1DCNA

Inactive mutant h162n of delta 2 crystallin with bound argininosuccinate
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
433
structure length
424
Chain Sequence
DQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLEKISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLNTGRSRNDQVVTDLKLFMKNSLSIISTHLLQLIKTLVERAAIEIDVILPGYTNLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNPLDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFSTNPDSLELIRSKSGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALTPEMLATDLALYLVRKGVPFRQAHTASGKAVHLAETKGITINNLSLEDLKSISPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRELMKKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DELTA 2 CRYSTALLIN
publication title Crystal structure of an inactive duck delta II crystallin mutant with bound argininosuccinate.
pubmed doi rcsb
source organism Anas platyrhynchos
molecule tags Eye lens protein
total genus 154
structure length 424
sequence length 433
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.1: Argininosuccinate lyase.
pdb deposition date 1998-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14698 ASL_C2 Argininosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 1dcnA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 1dcnA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 1dcnA02
2QGAB 2YIIA 4C5RA 3GZHA 3OCFA 1T6PA 2PTQA 1DCNA 2QVEA 3E04A 4V2RA 1B8FA 4HGVA 1FURA 1TJUA 1RE5A 1U15A 5F92A 2J91A 1HY0A 5EYVA 3TV2A 3GTDA 1U16A 4BAAA 2O6YA 1Q5NA 1EB4A 3OCEA 1W27A 1T6JA 2E9FA 5F91A 4FLCA 1TJ7A 4EFCA 1TJVA 4NLEA 3NZ4A 3R6VA 2RJRA 1TJWA 5D6BA 2HVGA 4C5UA 1AUWA 1JSWA 3NO9A 4ADLA 1YISA 2O7FA 1Y2MA 3RD8A 4APAA 2O7EA 4MX2A 2FUSA 4FFXA 1VDKA 2NYNA 2O7BA 2PFMA 2PTSA 3R6YA 4ADMA 4EEIA 3BHGA 2O78A 4NSLA 1C3UA 1XWOA 1C3CA 2PTRA 2RJSA 2NYFA 3UNVA 1K62A 4C5SA 3C8TA 2OHYA 1YFEA 3QBPA 1FUPA 3RRPA 1GKMA 3R6QA 1I0AA 2VD6A 2O7DA 4V2QA 1DOFA 1FUQA 4BABA 3KDYA 1J3UA 1GKJA 2X75A 5HW2A 3KDZA 1KQ7A 1GK3A 1HY1A 4APBA 1FUOA 1K7WA 4CQ5A 1GK2A 5EYTA 4C6GA 3CZOA 1YFMA
chains in the Genus database with same CATH superfamily
3CI0K 1Z4QA 2QGAB 2YIIA 3U13A 4C5RA 3GZHA 3OCFA 2D27A 1XL8A 1T6PA 2D28C 2PTQA 1DCNA 1Z4JA 1Z4LA 1Z4PX 2QVEA 3E04A 2JAUA 4V2RA 5M0JA 1B8FA 4HGVA 1FURA 1TJUA 1T9HA 1RE5A 1U15A 5F92A 4L57A 1HY0A 2J91A 1IW7D 5EYVA 4MWOA 1Z4IA 3TV2A 2VL7A 3GTDA 3CRW1 1U16A 4BAAA 2O6YA 1Q5NA 1U0LA 4NFLA 1EB4A 4A15A 3OCEA 1W27A 1T6JA 2E9FA 5F91A 4FLCA 1TJ7A 4L6AA 4EFCA 2FENA 1Z4MA 1TJVA 4NLEA 1Z4KA 4WNLA 3NZ4A 3R6VA 2RJRA 1TJWA 5D6BA 2HVGA 4C5UA 2RCNA 1AUWA 2JARA 