4E88A

Crystal structure of de novo designed cysteine esterase ech13, northeast structural genomics consortium target or51
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
195
structure length
194
Chain Sequence
b'GRALRVLVDMDGVLADVEGGLLRKFRARFPDQPFIALEDRRGYKAEQYGRLRPGLSEKARSIAESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPHKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DE NOVO DESIGNED CYSTEINE ESTERASE ECH13
publication title Northeast Structural Genomics Consortium Target OR51
rcsb
source organism Synthetic construct
molecule tags Hydrolase
total genus 61
structure length 194
sequence length 195
ec nomenclature
pdb deposition date 2012-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4e88A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4e88A01
4CNQA 3L8FA 2BDEA 2NO5A 1YS9A 3BWVA 5AW8A 5ALIA 2JGAA 2MSNA 1WR8A 1RC8A 1VFPA 3NUQA 2P11A 2ZBDA 2I7DA 2ODAA 4UM5A 2FPUA 2VKQA 4MWOA 3CNHA 1L7PA 4Y2SA 4AS3A 4C4SA 1J8DA 4YH1A 2R8ZA 1ZRNA 3ED5A 2HI0A 4OHFA 5AM2A 5IT0A 4BYGA 3QLEA 2R8YA 4FYPA 3WK4A 2YN4A 1RQNA 4UMVA 2ZXEA 5AESA 3WKEA 3FM9A 2EARA 2B1RA 2WF9A 2YJ3A 3PGVA 4L6CA 2FUEA 2YJ4A 4Y2QA 2HCFA 2HF7A 1Z4KA 1Z4OA 3PCTA 2Q5EA 1AQ6A 3F9RA 4AS2A 3VAYA 2IYEA 3QUTA 3I28A 4Y2PA 2Q4RA 2CFRA 1T5SA 2YJ6A 3E58A 3ZX4A 3ZI4A 4UAUA 4HGNA 1QH9A 1Z88A 3AR6A 3IB6A 3IRUA 3N5KA 5AI8A 2W4MA 4UM7A 2I34A 3A1CA 2O9JA 3WK6A 1WPGA 4RETA 4C4RA 5AW0A 5ALQA 2YFYA 1RRCA 5IT4A 3DV9A 3W5BA 2JAOA 5AM0A 3PGLA 2HX1A 4F72A 2YMPA 4Y2RA 4EELA 3L1UA 3E8MA 4XPZA 4GXTA 1QQ7A 2YJ5A 5AVSA 3WKCA 4CF5A 5AI0A 3WK5A 1XVIA 2YBDA 3NAMA 1YMQA 5AI9A 5AKIA 1TA0A 2I33A 5AM3A 3MPOA 2WFAA 1U2SA 3L8EA 5AKEA 4BKMA 3NALA 1Q91A 4J03A 5AKZA 1U2TA 5ALZA 2G08A 4AP9A 3I76A 1ZS9A 2WM8A 4KX5A 4DW8A 4PNHA 2HDOA 3QNMA 4NAVA 3EWIA 2R8XA 2B8EA 1RQLA 5AKLA 3QUBA 5AI4A 3E81A 1EK2A 3KC2A 4CE6A 3U7HB 4NV0A 5AM4A 4XQ0A 3K1ZA 1VJRA 1U02A 5AKKA 2ZOSA 3NANA 2AUTA 5AVVA 4BBJA 1S8OA 2ZG6A 2CFSA 3B8EA 4FFDA 5AW6A 1ZJJA 2I55A 3U19A 4DFDA 3U7FB 3R4CA 4L6AA 1L8LA 4IFTA 1PW5A 4QQFA 3AR2A 3SHQA 3QU7A 4Y2XA 4I9FA 3M1YA 3SF0A 2YMMA 2FEAA 2C8LA 3QGMA 4EZEA 4YIHA 3P96A 2G09A 4Y2JA 5AK3A 5ALEA 1S2OA 5AM1A 3W5CA 1FEZA 1RMYA 1ZD5A 4O8CA 5AIAA 1MH9A 4KX3A 1WVIA 5AI5A 4NWIA 3R9KA 1N8NA 1Z4MA 5ALRA 1J97A 3W5DA 3ZTYA 2PQ0A 5IS2A 1T5TA 5AKGA 3UMGA 5ALKA 2C88A 4ZEVA 2W11A 2G06A 2HEGA 3I6BA 4UW9A 3U7GA 3L0CA 4IG4A 3OCVA 3D6JA 5AKYA 2RAVA 3IJ5A 5AVYA 2JAWA 2HHLA 5AIBA 2WF7A 5FP0A 4OCZA 1JUDA 1LVHA 3B9BA 5ALJA 5ALUA 1U7PA 1QYIA 3B9RA 2ZBFA 5ALSA 2B82A 3WKBA 3ZUPA 3NRJA 1L8OA 3QU9A 1RPZA 4HAIA 2IOHA 1L7NA 5JJBA 3QU5A 2AGVA 2YMQA 4QJBA 3QUQA 1K1EA 2P69A 3SKXA 3M9LA 2OM6A 3DNPA 3SD7A 4CF3A 1CQZA 2HOQA 3QYPA 1XP5A 2QYHA 2RARA 2HF2A 3AR9A 2AMYA 4MUMA 1SWWA 3KBBA 4JB3A 4B6JA 1ZRMA 4FE3A 4UMDA 1RMQA 1Z4NA 2B30A 2I6XA 3L7YA 2C8KA 2GHQA 3SKYA 1VJ5A 2GHTA 3SMVA 3L5KA 4BX3A 3NIWA 2AH5A 3ZX5A 1NF2A 3N07A 4BEVA 4ZEWA 2I54A 1RKQA 2WF5A 3ZVLA 4ZEXA 1NRWA 4HGRA 1XPJA 1NNLA 3KDPA 3ET4A 4NABA 3KOOA 2OA0A 3ZWDA 2P9JA 4H1WA 1RKUA 4CF4A 5A3RA 4BNDA 3UM9A 3E84A 3DAOA 3N28A 5E0OA 1U7OA 4KYTA 4UASA 2G80A 3PDWA 3WK8A 2FPXA 3EF1A 3UMBA 3OCXA 5AI6A 2OYCA 5AW7A 2W43A 1ZOLA 3N1UA 5AKHA 5AVWA 3QXGA 2P27A 2HO4A 5ALLA 4L57A 1Q92A 4HGPA 2B0CA 1ZD4A 2PR7A 2WF8A 2JARA 5ALOA 2BDUA 4UMFA 3FZQA 4OFZA 1RMTA 3ESQA 1L6RA 5AVZA 3WKDA 3OCWA 3WGVA 1LTQA 2IA5A 3L0YA 5AVTA 3MN1A 2FPRA 3AR8A 1Z5GA 3HLTA 4GIBA 5A3QA 2B1QA 5AVXA 5AVUA 3ZWKA 2PKEA 1TJ4A 3ZU6A 4F71A 1RLOA 1Z4IA 3S6JA 4BNDB 1TE2A 3OTQA 2YY6A 3U7EB 2FUCA 2G07A 3FPBA 3KZXA 5ALYA 2B8JA 3AR3A 5ALDA 3MC1A 1IWOA 4Y2VA 4EENA 3J7TA 1Z5UA 3OCUA 1RKVA 4DWOA 2YMLA 3AR5A 2G1AA 4I9GA 5AW5A 4RESA 3A3YA 5T41A 1ZD2P 3QX7A 5ALGA 2HSZA 3QU4A 4C4TA 4EEKA 2DQSA 1KYTA 5AW9A 3WGUA 4HGQA 1Z4JA 2RB5A 5AW1A 4YCNA 3L8HA 1CR6A 1WZCA 4YCLA 5AKXA 1RLTA 2WHEA 3AR4A 1RLMA 5ALPA 3ZVNA 1T9ZA 3W5AA 4KNVA 1ZD3A 5AW3A 4J2TA 5AICA 3U26A 2JAUA 5AW2A 3L0BA 4XOUA 5ALFA 3DDHA 3FVVA 5A3SA 2O2XA 3A1EA 3ZVMA 2D2VA 2GFHA 5ALXA 2MU1A 5ALNA 2QLTA 3WK9A 1TJ5A 3ET5A 2ZBEA 2GMWA 2EAUA 3CZ4A 4UATA 4DCCA 5AM5A 2G0AA 4NFLA 3I1YA 5ALMA 2IOFA 1EK1A 3R09A 4YCMA 2R8EA 2ZBGA 3OCYA 3ZW7A 1YV9A 3N8GA 3WK7A 4BEWA 1Z4PX 4E88A 1N9KA 1YDFA 2FI1A 3MMZA 1YNSA 2IOFK 2BY4A 4Y2UA 4UAVA 1Z4QA 4YGYA 1QQ5A 4UU0A 4UMEA 4UU1A 3FPSA 4HGOA 5ALWA 5ALVA 3QU2A 3L8GA 1L7OA 1X42A 4KNWA 3EPRA 4OD0A 2CN1A 3BA6A 3FGOA 4YIKA 3L1VA 1SU4A 3AR7A 4UARA 3RF6A 5AVQA 4JDPA 5AK4A 4BX0A 5ALHA 4XE5A 3ONNA 3ZTWA 3RFUA 1F5SA 2WF6A 1SWVA 1TJ3A 2FPSA 5ALTA 2FDRA 2C4NA 1Z4LA 2GO7A 1L7MA 2EATA 5AVRA 2CFTA 4Y2TA 2NYVA 3UMCA 3OPXA 1YJ5A 2OBBA 4G63A 4Y3UA 3TLMA 3NASA 2Q4TA 1RDFA 2NO4A 3OCZA 3SLRA 5AW4A 3HYCA 2RBKA 3WKAA 4Y2YA 2FPWA 1O03A 2C9MA 3ESRA 4HYTA 5AK5A 3KD3A 3U13A 1O08A 1Y8AA 4EX6A 4EX7A 3A1DA 1QQ6A 5AKJA 4G9BA 5AK6A 3QUCA 4BX2A 2X4DA 3GYGA 3EF0A 5AHXA 4KN8A
chains in the Genus database with same CATH superfamily
