4IQJM

Structure of poliiialpha-tauc-dna complex suggests an atomic model of the replisome
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
177
structure length
138
Chain Sequence
b'HHHHHHKAGEAQDLAEGWRAFLEALKPTLRAFVREARPHLEGKTLVLRFPESKAFHHLLPLARAQFGVEELAFVLEKKSLSLEDPPWEAEEGEDPSEELRRLARLLGGRLLWVRKPKAPEAEEPVSEDGIGGNGIMPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(P*CP*GP*AP*AP*AP*CP*GP*AP*CP*GP*GP*CP*CP*AP*GP*TP*
publication title Structure of PolIIIalpha-Tauc-DNA complex suggests an atomic model of the replisome
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Transferase/dna
total genus 13
structure length 138
sequence length 177
chains with identical sequence N, O, P
ec nomenclature
pdb deposition date 2013-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.100 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Ribonucleotide Reductase Protein R1; domain 1 4iqjM02
4IQJM
chains in the Genus database with same CATH superfamily
3OCEA 2JAOA 2YV5A 3F4SA 2JAWA 1U0LA 1TJ7A 4NLEA 4YIHA 3C8TA 3OCFA 1Z4KA 1VDKA 2QGAB 3R6VA 1J3UA 1AUWA 4ADLA 4NSLA 1TJVA 3U19A 2X75A 3QBPA 1XWOA 1YFMA 1C3CA 1RE5A 3BHGA 3TV2A 1Q92A 4EFCA 2PTRA 3RRPA 1HY1A 2JARA 4APBA 2PFMA 4MX2A 1DCNA 5HW2A 4L6CA 1FURA 5D6BA 3R6QA 4IQJM 4YIKA 2I7DA 1YFEA 2JAUA 2FUSA 1Z4MA 1Z4LA 1Q91A 4MWOA 4E88A 1IW7D 4NFLA 1FUOA 3F4RA 3U13A 3BWVA 1Z4QA 2RCNA 3F4TA 4L57A 4HGVA 1T9HA 2PTSA 3NO9A 3CI0K 2D27A 1KQ7A 1Z4IA 2PTQA 1JSWA 1TJWA 4APAA 5F91A 1FUQA 1I0AA 1HY0A 1DOFA 1FUPA 1K7WA 1C3UA 5F92A 1U16A 1Z4JA 2D28C 1TJUA 3RD8A 1U15A 4L6AA 4EEIA 1MH9A 3E04A 4ADMA 3GTDA 1Q5NA 3GZHA 1K62A 1Z4PX 4MUMA 2E9FA 2HVGA
chains in the Genus database with same CATH topology
2D28C 3F4TA 2D27A 1IW7D 3F4SA 3F4RA 4IQJM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IQJ M; 
#chains in the Genus database with same CATH topology
 3OCE A;  2JAO A;  2YV5 A;  3F4S A;  2JAW A;  1U0L A;  1TJ7 A;  4NLE A;  4YIH A;  3C8T A;  3OCF A;  1Z4K A;  1VDK A;  2QGA B;  3R6V A;  1J3U A;  1AUW A;  4ADL A;  4NSL A;  1TJV A;  3U19 A;  2X75 A;  3QBP A;  1XWO A;  1YFM A;  1C3C A;  1RE5 A;  3BHG A;  3TV2 A;  1Q92 A;  4EFC A;  2PTR A;  3RRP A;  1HY1 A;  2JAR A;  4APB A;  2PFM A;  4MX2 A;  1DCN A;  5HW2 A;  4L6C A;  1FUR A;  5D6B A;  3R6Q A;  4IQJ M;  4YIK A;  2I7D A;  1YFE A;  2JAU A;  2FUS A;  1Z4M A;  1Z4L A;  1Q91 A;  4MWO A;  4E88 A;  1IW7 D;  4NFL A;  1FUO A;  3F4R A;  3U13 A;  3BWV A;  1Z4Q A;  2RCN A;  3F4T A;  4L57 A;  4HGV A;  1T9H A;  2PTS A;  3NO9 A;  3CI0 K;  2D27 A;  1KQ7 A;  1Z4I A;  2PTQ A;  1JSW A;  1TJW A;  4APA A;  5F91 A;  1FUQ A;  1I0A A;  1HY0 A;  1DOF A;  1FUP A;  1K7W A;  1C3U A;  5F92 A;  1U16 A;  1Z4J A;  2D28 C;  1TJU A;  3RD8 A;  1U15 A;  4L6A A;  4EEI A;  1MH9 A;  3E04 A;  4ADM A;  3GTD A;  1Q5N A;  3GZH A;  1K62 A;  1Z4P X;  4MUM A;  2E9F A;  2HVG A; 
#chains in the Genus database with same CATH homology
 2D28 C;  3F4T A;  2D27 A;  1IW7 D;  3F4S A;  3F4R A;  4IQJ M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...