1XMDA 1JSWA 3NO9A 4ADLA 1YISA 2O7FA 2VSFA 3CRVA 2JAOA 1Y2MA 3RD8A 4APAA 2O7EA 4MX2A 4YIHA 2FUSA 4MUMA 3U19A 4L6CA 1VDKA 4FFXA 2NYNA 1Q91A 2O7BA 2PFMA 2PTSA 3R6YA 4ADMA 4EEIA 3BHGA 1XMCA 2O78A 4NSLA 1C3UA 1XWOA 1C3CA 2PTRA 4YIKA 1XL7A 2RJSA 2NYFA 3UNVA 1K62A 1Q92A 2YV5A 4C5SA 3C8TA 2OHYA 1YFEA 3QBPA 1FUPA 3RRPA 1GKMA 2I7DA 3F4SA 3F4RA 1I0AA 3R6QA 2O7DA 2VD6A 4IQJM 1DOFA 4V2QA 5M0IA 1FUQA 2FELA 4BABA 3KDYA 1XLYA 1J3UA 3BWVA 1GKJA 2X75A 5HW2A 3KDZA 1KQ7A 1GK3A 1HY1A 5H8WA 4APBA 1FUOA 3F4TA 1K7WA 4CQ5A 4E88A 1MH9A 1GK2A 5EYTA 4C6GA 3CZOA 1YFMA 2JAWA
chains in the Genus database with same CATH topology
2QGAB 2YIIA 4C5RA 3GZHA 3OCFA 1T6PA 2PTQA 1DCNA 2QVEA 3E04A 4V2RA 1B8FA 4HGVA 1FURA 1TJUA 1RE5A 1U15A 5F92A 2J91A 1HY0A 5EYVA 3TV2A 3GTDA 1U16A 4BAAA 2O6YA 1Q5NA 1EB4A 3OCEA 1W27A 1T6JA 2E9FA 5F91A 4FLCA 1TJ7A 4EFCA 1TJVA 4NLEA 3NZ4A 3R6VA 2RJRA 1TJWA 5D6BA 2HVGA 4C5UA 1AUWA 1JSWA 3NO9A 4ADLA 1YISA 2O7FA 1Y2MA 3RD8A 4APAA 2O7EA 4MX2A 2FUSA 4FFXA 1VDKA 2NYNA 2O7BA 2PFMA 2PTSA 3R6YA 4ADMA 4EEIA 3BHGA 2O78A 4NSLA 1C3UA 1XWOA 1C3CA 2PTRA 2RJSA 2NYFA 3UNVA 1K62A 4C5SA 3C8TA 2OHYA 1YFEA 3QBPA 1FUPA 3RRPA 1GKMA 3R6QA 1I0AA 2VD6A 2O7DA 4V2QA 1DOFA 1FUQA 4BABA 3KDYA 1J3UA 1GKJA 2X75A 5HW2A 3KDZA 1KQ7A 1GK3A 1HY1A 4APBA 1FUOA 1K7WA 4CQ5A 1GK2A 5EYTA 4C6GA 3CZOA 1YFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QGA B;  2YII A;  4C5R A;  3GZH A;  3OCF A;  1T6P A;  2PTQ A;  1DCN A;  2QVE A;  3E04 A;  4V2R A;  1B8F A;  4HGV A;  1FUR A;  1TJU A;  1RE5 A;  1U15 A;  5F92 A;  2J91 A;  1HY0 A;  5EYV A;  3TV2 A;  3GTD A;  1U16 A;  4BAA A;  2O6Y A;  1Q5N A;  1EB4 A;  3OCE A;  1W27 A;  1T6J A;  2E9F A;  5F91 A;  4FLC A;  1TJ7 A;  4EFC A;  1TJV A;  4NLE A;  3NZ4 A;  3R6V A;  2RJR A;  1TJW A;  5D6B A;  2HVG A;  4C5U A;  1AUW A;  1JSW A;  3NO9 A;  4ADL A;  1YIS A;  2O7F A;  1Y2M A;  3RD8 A;  4APA A;  2O7E A;  4MX2 A;  2FUS A;  4FFX A;  1VDK A;  2NYN A;  2O7B A;  2PFM A;  2PTS A;  3R6Y A;  4ADM A;  4EEI A;  3BHG A;  2O78 A;  4NSL A;  1C3U A;  1XWO A;  1C3C A;  2PTR A;  2RJS A;  2NYF A;  3UNV A;  1K62 A;  4C5S A;  3C8T A;  2OHY A;  1YFE A;  3QBP A;  1FUP A;  3RRP A;  1GKM A;  3R6Q A;  1I0A A;  2VD6 A;  2O7D A;  4V2Q A;  1DOF A;  1FUQ A;  4BAB A;  3KDY A;  1J3U A;  1GKJ A;  2X75 A;  5HW2 A;  3KDZ A;  1KQ7 A;  1GK3 A;  1HY1 A;  4APB A;  1FUO A;  1K7W A;  4CQ5 A;  1GK2 A;  5EYT A;  4C6G A;  3CZO A;  1YFM A; 
#chains in the Genus database with same CATH topology