4Y2GA 4MUJA 2NZUG 1UJ4A 4RTSA 1ZGCA 3ROGA 2B7CA 3ZWVA 1AGXA 2JZOA 3ABRB 4JKYA 1K7YA 4YAGA 1WVGA 2YHBA 1Z0IA 2AMVA 3VNBA 2ZAYA 1KJNA 1YQQA 3E18A 2GZ1A 3FTDA 2P11A 2QUIA 1GKLA 4ZO6A 3OMWA 4DCJA 1RAFA 3RIXA 5A71A 1GUYA 1NL3A 3TTXA 5K6RA 3WJ7A 4F4UA 1YRBA 3AUUA 3TPCA 1U8TA 4MWOA 1M2WA 2QZJA 5REQB 4NJOA 4N82A 4HH4A 1E2BA 1X7ZB 1E98A 1HT2E 1R5JA 3H9UA 1XO1A 5LP6C 2DX7A 3O3NB 1M34B 4HZIA 3TTYA 5CK5A 1R0KA 1ECPA 1DIHA 4AS1A 1J8MF 1PTJC 4F3KA 2WBLC 1PD1A 4JP5A 4YGXB 5B7QA 3ZJUA 4W5HA 1TUGA 3WGYA 1ONOA 5H16A 1W0CA 4FGKA 4AMZA 2ZXEA 1E3EA 5LP1A 3TNYA 4JI2B 2A4KA 1JIVA 4W1PA 4OQZA 4XYMA 3RUAA 4CLOB 1K4KA 1MT3A 3NOQA 2CL0X 4L16A 2XRYA 2Z2JA 4R9SA 3UH0A 3R76A 2AFIA 3C3EA 3DOJA 2I6UA 4D79A 2X5KO 3OIYA 2DBZA 3H1GA 1XXHB 4LRTB 4MKIA 1FX0B 4CTOA 5KTPA 1I7LA 4ZAFA 2C9YA 1Z0AA 3LY9A 4C30A 3ASVA 1TA4A 2CMKA 2PXXA 2J30A 1L5HA 1DDOA 3PFKA 4G8CA 2Q4OA 3WIEA 4NU0A 5C8YA 2I1WA 3MELA 3P4XA 4Q05A 4OFWA 2X0DA 1JECA 4FOOA 1PYGA 4R41A 4MGKR 5FWDA 2I8LA 2YWRA 3R8CA 1IK6A 5EZ5A 3A1CA 3TZBA 3ELBA 2A9KA 2O0HA 5A0FA 4FGJA 1Q14A 3D6UA 4RXMA 2A1UB 5EWJB 4CM8B 4GPAA 4AM8A 3BERA 2OG1A 4N18A 4O1MA 4WKGA 4AJ9A 2EX0A 3UGKA 1DX6A 1NVWQ 3A04A 3PBKA 4H6VA 1YL6A 4CR6A 2AG5A 2FJUA 5K4AA 4G5RA 4LCEA 1UQUA 1IQPA 2BMEA 3PQ7A 2RAFA 5FQOA 3N0XA 3WKCA 5JSZA 4BFZA 1MO3A 4I9HA 3GG9A 1KXJA 2OYSA 1ZA2A 2EIXA 3QXSA 2GPNA 3AEYA 3DVLA 3BRWD 3I23A 3W1WA 4CMHA 1YDHA 2VZ9A 3R77A 3VPDA 3ZU2A 1X9GA 2PFGA 4IRMA 2JZCA 1QYRA 1KZ9A 2OKCA 4JMLA 3EWNA 4M9XA 2I33A 3EZYA 3CE9A 2BZGA 1K8QA 2R87A 1POWA 4LK2A 2XDYA 4M1MA 4JI3B 4I6GA 1H85A 1N2JA 2V9CA 2G72A 2I6QA 1GAJA 3AG6A 3R0JA 4WBSA 2QYTA 4MWGA 4RS3A 1RCTE 3O83A 2E4ZA 4JN6B 3R0QA 2IRWA 3FDJA 1OREA 1PDWA 3ESDA 3KXLA 4NZMA 5FUBA 2DCMA 5KJEA 1DLJA 3UH1A 1KMMA 4ZZ3A 3FMOB 3OTIA 2FUSA 2YJTD 5K3OA 2AMLA 1IAQA 1CJTC 3G9QA 3DC7A 2WG0A 3Q3JB 3TDMA 1XQYA 3WLRA 4L4SA 5EP1A 2X7HA 3NW9A 3O84A 1NZFA 1UKBA 2GBLA 3MTJA 2AFHE 3FYUC 1D2CA 3C0KA 4P92A 4X93A 4F1JA 3VDRA 1BIFA 3WMRA 1OI2A 3U3XA 5K9ZA 2H16A 1JJFA 4LTNA 2R84A 2EEPA 1RLJA 1THGA 5I7SA 9MHTA 1FC0A 4XIFA 2PH1A 4CTMA 2XRZA 1AIPA 2RHOA 2WSBA 2PSEA 5K01A 1HPLA 3L6BA 3WRXC 1YVEI 5C32A 4EGSA 1FDTA 4HBGA 3SEZA 4EOGA 1O3YA 3HU1A 4NNJA 2V9PA 1KJJA 4RF2A 1TJ7A 1V47A 1W76A 2XAAA 1Y6JA 1NOIA 4QBKA 4IQ8A 1TYEB 1PR2A 1W8IA 5JG7A 3ZNOA 1PNRA 4P2GA 3IKLA 4FUTA 3OFND 1OWPA 3WY9A 2VQFB 4ILKA 1FNNA 4TVSA 1PGNA 4MEBA 2GERA 4U8GA 4AMUA 5BVHA 1EVLA 1WULS 2C98A 4JNKA 4MDYA 2NGRA 4ETWA 4CDGA 4JP3A 2FH5B 3LW7A 1GSHA 1N4DA 4GOMD 5JYBA 4GKVA 1PT9A 2PGNA 4WFJA 3ZXXA 3U81A 1ZGAA 4C0AC 4YIHA 2VH1A 5CFZA 4DV0B 3FFAA 3M4NA 4L72A 4Y2JA 1YS4A 1GNTA 3C15C 2WIBA 3IR7A 3NT2A 4X3PA 2E9SA 5E3JA 5J58A 3U16A 4MWDA 3V55A 3BVPA 1KBZA 4NWIA 4QE3A 4AP5A 3TINA 2GAOA 4A0HA 4DA0A 3AESA 3N2LA 5IBPA 3B60A 3P9NA 4YFVA 3CRQA 4EBBA 1ZR2A 5GINE 2Q9BA 4GUAA 1XLVA 1EBBA 3W5DA 2BFBA 2ZPUA 4BUZA 2L19A 2J32A 4YMIA 1FQOA 2NO1A 1XMSA 1A4UA 4IQFA 4L2IA 2D5AA 1JDBB 2VK4A 1B43A 2W4QA 2WTMA 3W2IA 3RRYA 1YCGA 2VHEA 1YRYE 1SXJC 1I3CA 1SELA 4RY8A 1N5LA 4UNPA 3JQCA 3WSWA 4ZHQA 2FJPA 1GGVA 1YR6A 2IBSA 3DEAA 3S5UA 3NO9A 3NORA 2W71A 2DVMA 5ALJA 2LZ0A 2XCLA 1T13A 3RVOA 4GOKA 1MZPA 2YDXA 1Y5NA 1QC5B 1R5BA 3F5SA 3TNDA 1QFYA 1KMQA 3R3VA 5CW2A 5EHNA 4D5GA 3PNOA 1T9GR 2CCKA 4QLBA 1KQ3A 3A6KA 5A04A 3ZE1B 4D8XA 2XVYA 1N1EA 1N2HA 4Y2HA 4LDNA 3A25A 2QDXA 4B6OA 1A8UA 4BWVA 4ND6A 5JMTA 2WB2A 1JEEA 5KO2A 4K81B 4R8RA 1FUOA 5BYAA 1D8AA 5ABPA 1Y8ZA 4R0VA 1Z39A 4TS1A 4DHWA 1GKUB 2P9EA 3ZGXA 3AEQA 4YRLA 4OEHA 5HZHA 3A36A 1NMZA 3SKXA 5JU6A 1XV5A 1IY8A 4DR5B 3NAQA 2ADMA 2VYFA 2ZIFA 4PZLA 1XTIA 2FEMA 2QY6A 2X14A 2ZB7A 4NHEA 2JIBA 4XARA 5ENZA 3NI2A 3GZNB 3MJEA 4GH5A 4MGZR 1NVMB 4I3GA 3NOOA 2UXCB 3BE6A 3H1FA 3ZQKA 1L4HA 3MT9A 1NHGA 3H1EA 4Q37A 4PHHA 2IW1A 2NTYC 5GJCA 1P31A 1YZVA 4W5JA 3UN1A 1VL8A 1OVGA 3VR6D 2W2PA 4IHJB 4Y6LA 4QUDA 4S12A 3IQEA 1RCUA 1KE1A 1JAHA 1G3IA 1NY5A 1YZGA 2CCJA 4FR2A 1MAAA 2IPMA 1A77A 2VSNA 3FIUA 3LT1A 2AN4A 4BEVA 2PXCA 3PHGA 3WGTA 4J0DA 3GOHA 2ZJ3A 1NXOA 5T4FA 3V7UA 2GN4A 2P1RA 1CRWG 1FFHA 1PDVA 3CCCA 3EDOA 1IEXA 4FLEA 4FW9A 4KO4S 3UGTA 2OP1A 4U0JA 2I0FA 3QVTA 2M1XA 3LLVA 4EYKA 4AVYA 3MOIA 2GN9A 2X86A 1IM8A 3CXRA 4Q01A 2PUJA 3QKSA 2R2GA 1N7IA 5L4NA 1NURA 2KI5A 3ZWCA 2VXYA 5IF9A 5HRAA 4BNDA 4RFSA 4PIVA 3MOGA 3E84A 1I8TA 2IYLD 3CGWA 5FXMA 4YWJA 5HYVA 1U11A 2AJDA 4GWLA 4UASA 3OM1A 4MXDA 4Q18A 5G1PA 1XZLA 4BLOA 4O4LB 1RQ2A 1MXHA 1YA8A 4PSAA 1O0BA 5GAJA 2O5EA 1E66A 3OICA 2Q1TA 2WJ3A 4FWIB 2HIAA 4I4TA 2PRJA 1JPVA 1MOPA 2V7XA 3FVWA 4YP6A 1YC2A 1E96A 3KS9A 4BKQA 1QIJA 4MP8A 2JNWA 3AM1A 1COWA 3PGKA 3T3HA 4CIDA 1XQ1A 4ETMA 4ZI7B 1TLTA 2X23A 4DR6B 3SM9A 3Q2KA 1YRQA 3VJRA 4QYWA 4YPFA 3ESCA 5IXJA 1EEXB 1ZI9A 3B7WA 5KTKA 2OC4A 2W98A 1NBOA 5GQSA 2GCPA 2VBGA 3WWOA 5AVTA 4J75A 5M7EA 3GLRA 4ZAXA 2YWXA 4YJGB 5I7EA 3NWBA 4A8JA 5K09A 5LJIA 3L7CA 3GEDA 1O57A 3RC2A 3ICWA 3PFHA 3GBVA 4R9VA 3D8TA 2XZOA 3EPHA 4WOPA 4BQRA 3T99A 4TT3A 2RSLA 5EFOA 4ZYXA 2QD4A 3SDSA 3D6FA 1BXGB 3VQTA 5JJLA 4MW0A 3Q41A 3TUIC 2DECA 1W2WB 2OAGA 4WXMA 4H2DA 4F3CA 3JSAA 4XWKA 5JO9A 3E5NA 3I32A 1A72A 4ZOAA 1MW8X 1YVRA 3G2QA 3ZV6A 4R9UC 1YZQA 5ESRA 2VJPA 5AJTA 1RM4A 2HJGA 4MQMA 4B47A 2QRMA 5C7LO 2JVIA 4Z0HO 3PIRA 1MO6A 4TTTS 1Q1BA 4MW2A 2F8LA 4MSUA 1EFVA 2CJXA 3DQZA 3X1WA 2BHLA 2Q50A 2VSFA 3HJBA 4U3JA 2J4FA 3AF0A 2XDQA 4R8VA 3E61A 3IBCA 5FFNA 3ZI7A 4UCXA 3U1TA 4O2AA 