The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
10
|
sequence length |
66
|
structure length |
65
|
Chain Sequence |
VNNISGIEEVNMFTNQGTVIHFNNPKVQASLANTFTITGHAETKQLTEMLPSILNQLGADSLTSL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
The crystal structure of the human nascent polypeptide-associated complex domain reveals a nucleic acid-binding region on the NACA subunit
pubmed doi rcsb |
molecule tags |
Chaperone
|
source organism |
Homo sapiens
|
molecule keywords |
Transcription factor BTF3
|
total genus |
10
|
structure length |
65
|
sequence length |
66
|
ec nomenclature | |
pdb deposition date | 2010-01-28 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Single Sheet | Ubiquitin Ligase Nedd4; Chain: W; | Ubiquitin Ligase Nedd4; Chain: W; |
#chains in the Genus database with same CATH superfamily 1TR8 A; 3LKX B; 3LKX A; 3MCB B; 3MCB A; #chains in the Genus database with same CATH topology 2M8I A; 2YSH A; 2ZQU A; 5CQ2 A; 5E5W A; 2WAD A; 2XP9 A; 2ZQT A; 4U85 A; 2EZ5 W; 2XP3 A; 2KXQ A; 2Y8N B; 2ZR5 A; 2M8J A; 2JXW A; 2BA1 A; 3CNG A; 4U84 A; 3KAF A; 2WAE A; 3FSB A; 2YSI A; 3LKX A; 5AHT A; 2DJY A; 3KCE A; 1PIN A; 1I5H W; 2YAJ B; 1FLC A; 3LE4 A; 2XP5 A; 2YSF A; 2ZQS A; 1RP5 A; 2ZR6 A; 5E64 A; 2XPA A; 2QRV A; 2Q5A A; 2XP4 A; 4U86 A; 3KAH A; 4A0U A; 1JMQ A; 3LKX B; 4E5R A; 1K9R A; 3KAB A; 3KAG A; 2XP7 A; 2JMF A; 3KAI A; 2ITK A; 5E66 A; 2M3O W; 1TK7 A; 2XPB A; 1NMV A; 4REX A; 1O6W A; 5E62 A; 1EG4 A; 4A0T A; 3WH0 A; 2XP8 A; 1ZCN A; 3M7N A; 1EG3 A; 3PQH A; 2DWV A; 2YSB A; 3ODK A; 2DMV A; 2JX8 A; 2YSG A; 2XP6 A; 2MDI A; 5U47 A; 2F21 A; 3MCB A; 3OOB A; 3TC5 A; 2ZAJ A; 3TCZ A; 3MQG A; 2DK7 A; 2OWO A; 3L4H A; 4QIB A; 5E65 A; 1TR8 A; 3FSC A; 3KAD A; 3M85 A; 1K9Q A; 2RE3 A; 1WMV A; 2JV4 A; 1F8A B; 2E45 A; 3MQH A; 3TDB A; 2LAJ A; 3NTP A; 2ZR4 A; 3MCB B; 2DK1 A; 4GLX A; 1WR7 A; 2ZQV A; 3FS8 A; 2L4J A; 1YW5 A; #chains in the Genus database with same CATH homology 2M8I A; 2YSH A; 2ZQU A; 5CQ2 A; 5E5W A; 2WAD A; 2XP9 A; 2ZQT A; 4U85 A; 2EZ5 W; 2XP3 A; 2KXQ A; 2Y8N B; 2ZR5 A; 2M8J A; 2JXW A; 2BA1 A; 3CNG A; 4U84 A; 3KAF A; 2WAE A; 3FSB A; 2YSI A; 3LKX A; 5AHT A; 2DJY A; 3KCE A; 1PIN A; 1I5H W; 2YAJ B; 1FLC A; 3LE4 A; 2XP5 A; 2YSF A; 2ZQS A; 1RP5 A; 2ZR6 A; 5E64 A; 2XPA A; 2QRV A; 2Q5A A; 2XP4 A; 4U86 A; 3KAH A; 4A0U A; 1JMQ A; 3LKX B; 4E5R A; 1K9R A; 3KAB A; 3KAG A; 2XP7 A; 2JMF A; 3KAI A; 2ITK A; 5E66 A; 2M3O W; 1TK7 A; 2XPB A; 1NMV A; 4REX A; 1O6W A; 5E62 A; 1EG4 A; 4A0T A; 3WH0 A; 2XP8 A; 1ZCN A; 3M7N A; 1EG3 A; 3PQH A; 2DWV A; 2YSB A; 3ODK A; 2DMV A; 2JX8 A; 2YSG A; 2XP6 A; 2MDI A; 5U47 A; 2F21 A; 3MCB A; 3OOB A; 3TC5 A; 2ZAJ A; 3TCZ A; 3MQG A; 2DK7 A; 2OWO A; 3L4H A; 4QIB A; 5E65 A; 1TR8 A; 3FSC A; 3KAD A; 3M85 A; 1K9Q A; 2RE3 A; 1WMV A; 2JV4 A; 1F8A B; 2E45 A; 3MQH A; 3TDB A; 2LAJ A; 3NTP A; 2ZR4 A; 3MCB B; 2DK1 A; 4GLX A; 1WR7 A; 2ZQV A; 3FS8 A; 2L4J A; 1YW5 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...