1DCNA

Inactive mutant h162n of delta 2 crystallin with bound argininosuccinate
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
433
structure length
424
Chain Sequence
DQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLEKISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLNTGRSRNDQVVTDLKLFMKNSLSIISTHLLQLIKTLVERAAIEIDVILPGYTNLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNPLDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFSTNPDSLELIRSKSGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALTPEMLATDLALYLVRKGVPFRQAHTASGKAVHLAETKGITINNLSLEDLKSISPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRELMKKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an inactive duck delta II crystallin mutant with bound argininosuccinate.
pubmed doi rcsb
source organism Anas platyrhynchos
molecule tags Eye lens protein
molecule keywords DELTA 2 CRYSTALLIN
total genus 154
structure length 424
sequence length 433
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.1: Argininosuccinate lyase.
pdb deposition date 1998-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14698 ASL_C2 Argininosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 1dcnA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 1dcnA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 1dcnA02
2J91A 3C8TA 4HGVA 3R6VA 1KQ7A 4FLCA 5F92A 1EB4A 2O78A 4CQ5A 3OCEA 2O7FA 2O7EA 1JSWA 1U16A 3BHGA 3R6QA 2YIIA 1B8FA 4EFCA 4C5RA 2QVEA 1FURA 4V2QA 1TJUA 2FUSA 2O7DA 2PTQA 5D6BA 1GKJA 1FUPA 1K62A 4NSLA 3RRPA 5HW2A 1YFEA 1VDKA 1J3UA 1GKMA 1FUQA 5EYVA 3NO9A 4FFXA 3KDYA 2NYNA 1Y2MA 1Q5NA 4C6GA 3GTDA 2O6YA 1T6JA 1DCNA 3RD8A 4MX2A 1GK2A 4NLEA 3KDZA 1GK3A 2E9FA 3TV2A 2NYFA 3UNVA 2PFMA 2RJSA 3GZHA 3OCFA 2QGAB 4APBA 1W27A 1TJVA 1K7WA 4ADMA 4BAAA 1YFMA 2PTSA 5EYTA 1T6PA 1C3UA 2VD6A 1TJWA 2X75A 1HY0A 3CZOA 1RE5A 2O7BA 4BABA 4ADLA 2HVGA 2RJRA 1I0AA 3E04A 2OHYA 1DOFA 1AUWA 4C5SA 1YISA 4C5UA 4APAA 1HY1A 1TJ7A 5F91A 1C3CA 3QBPA 1FUOA 1U15A 3R6YA 2PTRA 4EEIA 3NZ4A 1XWOA 4V2RA
chains in the Genus database with same CATH superfamily
2J91A 3C8TA 5M0IA 1Z4QA 4HGVA 2YV5A 3R6VA 1KQ7A 1MH9A 4FLCA 3CI0K 1XL7A 5F92A 2JAOA 1EB4A 2O78A 4CQ5A 3OCEA 2O7FA 2O7EA 3F4SA 2JAUA 1JSWA 3U19A 1U16A 3BHGA 3R6QA 2YIIA 1B8FA 4EFCA 4C5RA 1IW7D 4NFLA 2QVEA 1FURA 3F4RA 4L6CA 4V2QA 1TJUA 2FUSA 2O7DA 2PTQA 3CRW1 5D6BA 1T9HA 1GKJA 1FUPA 1K62A 4NSLA 3U13A 3RRPA 1Q91A 5HW2A 1YFEA 1VDKA 2D27A 3F4TA 4IQJM 1J3UA 1GKMA 1FUQA 5EYVA 3NO9A 4FFXA 3KDYA 2NYNA 2JAWA 1Y2MA 2FELA 1Q5NA 4C6GA 1Z4PX 3GTDA 2O6YA 1T6JA 1DCNA 