2DQKA 4UXHA 1KVUA 3T9FA 1CLEA 4ALLA 3KEFA 1WB4A 3Q2IA 1N2XA 1UBRS 3I34X 4WW0A 1OLSA 3TKYA 2V6BA 4Q1AA 4TZ6A 1RRPA 5IYZB 5BORA 2JCYA 4QTUB 5FOSA 5C53B 4TXNA 1IHXA 4G01B 4EF4A 1VDKA 1GZ4A 2FPPA 2IGTA 1JIIA 2VP0A 2OQ2A 5JSFA 1NFQA 1T25A 4KO3S 2DTXA 1MAHA 2UYYA 1G42A 3ENVA 4CIVA 1SU7A 3ER6A 4JC4A 4MB6A 2VA9A 1JHPA 1LQUA 2XUAA 1Q57A 4S0ZA 3ZHQA 1ID1A 1KEUA 3PNBA 3LUKA 4TMZA 1U2GA 2GDJA 1NC1A 3BCRA 1JR2A 4IFIA 2QTBA 2WD7A 5K0TA 4N01A 3CW8X 3TDNA 1L5VA 4L3OA 3PR3A 1MUUA 3TW4A 3NLLA 1IN1A 1Y8RA 2G63A 3KYIB 4QYXA 3WRVA 3IDOA 2QUZA 2O05A 4D56A 3X43A 3V7NA 2VTBA 5E7MA 5I7RA 1L8QA 2FPLA 4LMAA 1V1RB 3L0BA 4TOIA 2DUMA 4AF7A 5L7YA 1DJPA 3FH0A 1WB5A 4P98A 4YJHA 5EPOA 4YUAA 1E20A 2G8NA 2O06A 4DIMA 2PZAA 5TGTA 1N2ZA 1TJYA 2XHEA 4J7UA 1SVNA 4NK4A 2GPBA 3TSOA 1GCIA 1KOJA 2J3MA 1DQYA 2VI5A 3KZOA 1I2CA 1J22A 1VE6A 2EL9A 1F8YA 2W6NA 4M55A 3UC5A 1JQEA 3PGMA 4L2IB 1T8YA 4LDRA 2XTJA 1HY0A 2OBMA 4GXQA 9LDBA 1H0SA 1QG6A 1E9FA 4S35A 1OXMA 3MK31 2OG2A 3L7JA 2IOFA 3O7MA 4NC9A 2GXAA 4XWTA 3D4BA 2ODBA 3Q7IA 2IYUA 1LLFA 1Z2CA 2JKZA 1ZK4A 3A3PA 3BULA 4AG3A 2W4IA 4XPIA 3EGVA 1AZTA 2IU4A 4JBHA 1EFKA 1YDFA 5CLLA 4Z9FA 2VDJA 1AA9A 3QK7A 2P5UA 3F3SA 1PGOA 2WPDD 3ZY2A 3V9AA 3IAXA 4NEGA 4EYGA 2HNAA 5D2CA 2VDWB 4GBGA 3WMFA 1RI3A 4J3FA 3FGPA 4DLTA 2KLHA 4YRPA 5AHKA 1FMFA 2GJSA 2J59A 3HKEA 3CF6R 1GV0A 2PMWB 5ESXA 4URHA 5BW5A 2QQ0A 4P0QB 3CMCO 1ZH6A 3THYA 1VE7A 3F97A 1B8NA 1FMCA 5L3ZA 2XW6A 4FGWA 3LE8A 2VT6A 4H1VA 3ZWMA 5AVQA 4TMTA 3FR8A 1E99A 4IO1A 4CMGA 2ZSDA 3JD2A 3GCZA 2QVZX 3RFUA 2BZ1A 5ILOA 4BVKA 4RVDA 4Q7MB 3IKTA 5K51A 1VCOA 2HLDD 1AK1A 5CNKA 4Q9JA 1DAPA 3OWHA 1KMCA 1KO4A 1KI7A 3OURA 3SI7A 1WP9A 5CCBA 5DHRA 3HZRA 1ZNXA 2BJWA 5J5AA 2C61A 1Y5MA 3N5CA 4HH3C 2QG9A 3DMYA 2ATEA 2P8SA 1MD9A 2W8ZA 4FMDF 3B3JA 2NLOA 4O4JF 4GVLA 1DV1A 2MSKA 4JDUA 4NFSA 4PAQA 1NMYA 5F9HA 3VV2A 4LYGA 3BFPA 2CNWA 3DOHA 1SKYE 1BWRA 3TLMA 1W34A 1O54A 3VPCA 3OCZA 4NZNA 1FPMA 2Y2UA 4QYSA 4RZXA 1DQNA 3EQ8A 2ZUBA 3H5WA 3N2KB 4C78A 4N3BA 4V24A 3MFYA 1C7FA 2W6QA 1TU3A 3OH8A 4I8DA 4Y2YA 3SVTA 3G0HA 3ODGA 4CXMA 1IB0A 1DC3A 4EVQA 1DO8A 1XP8A 4RDCA 4K1XA 3QEMB 3OEYA 2GZMA 1H05A 1BDMA 2D62A 1W30A 2JEOA 3OKCA 2D74A 1O96B 1R6VA 4MHSA 4X6UA 4ANFA 2QX7A 2P6PA 4KAFA 4A7PA 3U9LA 5A7FA 3CUEF 2FAXA 4N0PA 1PQYA 2KSQA 4BMNA 3HKCA 2OFOA 1BMFA 1Q0HA 4XSGA 3U1BA 1VJCA 3KNZA 1CZLA 4AKIA 1HF3A 3HU2A 2QTHA 4OQNA 1JA0A 4NE2A 2QL9A 1QO7A 3I5MA 3ENQA 3IDSA 1P6QA 2OPBA 1VBNA 2E21A 4NH0A 2IIVA 1DJMA 3A3KA 1IW7D 1ZW1A 4UM5A 5E6SA 4X1YA 3ZHSA 1PS0A 3NHUA 1IQ0A 4K9PA 4Y0VA 2FSPA 4AJNA 4R7TA 4AZSA 1FXSA 1JQBA 4JLJA 2DJ5A 4A8JB 4PXSA 5KU1A 1LSSA 2PJZA 2ZT8A 3D6VA 3NX4A 1CR1A 4X63A 4RZIA 1TQ8A 3L5OA 2PMBA 5CNMA 2CXPA 5DT2A 2FQWA 4FS8A 1K7SN 1VMAA 2UZ3A 2HU2A 2GK6A 3JSXA 3NTOA 4KWIA 4KYVA 3OM8A 4MV1A 3RD5A 4F4HA 4I1OA 3DJFA 3PNLA 4NBNA 2D5BA 4FYPA 4YQYA 2ZYAA 3SFTA 4UMVA 4J1TA 1DBRA 1EUYA 3AEXA 1EFPA 2XUGA 3MS7A 3OCJA 4MV4A 2WU0A 4MCJA 2M1ZA 3H5IA 3I04A 1LJ8A 1R4ZA 2J5RA 3IAEA 5E8RA 5SZKB 4KDCA 2FP3A 1Z29A 5EQTA 1N5JA 5GJVC 4B4KA 4LOLA 4NMLA 1A9QA 3TSCA 4DBLE 1KPGA 2V7QD 4TUYA 1VJDA 1C8LA 3JALA 5TY0A 3FIJA 2DHCA 2K7ZA 3NHYA 3HA2A 4CUZA 4DXHA 5IJ9A 3ANTA 1RWMA 2CJYA 2LCIA 1HX7A 4WESB 5EKXA 1GGKA 1T5SA 3A6FA 4KFTA 4ZXPA 1I4EB 3IQFA 2OMKA 4NXMB 3NHJA 2OGZA 5J2UB 4O4IF 1O97C 2XKAA 4NOJA 1QH9A 6PFKA 3DOUA 1JKXA 1W35A 1WQ4A 3AR6A 3N5KA 4M0LA 3VOTA 4EGCB 2NIPA 4R71A 1RWBA 4Q21A 1N2OA 3TOCA 2O4UX 4GEGA 2O9JA 2DC1A 3IEPA 2JIZA 3HWWA 2YJZA 3DDUA 1X9IA 3D7KA 1RT9A 3LCCA 3T5PA 3CJRA 3OECA 3ONDA 4GBMA 2Q0SA 5EN4A 5CMLA 3DMFA 3SEAA 1IB6A 3GPBA 5DPMA 4OBXA 3UZUA 5BN5B 3RSGA 4HXYA 4CI0B 3V8RA 4IBOA 1N5IA 1QDEA 1R10A 4GXTA 1ONBA 2MTBA 1RXWA 4G56A 1WF3A 3IQWA 4A27A 1XELA 4LDJA 3P5SA 4JQOA 2Q0HA 1XVIA 1BS2A 4OGFA 1PWEA 1Q7EA 4UM9B 1FRQA 5AXBA 1UBCA 1EWQA 1H4TA 2ZCUA 4ENVA 1ZUNB 1JHDA 3F98A 1ZNYA 4ZU6X 2VTBB 1NGSA 4Q4JB 3LQYA 3HA7A 2PX2A 2Y4OA 3P52A 4O2LA 4GOLD 5JSQA 3RADC 5FI0B 1N5KA 1EXVA 4OTZA 5DH9A 3MJVA 5ALZA 3KQPA 3C87A 1JG7A 2CYCA 1I1OA 3TG2A 3T1NA 1M1YB 5ITZB 4J0FA 5G3YA 5KPJA 2C59A 4U7FA 1WVMA 3K1TA 2ZRAA 2IOQA 3K2BA 4G0PA 4PLFA 3VNUA 3QNMA 2RKOA 3OKAA 4BB6A 4EY7A 2VUTA 2DH6A 4RABA 2R8XA 3HJNA 5JZMA 2C2XA 3MTQA 2X8BA 3M5PA 4FHFA 4H18A 1EK2A 4LZAA 3GLGE 1UDXA 4R84A 3FJYA 1KS9A 3MRXA 3VYUB 2HWXA 5JASA 1RP1A 4RLQA 1EQUA 3I9OA 4P34A 3C8UA 4CG3A 1WKCA 2KQUA 3TBKA 2XYGA 2QRVB 2PL3A 2QMUA 3DOFA 3H83A 3AW9A 2HPZA 1S8OA 3N2IA 1ACJA 4QA9A 2GXUA 3DMTA 4NH4A 1XDSA 1L7DA 3F4SA 1ZJJA 1ORWA 2GHRA 1CY1A 1UJBA 2PXAA 3GF4A 4YV0A 1I3MA 1Z5OA 5JYEA 1CUYA 5FO0A 4XWGA 1UAYA 1D5WA 1VSUA 3P2EA 1LU9A 4KE9A 2DBVO 3S28A 3DYBA 5EZYF 4IIXA 1EGVB 4MAFA 2BFMA 4MJ7A 2HN9A 3UJ6A 1FS4A 1MO5A 2O8CB 2B2NA 2PIDA 1KZ7B 1QIKA 3PNQA 1TD1A 5TXGA 3FOWA 3MYYA 1XRRA 5BN3A 4EFCA 2XCSB 2KS6A 3BD6A 3K9WA 2PZLA 4YQEA 4HPJB 2HNBA 2ZRNA 5KWEA 3BXPA 5J63A 3NHKA 2R6R1 1ZC3A 3GV0A 3SZ3A 1SHUX 3BG5A 2R4UA 4U7HA 4O8CA 4MOWA 2DAPA 1QRUA 2OK7A 1JIXA 3EX7C 3TXYA 2VZLA 5EMJA 3EWSA 4UDNA 2H4JA 4S1WA 3WIVA 1PV4A 3HKBA 1ZK0A 1G9TA 3JASB 1NIJA 1YBMA 3DE6X 1D0SA 1OA1A 4GPBA 4LXHA 4NCHA 5AKGA 5IS2A 1Z68A 4Z8YA 2CBXA 1RQPA 1H0HA 2C88A 2P0YA 5FJJA 