1DCNA

Inactive mutant h162n of delta 2 crystallin with bound argininosuccinate
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
433
structure length
424
Chain Sequence
DQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLEKISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLNTGRSRNDQVVTDLKLFMKNSLSIISTHLLQLIKTLVERAAIEIDVILPGYTNLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNPLDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFSTNPDSLELIRSKSGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALTPEMLATDLALYLVRKGVPFRQAHTASGKAVHLAETKGITINNLSLEDLKSISPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRELMKKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Eye lens protein
molecule keywords DELTA 2 CRYSTALLIN
publication title Crystal structure of an inactive duck delta II crystallin mutant with bound argininosuccinate.
pubmed doi rcsb
source organism Anas platyrhynchos
total genus 154
structure length 424
sequence length 433
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.1: Argininosuccinate lyase.
pdb deposition date 1998-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14698 ASL_C2 Argininosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 1dcnA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 1dcnA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 1dcnA02
1YFMA 1JSWA 4BAAA 2J91A 4ADMA 1FUPA 1VDKA 3E04A 2RJSA 3R6YA 2O7FA 3R6QA 1FUQA 1TJVA 2X75A 2O7DA 3OCFA 1GK3A 2PFMA 1T6PA 1T6JA 3RRPA 2QVEA 4EEIA 4CQ5A 4C5RA 1TJ7A 2O78A 1U16A 1GKJA 2VD6A 4C5SA 1HY1A 1K62A 1C3CA 5HW2A 1YFEA 4MX2A 3KDYA 1KQ7A 4FFXA 3NO9A 4APBA 2NYFA 5D6BA 3UNVA 1TJWA 4BABA 1K7WA 2PTSA 4HGVA 3KDZA 4FLCA 4C5UA 1GKMA 4APAA 1RE5A 2YIIA 4V2RA 3GTDA 5EYTA 3QBPA 1EB4A 4V2QA 4EFCA 2FUSA 2E9FA 2O7BA 1U15A 1B8FA 3CZOA 4ADLA 1GK2A 5F91A 1DOFA 3OCEA 3BHGA 4NSLA 3R6VA 2PTQA 2QGAB 1YISA 2RJRA 4NLEA 2OHYA 3GZHA 3C8TA 1XWOA 1FURA 3NZ4A 4C6GA 1J3UA 2O7EA 2O6YA 1TJUA 1DCNA 1I0AA 1Q5NA 1Y2MA 5EYVA 2PTRA 1W27A 2HVGA 3TV2A 1C3UA 1AUWA 1HY0A 1FUOA 3RD8A 5F92A 2NYNA
chains in the Genus database with same CATH superfamily
1YFMA 1Q91A 1JSWA 4BAAA 2J91A 4ADMA 2JAUA 1FUPA 2I7DA 1VDKA 3E04A 2RJSA 3R6YA 2O7FA 3R6QA 1XL7A 1FUQA 1TJVA 1Z4KA 2X75A 2O7DA 5M0IA 1Z4MA 3F4SA 3OCFA 1GK3A 1Q92A 2PFMA 2RCNA 3F4RA 1Z4PX 1T6PA 1T6JA 2D27A 3RRPA 2QVEA 4EEIA 4CQ5A 4C5RA 1TJ7A 2O78A 1XL8A 3CI0K 1U16A 1GKJA 2VD6A 1Z4LA 4C5SA 1HY1A 1K62A 1C3CA 5HW2A 1YFEA 4MUMA 4MX2A 3KDYA 1KQ7A 4FFXA 2VSFA 3NO9A 4APBA 2NYFA 3CRVA 5D6BA 5M0JA 3UNVA 4L57A 1TJWA 1U0LA 1K7WA 2PTSA 4HGVA 3KDZA 