 3CI0 K;  1Z4Q A;  2QGA B;  2YII A;  3U13 A;  4C5R A;  3GZH A;  3OCF A;  2D27 A;  1XL8 A;  1T6P A;  2D28 C;  2PTQ A;  1DCN A;  1Z4J A;  1Z4L A;  1Z4P X;  2QVE A;  3E04 A;  2JAU A;  4V2R A;  5M0J A;  1B8F A;  4HGV A;  1FUR A;  1TJU A;  1T9H A;  1RE5 A;  1U15 A;  5F92 A;  4L57 A;  1HY0 A;  2J91 A;  1IW7 D;  5EYV A;  4MWO A;  1Z4I A;  3TV2 A;  2VL7 A;  3GTD A;  3CRW 1;  1U16 A;  4BAA A;  2O6Y A;  1Q5N A;  1U0L A;  4NFL A;  1EB4 A;  4A15 A;  3OCE A;  1W27 A;  1T6J A;  2E9F A;  5F91 A;  4FLC A;  1TJ7 A;  4L6A A;  4EFC A;  2FEN A;  1Z4M A;  1TJV A;  4NLE A;  1Z4K A;  4WNL A;  3NZ4 A;  3R6V A;  2RJR A;  1TJW A;  5D6B A;  2HVG A;  4C5U A;  2RCN A;  1AUW A;  2JAR A;  1XMD A;  1JSW A;  3NO9 A;  4ADL A;  1YIS A;  2O7F A;  2VSF A;  3CRV A;  2JAO A;  1Y2M A;  3RD8 A;  4APA A;  2O7E A;  4MX2 A;  4YIH A;  2FUS A;  4MUM A;  3U19 A;  4L6C A;  1VDK A;  4FFX A;  2NYN A;  1Q91 A;  2O7B A;  2PFM A;  2PTS A;  3R6Y A;  4ADM A;  4EEI A;  3BHG A;  1XMC A;  2O78 A;  4NSL A;  1C3U A;  1XWO A;  1C3C A;  2PTR A;  4YIK A;  1XL7 A;  2RJS A;  2NYF A;  3UNV A;  1K62 A;  1Q92 A;  2YV5 A;  4C5S A;  3C8T A;  2OHY A;  1YFE A;  3QBP A;  1FUP A;  3RRP A;  1GKM A;  2I7D A;  3F4S A;  3F4R A;  1I0A A;  3R6Q A;  2O7D A;  2VD6 A;  4IQJ M;  1DOF A;  4V2Q A;  5M0I A;  1FUQ A;  2FEL A;  4BAB A;  3KDY A;  1XLY A;  1J3U A;  3BWV A;  1GKJ A;  2X75 A;  5HW2 A;  3KDZ A;  1KQ7 A;  1GK3 A;  1HY1 A;  5H8W A;  4APB A;  1FUO A;  3F4T A;  1K7W A;  4CQ5 A;  4E88 A;  1MH9 A;  1GK2 A;  5EYT A;  4C6G A;  3CZO A;  1YFM A;  2JAW A; 
#chains in the Genus database with same CATH homology
 2QGA B;  2YII A;  4C5R A;  3GZH A;  3OCF A;  1T6P A;  2PTQ A;  1DCN A;  2QVE A;  3E04 A;  4V2R A;  1B8F A;  4HGV A;  1FUR A;  1TJU A;  1RE5 A;  1U15 A;  5F92 A;  2J91 A;  1HY0 A;  5EYV A;  3TV2 A;  3GTD A;  1U16 A;  4BAA A;  2O6Y A;  1Q5N A;  1EB4 A;  3OCE A;  1W27 A;  1T6J A;  2E9F A;  5F91 A;  4FLC A;  1TJ7 A;  4EFC A;  1TJV A;  4NLE A;  3NZ4 A;  3R6V A;  2RJR A;  1TJW A;  5D6B A;  2HVG A;  4C5U A;  1AUW A;  1JSW A;  3NO9 A;  4ADL A;  1YIS A;  2O7F A;  1Y2M A;  3RD8 A;  4APA A;  2O7E A;  4MX2 A;  2FUS A;  4FFX A;  1VDK A;  2NYN A;  2O7B A;  2PFM A;  2PTS A;  3R6Y A;  4ADM A;  4EEI A;  3BHG A;  2O78 A;  4NSL A;  1C3U A;  1XWO A;  1C3C A;  2PTR A;  2RJS A;  2NYF A;  3UNV A;  1K62 A;  4C5S A;  3C8T A;  2OHY A;  1YFE A;  3QBP A;  1FUP A;  3RRP A;  1GKM A;  3R6Q A;  1I0A A;  2VD6 A;  2O7D A;  4V2Q A;  1DOF A;  1FUQ A;  4BAB A;  3KDY A;  1J3U A;  1GKJ A;  2X75 A;  5HW2 A;  3KDZ A;  1KQ7 A;  1GK3 A;  1HY1 A;  4APB A;  1FUO A;  1K7W A;  4CQ5 A;  1GK2 A;  5EYT A;  4C6G A;  3CZO A;  1YFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...