1U0NA 2PKRA 5BW8A 1AO3A 4CIBA 1Y4AE 4B82A 2ZM5A 3OCVA 2H2AA 1E7WA 2Q6VA 4S05A 3WIBA 3SWWA 3THOA 1NU6A 3GD5A 3PE6A 3NHSA 1KWKA 2WM2A 4OK3A 3IMEA 4PRKA 3BB3A 5FWXA 1RFLA 2GZAA 4FB5A 2C1ZA 4U63A 1TO1E 2LVBA 4MICA 1SGWA 2XECA 2J85A 1TAUA 3GLQA 2G40A 3GK3A 3D5EA 4TM7A 3PUZA 4L0MA 4PZ0A 4BU0A 4UCWA 4BQIA 3F4TA 4NECA 1ZZGA 1E79D 2C2MA 2WIAA 4DYHA 5JJBA 1AV7A 1JSXA 3DC2A 4XXHA 4EFDA 1L7VC 5JNVA 4ACAA 2IP2A 3GRKA 4QJBA 4AKHA 4ZJZA 2H4ZA 3NHPA 3W6OA 3THWA 1D1QA 4WNYA 3EXG2 2PZEA 3UJNA 2HOQA 2RHCA 4ES6A 1WHTB 4LJSA 1E5LA 1QANA 5CG2A 2WIDA 2Q27A 1DRUA 2EX1A 2JCBA 2HSWA 2XOKD 3L7OA 4JK3A 3GT4A 3KBBA 2I6TA 3JQPA 4LAFA 4LJKA 4HN4B 5F2OA 1U3CA 5HJEA 1S5PA 3VH1A 1CKEA 1RE1A 1XVVA 5C5IA 1MJ5A 1ZLYA 3UMYA 1A50B 3RC9A 4D8YA 3WHKA 3HVJA 4DLPA 2WJIA 5FPQA 1Y6FA 2JGFA 4N3AA 3W2HA 2GHTA 1TGYA 5JCOA 3ZJYA 4Z4CA 3B6KA 4FHGA 3B1WA 4IKOA 5FWAA 4IWXA 1NF9A 2XBMA 2GAIA 3O4VA 4HPXB 4BX8A 3S8MA 1NV8A 1HY1A 1CE8A 1GTJ1 1JTVA 1Z0SA 2P7IA 3DKKA 4LC1A 2UU9B 3I37X 4RM3A 3LDFA 1J0AA 5DF1A 5C7OO 3C98A 3H5AA 3NBYC 4AG5A 4KQEA 2Y27A 2AWNA 4HADA 1GTSA 4ND4A 2WMDA 4G0MA 2FOXA 3WIDA 4RZUA 2VBFA 1K4MA 3W4KA 3ENKA 3Q3CA 1C4KA 2MCFA 1QE0A 3R9WA 2X0EA 1H23A 4RGYA 1DJNA 3BKWA 5H1YA 4J16A 3K70D 3VR2A 2RAUA 5I7FA 2GBLC 2H92A 3I2HA 4DLLA 2IYPA 2HGSA 3LM8A 3TX6A 4E4RA 2QZPA 5JNTA 1IJKA 1FUKA 3H19A 5DU2A 5JQWA 1Y7HA 2QI9C 3AGPA 3CNNA 5H70A 1E0KA 1R8JA 1WABA 2WNHA 3NDJA 2FWJA 3ZE8A 2ZRHA 4ALNA 4JLUA 1E7RA 4Z1MD 1W1UA 4DLBA 2GVDC 3JQAB 1LC0A 1TMGE 2B9VA 3NJRA 3LVRE 3NTQA 8GPBA 3ZBPA 2OWEA 1SUWA 2FZEA 3ZK9A 4EG1A 1Z08A 3FNRA 1OF1A 3C3XA 1K62A 2PPVA 1E5XA 1IHYA 3D4OA 3RIMA 3V2HA 5EXXA 1Q6ZA 1T3LA 1SHJA 3CSSA 3IL2A 4YBZA 3GX1A 4DIEA 1L7RA 2J3QA 2NP6A 4LJ9A 1GQYA 1KI3A 3G8YA 4OMCA 3IV7A 2UYHA 4GIBA 2DFDA 1GQOA 3NHMA 2V8BA 1MX3A 4O0LA 1J0CA 2RHGB 3EUWA 2Q1UA 1PR3A 2ZJOA 2A9JA 2R2AA 3BGDA 4NIMA 2O3RA 3K92A 3DEHA 4MUYA 4CI9A 2EGUA 2FF7A 4HJRA 4WJKB 2P2SA 2V96A 2F6RA 4UKDA 4ZGBA 4DCVA 2IEDA 1DINA 5C3MA 2SKDA 3A9UA 2HJRA 3W3AD 2ZIVB 4KVAA 3ZE0B 1GYPA 1GL3A 1OKKD 5TJ9A 4MINA 1MIOA 3X2EA 3KJGA 4MDFA 3UK2A 1MFPA 2IDJA 1ZCBA 4BLTA 2BFPA 3SJZA 2WT4A 5EPEA 1PLJA 3W2TA 3C5VA 3AGQA 4ZDIA 4OOFA 4BY9E 5BV8A 4GM4A 1GG9A 1O9GA 1RKVA 4OIFA 3KPYA 5K3AA 1J2TA 5F1YA 3QM1A 4GC9A 4TSFA 1R12A 3IAHA 1ZD2P 3GMSA 3KFVA 3ASYA 3M5WA 3NAGA 5EZ6B 2P9CA 4HQLA 2HSZA 5EPUA 5FNVB 1A9OA 4NS4A 1LSUA 1P9RA 1IY2A 1D4AA 2XYQA 3KB1A 4RF4A 4EL0A 4CMEA 1U1IA 3LUAA 4WK0B 5DXFA 3SX2A 3HKDB 2JFYA 3IDQA 4M76B 5ER6A 1BOOA 5BUQA 5AW1A 2VPTA 3AZQA 4I55F 3ZJ4A 4J43A 5LVAA 2G4LA 2EKLA 2Q29A 3KKKA 3CONA 4XASA 5GJBA 1GZ6A 3K9CA 3L0DA 4E5DA 2JATA 3TEJA 5JVDA 3SM3A 2X15A 3PIIA 1DUIA 1OBVA 1PT7A 3GFOA 3K8OE 4YACA 1C1DA 5BR1A 4LXIA 1RWKA 3WSTA 5EJ8A 2BM8A 3L93A 3T52A 1J5EB 4MR7B 4P3KA 1PQ4A 4EH1A 3IALA 3WLNA 1JHUA 2AR9A 2M6SA 3K09C 1ZOSA 3N39C 3RT7A 3WLIA 3HKBB 4UFPA 4ESVA 4QXRA 1F17A 3CF4A 1SR8A 4O2RA 4QT0A 1KVSA 2H4HA 4EUFA 5DGXA 3J80A 3UAXA 2BC9A 3G2NA 4GICA 4KNYA 1H8ED 1SAYA 4R9RA 3ZYZA 3PICA 1PJCA 3AETB 4Q6WA 3FETA 1RQGA 4NFLA 1AGRA 1XTTA 2FRDC 5M5BA 3NZEA 1DBSA 3O2NA 1B3RA 1BJKA 3IOEA 4KFSA 4QGBA 2BZ0A 3BGWA 3TQHA 1FU4A 1KARA 2W6JD 1G9XA 1LPPA 5KVVA 3OCYA 1AGNA 4U9HS 1FFCA 2Q41A 3V9PA 2JJ2D 4L0QA 4RLSA 3RU9A 4WXRA 1WZIA 1N9KA 1NUPA 4LSGA 2LTAA 2B20A 4TX1A 3LG2A 5LZ9A 1F2UA 4GBED 2ZJFA 3RWOA 1WW2A 3GFVA 5IAJA 3H6HA 3FY4A 4C6TB 3WAGA 2IUEA 3TKAA 3DLIA 4N3CA 1P4AA 1TZJA 4UAVA 4Z7JA 1V2GA 2AA3A 2TMKA 3OUUA 1FVHA 4DQ0A 4YLYA 4V2UA 2HBYA 4V0SA 4C87A 1JLHA 4F3TA 1JEYA 1E6CA 2E82A 2R79A 2W0MA 3LX6A 4H27A 4KVFA 4HUQA 3COZA 4MS3A 1NQWA 2HWWA 1JDZA 2MSDB 1JHRA 2PXHA 4HWOA 3RFFA 4CIAA 1KQOA 3WX0A 1OC2A 3E23A 2FZCA 2G0NA 3IUQA 3ND7A 1GUDA 3DHNA 4MGHA 5EOVA 3VJKA 2VQSA 4IIJF 2Q8QA 4P3NA 4RY0A 1SU4A 2DHQA 4FB4A 2ZK7A 4MVWA 2A9FA 4LSWA 1V5IA 3MBIA 5MN6A 1AK2A 4XE5A 3M1AA 3KXIA 5KYGA 1I2BA 4GZ3A 4GYYA 4KO1S 1EFRD 3H99A 3VBCA 4YAEA 1D04A 1NX6A 1Q83A 2CHUA 1JI0A 3DZCA 1KVQA 4JJ7A 3BWCA 1GVNB 4IIDA 3ACBA 4G26A 1A1SA 2AZDA 3LIPA 3NU1A 3DAPA 2J46A 2C4NA 2R4QA 2ZI5A 2QE6A 1H66A 2VT3A 1JSZA 3EARA 2GO7A 4QWMA 1NVFA 4A8JC 3BIFA 1HFJA 3R24A 4UVEA 1WXXA 3RTEA 1IOLA 3GRFA 2CFTA 2ES4A 1CQPA 4MPJA 1I6LA 1UF9A 4REQB 1CY0A 1OLOA 1QZ3A 2PKWA 4ER3A 5B7PA 3DBLB 3IFSA 3HCPA 1V37A 1CJMA 1T5LA 2H18A 2VJAA 4EMBA 2VH2A 1QP7A 2BELA 3NMUF 1G2PA 3A2MA 4GHWA 2HCJB 3SLRA 1C1YA 1GXSB 4AY3A 1QLWA 2WJHA 3EUAA 1IXKA 1QHSA 2W42A 3OLZA 3EHDA 2WE8A 3ESRA 1SA0A 1UKAA 3E5HA 4L4XA 1EB8A 4M1KA 2J3JA 4TVOA 1YI0A 2VPYA 1OBFO 2X9VA 5JD5A 2VPWA 4MP6A 3U61B 4JIMA 4EB0A 2QAIA 2YVQA 3CG0A 3ZW8A 2ISSD 4TWZA 2J3IA 3VNRA 2KYRA 1P5JA 2CHGA 2C92A 3PLRA 1P8AA 9LDTA 721PA 3T4EA 3KT6A 4K9KA 4RM2A 3OTWA 1VIDA 2FW7A 3OOWA 4PLZA 1JHMA 1W36B 3NBFA 4OBWA 1E4VA 3UB2A 1XNJA 1Z6XA 2AHRA 3SIWA 2ETVA 5LMNB 1P81A 3HBAA 2NO5A 5D8DA 4NSLA 4UBKA 1CVIA 1U1FA 5H7XA 5AW8A 1RYBA 3PVZA 1QAOA 3KBOA 1GFSA 4G37A 3PPIA 1DCKA 1G20A 2FK7A 3NUQA 4EGQA 1P9OA 1B6TA 1KZ1A 4LYEA 2OUIA 4BJ1A 5CDSA 5ITWA 2UAGA 4MJLA 4OUKX 4H7DA 2FPUA 3FE2A 4AUEA 1T34A 2FR8A 2W2LD 1U2GC 1HT0A 4C3ZA 5EWLA 1DIRA 1Y1SA 4P36A 4C4SA 5BV0A 5C7YA 4DR1B 4DCNA 2O2ZA 4WCFB 4EITA 2IY9A 2FOIA 4KQ6A 1E3WB 