3RD8A 4MX2A 1GK2A 4NLEA 1Z4LA 3KDZA 1GK3A 2E9FA 3TV2A 2NYFA 3UNVA 2PFMA 2RCNA 2RJSA 3GZHA 3OCFA 2QGAB 4APBA 1W27A 1XMDA 1TJVA 4L57A 1K7WA 4ADMA 1XLYA 4BAAA 1YFMA 2PTSA 5EYTA 1T6PA 1C3UA 5H8WA 4WNLA 2VD6A 1TJWA 5M0JA 1Z4MA 2D28C 2X75A 1HY0A 3CZOA 1RE5A 4E88A 1Z4JA 4YIHA 2O7BA 4BABA 1XL8A 4ADLA 1XMCA 2HVGA 3CRVA 2VSFA 4MUMA 2RJRA 1I0AA 1U0LA 3E04A 4L6AA 2OHYA 1DOFA 4MWOA 1AUWA 4C5SA 1YISA 1Z4KA 4C5UA 4APAA 2VL7A 1HY1A 4YIKA 1TJ7A 4A15A 2I7DA 5F91A 3BWVA 1C3CA 3QBPA 2FENA 1Z4IA 1FUOA 1U15A 2JARA 3R6YA 2PTRA 4EEIA 1Q92A 3NZ4A 1XWOA 4V2RA
chains in the Genus database with same CATH topology
2J91A 3C8TA 4HGVA 3R6VA 1KQ7A 4FLCA 5F92A 1EB4A 2O78A 4CQ5A 3OCEA 2O7FA 2O7EA 1JSWA 1U16A 3BHGA 3R6QA 2YIIA 1B8FA 4EFCA 4C5RA 2QVEA 1FURA 4V2QA 1TJUA 2FUSA 2O7DA 2PTQA 5D6BA 1GKJA 1FUPA 1K62A 4NSLA 3RRPA 5HW2A 1YFEA 1VDKA 1J3UA 1GKMA 1FUQA 5EYVA 3NO9A 4FFXA 3KDYA 2NYNA 1Y2MA 1Q5NA 4C6GA 3GTDA 2O6YA 1T6JA 1DCNA 3RD8A 4MX2A 1GK2A 4NLEA 3KDZA 1GK3A 2E9FA 3TV2A 2NYFA 3UNVA 2PFMA 2RJSA 3GZHA 3OCFA 2QGAB 4APBA 1W27A 1TJVA 1K7WA 4ADMA 4BAAA 1YFMA 2PTSA 5EYTA 1T6PA 1C3UA 2VD6A 1TJWA 2X75A 1HY0A 3CZOA 1RE5A 2O7BA 4BABA 4ADLA 2HVGA 2RJRA 1I0AA 3E04A 2OHYA 1DOFA 1AUWA 4C5SA 1YISA 4C5UA 4APAA 1HY1A 1TJ7A 5F91A 1C3CA 3QBPA 1FUOA 1U15A 3R6YA 2PTRA 4EEIA 3NZ4A 1XWOA 4V2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J91 A;  3C8T A;  4HGV A;  3R6V A;  1KQ7 A;  4FLC A;  5F92 A;  1EB4 A;  2O78 A;  4CQ5 A;  3OCE A;  2O7F A;  2O7E A;  1JSW A;  1U16 A;  3BHG A;  3R6Q A;  2YII A;  1B8F A;  4EFC A;  4C5R A;  2QVE A;  1FUR A;  4V2Q A;  1TJU A;  2FUS A;  2O7D A;  2PTQ A;  5D6B A;  1GKJ A;  1FUP A;  1K62 A;  4NSL A;  3RRP A;  5HW2 A;  1YFE A;  1VDK A;  1J3U A;  1GKM A;  1FUQ A;  5EYV A;  3NO9 A;  4FFX A;  3KDY A;  2NYN A;  1Y2M A;  1Q5N A;  4C6G A;  3GTD A;  2O6Y A;  1T6J A;  1DCN A;  3RD8 A;  4MX2 A;  1GK2 A;  4NLE A;  3KDZ A;  1GK3 A;  2E9F A;  3TV2 A;  2NYF A;  3UNV A;  2PFM A;  2RJS A;  3GZH A;  3OCF A;  2QGA B;  4APB A;  1W27 A;  1TJV A;  1K7W A;  4ADM A;  4BAA A;  1YFM A;  2PTS A;  5EYT A;  1T6P A;  1C3U A;  2VD6 A;  1TJW A;  2X75 A;  1HY0 A;  3CZO A;  1RE5 A;  2O7B A;  4BAB A;  4ADL A;  2HVG A;  2RJR A;  1I0A A;  3E04 A;  2OHY A;  1DOF A;  1AUW A;  4C5S A;  1YIS A;  4C5U A;  4APA A;  1HY1 A;  1TJ7 A;  5F91 A;  1C3C A;  3QBP A;  1FUO A;  1U15 A;  3R6Y A;  2PTR A;  4EEI A;  3NZ4 A;  1XWO A;  4V2R A; 
#chains in the Genus database with same CATH topology
