4IQJM

Structure of poliiialpha-tauc-dna complex suggests an atomic model of the replisome
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
177
structure length
138
Chain Sequence
HHHHHHKAGEAQDLAEGWRAFLEALKPTLRAFVREARPHLEGKTLVLRFPESKAFHHLLPLARAQFGVEELAFVLEKKSLSLEDPPWEAEEGEDPSEELRRLARLLGGRLLWVRKPKAPEAEEPVSEDGIGGNGIMPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of PolIIIalpha-Tauc-DNA complex suggests an atomic model of the replisome
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Transferase/dna
molecule keywords DNA (5'-D(P*CP*GP*AP*AP*AP*CP*GP*AP*CP*GP*GP*CP*CP*AP*GP*TP*
total genus 13
structure length 138
sequence length 177
chains with identical sequence N, O, P
ec nomenclature
pdb deposition date 2013-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.100 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Ribonucleotide Reductase Protein R1; domain 1 4iqjM02
4IQJM
chains in the Genus database with same CATH superfamily
1K62A 4L57A 3OCEA 4MWOA 1FUOA 4YIKA 3TV2A 1MH9A 3R6VA 4APBA 1Z4IA 4ADLA 1Z4JA 3QBPA 1AUWA 1Z4MA 4HGVA 4EFCA 3GTDA 1HY1A 1RE5A 2I7DA 4EEIA 3OCFA 3F4TA 2D27A 2HVGA 2YV5A 1VDKA 1T9HA 2D28C 1C3CA 1FUQA 1U0LA 4E88A 2JAOA 2JARA 5F91A 2JAWA 1I0AA 4L6CA 1FUPA 3F4RA 1J3UA 5F92A 4NLEA 3U13A 1Q5NA 1Q91A 3U19A 4L6AA 3RRPA 2X75A 2RCNA 4MX2A 2FUSA 4NSLA 3C8TA 1K7WA 4YIHA 3F4SA 1TJ7A 1IW7D 3NO9A 1U15A 3RD8A 2QGAB 1FURA 2PFMA 1TJUA 1YFEA 4MUMA 5HW2A 3CI0K 1Z4KA 1DOFA 3BWVA 1Z4PX 3R6QA 4APAA 4ADMA 4NFLA 3BHGA 2JAUA 5D6BA 1TJVA 4IQJM 1DCNA 1Q92A 1KQ7A 1Z4QA 1XWOA 1Z4LA 2E9FA 2PTSA 1HY0A 2PTRA 1YFMA 1U16A 3GZHA 1JSWA 1TJWA 3E04A 2PTQA 1C3UA
chains in the Genus database with same CATH topology
4IQJM 2D28C 3F4TA 3F4RA 2D27A 3F4SA 1IW7D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IQJ M; 
#chains in the Genus database with same CATH topology
 1K62 A;  4L57 A;  3OCE A;  4MWO A;  1FUO A;  4YIK A;  3TV2 A;  1MH9 A;  3R6V A;  4APB A;  1Z4I A;  4ADL A;  1Z4J A;  3QBP A;  1AUW A;  1Z4M A;  4HGV A;  4EFC A;  3GTD A;  1HY1 A;  1RE5 A;  2I7D A;  4EEI A;  3OCF A;  3F4T A;  2D27 A;  2HVG A;  2YV5 A;  1VDK A;  1T9H A;  2D28 C;  1C3C A;  1FUQ A;  1U0L A;  4E88 A;  2JAO A;  2JAR A;  5F91 A;  2JAW A;  1I0A A;  4L6C A;  1FUP A;  3F4R A;  1J3U A;  5F92 A;  4NLE A;  3U13 A;  1Q5N A;  1Q91 A;  3U19 A;  4L6A A;  3RRP A;  2X75 A;  2RCN A;  4MX2 A;  2FUS A;  4NSL A;  3C8T A;  1K7W A;  4YIH A;  3F4S A;  1TJ7 A;  1IW7 D;  3NO9 A;  1U15 A;  3RD8 A;  2QGA B;  1FUR A;  2PFM A;  1TJU A;  1YFE A;  4MUM A;  5HW2 A;  3CI0 K;  1Z4K A;  1DOF A;  3BWV A;  1Z4P X;  3R6Q A;  4APA A;  4ADM A;  4NFL A;  3BHG A;  2JAU A;  5D6B A;  1TJV A;  4IQJ M;  1DCN A;  1Q92 A;  1KQ7 A;  1Z4Q A;  1XWO A;  1Z4L A;  2E9F A;  2PTS A;  1HY0 A;  2PTR A;  1YFM A;  1U16 A;  3GZH A;  1JSW A;  1TJW A;  3E04 A;  2PTQ A;  1C3U A; 
#chains in the Genus database with same CATH homology
 4IQJ M;  2D28 C;  3F4T A;  3F4R A;  2D27 A;  3F4S A;  1IW7 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...