3E5RA 2Y93A 1L4NA 5JC1A 1HDXA 2GARA 4P93A 4YX9A 3ITDA 3H9GA 4RTMA 4CJXA 3LZDA 4M22A 2IQ5A 2VBIA 2HFJA 3GXBA 3PA8A 5F77A 2BMAA 1P7YA 2G3YA 1M74A 4N48A 1YJCA 4DMRA 2P3LA 2J3DA 1IN7A 2YUTA 4QUAA 5TQ2A 3T15A 3ZBQA 1KRWA 1FUQA 4KPUB 1BO6A 4LSZA 3AV3A 4GI3A 4EB8A 3I62A 2ZRJA 2EQBA 1UBKS 2H08A 3WGQA 1NR1A 2MOKA 3CEMA 3MVEA 1DARA 3QV2A 1GZVA 1FZTA 5E1OA 3V4FA 2WZQA 4R2HA 4MVXA 1FQKA 4EHHA 2ALJA 2H9YA 2ZDQA 3JATA 1WXQA 2UYCA 2BKLA 2H0AA 1GILA 2J9GA 5KI6A 4MPTA 3CF0A 1FYEA 2B94A 1UKYA 4JVLA 4JMPA 4LTDA 4MWBA 4MS1B 1NXWA 1JEAA 2PGXA 2XB8A 1EHCA 2BMDA 2AVDA 2ODNA 3WGJA 3UW3A 1QHIA 2BKEA 1E1LA 4OV6B 2W6ID 3G5TA 4NHOA 1ZO8A 5EXSA 5FOVA 1DKLA 2HMWA 3GLHB 4NTZA 4EG4A 3VPSA 1HYBA 4NZOA 1ZEMA 5JFGA 5HPYB 3DWGA 4M0DA 4CF5A 2V7WA 3ZCPA 1GPH1 3I30X 2HMVA 4HZGA 2KHZA 1KETA 3QX9A 4BGDA 2WHXA 1L5OA 1G5HA 3QKRA 2YS7A 5CA0A 3GMDA 2L18A 2H5IA 3KJQA 3QVGA 3EEIA 4K6MA 3AL0C 4TTSA 1YB1A 2RH9B 4G1UC 4DIUA 1Q7GA 3CX7A 1U0EA 1JI3A 1HURA 3JZFA 2WQ6A 3PSHA 4EFMA 1Q91A 5A4MS 1TT7A 3HE3A 4CLEA 1Q5PA 4NY1A 3F0TA 1IZ9A 4MQBA 2JKYA 3A2LA 2ORYA 4R83A 3M6WA 1RYDA 1H2WA 1XWIA 4NBLA 1LA2A 4HVAA 2PZBA 4JX8A 3AXSA 3NBZC 5AKLA 2CEAA 2P6UA 3F6PA 3SXJA 4DLYA 1XQ6A 4FEAA 1ZN8A 3MJDA 4M8LA 3DBRA 2JLYA 3ZD6A 3WA6A 2QSZA 1TVKA 4KKVA 1EUCB 2NU6A 2W6CX 4JEMA 4U9IS 2YZNA 4C3VA 4DDUA 1DFGA 1GTL1 3CH5A 1U5BB 4J07A 3JRXA 4EVIA 4G1EB 2OCAA 5H4GA 2A5DA 5IWAB 2FJ0A 1NUUA 2Z2ZA 1FNSA 2ZDHA 2ZOSA 4L9WA 2R1ZA 3GFGA 3DULA 9GPBA 4JC5A 2YZMA 1KMIY 4BBJA 4BCDA 2C9ZA 1DFHA 2CWDA 4B3GA 1XR3A 1V2HE 2E87A 2D13A 3TTVA 2CDAA 3EXEA 1I7QB 1D4FA 4KODA 1JEYB 5C37A 3RV3A 3UY4A 4J9VA 5EJAA 2CNNA 1XYYA 3TOZA 4TRRA 4DR3B 3JARB 3GVXA 5KZMB 3WLLA 1DUVG 1ONNA 2PZ8A 3SYKA 5GZ3A 5ESWA 2Z2XA 3M1YA 2F3SA 1CEXA 4PINA 2X5XA 4LXTA 2ZIWB 2O8DA 5BOSB 3M2TA 1Y37A 3FI9A 3AKCA 2VNSA 3G13A 1S8AA 4KV7A 2OL4A 4O8ZA 1CR4A 1SBNE 3PQ5A 5CVCA 2QGAB 4XUEA 4TUYF 4WA8A 4DC9A 4UCFA 5FRDA 2A4MA 1Q0LA 5F5XA 4HV4A 3LVFO 4QELA 3EUEA 4S04A 1OGJA 2FETA 1T2VA 3PNMA 2PH5A 3KE9A 1TQHA 4OVKA 2V6FA 3EBPA 4MUGA 4PX3A 1R6XA 2IEYA 5M34A 4QBIA 1H1DA 2KLBA 3A28A 3OZDA 5JHHB 1GNLA 1N1GA 1L0BA 4DQVA 4CKBB 5HCUA 1QPZA 1VBMA 2A9RA 4QDXA 3LHKA 1XQWA 4J1TC 3QRWA 4XB2A 4LRWA 3DPUA 2YVUA 5LNK6 2V58A 5IM5A 5MN5A 4M1TA 4X9XA 2RAVA 3U60B 1SCIA 5EHQA 2WT8A 1THMA 3AKYA 4B7CA 5JMOA 2H2HA 3VZRA 1UBGA 3S2FA 1U63A 2IS1A 3UOWA 3F78A 2UZ1B 2CFOA 4A0RA 5CEFA 3EPPA 1K4YA 5CK4A 3ISJA 4TWAA 5A9TA 5C5CA 1Z56C 4D9HA 4NP6A 2XMQA 1S3GA 3C1TA 3FAKA 4FNAA 4L5YA 4M87A 5IANA 3ETDA 4I46A 4NBTA 2VPXA 4IGEA 3MS2A 3G2JA 2LPMA 4LV6A 1T36A 1ZONA 2B7LA 2CHQA 3B9QA 4O1IA 1YZNA 2VJQA 5DJ5A 2VWHA 4G85A 3BGSA 3ZZUA 2EWVA 4CT5A 1RACA 1ZRHA 2PZMA 2DF8A 2ATIA 3AJ8A 3TGWA 2GH1A 3L7AA 2H57A 4W9RA 1J06A 2AR0A 3B36A 1CR2A 2BKXA 3QYPA 7MDHA 3DBOB 3E03A 3ZXSA 3JQ8A 1TUIA 2AMYA 2KM1A 5IJXA 1LPOA 4JB3A 1ZN2A 1ZRMA 1ZC4A 4KQXA 3KPWA 3VUEA 5I7HA 1QTRA 1RMQA 2JIMA 2I6XA 3LMKA 1VA4A 3O3CA 1JR3D 5HCNA 1LDYA 4L4RA 4N47A 5J5VA 1KYVA 3D54D 5JNLA 3JV7A 4X44A 4JT4A 4DR4B 3LYLA 1K9SA 1FK8A 3MF4A 3Q8LA 4WLVA 1DS6A 3STVA 2PU5A 5F7ZA 3N6XA 2GZRA 2RGCA 4M0MA 4M21A 1RW4A 2AXQA 3CUVA 2Q0XA 1IBCA 4P4LA 4PQFA 4RA6A 4MRMA 5CRIA 1OFTA 3KDPA 2VK2A 1A2OA 3PUHA 3QFTA 3BWEA 3ICVA 3EW9A 4FHZA 2E55A 2Q0QA 2XR1A 5J1TB 2D54A 2R751 5THKA 5IU6A 2HRRA 1SQ0A 1VHLA 3EVCA 3LY8A 1T8UA 3QPWA 1FXUA 4JWTA 3DL7A 3WWPA 1JHVA 1GNSA 1TFUA 4GE3A 4MYUA 5E0OA 5EYPB 9ABPA 1HEIA 3PDWA 4X1IA 1X1BA 1M5UA 3KOZA 3REOA 1HSZA 2VJMA 2G6TA 3S99A 1J1IA 4JI5B 4OSOA 1YR1A 3IMKA 2I4TA 3FBWA 2XT9A 3SIXA 4CETA 5GONA 1MEOA 2D2XA 1XZCA 3JATB 4G5XA 3GGCA 5JBQA 3AVWA 2ZI6A 4O1HA 3FW1A 3G9UA 3ZGYA 3PGJA 2YHIA 2I4IA 1FP6A 3HTXA 1GN8A 3UHFA 4Q66C 1X80B 1EX9A 4V0KA 4E2XA 4AICA 4IVPA 2PFKA 2YX1A 1WY5A 3OSZA 4OFZA 4YASA 1Z0UA 5KTYA 3ICPA 4A36A 1T3GA 1AUPA 3HB1A 4LIPD 4OXYA 1GT91 3R7LA 5CM8B 2YXPX 3DMTC 1K6XA 4PPQA 4I36A 4EI2A 2CMDA 1DCMA 1ZIPA 2YN0A 5CEJA 3E22A 1BHQ1 2QJWA 2OHHA 1JZSA 1RAHA 1GUAA 2FPRA 4XTCS 3BXHA 1Z5GA 1W36D 2H65A 2LW7A 4NDAA 1TKCA 4MWZA 3CF4G 4X95A 1RBZA 3LY7A 2XBUA 4MWCA 4DLXA 1MCZA 1U2QA 3VH3A 1CK4A 3FX2A 1Z17A 3HM2A 4HEA6 4Q3OA 3UJBA 1YDGA 4BMDA 3OF2A 1R5OA 5JCJA 1AS3A 4BWFB 2MJLA 4HXEB 1K0UA 3GUHA 3M1IA 3OTQA 4A0GA 4AX8A 4KPEC 1E2QA 1PFYA 4LC0A 1OBOA 2PLFA 1V5FA 5J4VA 1SD2A 3M4ZA 2CCGA 2G76A 1R64A 3DLTA 4N40A 1VHJA 3BZUA 5B2ZA 1TYCA 4BN4A 1UPUA 3KSUA 2IWHA 5BMOA 2NTNA 4Y9TA 4CTKA 4W7SA 1LC3A 5DTRA 2AN9A 1HT1E 4Y2VA 1J0EA 5FI3A 3UJ3X 1FX1A 4EENA 1UODA 4LGYA 3LF1A 4CT4B 5HIAA 4DMUB 3UOAB 2NOAA 1SXQA 5HK8A 1HQYE 3EW7A 4PNPA 3X2FA 3NQ41 2C20A 5DWVA 5EJIA 3A70A 4MTLA 2PRYA 1DAKA 1UOPA 4F6RA 2B21A 1Z6TA 2AX3A 3ETJA 4M8IA 3WDMA 1NKTA 2Q2OA 3RK1A 5CFLA 1E77A 2GN0A 3QTTA 2C2GA 4BL5A 4YROA 2Y6VA 4XR4A 4PYLA 4FXPA 4E51A 3RABA 1VE5A 3CSDA 3PJDA 1HNNA 2G25A 4IDEA 4L5CA 1XRJA 3IPLA 4N12A 4QPDA 2DG2A 4DA9A 1IBKB 2NMVA 4PCAA 4OLAA 1G1MA 1VECA 4XRGA 5LQAA 4R16A 5FLEX 3FDZB 3DDOA 1S01A 3Q7EA 1AS0A 2P8JA 3HGQA 2DTDA 1JT9A 4YCAA 3E9CA 1BKYA 1YMVA 3CU5A 2CSUA 3ZWPA 4W5OA 1WWKA 4FM9A 3TFQA 1T9ZA 1UXIA 4JBNA 4KNVA 4GBJA 1JYFA 1L8AA 4C0JA 5AW3A 2G67A 3N59A 1ZCFA 3NIDB 3OEHD 4G4SO 3LP8A 3EG9A 3N9IA 1KO7A 3N8IA 