4IQJM

Structure of poliiialpha-tauc-dna complex suggests an atomic model of the replisome
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
177
structure length
138
Chain Sequence
HHHHHHKAGEAQDLAEGWRAFLEALKPTLRAFVREARPHLEGKTLVLRFPESKAFHHLLPLARAQFGVEELAFVLEKKSLSLEDPPWEAEEGEDPSEELRRLARLLGGRLLWVRKPKAPEAEEPVSEDGIGGNGIMPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/dna
molecule keywords DNA (5'-D(P*CP*GP*AP*AP*AP*CP*GP*AP*CP*GP*GP*CP*CP*AP*GP*TP*
publication title Structure of PolIIIalpha-Tauc-DNA complex suggests an atomic model of the replisome
pubmed doi rcsb
source organism Thermus aquaticus
total genus 13
structure length 138
sequence length 177
chains with identical sequence N, O, P
ec nomenclature
pdb deposition date 2013-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.100 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Ribonucleotide Reductase Protein R1; domain 1 4iqjM02
4IQJM
chains in the Genus database with same CATH superfamily
2QGAB 2PTQA 4L57A 2YV5A 2X75A 1Z4JA 1Z4QA 3GTDA 1Z4KA 2HVGA 3RRPA 1AUWA 2FUSA 4IQJM 3GZHA 1FUOA 3F4SA 5F92A 5F91A 3BHGA 1FUPA 1MH9A 2JARA 4NLEA 3R6VA 4NFLA 3QBPA 4ADMA 3C8TA 1C3UA 4MX2A 2E9FA 1T9HA 2JAOA 3CI0K 1I0AA 2PTSA 3BWVA 1K7WA 1Z4PX 2D28C 1U16A 3U13A 1KQ7A 4MWOA 1HY1A 2PTRA 1C3CA 1DOFA 3OCFA 3F4RA 1TJWA 1RE5A 3TV2A 1XWOA 4MUMA 1FURA 2I7DA 4HGVA 4L6AA 5HW2A 4APAA 4L6CA 4NSLA 1YFEA 2D27A 1U0LA 1DCNA 2JAWA 4EEIA 4ADLA 4EFCA 1IW7D 2RCNA 4E88A 1Z4LA 1Z4MA 2JAUA 1JSWA 1Q91A 1YFMA 1Z4IA 1U15A 1TJ7A 3OCEA 3E04A 1HY0A 3R6QA 1VDKA 3U19A 4APBA 1Q5NA 1J3UA 5D6BA 1Q92A 4YIKA 1K62A 1TJVA 2PFMA 3NO9A 1TJUA 4YIHA 3RD8A 1FUQA 3F4TA
chains in the Genus database with same CATH topology
3F4SA 2D28C 2D27A 4IQJM 1IW7D 3F4TA 3F4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IQJ M; 
#chains in the Genus database with same CATH topology
 2QGA B;  2PTQ A;  4L57 A;  2YV5 A;  2X75 A;  1Z4J A;  1Z4Q A;  3GTD A;  1Z4K A;  2HVG A;  3RRP A;  1AUW A;  2FUS A;  4IQJ M;  3GZH A;  1FUO A;  3F4S A;  5F92 A;  5F91 A;  3BHG A;  1FUP A;  1MH9 A;  2JAR A;  4NLE A;  3R6V A;  4NFL A;  3QBP A;  4ADM A;  3C8T A;  1C3U A;  4MX2 A;  2E9F A;  1T9H A;  2JAO A;  3CI0 K;  1I0A A;  2PTS A;  3BWV A;  1K7W A;  1Z4P X;  2D28 C;  1U16 A;  3U13 A;  1KQ7 A;  4MWO A;  1HY1 A;  2PTR A;  1C3C A;  1DOF A;  3OCF A;  3F4R A;  1TJW A;  1RE5 A;  3TV2 A;  1XWO A;  4MUM A;  1FUR A;  2I7D A;  4HGV A;  4L6A A;  5HW2 A;  4APA A;  4L6C A;  4NSL A;  1YFE A;  2D27 A;  1U0L A;  1DCN A;  2JAW A;  4EEI A;  4ADL A;  4EFC A;  1IW7 D;  2RCN A;  4E88 A;  1Z4L A;  1Z4M A;  2JAU A;  1JSW A;  1Q91 A;  1YFM A;  1Z4I A;  1U15 A;  1TJ7 A;  3OCE A;  3E04 A;  1HY0 A;  3R6Q A;  1VDK A;  3U19 A;  4APB A;  1Q5N A;  1J3U A;  5D6B A;  1Q92 A;  4YIK A;  1K62 A;  1TJV A;  2PFM A;  3NO9 A;  1TJU A;  4YIH A;  3RD8 A;  1FUQ A;  3F4T A; 
#chains in the Genus database with same CATH homology
 3F4S A;  2D28 C;  2D27 A;  4IQJ M;  1IW7 D;  3F4T A;  3F4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...