A; 1I5H W; 2JV4 A; 3KCE A; 2LAJ A; 1K9Q A; 2KXQ A; 3KAD A; 5AHT A; 5E62 A; 2YSH A; 2ZAJ A; 1JMQ A; 3TC5 A; 1RP5 A; 2ZQS A; 2XP8 A; 2ZQV A; 3TCZ A; 4A0U A; 2XP6 A; 3KAB A; 2BA1 A; 3LKX B; 3TDB A; 2EZ5 W; 2XP4 A; 1TR8 A; 3ODK A; 3PQH A; 1O6W A; 2JMF A; 2XP3 A; 2Q5A A; 3FSC A; 5E5W A; 2RE3 A; 2YSF A; 1YW5 A; 2XPB A; 3CNG A; 5E66 A; 1EG3 A; 2M8J A; 2ZR6 A; 5E64 A; 1TK7 A; 3L4H A; 3KAF A; 4E5R A; 3FS8 A; 3KAI A; 4U84 A; 1F8A B; 2L4J A; 4U86 A; 2MDI A; 3KAH A; 1WR7 A; 2ZQT A; 3WH0 A; 2WAD A; 2ZR5 A; 4GLX A; 2E45 A; 2ZR4 A; 2XP7 A; 4A0T A; 2DK7 A; 3MQG A; 3KAG A; 3M85 A; 3M7N A; 4QIB A; 2OWO A; 4U85 A; 1ZCN A; 2JX8 A; 2YSI A; 2XPA A; 2ZQU A; 1WMV A; 2XP5 A; 3MCB A; 5E65 A; 5CQ2 A; 1EG4 A; 2DJY A; 2DMV A; 2WAE A; 2Y8N B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...