4FLCA 4BABA 1GKMA 4C5UA 4APAA 1RE5A 5H8WA 2YIIA 2JAWA 4L6CA 4V2RA 3GTDA 3CRW1 5EYTA 3QBPA 1EB4A 4V2QA 4EFCA 1XMDA 4IQJM 2FUSA 2E9FA 2O7BA 1U15A 1T9HA 1B8FA 2JARA 1Z4IA 3CZOA 4NFLA 1Z4QA 4ADLA 3U13A 1GK2A 2YV5A 5F91A 1DOFA 1XMCA 2JAOA 4YIKA 3OCEA 3BHGA 4MWOA 4NSLA 3R6VA 4YIHA 2PTQA 2QGAB 2FELA 1YISA 4L6AA 2RJRA 4NLEA 2OHYA 3GZHA 4A15A 3C8TA 1XWOA 1FURA 3NZ4A 4C6GA 4E88A 3U19A 1J3UA 2O7EA 3BWVA 2O6YA 4WNLA 1Z4JA 1XLYA 1TJUA 1DCNA 1I0AA 2FENA 1Q5NA 1Y2MA 5EYVA 2VL7A 2PTRA 1W27A 2HVGA 3TV2A 1C3UA 1AUWA 1MH9A 3F4TA 1HY0A 1FUOA 3RD8A 1IW7D 5F92A 2NYNA 2D28C
chains in the Genus database with same CATH topology
1YFMA 1JSWA 4BAAA 2J91A 4ADMA 1FUPA 1VDKA 3E04A 2RJSA 3R6YA 2O7FA 3R6QA 1FUQA 1TJVA 2X75A 2O7DA 3OCFA 1GK3A 2PFMA 1T6PA 1T6JA 3RRPA 2QVEA 4EEIA 4CQ5A 4C5RA 1TJ7A 2O78A 1U16A 1GKJA 2VD6A 4C5SA 1HY1A 1K62A 1C3CA 5HW2A 1YFEA 4MX2A 3KDYA 1KQ7A 4FFXA 3NO9A 4APBA 2NYFA 5D6BA 3UNVA 1TJWA 4BABA 1K7WA 2PTSA 4HGVA 3KDZA 4FLCA 4C5UA 1GKMA 4APAA 1RE5A 2YIIA 4V2RA 3GTDA 5EYTA 3QBPA 1EB4A 4V2QA 4EFCA 2FUSA 2E9FA 2O7BA 1U15A 1B8FA 3CZOA 4ADLA 1GK2A 5F91A 1DOFA 3OCEA 3BHGA 4NSLA 3R6VA 2PTQA 2QGAB 1YISA 2RJRA 4NLEA 2OHYA 3GZHA 3C8TA 1XWOA 1FURA 3NZ4A 4C6GA 1J3UA 2O7EA 2O6YA 1TJUA 1DCNA 1I0AA 1Q5NA 1Y2MA 5EYVA 2PTRA 1W27A 2HVGA 3TV2A 1C3UA 1AUWA 1HY0A 1FUOA 3RD8A 5F92A 2NYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YFM A;  1JSW A;  4BAA A;  2J91 A;  4ADM A;  1FUP A;  1VDK A;  3E04 A;  2RJS A;  3R6Y A;  2O7F A;  3R6Q A;  1FUQ A;  1TJV A;  2X75 A;  2O7D A;  3OCF A;  1GK3 A;  2PFM A;  1T6P A;  1T6J A;  3RRP A;  2QVE A;  4EEI A;  4CQ5 A;  4C5R A;  1TJ7 A;  2O78 A;  1U16 A;  1GKJ A;  2VD6 A;  4C5S A;  1HY1 A;  1K62 A;  1C3C A;  5HW2 A;  1YFE A;  4MX2 A;  3KDY A;  1KQ7 A;  4FFX A;  3NO9 A;  4APB A;  2NYF A;  5D6B A;  3UNV A;  1TJW A;  4BAB A;  1K7W A;  2PTS A;  4HGV A;  3KDZ A;  4FLC A;  4C5U A;  1GKM A;  4APA A;  1RE5 A;  2YII A;  4V2R A;  3GTD A;  5EYT A;  3QBP A;  1EB4 A;  4V2Q A;  4EFC A;  2FUS A;  2E9F A;  2O7B A;  1U15 A;  1B8F A;  3CZO A;  4ADL A;  1GK2 A;  5F91 A;  1DOF A;  3OCE A;  3BHG A;  4NSL A;  3R6V A;  2PTQ A;  2QGA B;  1YIS A;  2RJR A;  4NLE A;  2OHY A;  3GZH A;  3C8T A;  1XWO A;  1FUR A;  3NZ4 A;  4C6G A;  1J3U A;  2O7E A;  2O6Y A;  1TJU A;  1DCN A;  1I0A A;  1Q5N A;  1Y2M A;  5EYV A;  2PTR A;  1W27 A;  2HVG A;  3TV2 A;  1C3U A;  1AUW A;  1HY0 A;  1FUO A;  3RD8 A;  5F92 A;  2NYN A; 
#chains in the Genus database with same CATH topology