 2J91 A;  3C8T A;  5M0I A;  1Z4Q A;  4HGV A;  2YV5 A;  3R6V A;  1KQ7 A;  1MH9 A;  4FLC A;  3CI0 K;  1XL7 A;  5F92 A;  2JAO A;  1EB4 A;  2O78 A;  4CQ5 A;  3OCE A;  2O7F A;  2O7E A;  3F4S A;  2JAU A;  1JSW A;  3U19 A;  1U16 A;  3BHG A;  3R6Q A;  2YII A;  1B8F A;  4EFC A;  4C5R A;  1IW7 D;  4NFL A;  2QVE A;  1FUR A;  3F4R A;  4L6C A;  4V2Q A;  1TJU A;  2FUS A;  2O7D A;  2PTQ A;  3CRW 1;  5D6B A;  1T9H A;  1GKJ A;  1FUP A;  1K62 A;  4NSL A;  3U13 A;  3RRP A;  1Q91 A;  5HW2 A;  1YFE A;  1VDK A;  2D27 A;  3F4T A;  4IQJ M;  1J3U A;  1GKM A;  1FUQ A;  5EYV A;  3NO9 A;  4FFX A;  3KDY A;  2NYN A;  2JAW A;  1Y2M A;  2FEL A;  1Q5N A;  4C6G A;  1Z4P X;  3GTD A;  2O6Y A;  1T6J A;  1DCN A;  3RD8 A;  4MX2 A;  1GK2 A;  4NLE A;  1Z4L A;  3KDZ A;  1GK3 A;  2E9F A;  3TV2 A;  2NYF A;  3UNV A;  2PFM A;  2RCN A;  2RJS A;  3GZH A;  3OCF A;  2QGA B;  4APB A;  1W27 A;  1XMD A;  1TJV A;  4L57 A;  1K7W A;  4ADM A;  1XLY A;  4BAA A;  1YFM A;  2PTS A;  5EYT A;  1T6P A;  1C3U A;  5H8W A;  4WNL A;  2VD6 A;  1TJW A;  5M0J A;  1Z4M A;  2D28 C;  2X75 A;  1HY0 A;  3CZO A;  1RE5 A;  4E88 A;  1Z4J A;  4YIH A;  2O7B A;  4BAB A;  1XL8 A;  4ADL A;  1XMC A;  2HVG A;  3CRV A;  2VSF A;  4MUM A;  2RJR A;  1I0A A;  1U0L A;  3E04 A;  4L6A A;  2OHY A;  1DOF A;  4MWO A;  1AUW A;  4C5S A;  1YIS A;  1Z4K A;  4C5U A;  4APA A;  2VL7 A;  1HY1 A;  4YIK A;  1TJ7 A;  4A15 A;  2I7D A;  5F91 A;  3BWV A;  1C3C A;  3QBP A;  2FEN A;  1Z4I A;  1FUO A;  1U15 A;  2JAR A;  3R6Y A;  2PTR A;  4EEI A;  1Q92 A;  3NZ4 A;  1XWO A;  4V2R A; 
#chains in the Genus database with same CATH homology
 2J91 A;  3C8T A;  4HGV A;  3R6V A;  1KQ7 A;  4FLC A;  5F92 A;  1EB4 A;  2O78 A;  4CQ5 A;  3OCE A;  2O7F A;  2O7E A;  1JSW A;  1U16 A;  3BHG A;  3R6Q A;  2YII A;  1B8F A;  4EFC A;  4C5R A;  2QVE A;  1FUR A;  4V2Q A;  1TJU A;  2FUS A;  2O7D A;  2PTQ A;  5D6B A;  1GKJ A;  1FUP A;  1K62 A;  4NSL A;  3RRP A;  5HW2 A;  1YFE A;  1VDK A;  1J3U A;  1GKM A;  1FUQ A;  5EYV A;  3NO9 A;  4FFX A;  3KDY A;  2NYN A;  1Y2M A;  1Q5N A;  4C6G A;  3GTD A;  2O6Y A;  1T6J A;  1DCN A;  3RD8 A;  4MX2 A;  1GK2 A;  4NLE A;  3KDZ A;  1GK3 A;  2E9F A;  3TV2 A;  2NYF A;  3UNV A;  2PFM A;  2RJS A;  3GZH A;  3OCF A;  2QGA B;  4APB A;  1W27 A;  1TJV A;  1K7W A;  4ADM A;  4BAA A;  1YFM A;  2PTS A;  5EYT A;  1T6P A;  1C3U A;  2VD6 A;  1TJW A;  2X75 A;  1HY0 A;  3CZO A;  1RE5 A;  2O7B A;  4BAB A;  4ADL A;  2HVG A;  2RJR A;  1I0A A;  3E04 A;  2OHY A;  1DOF A;  1AUW A;  4C5S A;  1YIS A;  4C5U A;  4APA A;  1HY1 A;  1TJ7 A;  5F91 A;  1C3C A;  3QBP A;  1FUO A;  1U15 A;  3R6Y A;  2PTR A;  4EEI A;  3NZ4 A;  1XWO A;  4V2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...