4E88A

Crystal structure of de novo designed cysteine esterase ech13, northeast structural genomics consortium target or51
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
195
structure length
194
Chain Sequence
GRALRVLVDMDGVLADVEGGLLRKFRARFPDQPFIALEDRRGYKAEQYGRLRPGLSEKARSIAESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPHKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DE NOVO DESIGNED CYSTEINE ESTERASE ECH13
publication title Northeast Structural Genomics Consortium Target OR51
rcsb
source organism Synthetic construct
molecule tags Hydrolase
total genus 61
structure length 194
sequence length 195
ec nomenclature
pdb deposition date 2012-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4e88A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4e88A01
1ZRMA 5AK4A 3L8HA 1QH9A 2O2XA 2FPUA 3FPSA 2NYVA 1TJ4A 3E84A 3I6BA 5A3RA 3U13A 1WZCA 5AI6A 2G06A 2G0AA 5ALDA 3B9RA 3EF1A 2D2VA 4KX3A 1O03A 1RQLA 2I6XA 5ALRA 2P11A 4I9FA 4HGNA 4UU0A 4PNHA 2G1AA 3ZTWA 4BBJA 4EX6A 5ALNA 4DCCA 2YN4A 4Y2TA 1YNSA 3FVVA 4EX7A 3ESQA 3UMGA 4JB3A 5AKJA 5AM2A 2WF7A 5AK3A 3OCUA 1Z5UA 1RMQA 2B82A 5AW7A 5AIBA 2W43A 4EENA 2WM8A 2ZXEA 1CQZA 5AW5A 2YJ5A 1QQ5A 2Q5EA 4BYGA 2OM6A 2P27A 3WGVA 4IG4A 2I54A 3WKCA 4Y3UA 2I33A 1YJ5A 1NNLA 4KNWA 4Y2YA 3QNMA 2HX1A 2B30A 1ZD4A 3UMCA 5IT0A 4MUMA 4BX0A 2RB5A 1O08A 2FUEA 3U7EB 1J8DA 3W5BA 2QLTA 4ZEVA 4FFDA 3KDPA 5AI9A 4EELA 4FYPA 1U7PA 4UAUA 2IOFA 3ZTYA 2B1RA 1RMTA 1ZD3A 4B6JA 4Y2RA 3NUQA 4YIHA 5JJBA 4DWOA 3DDHA 5AK5A 3PDWA 2ZBGA 3EWIA 3ZI4A 3A1EA 2JAOA 3MMZA 1RQNA 1Y8AA 5AVTA 2PQ0A 5ALUA 2JAWA 2OA0A 1MH9A 5AKHA 4UARA 4F72A 3MN1A 2VKQA 2HEGA 3L1VA 5AKGA 5AHXA 5AW3A 2R8XA 1XP5A 3L8GA 4RESA 2WF6A 5AKKA 2G09A 1QQ6A 3QU4A 3ZWDA 1YDFA 4XE5A 1X42A 1N9KA 3OCZA 