4IQJM

Structure of poliiialpha-tauc-dna complex suggests an atomic model of the replisome
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
177
structure length
138
Chain Sequence
HHHHHHKAGEAQDLAEGWRAFLEALKPTLRAFVREARPHLEGKTLVLRFPESKAFHHLLPLARAQFGVEELAFVLEKKSLSLEDPPWEAEEGEDPSEELRRLARLLGGRLLWVRKPKAPEAEEPVSEDGIGGNGIMPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of PolIIIalpha-Tauc-DNA complex suggests an atomic model of the replisome
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Transferase/dna
molecule keywords DNA (5'-D(P*CP*GP*AP*AP*AP*CP*GP*AP*CP*GP*GP*CP*CP*AP*GP*TP*
total genus 13
structure length 138
sequence length 177
chains with identical sequence N, O, P
ec nomenclature
pdb deposition date 2013-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.100 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Ribonucleotide Reductase Protein R1; domain 1 4iqjM02
4IQJM
chains in the Genus database with same CATH superfamily
1Z4QA 3NO9A 1I0AA 2PTRA 1VDKA 1AUWA 5HW2A 4L6CA 3RRPA 4L6AA 1HY0A 5D6BA 4APAA 4NFLA 1TJ7A 3GZHA 2RCNA 1KQ7A 1FUOA 1MH9A 2JAOA 1YFMA 1RE5A 3R6QA 1FUPA 2FUSA 2JARA 2JAWA 1Z4JA 4EFCA 3F4RA 2HVGA 2X75A 1U16A 1Z4KA 1C3UA 2PTSA 2D28C 2JAUA 3RD8A 3BWVA 5F92A 2I7DA 4E88A 4YIHA 4MWOA 1U0LA 3BHGA 1XWOA 1K62A 2PFMA 3R6VA 3U13A 4ADMA 1Q5NA 4NLEA 1J3UA 1Q91A 2E9FA 4NSLA 3OCFA 4YIKA 4IQJM 1FURA 3C8TA 1C3CA 4APBA 3TV2A 3E04A 3GTDA 3QBPA 1TJVA 1DOFA 1IW7D 4EEIA 3U19A 1Z4IA 3F4SA 1TJWA 1Z4PX 1JSWA 1DCNA 1FUQA 1YFEA 2PTQA 1Z4LA 1HY1A 4ADLA 1T9HA 1U15A 4HGVA 4MUMA 3OCEA 5F91A 1TJUA 4MX2A 2YV5A 2D27A 3F4TA 1Z4MA 2QGAB 3CI0K 4L57A 1Q92A 1K7WA
chains in the Genus database with same CATH topology
2D27A 3F4TA 1IW7D 4IQJM 2D28C 3F4RA 3F4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IQJ M; 
#chains in the Genus database with same CATH topology
 1Z4Q A;  3NO9 A;  1I0A A;  2PTR A;  1VDK A;  1AUW A;  5HW2 A;  4L6C A;  3RRP A;  4L6A A;  1HY0 A;  5D6B A;  4APA A;  4NFL A;  1TJ7 A;  3GZH A;  2RCN A;  1KQ7 A;  1FUO A;  1MH9 A;  2JAO A;  1YFM A;  1RE5 A;  3R6Q A;  1FUP A;  2FUS A;  2JAR A;  2JAW A;  1Z4J A;  4EFC A;  3F4R A;  2HVG A;  2X75 A;  1U16 A;  1Z4K A;  1C3U A;  2PTS A;  2D28 C;  2JAU A;  3RD8 A;  3BWV A;  5F92 A;  2I7D A;  4E88 A;  4YIH A;  4MWO A;  1U0L A;  3BHG A;  1XWO A;  1K62 A;  2PFM A;  3R6V A;  3U13 A;  4ADM A;  1Q5N A;  4NLE A;  1J3U A;  1Q91 A;  2E9F A;  4NSL A;  3OCF A;  4YIK A;  4IQJ M;  1FUR A;  3C8T A;  1C3C A;  4APB A;  3TV2 A;  3E04 A;  3GTD A;  3QBP A;  1TJV A;  1DOF A;  1IW7 D;  4EEI A;  3U19 A;  1Z4I A;  3F4S A;  1TJW A;  1Z4P X;  1JSW A;  1DCN A;  1FUQ A;  1YFE A;  2PTQ A;  1Z4L A;  1HY1 A;  4ADL A;  1T9H A;  1U15 A;  4HGV A;  4MUM A;  3OCE A;  5F91 A;  1TJU A;  4MX2 A;  2YV5 A;  2D27 A;  3F4T A;  1Z4M A;  2QGA B;  3CI0 K;  4L57 A;  1Q92 A;  1K7W A; 
#chains in the Genus database with same CATH homology
 2D27 A;  3F4T A;  1IW7 D;  4IQJ M;  2D28 C;  3F4R A;  3F4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...