4IQJM

Structure of poliiialpha-tauc-dna complex suggests an atomic model of the replisome
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
177
structure length
138
Chain Sequence
HHHHHHKAGEAQDLAEGWRAFLEALKPTLRAFVREARPHLEGKTLVLRFPESKAFHHLLPLARAQFGVEELAFVLEKKSLSLEDPPWEAEEGEDPSEELRRLARLLGGRLLWVRKPKAPEAEEPVSEDGIGGNGIMPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(P*CP*GP*AP*AP*AP*CP*GP*AP*CP*GP*GP*CP*CP*AP*GP*TP*
publication title Structure of PolIIIalpha-Tauc-DNA complex suggests an atomic model of the replisome
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Transferase/dna
total genus 13
structure length 138
sequence length 177
chains with identical sequence N, O, P
ec nomenclature
pdb deposition date 2013-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.100 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Ribonucleotide Reductase Protein R1; domain 1 4iqjM02
4IQJM
chains in the Genus database with same CATH superfamily
2RCNA 2JAOA 1T9HA 2I7DA 3CI0K 1VDKA 1Z4QA 3QBPA 1Q92A 1Z4IA 2PFMA 2D28C 2E9FA 4NLEA 3BWVA 2QGAB 2D27A 4HGVA 1DOFA 2JAUA 1DCNA 3GZHA 1KQ7A 5HW2A 4IQJM 4L57A 1U0LA 3F4TA 1C3CA 2X75A 1I0AA 1Q5NA 3E04A 2YV5A 1YFEA 3F4RA 1Z4LA 3TV2A 1XWOA 4YIHA 4NFLA 1Q91A 1Z4KA 3RD8A 3NO9A 3U13A 2PTQA 1YFMA 4L6CA 1TJUA 3R6QA 3C8TA 1IW7D 4ADMA 1Z4PX 4APAA 4L6AA 2PTRA 1JSWA 1HY0A 3OCEA 1FUQA 2JAWA 1J3UA 1TJ7A 3U19A 3GTDA 4YIKA 1TJVA 3OCFA 5D6BA 4EFCA 4NSLA 1AUWA 5F92A 1U16A 1K7WA 1FUOA 3F4SA 1HY1A 3R6VA 4EEIA 3BHGA 2FUSA 1RE5A 5F91A 4ADLA 4MUMA 2PTSA 1K62A 1MH9A 1Z4MA 1Z4JA 4MX2A 1TJWA 1FUPA 3RRPA 4E88A 2JARA 1C3UA 1FURA 4MWOA 4APBA 1U15A 2HVGA
chains in the Genus database with same CATH topology
3F4TA 1IW7D 2D27A 3F4RA 2D28C 4IQJM 3F4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IQJ M; 
#chains in the Genus database with same CATH topology
 2RCN A;  2JAO A;  1T9H A;  2I7D A;  3CI0 K;  1VDK A;  1Z4Q A;  3QBP A;  1Q92 A;  1Z4I A;  2PFM A;  2D28 C;  2E9F A;  4NLE A;  3BWV A;  2QGA B;  2D27 A;  4HGV A;  1DOF A;  2JAU A;  1DCN A;  3GZH A;  1KQ7 A;  5HW2 A;  4IQJ M;  4L57 A;  1U0L A;  3F4T A;  1C3C A;  2X75 A;  1I0A A;  1Q5N A;  3E04 A;  2YV5 A;  1YFE A;  3F4R A;  1Z4L A;  3TV2 A;  1XWO A;  4YIH A;  4NFL A;  1Q91 A;  1Z4K A;  3RD8 A;  3NO9 A;  3U13 A;  2PTQ A;  1YFM A;  4L6C A;  1TJU A;  3R6Q A;  3C8T A;  1IW7 D;  4ADM A;  1Z4P X;  4APA A;  4L6A A;  2PTR A;  1JSW A;  1HY0 A;  3OCE A;  1FUQ A;  2JAW A;  1J3U A;  1TJ7 A;  3U19 A;  3GTD A;  4YIK A;  1TJV A;  3OCF A;  5D6B A;  4EFC A;  4NSL A;  1AUW A;  5F92 A;  1U16 A;  1K7W A;  1FUO A;  3F4S A;  1HY1 A;  3R6V A;  4EEI A;  3BHG A;  2FUS A;  1RE5 A;  5F91 A;  4ADL A;  4MUM A;  2PTS A;  1K62 A;  1MH9 A;  1Z4M A;  1Z4J A;  4MX2 A;  1TJW A;  1FUP A;  3RRP A;  4E88 A;  2JAR A;  1C3U A;  1FUR A;  4MWO A;  4APB A;  1U15 A;  2HVG A; 
#chains in the Genus database with same CATH homology
 3F4T A;  1IW7 D;  2D27 A;  3F4R A;  2D28 C;  4IQJ M;  3F4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...