3L7YA 3M9LA 2R8EA 1RLMA 4O8CA 4OCZA 3L0YA 3OCYA 2IOFK 2FUCA 4BX2A 4YH1A 3U7FB 3AR6A 1ZD2P 2YMPA 3S6JA 5AM5A 3QX7A 3MC1A 3AR3A 3QUBA 5ALMA 5AM0A 5E0OA 2GMWA 3I1YA 4C4TA 1L8OA 5ALYA 1U7OA 3ZWKA 3IRUA 2GHTA 3ZW7A 3N28A 1SWWA 2C8KA 3L0BA 3U19A 4UASA 4RETA 3MPOA 3QU2A 3DNPA 3QLEA 3QUQA 1RKUA 1QQ7A 4XOUA 1XVIA 1Z4OA 2R8ZA 4BX3A 4BNDB 2AUTA 2CFSA 1RKQA 2O9JA 4C4SA 4UMFA 2PKEA 1JUDA 1Z4NA 5AKZA 3QGMA 4NFLA 5ALQA 5AW9A 2GFHA 2GO7A 3R9KA 2P9JA 4YCMA 3SLRA 2OBBA 4BEVA 4HGPA 4UU1A 1RKVA 3OCXA 2YMQA 4KNVA 3M1YA 4Y2SA 2FI1A 3NRJA 4CNQA 3DAOA 3RF6A 2HI0A 3WGUA 2HDOA 4UMVA 5AKYA 3BWVA 4UATA 1U02A 3WK8A 2C9MA 5AW4A 2FEAA 1K1EA 4DFDA 2FDRA 5AVSA 3U7HB 3L0CA 5ALSA 3SF0A 4EEKA 2RARA 5AVZA 1T5TA 3AR4A 1WR8A 2I55A 5T41A 1PW5A 1Z4KA 2MSNA 1F5SA 3ET4A 3P96A 4UMEA 4AP9A 5AVUA 5AKXA 5ALZA 3ONNA 1TA0A 2ZG6A 1Z4PX 5AI5A 2NO5A 2B8EA 3KC2A 4JDPA 1YMQA 2YMMA 1S8OA 1Q92A 1YS9A 2YJ4A 4XQ0A 4L6AA 1NRWA 5AVYA 1ZOLA 2IA5A 4HGOA 3R4CA 4UM5A 4CF5A 3GYGA 3EF0A 2WF8A 1Q91A 3AR8A 2WFAA 4Y2VA 3K1ZA 4Y2XA 2MU1A 3B9BA 5ALOA 1RDFA 2NO4A 5AICA 1VJRA 4E88A 5ALHA 4KN8A 4G9BA 5ALVA 1Z4MA 2ZBFA 4UW9A 3TLMA 2HCFA 3KOOA 2R8YA 2IYEA 1S2OA 3J7TA 2RBKA 4YGYA 5AVRA 3WK6A 1IWOA 1T9ZA 2YMLA 1RLOA 2CN1A 3ZVMA 2HOQA 1EK1A 1WPGA 3I28A 5AKLA 5AM1A 2BDEA 2HF7A 3WKBA 3OCVA 5AW8A 3QUCA 1ZRNA 4UM7A 5ALWA 2ODAA 4H1WA 3QUTA 3A1CA 3L8FA 5ALXA 1XPJA 5AW1A 1CR6A 1Z4QA 2Q4RA 3FZQA 1LVHA 3N07A 3D6JA 5ALJA 3VAYA 2FPRA 3F9RA 4I9GA 3QU7A 4CE6A 3ZX5A 3ZX4A 4OD0A 3NAMA 1RLTA 4GXTA 5A3QA 3NALA 2C88A 3SMVA 5AW0A 1ZJJA 2AMYA 2ZBDA 4HGQA 3SKXA 4BNDA 5A3SA 3N5KA 1TE2A 2G08A 5AVVA 2HSZA 1AQ6A 5ALLA 2YY6A 3FPBA 3WK4A 2HO4A 3A3YA 2P69A 4HYTA 2BDUA 4UMDA 2WF5A 4DW8A 5AW6A 4BEWA 4Y2PA 1J97A 3IJ5A 3SHQA 3CZ4A 3OPXA 4F71A 2FPXA 3KZXA 1L6RA 4NWIA 5AIAA 3FM9A 4KX5A 5AKIA 