4JLPA 3RVKA 3UENA 2P9FA 3DDHA 3IAUA 4PPYA 4RIEA 1LW7A 4OGLA 4LX8A 2AJBA 3O74A 3WVNA 5BN1A 2OVFA 2WTAA 2RKBA 4YV2A 3DL0A 3QXXA 3P9CA 4W1QA 3TQTA 4LZZA 4JJZA 4CKZA 2BONA 5JCOC 1Z38A 2QZZA 1ZUD1 2ZWPA 1LX6A 2H2WA 3L04A 4MS4A 4J9UE 4YRRA 2M6RA 2RCNA 4UATA 1PJ8A 5EMKA 3WYBA 1XLUA 3NHFA 5IK2D 2IV2X 1EWTA 4RNDB 3CNOA 3ZVRA 3JTMA 2ECOA 1LEHA 5F91A 1QH8B 2IXBA 2QE7A 3WL4A 1X3SA 5BMVF 3KQKA 4DLRA 1M2OA 3ETCA 4JJGA 1GFIA 3U5TA 2HTFA 4KHPB 4RJLA 1U28A 3H1PA 5KKNB 3LHFA 3A6GA 3VHQA 6Q21A 2OGTA 2ZWAA 4D2IA 1X0VA 1ZH0A 4RVNA 1JVBA 1C9NA 2OC9A 1MW9X 3HYRA 4J16C 3U6KA 1EM6A 1VZ3A 3IDZA 2ZE8A 4YA6A 1J49A 3TO5A 3AIOA 5LKAA 2B98A 2SCUA 4TV8B 2CJWA 3IP3A 4OYYA 4UU0A 3PXUA 4WBNF 2COUA 1ULTA 2XYHA 1LWOA 3A1UA 3MA0A 3NOVA 4WEQA 1LTHR 2L82A 4BNFA 2RC6A 4I1VA 5ICGA 2WJJA 1GU1A 5BXYA 1MOSA 5DT9A 1CU1A 1A76A 2R8OA 1H4QA 2NP7A 2IYAA 1L7OA 2MDTA 3BJMA 3EPRA 2X8AA 4RUKA 5F1PA 3WB9A 3H16A 1P74A 1Y63A 2PX8A 2QGNA 3Q7SA 5CLJA 1R88A 1V16A 2X58A 1OVMA 4PAOA 4PLCA 2PS1A 3PJRA 1GSIA 3PGXA 1DKRA 1F2TB 3ZTWA 1XD9A 1UBLS 2X9GA 3H2HA 3RSHA 1P5ZB 1Q7BA 1SXJD 4EFLA 3LC2O 4I19A 1PR5A 2YYSA 1GLGA 2JFNA 3NWEA 5JJ5A 2BTQA 1X8JA 2I99A 1D4OA 1N6HA 3HXPA 2A58A 4Q0MA 4QQNA 3ESZA 1G5IA 3QVOA 1WB6A 1SG6A 1KEEA 4Q4HB 4RZ2A 2JLSA 4QTXA 1L7MA 3R5XA 2IQIA 3IIMA 4BAGA 4LVNA 1DXOA 3UMCA 4TLEA 2I6SA 2B4TO 1XNGA 1Y8QA 1F0PA 1LUAA 3EAFA 3SC6A 2ZTMA 3W9UA 1NBMD 2ZZNA 1U3WA 3N8DA 1YJQA 1TJNA 1UMDB 3JQFA 2EKPA 3K9HA 3PA6A 4MP3A 3HN2A 5HA5A 3NASA 1OYYA 4ZU1X 3C6ZA 5ENDA 1ODJA 2PVCA 5FUYA 2IXTA 3JAKB 3QBVA 1XWWA 3MB8A 2R1VB 1CZRA 5GGYA 3KJFA 2X6QA 3V6LA 3HY3A 5ITSA 1XDGA 1EKXA 1P45A 3ORSA 3OQMA 1W581 2CV2A 2SKEA 4PYNA 4HDRA 3SJUA 3VA7A 3D4PA 3O1LA 5DN6D 1P19A 1E3TA 4Y1FA 1Z3IX 4M7PA 4PFKA 4QBHA 2AOTB 1VLMA 1WU8A 2F1JA 1HMYA 5CB4A 1U4NA 1C0LA 2HLNA 4P3YA 3AJAA 4BX2A 2H1CA 3QUAA 2H4YA 3N74A 1L4BA 1AUVA 4DLZA 3A1FA 4M0PA 2I87A 4R3UC 1T0BA 1ECLA 2B8WA 1T4CA 2QN1A 3WADA 2YHIB 1KJZA 1EYZA 2D5CA 3GRUA 4XLZA 1A7KA 1ZOOA 3K0FB 5LMZA 2QBYA 2R00A 3E1KA 3ICEA 1FP1D 2JJ1A 3D0OA 4RIGA 2ZU6A 1VI6A 2QL7A 3BJEA 1XTRA 3R3JA 4RD4A 4LFCB 1P80A 5KWVA 4G8BA 4X97A 4CMEC 3WHPA 1KH1A 4GR5A 5EKSA 4B7ZA 1ONPA 3ITEA 1DUSA 2O23A 3L7BA 3OJXA 3FSGD 4G0OA 4V02A 2J1LA 1ZOPA 5KJCA 3IAS1 4HUJA 5FA8A 3IEVA 3DF7A 3VHXA 4RPIA 3T38A 3L4JA 4P7JA 5K20A 1EE2A 4ZCRA 2I71A 3ZWOA 1DC5A 4KB5A 4U8HA 1GRNA 3W6PA 1MDFA 4IDOA 4OA5A 2R7LA 3FSEA 1P9LA 2W2MA 4UZEA 4EPXA 5KMGA 1DKMA 1GSAA 3NKFA 1LVUA 3RIEA 1T9AA 3K9QO 1VCNA 3F4BA 3WNDA 2C2KA 3ID6C 4I8IA 4JR0A 5HKBA 4UNSA 3VR5H 4OXQA 1BW9B 1ISFA 4G2NA 1NI4B 2VT7A 4YAIA 2PANA 4NNOA 2GAFA 1FFAA 2WUGA 2FPGA 3GNTA 2F4VB 1FDUA 4ZYUA 5BXQC 4F84A 5CVTA 3BM5A 4BO1A 1PSZA 1INLA 3C16C 5AOBA 4LJYA 2I5PO 2AC2A 2OSBA 3C4VA 2P4EA 3GDGA 1TRKA 4WY2A 2IUUA 1P4SA 2Z4SA 1JEOA 4PXYA 3BH6A 4OHCA 2O4CA 3G0IA 3MWEB 4GGMX 3UWOA 3VYRB 4ERXA 1XNRB 4OBEA 2C3PA 3B6IA 2ODQA 4YVFA 3ZX4A 2A7QA 4YRQA 4K6OA 4QLAA 3IB6A 3WNQA 4CMCA 5AI8A 5HBRA 2YVAA 1JEJA 1AXEA 1TDJA 1XZGA 1HK7A 2P62A 3NHRA 1T0PA 3OCFA 2FPOA 1OASA 2IC5A 4FDLA 3I5YA 3ZZNA 2GWHA 2J7PA 3PQFA 3DO6A 1QVAA 1SXJE 2VOEA 2B1GA 1II9A 1LJUA 4C7VA 2HX1A 3RVPA 4Y2RA 2CNKA 3OZFA 2E4YA 3BSSA 4N8DA 3T7AA 2OHGA 1ZJ6A 1NDHA 2PNFA 3IUMA 1K0FA 1L4UA 3AB8A 1IDN1 3BCUA 1SIWA 3FTQA 4KWTA 4DA4A 4MV9A 2FR0A 3EIQA 1E32A 3O8BA 4PW0A 4BLWA 4YRKA 1NBME 4KGVA 5I7AA 1JDUA 1PJ4A 2REQB 3C7CB 4D6PA 3QVSA 4ARSA 1A9XB 3AKZA 4DV6B 1BCRA 3GJ3A 4B71A 2RGAA 3ETEA 2VS1A 4IQ4A 5A4AA 2GFQA 3JVEA 4ONEA 1RC0A 2AYYA 4MYTA 4D0LB 2R6JA 4YRCA 1NNI1 4XYLA 5F76A 1TKAA 4HDQB 2QIPA 4KGZA 5GV7A 1JDNA 1CRZA 1T9CA 1EM8B 5SICE 2I1LA 3FMGA 1KJQA 1MV5A 3GDFA 3R40A 3STXA 5BNTA 3PXCX 1EXWA 2O5CA 4EW1A 1AKQA 1YS1X 2B92A 2HDOA 3OA2A 2WWIA 3Q9UA 4LEIA 5HILA 3RR2A 3ZV4A 1N34B 1CJVC 3CLVA 1N6PA 1VI2A 1I2DA 1RQLA 2PVPA 3IT0A 3QA9A 3QUBA 4ARCA 1WUKS 3GQVA 3INGA 1RPNA 1E0DA 2YR0A 1D0VA 3BD8A 1ISMA 3CLTC 1FJGB 5KC8A 3RS4A 4L08A 4MA5A 3TLCA 3PR2B 1KI6A 3DR3A 5AJHA 1T5DX 2I6FA 1ZX1A 1V5EA 3W6NA 2IT1A 4FKMA 3RB8A 2V1UA 3GZTB 4MCAA 3PC4A 4I08A 3IAAA 1NDQA 1YR8A 4MMYB 2GEVA 1TMOA 3T7RA 4D4GA 5JANA 1YKSA 1M6EX 1LK0A 2AUTA 2CK3A 4FEEA 5F2KA 2GD2A 5KYXA 4G5FA 1NN0A 4L8WB 4TWBA 1K5PA 1QFMA 2ZG6A 4DMGA 4W4TA 2D7JA 2SCUB 3HO1A 3V6MA 1OIWA 5K0LA 3H1TA 2ZI9A 1SCJA 3IGFA 4US1R 1Z6YA 2IYVA 4L6AA 1M7GA 2PSSA 3K1YA 5AR1A 2O3QA 4F1KA 1PW5A 4HFRA 1QWOA 4PHTA 1YFZA 5TRTA 1F60A 3AF3A 3LCJA 3PFIA 1F0NA 5LMCA 4LXGA 5DLQC 5B3JA 2Z5LA 3QGMA 3LUHA 3D7MA 2VHWA 3AI3A 4C2BA 1DAMA 3W8EA 1ILWA 2JBAB 2D0OB 5EIBC 1GYRA 4BFCA 2GO1A 3TQRA 2AOWA 2RGWA 2FR8C 3MSCA 5EVJA 3G5UA 3CE6A 2J8ZA 1YCDA 1ODLA 2VQDA 3OTHA 5DNVA 3ZCSA 3R3XA 2V9ZA 2OO5A 4FP9A 3ZGNA 4FFPA 1W29A 4FT4A 5ALKA 1E2NA 1H1LB 5EE1A 3VV3A 3ESYA 3Q10A 2J5BA 5AJWA 1SQGA 4G97A 4YMGA 3L6CA 1QJCA 2GCIA 3O0DA 3RWBA 2NU8A 2PJDA 2IX9A 3SFZA 3OT1B 1QWSA 1OT3A 1PJTA 1WX1A 2QMEA 3O4HA 5KCMA 4AIIA 3ABOB 1G64A 2AXPA 3FN4A 4PCVA 1BXRA 1EPUA 2D06A 1A7UA 3AERB 5ALUA 1ZZEA 1E2MA 2UVDA 1J2JA 1OPRA 4P54A 3BWXA 1P44A 3VDXA 4ERNA 1OXTA 3I8OA 5T8KA 4P9NA 2EEZA 1M66A 4XB6B 3LVBA 1C2YA 2X1HA 5KJ1A 1GA6A 2BFFA 3NYRA 2YRFA 4BDSA 3OZGA 5ITVA 1TKRA 3Q8MA 1T4CB 4Y9RA 3FPGA 