 1YFM A;  1Q91 A;  1JSW A;  4BAA A;  2J91 A;  4ADM A;  2JAU A;  1FUP A;  2I7D A;  1VDK A;  3E04 A;  2RJS A;  3R6Y A;  2O7F A;  3R6Q A;  1XL7 A;  1FUQ A;  1TJV A;  1Z4K A;  2X75 A;  2O7D A;  5M0I A;  1Z4M A;  3F4S A;  3OCF A;  1GK3 A;  1Q92 A;  2PFM A;  2RCN A;  3F4R A;  1Z4P X;  1T6P A;  1T6J A;  2D27 A;  3RRP A;  2QVE A;  4EEI A;  4CQ5 A;  4C5R A;  1TJ7 A;  2O78 A;  1XL8 A;  3CI0 K;  1U16 A;  1GKJ A;  2VD6 A;  1Z4L A;  4C5S A;  1HY1 A;  1K62 A;  1C3C A;  5HW2 A;  1YFE A;  4MUM A;  4MX2 A;  3KDY A;  1KQ7 A;  4FFX A;  2VSF A;  3NO9 A;  4APB A;  2NYF A;  3CRV A;  5D6B A;  5M0J A;  3UNV A;  4L57 A;  1TJW A;  1U0L A;  1K7W A;  2PTS A;  4HGV A;  3KDZ A;  4FLC A;  4BAB A;  1GKM A;  4C5U A;  4APA A;  1RE5 A;  5H8W A;  2YII A;  2JAW A;  4L6C A;  4V2R A;  3GTD A;  3CRW 1;  5EYT A;  3QBP A;  1EB4 A;  4V2Q A;  4EFC A;  1XMD A;  4IQJ M;  2FUS A;  2E9F A;  2O7B A;  1U15 A;  1T9H A;  1B8F A;  2JAR A;  1Z4I A;  3CZO A;  4NFL A;  1Z4Q A;  4ADL A;  3U13 A;  1GK2 A;  2YV5 A;  5F91 A;  1DOF A;  1XMC A;  2JAO A;  4YIK A;  3OCE A;  3BHG A;  4MWO A;  4NSL A;  3R6V A;  4YIH A;  2PTQ A;  2QGA B;  2FEL A;  1YIS A;  4L6A A;  2RJR A;  4NLE A;  2OHY A;  3GZH A;  4A15 A;  3C8T A;  1XWO A;  1FUR A;  3NZ4 A;  4C6G A;  4E88 A;  3U19 A;  1J3U A;  2O7E A;  3BWV A;  2O6Y A;  4WNL A;  1Z4J A;  1XLY A;  1TJU A;  1DCN A;  1I0A A;  2FEN A;  1Q5N A;  1Y2M A;  5EYV A;  2VL7 A;  2PTR A;  1W27 A;  2HVG A;  3TV2 A;  1C3U A;  1AUW A;  1MH9 A;  3F4T A;  1HY0 A;  1FUO A;  3RD8 A;  1IW7 D;  5F92 A;  2NYN A;  2D28 C; 
#chains in the Genus database with same CATH homology
 1YFM A;  1JSW A;  4BAA A;  2J91 A;  4ADM A;  1FUP A;  1VDK A;  3E04 A;  2RJS A;  3R6Y A;  2O7F A;  3R6Q A;  1FUQ A;  1TJV A;  2X75 A;  2O7D A;  3OCF A;  1GK3 A;  2PFM A;  1T6P A;  1T6J A;  3RRP A;  2QVE A;  4EEI A;  4CQ5 A;  4C5R A;  1TJ7 A;  2O78 A;  1U16 A;  1GKJ A;  2VD6 A;  4C5S A;  1HY1 A;  1K62 A;  1C3C A;  5HW2 A;  1YFE A;  4MX2 A;  3KDY A;  1KQ7 A;  4FFX A;  3NO9 A;  4APB A;  2NYF A;  5D6B A;  3UNV A;  1TJW A;  4BAB A;  1K7W A;  2PTS A;  4HGV A;  3KDZ A;  4FLC A;  4C5U A;  1GKM A;  4APA A;  1RE5 A;  2YII A;  4V2R A;  3GTD A;  5EYT A;  3QBP A;  1EB4 A;  4V2Q A;  4EFC A;  2FUS A;  2E9F A;  2O7B A;  1U15 A;  1B8F A;  3CZO A;  4ADL A;  1GK2 A;  5F91 A;  1DOF A;  3OCE A;  3BHG A;  4NSL A;  3R6V A;  2PTQ A;  2QGA B;  1YIS A;  2RJR A;  4NLE A;  2OHY A;  3GZH A;  3C8T A;  1XWO A;  1FUR A;  3NZ4 A;  4C6G A;  1J3U A;  2O7E A;  2O6Y A;  1TJU A;  1DCN A;  1I0A A;  1Q5N A;  1Y2M A;  5EYV A;  2PTR A;  1W27 A;  2HVG A;  3TV2 A;  1C3U A;  1AUW A;  1HY0 A;  1FUO A;  3RD8 A;  5F92 A;  2NYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...