4NAVA 2BY4A 3AR5A 4Y2QA 3W5CA 2ZBEA 3ZVNA 2G80A 5AVWA 3IB6A 2HHLA 2EATA 5ALKA 4NV0A 3PGLA 5ALIA 3ED5A 1LTQA 2ZOSA 3B8EA 3L8EA 5ALGA 5ALPA 4AS2A 5AM3A 3OCWA 3QXGA 1T5SA 2AGVA 4HGRA 1WVIA 1Z88A 4MWOA 2RAVA 2Q4TA 3KBBA 4G63A 4YIKA 2OYCA 2G07A 3L5KA 2JAUA 2JGAA 4KYTA 1L7PA 5IT4A 3ET5A 2WF9A 2CFTA 2FPSA 2DQSA 3SKYA 3UM9A 3RFUA 3ZU6A 5ALTA 3I76A 2HF2A 3PGVA 2EAUA 3ZUPA 3AR2A 4Y2JA 4YCLA 1U2TA 1QYIA 4ZEWA 1TJ5A 2B0CA 3ESRA 4OFZA 3WKAA 3WK9A 4ZEXA 4AS3A 3U7GA 1EK2A 4OHFA 4J03A 5AI0A 1SU4A 2X4DA 3FGOA 1RC8A 3WK5A 2YBDA 1VFPA 3U26A 5AESA 4L57A 5AI4A 4HAIA 3QYPA 4L6CA 2QYHA 2AH5A 2CFRA 3UMBA 1RPZA 4UAVA 3BA6A 1L7NA 2C8LA 4CF4A 4BKMA 4IFTA 2FPWA 3PCTA 1Z4JA 3E81A 3E58A 2W11A 3HYCA 5AVQA 4YCNA 3A1DA 4EZEA 1TJ3A 5IS2A 2B8JA 3W5DA 2B1QA 1YV9A 2C4NA 2W4MA 5FP0A 4Y2UA 5AKEA 3OTQA 1L8LA 2WHEA 3DV9A 4NABA 5AI8A 2JARA 5AK6A 2YJ3A 3NASA 4J2TA 3N1UA 3SD7A 3HLTA 1Z4LA 3AR7A 3QU5A 1VJ5A 5AW2A 2IOHA 2PR7A 5AM4A 1L7MA 1RRCA 3CNHA 3WKEA 1ZS9A 4C4RA 1NF2A 4XPZA 4QQFA 3ZVLA 4QJBA 2I7DA 3AR9A 1Z5GA 1N8NA 3E8MA 4GIBA 2GHQA 1FEZA 1SWVA 3W5AA 1Z4IA 1RMYA 5ALEA 3WK7A 5ALFA 5AVXA 3NIWA 1ZD5A 4FE3A 2EARA 3QU9A 1L7OA 2YJ6A 3N8GA 3NANA 3KD3A 2YFYA 3WKDA 3L1UA 1KYTA 2I34A 3R09A 4CF3A 1U2SA 3EPRA
chains in the Genus database with same CATH superfamily
5HILA 1UQRA 1X1TA 3UXYA 4MUAA 2PUFA 2IH5A 1SBIA 4AY4A 2WUVA 2HKIA 1AKRA 1M2NA 1Y1SA 2DWUA 4CCAA 4DBLC 3H2BA 4HVCA 1GTZA 3L05A 2V6IA 3DEIA 3G2PA 4FR0A 4RE6A 3P45A 1FDRA 3UOAB 2HLDD 2V4ZA 3F74A 4NCAA 3TQHA 4Y18A 4ETMA 3NM5A 1OIVA 3FY4A 4BLWA 4QQRA 1DRWA 4O4JB 1MB3A 4WASA 5AJVB 3T5BA 3TXXA 3RAFC 4HGNA 1G66A 1V3VA 2BTOA 3O8BA 1L5WA 4UU0A 1JFFB 2DPMA 3CZQA 4B3DA 1DOAA 3K2QA 1TJPB 1DAOA 1E5TA 1KOGA 1JEQB 2CKDA 4E22A 5JRJA 5FTWA 3WGQA 3RCBA 5JXIA 3K72B 1JJIA 3ZWQA 1IBKB 