1QHFA 5JDIA 1SN7A 4R3WA 2EF1A 4CHTA 1K06A 2H5JA 3M9LA 4TS4A 2OM6A 2XE4A 2XV1A 3S68A 3SBDA 1XAJA 1CQZA 3HBFA 3VTFA 1CF4A 1TQ2A 1GPJA 3TZQA 1XP5A 1Q17A 3FDIA 5EMHA 3M5CA 2ONZA 5COQA 2ID4A 1NFRA 3ZQ4A 1J5XA 4QRDA 4EY4A 2ID8A 1XNQB 2VRBA 3VGJA 5TV2A 3R3YA 4F5YA 1GN9A 2I8AA 1KMHA 4RD3A 4P8RA 5TVKA 1RTKA 5D3KA 5JT1A 4NCJA 1ZINA 1RABA 1UINA 1NLYA 3K72B 4LWZA 3RSCA 2HXYA 4KE8A 4RVOA 4COOA 3SOZA 2N42A 2CGEA 3ONVA 1ICEA 4WGFA 4B2YA 1KKLA 2DHDA 3D3QA 3HS3A 3O4JA 2VAMA 3RBVA 1JHAA 1R0YA 2O5VA 1ISJA 5JSKA 3D02A 4PZAA 5L3SB 2Z2IA 4P82A 3WTCA 2X0KA 4Z6KA 4N0EA 1ODSA 3IDAA 4EYQA 3ZVLA 1R6TA 2GJ8A 2ZT5A 3H2ZA 4W5QA 2AI2A 5BVGA 1OOEA 3M9WA 5IHXA 3GPIA 4P0PB 1JLKA 1I51A 2EU8A 3DXZA 1XOIA 3FFTA 3EWAA 3L41A 1TW2A 4GFDA 2PWPA 4P35A 3U39A 1RHUA 1Z8HA 4HNHA 4LF8B 2RHBA 3C3KA 3F6RA 2IZ5A 4M6WB 2G9UA 2FP4A 3PP8A 4KMRA 4KQFA 1E2GA 2IEIA 1QGUB 2LRHA 3PHLA 4ZVQA 5DMXA 1GEGA 1Q77A 421PA 2B4KA 2I8CA 4N9WA 2DOKA 1A2KC 3PNYA 1R18A 4NEQA 4WK2B 1Y5RA 5E3HA 2X75A 2IYOA 1D2HA 1MT0A 1MTZA 2YHUA 1A7JA 3QYJA 4CV3A 3O8RA 4ZAVA 5K8LA 1YTUA 5FH9A 2Y0DA 4IYJA 5LIPA 4OQPA 4F1WA 4XIIA 2XTMA 1BEZA 1AHNA 1YH3A 3RIHA 1B8OA 2Z8XA 4BVLA 5IUKC 1QF9A 1E18A 5IVIA 3IH5A 5EXDA 2XA2A 5DBGA 1EFDN 1EBFA 1UFVA 3H0CA 3VDQA 2P65A 2GRJA 4X1KA 1VLQA 2LR0A 1ZJ5A 4OFBA 2C31A 2GESA 1JYEA 2GKSA 4J3NA 3KQYA 4U2BA 1P72A 5HF9A 3RC8A 4KLRA 1A96A 2K2QB 5CITA 4PQRA 2GT1A 3NPAA 1UEJA 4M8NE 4RE6A 1P5HA 1QUEA 1MQ9A 2OFPA 3H4TA 3LC0A 3W8RA 3PT9A 1WZUA 4AMGA 4YQFA 4HEQA 5IN4A 4P7KA 4EHLA 2XUKA 2G88A 1VE9A 3QTBA 4HDKA 2AJCA 2IUSA 3FNFA 3RU2A 1Q0PA 2BEKA 3QUSA 4ZVNA 1KVTA 4F71A 4WI1A 1V9LA 5JH7F 2A0FA 1KU6A 1K5GA 4XGQA 1OTHA 2G1UA 4OP2A 1L5LA 2JGKA 3DE3X 1XJCA 3DM5A 4JSYA 2HIHA 4A6PA 1I3OA 1TI7A 1JKJA 1M6VA 1BHSA 3QLVA 5AXAA 4CL2A 3LU1A 2X8WA 3OEED 3HFSA 1RJFA 3BMOA 4KIJA 4B46A 4LZPA 1NONA 1LB1B 1KK2A 5DKFA 4PWZA 3WMGA 4BGVA 1LX7A 2IY8A 2ZE7A 1I7PA 5DZSA 2GM9A 3I9JA 3GAMA 3CLSD 1A97A 3GEHA 3GIDA 3PQEA 5EHXA 4U4AA 5SY4A 4DSOA 1M34E 5K0EA 4RKQA 4EJSA 4I9GA 2HZBA 3SZMA 2W6PA 3EPKA 1NQ5A 4J4HA 1B00A 1JIQA 4Y6GB 1QHHA 3SEQA 2XH8A 3B70A 2NYRA 3RYHB 3QU4A 1CC1S 1SBTA 1UBFA 2HIMA 4GOND 4TROA 1OX4A 2KMLA 2IELA 3ISTA 4OQYA 5CLIA 5E2AA 4EUSA 3PFWO 5B37A 3KCNA 3L0PA 4PO3X 4D4LA 4RIIA 2ON6A 5LYJA 1J56A 1LRJA 1X70A 3USES 5A06A 2A9OA 2MYUA 2QPLA 3KSZO 3ODPA 1RZRA 1N6NA 3TI9A 2WHRA 1HYHA 4H08A 3IVXA 1QH1A 5C8DA 1ZIXA 1I5OA 4ZKEA 4YT5A 2B78A 4QPZA 1DV2A 3U26A 4RF3A 4UAJA 2ZIAA 1SMKA 4YALA 1T2UA 4FTWA 4S1TA 3OOYA 3FVVA 1VPLA 4XOUA 3EDQA 3QF4B 4R6WA 1V71A 2CFCA 4O2BA 2ZRCA 5SZIA 3RUDA 5JSZB 4XJXA 1V9SA 3V46A 1PVVA 2HR1A 4Q03A 1WTCA 2CNDA 2JFVA 4KKXB 3CX6A 3LBFA 4BS9A 1N0WA 4BV9A 4EG5A 3Q11A 3S1AB 5DNUA 1QQTA 2R6GA 2EKQA 1KH3A 2DWCA 1J9ZA 1N7HA 3BXOA 2CD7A 2C78A 1V8DA 2Y92A 3CZ4A 3Q5DA 1FFBA 3C14C 2GETA 4RKWA 3KB6A 4X8MA 3W2EA 2NZVG 1HG0A 3O3OB 3RS2A 2G5CA 4E5SA 4XGNA 1GTMA 3C7KA 3KUUA 4PICA 4P08A 3JYQA 2JIPA 3JD0A 1E59A 4HGZA 3QBEA 3UXEA 1ABBA 4ZRNA 1QIDA 2I1QA 4AQYB 2ZT6A 3PDIB 1GQ2A 4N39A 5G4KB 1IIRA 1IY1A 1NYRA 1YI1A 2NQ8A 1OXUA 4RJ2A 5JWRA 3A1TA 1FFYA 1OPXA 4U2CA 5TPWA 3NM6B 1H2XA 3ZWYA 2HB6A 3D43A 4XA8A 4YN3A 3O91A 3OESA 1SVWA 1HYEA 3V1NA 1XZEA 3BYZA 3W5HA 1Z74A 4N65A 1ZH8A 1YNSA 1PBNA 3DP9A 4RORA 2GBCA 3MJHA 1CERA 3RJMA 4TPKA 5JQGB 2FFAA 2PMFA 4G1FA 2D1TA 3EEFA 4MUKA 4YGYA 5H59A 1U3GA 5TGDA 4ZCMA 2D7DA 3GLIB 3RAGA 5I4BA 2HMAA 4FJ0A 2E9FA 3B38A 3KKPA 4CM9D 2B61A 4LF6B 2P2CA 2Q2QA 4QSHA 1FSZA 1HA3A 1AHIA 4LF7B 2Q4DA 1TB4A 5CEEA 5JS8A 1UZMA 1KQFA 4Y1RB 1QRTA 2BHNA 1NBEA 2Q5LA 1JJAA 3GRRA 1GJRA 4UHBA 4NYJQ 1Z0DA 3GEEA 1AHPA 1XZMA 3PEVA 3BE4A 1SCUB 4DKJA 3C8DA 4FNMA 1WBDA 2FE4A 2WAMA 4Q82A 3HJHA 4MA0A 2QL6A 2VJNA 3AI1A 1DDGA 3BN3A 4NPAA 1Y48E 3OD1A 4U7WA 4X7BA 5I5EA 2HK8A 3E2MA 1H9CA 3U6BA 1T5OA 4HDSA 3EVAA 1Z4LA 1I6MA 1RBMA 3GRPA 1XRSB 3MTBA 2D00A 4HDMA 1SUPA 4JLDA 4IHJF 1XQVA 1K6MA 4HD8A 3MD0A 2PRIA 4V39A 1YZ3A 4PRZA 4GMDA 1BU8A 2IBMA 3VNSA 3UAWA 4LMBA 2ORIA 2LP4Y 1J07A 2A0KA 5CW1A 3RSZA 3H9QA 3H11B 3CX8A 5FA6A 3K6SB 2HLHA 2OBBA 1SCNE 5F92A 1AVTA 1Q1ZA 1TZBA 2NADA 2VHVA 3ENZA 2R7KA 3IHKA 1ZWKA 2OE2A 3PEUA 4Q9NA 1X15A 2YOFA 1JWBB 4PIMA 1X1RA 4GGOA 3VR4D 1YWGO 3FZNA 4M7OA 4D1YA 1DXYA 2P67A 3FCOA 3AWDA 3LXUX 3VC1A 3D59A 3S1LA 3HR7A 2QUJA 2YXBA 3WFIA 2H5LA 2IHBA 2PFSA 1E2KA 3DEJA 3OQJA 1L5ZA 3UGJA 4YUWA 1Q7TA 3I0MA 1SCKA 1R9NA 2GJAA 3DBHB 3TBFA 5AOVA 3VZQA 1SKYB 1VIYA 3P97A 4Q16A 2IFTA 4O4LF 3PFCA 2OENG 3O1IC 3ZHTA 1PJSA 1ODIA 3EF0A 4GLOA 1U04A 5IULC 2VQ6A 4G25A 1UMKA 4P1ZA 4RJJA 5BWOA 1Z62A 3PC8A 4EY5A 5B2EA 3F5DA 5JAMA 4JYZA 4S1NA 1KI1A 1YS9A 4CVNA 4PC3A 5ENVA 1T1SA 2Z1MA 2HC9A 4F2WA 4F4DA 1NMXA 1TPYA 1NSYA 3KX2A 1Z35A 4MV3A 4AY4A 1AURA 4ZI7F 4EEIA 1IVYA 3AUFA 4IRXA 4OYLA 2BE9A 4EW6A 4B32A 1X39A 1EK5A 1YZTA 1H6BA 4KMMA 3SVLA 3CNHA 1L7PA 3CVOA 2H11A 1F4PA 1HE2A 4EDFA 6NULA 1A5ZA 5LZ4A 2OGSA 2A0UA 1QNLA 4XGRA 5DN6A 5HMLA 3EGXB 3OHPA 3Q15C 3NRBA 1HQCA 3EVEA 2W2VA 4OHFA 1LCIA 2HD4A 1M73E 1Y6QA 1NR5A 2PT7A 4C7OB 2B7BA 4G0NA 5HZGA 1MC5A 1GADO 2QRUA 2REBA 5CLQA 2C0PA 2YN4A 1XZDA 1US8B 4P83A 1O6BA 4B0PA 1Z7YA 4L76A 1KERA 3A6EA 2EARA 4HPWA 3AT1A 3NGMA 3A1NA 4ZO9A 3QBPA 