2G5TA 2X9VA 3GCDA 4Y6LA 2HUPA 2IGBA 1WSWA 2YV1A 3FBTA 3GRRA 3PGA1 5AKJA 4A03A 5E8JA 4WCFA 4FYIA 1C4WA 5BQPA 2ZQ5A 2I87A 3SR0A 5JEEA 1NF8A 2EXXA 3PPXA 4WGFA 4NZOA 2F9LA 1A9XA 1KP2A 3AIOA 4WQMA 5IAGA 3OFJA 3DKRA 1YDHA 2YJ5A 2Z1DA 3FKSD 3JAKA 1SVNA 4HQNA 4YCAA 4K2AA 1OFGA 2P9CA 2ZRFA 4G26A 4L4ZA 2A9KA 2H5LA 4MHTA 1J2UA 3LDHA 3J81k 2PWBA 1YJ5A 3TLBA 3IQZA 4JL5A 4NPHA 2VRWA 3KB8A 4MVJI 2D27A 3F78A 5KSPA 3C7CB 3AF0A 1QFYA 1JIVA 1UBKS 4NBRA 2WFZA 4CG3A 1H8HD 1LC0A 3SC2B 4YT5A 4ALJA 4ARZA 2WYHA 2IYTA 2MSKA 2I8CA 3DW3X 3I4FA 4NICA 4FYXA 5KX5A 5B4TA 4C2AA 4UD2A 2J6IA 1N3YA 4RENA 4E7PA 1Y0BA 1U7PA 2E1PA 4BP9A 5I8PA 3W9BA 3EGDA 5BVHA 2VK4A 4MLDA 1E2EA 1KERA 1K6MA 1AKQA 1G8AA 2BGIA 3BBPA 3FF4A 4KI7A 4YIHA 1PR2A 2IYNA 1HFJA 3DLIA 1S2LA 4G3XA 5FEUA 1H69A 2V7QD 1Z5PA 1DBRA 3GT4A 2CMHA 2QIPA 3AFGA 3PDIA 4KLCA 4X8OA 1SNYA 4AF6A 4BEJA 1HLPA 3K9FC 2F43B 1UBTS 1P73A 2P6PA 1RQNA 1P1IA 4HUQB 4F3RA 5KIAA 1N33B 5BRNA 1PUXA 1AN0A 3VHRA 1SXHA 1LS1A 2WVGA 3ADOA 1VE5A 2KJQA 2Q1TA 3CPHA 3ENVA 3H5WA 3MSCA 4D9CA 4ABTA 4CGZA 2XYQA 3L7NA 3ORYA 1WB5A 1UBJS 4JGIA 4AJ4A 3KKMA 3UQYS 2ZZKA 2W2QA 3ZD8A 3H9UA 4EY7A 1B76A 2IKSA 1XMSA 3HB1A 3A2NA 4M87A 2IEGA 3EPKA 3GQBA 2EU8A 1CJUC 2JA1A 2RH4A 2WD7A 2ZIVB 3BGWA 4NYIQ 5F33A 2JGMA 3PGMA 1MV5A 3S40A 3ZWDA 3IQHX 4J3FA 3COWA 2ISCA 2OHIA 2QW0X 3NGLA 3HXOA 4AF7A 3WWEA 5IF9A 1UL1X 4CR8A 4ENQA 4WVFA 3CUSA 3VTKA 3F4LA 1R5NA 1RLMA 1G55A 1Z29A 3L5OA 2VJNA 3MLEA 5HDBB 3RB8A 2ACVA 2BBOA 4FMBB 4W9RA 4DUGA 1RAGA 2P4UA 1YBHA 3HFRA 3Q8XB 4PYIA 1E1RD 3FCOA 4WZAA 2FETA 1N34B 3SM9A 2MINB 3I8XA 1NVKA 2DBZA 1RAEA 2WHPB 3ANSA 5C1DA 5DBHX 2P4SA 3T7JA 4Y9DA 3T3GA 2CL7X 3IUJA 1VGVA 4I46A 3B12A 1KJWA 4RK7A 1YJBA 1PS8A 4TUYB 1MC8A 3WGYA 4EMTA 2DT5A 3O93A 2J4DA 4FT2A 3RANA 1O5IA 3RFFA 1FVFA 4D9IA 4EJSB 1XZAA 3IAXA 1NJ2A 4KQKA 1ZRSA 2HJ9A 1P61B 3RVOA 1GZUA 5LQAA 4BX8A 3RT9A 1PL8A 1ZZEA 3HEMA 2WT4A 2GCNA 1FFSA 3CO0S 3FOZA 4JJGA 5C53B 5M04A 2UZ3A 2C61A 4MITA 7REQA 3ESBA 1XVIA 1TGYA 4Q4JA 1LY1A 3TNDA 3U5ZB 1S9DA 3RUAA 3E5NA 1SPBS 2HY7A 1DI0A 3TCXB 2FSVC 1G5RA 1JNXX 2M6KA 3X44A 2G8LA 3MMPA 1JR3E 1GKYA 2O9JA 5FQOA 1M6HA 4OOFA 1UP4A 3FMOB 2DHQA 3A1FA 4EG0A 5DTIA 8AT1A 3PT5A 1C30A 1Q1EA 2EQAA 4YVFA 3MIZA 2X2EA 2Y1CA 4Y2HA 2ACKA 1U0NA 4JC8A 2BEWA 2HNKA 2JNWA 2J6HA 5FADA 4ADSG 3R6VA 2FQQA 2AVNA 3QJYA 2CXPA 2VHWA 5GV8A 1M0TA 5K0SA 4H16A 1IEVA 1C4XA 2Z09A 3ZHVA 4Z4QA 1JHOA 1L7QA 1Q7BA 1UF9A 3STVA 1KORA 1V25A 1O6GA 1W8DA 1Q5PA 1X7XB 2FI1A 3DAOA 3OF3A 4JMPA 3ZDCA 2LE0A 5JQGB 2ONZA 1ZI8A 4FYVA 1F0NA 3TZKA 2I2BA 2WOOA 5GJBA 2PXCA 3GJ0A 1Y4AE 1A9ZA 1JHAA 3VTAA 2KBFA 2XVMA 1KQ7A 3DMFA 2FDRA 3U80A 2G72A 3W5VA 4RHCA 4OHPA 4LYJA 1BU5A 3SQNA 2C1XA 2VYVD 1BSVA 1OTXA 2I4TA 3CNNA 4I5FA 1E1LA 4PV7A 3WL8A 3ZOZA 1FUKA 2JI8A 1NG9A 3PHGA 4RH0A 5MGNA 3U3DA 3ZEAA 4WECA 1HLGA 3GPCA 3QVSA 1OBVA 2B4AA 1NXQA 1BGVA 3D4BA 1QKJA 1WSBA 3OPNA 3I0MA 4QT4A 5AVUA 1BWQA 4FZJA 4P38A 1JKXA 2HU7A 4FGJA 4ALNA 4G0UA 2FXVA 5FNVB 1NN0A 4LQ4A 4JV5B 3U7JA 2X2PA 3N2EA 4GT1A 3WRXA 2C5LA 3GVXA 2QZZA 2JCVA 1AUPA 4XQ0A 2WTMA 2YQZA 1KMCA 4BFTA 4OTZA 3NDBB 3V8RA 1C29B 2NP7A 5IC6A 1NJ5A 3UK6A 4LYGA 2PTQA 3FWKA 1FUPA 1U0RA 2KE5A 1SHTX 2J07A 3BT7A 4BV8A 2HSDA 1JNYA 1D1QA 2XUAA 1PG2A 1ZJZA 4M49A 3TVYA 5BY2A 2BUCA 1I3MA 3DHEA 4J1TC 5F1OA 4V0LA 2AC2A 2FB9A 5ALHA 1USVA 1U2GA 1DEHA 1QRRA 3TUIC 1R5BA 4FSXA 4C1NA 1YCFA 1RYNA 2GZ1A 1SCJA 4W9NC 2JDIA 1JEOA 2AFIB 5FEMA 1S2OA 1E9SA 1TAGA 4K6KA 3VDRA 3IBFA 4NZMA 3AHHA 1Z6AA 4ZI7B 1XRLA 1K06A 4DM7A 4MR7B 4IWXA 4II2A 3V34A 1W2GA 1XZGA 2CD9A 3Q98A 1TFRA 3LHFA 1LBTA 4KIGA 3Q7RA 1I10A 3DHNA 2HZBA 3VR3D 