1FTGA 4BNVA 3UCFA 5E6UA 1A82A 1ITZA 1IOZA 1M6VB 4K6HA 2FA9A 3OZAA 4M1EA 2O1EA 3WO1A 5E1BA 4IHKA 3P9SA 3VGPA 5IUJC 1IXZA 5JO0A 1GD1O 1EGHA 4CCYB 1QBGA 1Q0TA 3UWSA 3D2AA 1I9CA 1M83A 3BXGA 2QP4A 4DSZA 5FCDA 5JIBA 4YUYA 4C7BA 3MGCA 1W44A 2REXB 2WHPB 1ORRA 1DTWB 4R5HA 4D6XA 4G9GA 2DY1A 4Z9XA 1TJVA 2E7ZA 2KE5A 1CUEA 2YXEA 4AZ0A 3FPHA 2DPLA 2A1TS 3WDLA 3IP9A 2J0VA 5AJVB 4NU5A 4IPTA 1SD1A 3BE8A 3PXDA 3F73A 1FSGA 3OP4A 1ZVMA 1A9SA 1U28C 3KYCA 4OQXA 4TGLA 3AO0B 3U4IA 4FGLA 4RHYA 2FN4A 3AOEA 5ALQA 3IQIX 2AOXA 3T4PA 1P2DA 5IYZF 2XE8A 1HNZB 4H31A 4ND8A 5DISB 3KSBC 1VLVA 3ERCA 1T1GA 2FZLA 1FXWA 2VJYA 5CURA 1JJ7A 5DWQA 3CRW1 4B3DA 2GASA 4WAUA 5T57A 1KNXA 1T5HX 2PZJA 2J9RA 5T6MA 1OFHA 1U9CA 1WS6A 4CKEA 4M0UA 1D5CA 4MROA 3ZDBA 5HQ3A 5AVSA 1DAFA 2XSZD 5CVDA 3ZK7A 2PBLA 3AFIA 1QGZA 4QASA 4J0EA 3CWZA 3VYTB 1D2RA 1BGVA 3F1LA 4DZTA 4C22A 3UOGA 2P6NA 1P39A 1DCFA 1K5DA 4NEHB 3V00A 1JA9A 1TA0A 3DE4X 2NUTB 4UTXA 3PT5A 5CB8A 5B3AA 3ND9A 4JKOA 4LNUB 3H75A 4RW0A 5HJ2A 4V2IA 2QN8A 1HDGO 2FMIA 3AOGA 1I6KA 4QYTA 5A03A 2O1WA 13PKA 1C9KA 3PIDA 1YDMA 3NALA 4CF7A 3SQDA 5K99A 4CMAA 2QQEA 3SJCA 1E2UA 1QO0D 2AEEA 5TB5A 1L4GA 5HG0A 1UXHA 2CDRA 4YMUA 1XCGB 3AW8A 1X14A 3R9XA 2V65A 4C4OA 2JD2A 3K4QA 3WSVA 4CNBA 3LW8A 1I14A 3Q0TA 1H2FA 3V1LA 4Y6OA 5JSHA 3U44B 1M1NA 3K2IA 3HM9A 3ZE7A 4UUOA 3U56A 4UD6A 2L69A 3VO9A 2FB9A 4IILA 2OOSA 2PRSA 1J6UA 2I67A 5EERA 1WDWB 4X91A 2BEVA 1M5TA 1E2PA 2ISQA 2RGUA 4QOIA 3JQFC 5TS2A 3GUUA 2WJ6A 4M9SA 4TYMA 5CX1A 5C3UA 3K5HA 1CIPA 4LRYA 4LZJA 2EHDA 4TT8A 4WCVA 4EP1A 1OX6A 1NTRA 1R8XA 1P7WA 3HFRA 1HBJA 4EI9A 2R7AA 5T3UA 3UT5A 3FGZA 5DM60 1I7SB 2OY0A 5HSGA 4FLMA 5G1NA 2BFCB 3ADDA 1HKUA 1E9SA 4BQOA 4CUJA 1E1DA 4FFDA 1SG0A 4C03A 4RAQA 2QUKA 4AF6A 3S2IA 4CIXA 4OB7A 3LI2A 4A6XA 1TMKA 2YNMA 4I8XA 1T1IA 2Y1EA 2WWWA 1W5SA 4UEKA 3FKSA 3FSJX 5ULLA 2GYYA 1JFFB 1GGMA 1NBHA 2IK8A 2EERA 3ZWQA 1CP3A 1Y4UA 2WAXA 1O5TA 3D6HA 4IGIA 4P58A 2GN6A 3LCMA 2WNSA 2NT3A 2ZAGA 5TR9A 3HVRA 3PUWA 3MTEA 2W6MA 2XVZA 1RZUA 2QT9A 3HBJA 1XIVA 4HJXA 4WA7A 3T35A 4YT2A 2XMZA 1SM4A 3Q6NA 4Z9BA 4B73A 1KYZA 3L4BA 3KQOA 3VKFA 1F3LA 4BIIA 3QBDA 3UIEA 1FEZA 1N2IA 2Z6UA 3O9MA 3BL5A 4KO2S 3SBXA 3HXMA 2AVNA 1S2DA 3IBFA 4PHCA 2RHDA 5E2IA 3ORRA 4HDSB 4F4CA 1G5QA 4PCUA 5LMUB 2PD4A 3OE1A 3WYDA 1Z6GA 1C3VA 1LF0A 2AC7A 4H6PA 1PLLA 3UHPA 4CYMA 3UCXA 3VZSA 1OA0A 2YV1A 4F12A 5LXTB 2FXIA 5H82A 3IILA 1RRKA 2JF0A 3R6LA 3I6BA 4WK4B 4OK6A 1YNOA 2M32A 4UW9A 2QU8A 4KMOA 3KOXA 4X3OA 2BF7A 3L0CA 2IZ6A 4LTMA 1HZJA 1KRHA 1TTPB 2G7MC 4R2WA 1W52X 4CMKA 2QLFA 2AQ8A 3IJ5A 4I4IA 5DK6A 2F3QA 3AEUB 5KDDA 5IHPA 4NAUA 2BRUC 4FX5A 4QUEA 1KO1A 2ZWMA 5EUBA 1G7CA 1ZMBA 1E60A 1UWKA 1YQTA 2A3RA 4ML3A 3RKUA 1YKGA 3WKBA 3CUKA 3GA5A 4EB3A 2HO5A 4HAIA 4Q39A 5T4BA 5B6JA 2V54A 2WRZA 4Y0NA 3ANMA 2O7NA 1G4UR 1L7NA 4GXNA 4ZCTA 5C7IO 1TCAA 1X0XA 2K2WA 1X8XA 4K9OA 4IR7A 2V1XA 5TQ0B 2EJUA 1FTNA 5J2TA 1UOEA 5JLAA 1E3IA 1JHZA 3BXZA 5JZ9A 3QUQA 3W9SA 4EHDA 2VIIA 1E1MA 3H1BA 4YJ3A 3G0CA 3PQ4A 4RTRA 3EFOA 3FCEA 4KRXA 5DW0A 2P6MA 3MCUA 2DXIA 1OLXA 1KC1A 4JJEA 3C24A 1WXWA 2RARA 3MWDA 1HC7A 3UQYS 1NVBA 3OQNA 4ETIA 3PF8A 4YMWA 4L5IA 4KPYA 3NCHA 2PLRA 3W5VA 3ZNPA 1UJCA 1U7XA 1UPCA 3K5WA 4D9IA 2CXSA 2R1TA 4TXHA 3N2NA 2R66A 4BGIA 3SKYA 2XDAA 4N5IX 3U1VA 2JHPA 4FYVA 4HWGA 4C1NA 4BX3A 1SKBA 4HR7A 3U37A 2QMZA 5AVJA 2WJPA 1NF2A 3CX4A 4MEAA 2QN9A 1O6ZA 3NHZA 2GPYA 4JCOA 2CLKB 4BIMA 1G6Q1 2BSQA 621PA 1KEKA 1YUMA 3CUTA 3AY3A 3HUTA 3QH4A 2SBTA 4JOSA 2FFJA 2QUAA 4M2LA 4WN3A 4EKGA 1NXXA 3RT9A 2O48X 1H6CA 1TM4E 3FMIA 4I1YA 4MUNA 2PUHA 2JHGA 4P3XA 4LHYA 2VHJA 4YJKA 3SK0A 4AU1A 1HE5A 4IVNA 4F7DA 3K31A 1JLLB 4C08A 3T3PB 1GY8A 2VXCA 1F8GA 3DAOA 3EQ6A 4KYTA 5DNCA 4RSHA 1R1DA 1AKUA 1B42A 1U4OA 3QLJA 3SR0A 1CUBA 1CQJA 4JSRA 4QUKA 5LA6A 3SC2A 1TADA 5ILQA 2XTZA 2OYRA 3TLKA 2AF4C 1RXCA 4ZVSA 1FL9A 3ZC3A 2ZIGA 4RTKA 1C14A 2OZKA 4B76A 1J1ZA 2ZJ4A 2BFDB 3OM0A 5J2UF 2Z6QA 3R5FA 2ETXA 4AYXA 5I7UA 4R1SA 4UM9D 4S3MA 2NACA 4JBYA 1W59A 5FNZA 3STHA 2WYVA 3GL9A 3TUJC 3ZVKA 1G59A 1BCSB 3B20A 3GT3A 1EESA 3QIVA 4TQ9A 5HKLA 1L6RA 1U8CB 1PZXA 3WKDA 2X22A 4JJIA 3DOIA 2CLEB 3Q6MA 2A0XA 2QG4A 1YJBA 1G8PA 2NZYA 3TIVA 4BAZA 1CUFA 3COJA 5T67A 1KZHA 3PKJA 4CEJB 3MN1A 2H1IA 3QKIA 2GUGA 3NATA 3W8FA 4GDMA 4LXUA 1CDDA 4D9FA 4PRYA 1Q21A 4FKBA 1EP1B 1K6IA 2BOVA 2P5SA 3TIGA 4KL8S 3EVTA 4GLLA 1ZMRA 3A4YA 3DE0X 4TZKA 3RDPA 1XC7A 2XCIA 3DAYA 4FC6A 3Q98A 3W1VA 4KU4A 5ICMA 2N46A 1JAIA 2OHIA 5MN4A 2AEMA 5EWMA 2BGLA 1KQ7A 2EP8A 3M6AA 1YZYA 5KQLA 4ZVKA 4ZVUA 3MGAA 1P77A 4F8YA 1QNFA 3RTBA 4H7IA 1E2LA 4WZBA 3PE4A 3VVBA 2FW8A 4TKVB 4BFSA 1GPYA 1UC9A 3Q12A 4POAA 2OO5C 4A91A 1NVTA 4TLLB 1JB1A 5BWMA 5EXPA 1WBJB 2OBNA 3D1JA 4KRYA 4B3CA 2NSJA 1QV6A 2Q8PA 4K9RA 2E2WA 3OOEA 3UJDA 1FTSA 2ZJ2A 3LECA 4PSUA 1K08A 1MRNA 2H0QA 4KQWA 4B75A 4CIYA 3ZDDA 4JI4B 2V6IA 3HGMA 4E33A 3E8XA 2WSSD 2RGYA 3DF9A 3PRYA 4IJQA 3RJTA 3R8FA 1SZJG 1P5RA 2YIMA 2OV8A 3CKMA 3CZ5A 4Z4GA 4B17A 4EHIA 5ALGA 1E7QA 3EC7A 2XMDA 3FMFA 3IMCA 3MLAA 1CNEA 2RGXA 2E4WA 3DL4A 1A69A 1QKJA 4YCDA 4DCSA 1E1RD 2GEBA 3KALA 2FEKA 4PBTA 4GLJA 3MINB 4X24A 221PA 2YXDA 3OZBA 2V59A 3ES9A 1L9XA 1Y0BA 1Z75A