4CV3A 2BEUB 3PQ2A 2IZOA 4KFCA 3FW1A 2CDAA 3QVGA 1K2WA 2WFMA 3L77A 4JUIA 4P7JA 1CHNA 5DW0A 2Z2JA 1RTTA 3S44A 4EOGA 1HY1A 3CW9A 3D4LA 5AHKA 5T4FA 2G04A 1FLNA 3GFTA 4EHIA 3KVYA 2R6GA 5EWMB 4CFZA 3M3PA 1XCGB 1PGPA 3T52A 1GFSA 4W8OA 4BLOA 1Z4QA 1VIYA 4G1UC 3BKWA 3N07A 3UJBA 1X80A 2XQKA 4N4AA 3RVBA 2VO1A 4L08A 3I39X 1FRNA 2ZRLA 3ELDA 3RUHA 3GMSA 2WTNA 1L8QA 1YQWA 1CSEE 2G4CA 2NXNA 3BGIA 2XUGA 4BECA 1DINA 1R74A 1NX9A 1YOBA 4OD0A 1YB7A 4LY0A 4IVRA 4A8TA 2FZWA 2ACEA 3N2KB 1ZGAA 1LDEA 4YRMA 3ZZTA 5LP1A 3MWFA 5IT9A 1T2UA 3CVVA 1NYQA 4YNBA 4RTSA 4IVNA 4MDEA 2UZIR 2YNMA 5HKAA 1N6KA 1V39A 1LCIA 1T0IA 1L7DA 1XJWA 2G08A 2RHRA 3EDYA 4MVXA 3NHAA 1U63A 1E6CA 1GNLA 3MYYA 5DM60 3TZHA 4TYYA 1IUOA 1L7EA 2HJHA 1H0RA 4DC9A 5JAIA 3CCFA 2P69A 3R0QA 4DW8A 1OB2A 4QPZA 5TMBA 2H1HA 2VCEA 1X92A 1IY9A 4JBNA 2VHEA 1OT5A 1E61A 1ILEA 2CDNA 3P4XA 3R0JA 1XVTA 1HTTA 3RTGA 3ZY2A 3QI2A 2A14A 2QJRA 2CHUA 3GEBA 4Z0NA 2CEKA 3NEYA 2QX7A 4NWIA 3SYNA 1SVOA 1TK9A 1BKYA 4KE7A 3GUHA 2AOTB 4KXQA 3IB6A 2ABWA 3PFFA 3WTBA 1ZUNB 4KBGA 4B2IA 1GZ4A 1K7SN 4PSUA 5CT8A 3HI4A 3PGLA 2C5EA 5G53C 2PJDA 5JZBA 1UBUS 5G41A 2MJLA 2P1ZA 1BH6A 3SAJA 1T36B 1T5SA 4IAOA 2NT3A 3UW3A 1MJNA 1TUBA 1XZNA 3GRCA 4TVSA 4RKFA 4IQ8A 4PG5A 4RF4A 3PGJA 4DR2B 1NDUA 4HRYA 3MAAC 5A4FS 3FH0A 3NHUA 4NPCA 4J4TA 4RQTA 4RZIA 2E89A 1NW7A 1A5ZA 2JZNA 3CQ9A 3MTDA 1PTJC 3ZCPA 3C3MA 2JGDB 3CPSA 3KQTA 4K9KA 4TS9A 1X6VA 4KXXA 4QVGA 3SF8A 3ZY3A 2DQSA 3BJRA 2PQ2A 4MW6A 1HDEA 5DHTA 4N65A 5DFAA 1E3WB 1KI8A 2GKSA 4YREA 4AN4A 5MF6A 2C7PA 5IYZB 2HMSA 1JBEA 4CPDA 1N2EA 1A95A 3W2HA 1PD1A 2H59A 2N47A 3VJKA 1AK2A 5H59A 4I3GA 1D0SA 1Z33A 2QMYA 4MPDA 4DCMA 3G82C 1M74A 1Q7TA 4RHFA 5JC8A 3ODGA 4JLSA 1IPHA 1LDNA 1ZWLA 4AZ3B 3KEMA 4GXQA 2YV2A 1V5IA 1PJZA 3ERCA 3AEXA 2ZATA 3FI9A 3OU7A 2AZMA 3I01M 2PLAA 3LF1A 1VKZA 1FFAA 2HJSA 2Q1YA 5HPYB 3SU8A 1GNQA 5KNCA 3DLCA 5JTTA 4I4NA 3USCS 4EG5A 1PFQA 1HMYA 1VPDA 3O2QB 2AJ8A 2X8LA 3BAZA 1H2WA 4DQ0A 3QYPA 4EFCA 3CURA 1GZSA 3F5DA 3LMKA 4W5NA 1ZW1A 2B92A 2GS9A 1L1EA 4MEJA 3RD8A 2LKDA 5DGDA 4HS9A 3U09A 1QTQA 1KI7A 4JFRA 1EFPB 1EXMA 2IVFA 1ACMA 1MX9A 1SQSA 1P6XA 1U3WA 1U28C 3KQOA 3ML1A 1YQQA 3M0EA 4XFJA 5DTMA 5J2TB 3GLGA 2IIQA 1KYIA 2IHUA 5E6RA 3WNVA 1P17A 1Q19A 3GFFA 3LHKA 4M9CA 1J2TA 5K9ZA 1TDJA 5ADUS 1XRPA 3R5JA 5J4YA 1UKVY 2QRMA 1KXJA 4YLGA 4UHKA 4MMZB 4V0QA 4NZ9A 5BN5A 1XTPA 3H9GA 3RYTC 3IFSA 4BLTA 1QH8A 3SIPA 3DVAB 2I3GA 2A9VA 3NMUF 1F48A 2AW3A 3O4HA 3NASA 3WGHA 1NFFA 3PCRB 3OOSA 3UJNA 4P3KA 1F8UA 2MYTA 3MJTA 3B9PA 1HDYA 2ZUEA 5DIZA 4G5HA 1EUCA 3MQ2A 3NFRA 1IRXA 2FEXA 2FEPA 2QTHA 3IVGA 3RC9A 3I9KA 4CT5A 2HT1A 1YE5A 2GEUA 2XNCA 3RVDA 1SB8A 4OQPA 3IDZA 1UAGA 4KXVA 2VJCA 3PDHA 1U5CA 4RUKA 1HZZA 2Z43A 2Z57A 5SZHB 4LHWA 3BSFA 3VR6H 2XMZA 1ONSA 4MZDA 5JJCA 1XU4A 2CZCA 4EJ0A 3DBVO 2R8OA 4UOEA 4Z3KA 2GNOA 4ZVUA 2QMZA 5CB8A 5ALEA 1QWOA 2JLWA 5EUQB 3HCCA 3U9SA 4MPJA 1AXRA 2H1RA 3AM4A 1LV8A 4IPTA 3E22A 3IAS1 3HCOA 1M83A 3E9NA 3COYA 1U2DC 2QV0A 1ZJYA 1YL5A 4QUAA 5CYOA 1R9JA 1REQB 4EHLA 4KN6A 1OYYA 4IRMA 5FI0B 2IOYA 5TARA 2CB9A 2IPMA 4RV4A 1LS6A 2GDZA 1QKKA 5AMXA 5ECYA 5HS6A 3TN7A 5JPCA 1VPTA 2WDZA 3ZU4A 1PS0A 5E6UB 3I5UA 1ZX1A 1U2SA 3LWBA 4JLJA 4CUKA 1VYHA 4XVRA 3K6SB 3TXYA 2QSJA 3E1KA 4HEHA 4HRVA 5HCNA 3NTQA 3UWMA 3WRVA 2GAOA 4QO8A 3EPPA 2H52A 3D5QA 4D4KA 4IL5A 4MLPA 2BAGA 3FPSA 3H2ZA 2QYOA 3IMCA 4FEAA 3KXDA 4KCGA 2JD2A 1T24A 4QYIA 4M8LA 3RVQA 2QQ5A 1VHLA 4P7KA 4GR4A 2J0QA 1ZH6A 3BH0A 5I45A 4OEHA 3U49A 4JIMA 2G0AA 3QTTA 3BMCA 3IPYA 5TR9A 5LQUA 5I7WA 2I6XA 3S2GA 4ZT5A 2BMAA 2GPTA 4G56A 1NVAA 2R8BA 2G9ZA 3ANXA 4CUZA 1CY6A 3FGZA 821PA 4HB4A 4OJYA 5JBIA 5K0CA 3T7DA 5GP1A 2JFNA 1XTUA 5F35A 2VDMB 1NXPA 2C2YA 2WT9A 4Q7KA 1LB1B 2FH5B 5E3HA 1E2JA 3P9NA 2RHBA 4DCCA 2IITA 2XEXA 4GOND 1D2CA 1Q1QA 2ZRIA 3RSLA 3F5SA 1H2AS 2VT6A 1ZG3A 3ULKA 5IPFA 3VZBA 2VDUE 3DDWA 3LM8A 4URZR 2WF7A 2XNJA 3AINA 1M34E 1MNQA 4NTZA 1H23A 2BKXA 1IULA 1RXCA 3DOJA 3OFSA 2BMEA 2H4WA 3M6MD 4Q15A 2H1CA 1YA8A 2GRJA 1FFYA 1II8B 3RSFA 2BMVA 2EWWA 4AUMA 4OX9Y 3TVDA 1QZTA 1K7YA 1G3QA 5EJ7A 2XYPA 2ZKIA 4YJFB 1OYWA 2IW3A 2PWYA 4BLVA 4BN5A 4EY8A 4OHYA 3KXKA 4RX1A 3BMOA 3HACA 1CD5A 4BQQA 3NUZA 5L4SA 1RI2A 3JQ9A 2VPWA 3V5NA 4QGFA 3EK2A 3HXLA 5JS8A 1SAYA 2CFOA 3EVAA 5EJ5A 1FS5A 2H18A 2YCBA 3QNMA 5GIPE 3O8OB 1EHIA 1Y6QA 2ZRCA 3H75A 4WN9B 4TLEA 4A23A 3TW6A 2WU3A 1MJGA 5D5PA 3RUIA 5KI6A 4OSPA 1KAGA 4OH7A 4MS3A 4QYTA 4RSMA 2V0NA 2ZK7A 3H1AA 1IPEA 2EKBA 3Q0TA 5C5CA 3NHFA 2BI8A 3G0IA 1GSOA 3LQRA 3M83A 2OAEA 3NR2A 3OY2A 4N7BA 3V1TC 2AZTA 5KU7A 1T8TA 2QPLA 4TMXA 2OFXA 2VNIA 1XQ9A 2G9VA 3D8NA 3DEKA 4S1PA 4PAMA 4DSZA 1VKJA 1W73A 4HSGA 3STYA 2D1FA 2ZT6A 3ECAA 1E5XA 1TAUA 1UKCA 5FLKA 4R69A 4FS3A 4I6EA 4N5IX 4QU9A 4XKJA 2JAOA 1VQ1A 4OHUA 4QSHA 4ZCRA 4L4UA 3C1TA 1X2BA 2YC4C 3FAKA 4M1TA 2X40A 5COQA 3W2TA 2HSJA 5KREA 3R74A 1KQGA 3NIGB 1KOFA 4QOJA 3FTNA 2VKQA 3ZHRA 2O0KA 3EVTA 2UXCB 2I65A 1ZIDA 2QN3A 2VNKA 2WVJA 2P2DA 4YAOA 3TTUA 5DCYA 3I58A 3LPMA 4E2XA 4QQNA 2GJSA 2ZPTX 4DLWA 3KQNA 1WZUA 4FQ8A 4JZKA 2A3RA 2I4LA 2ZTUA 2QEQA 3GDHA 4O08A 3UJ7A 5B6JA 1QQ6A 3QU4A 1YAJA 5DRYA 1H2YA 1K8RA 3SQOA 3BGSA 4G24A 1TVKA 1WXFA 1LRJA 3IAM6 5MGBA 1XXHA 5D3ZA 3T9CA 3V8MA 2DU8A 4KK4A 2QSZA 1KMHB 3UPTA 3OFNA 3K5IA 5EMKA 4M76B 1K5HA 4PSVA 5LP6A 3WVNA 4C2BA 1LJLA 2IOFK 3RHSA 3QPUA 3BF8A 3CTPA 4EARA 3N05A 4UQOA 2SCUA 1RXEA 2NUTA 2PLRA 4FE4A 3TIIA 2FHSA 4P0TA 1RWNA 1YS7A 3G0CA 5HQ3B 3QX7A 1VIMA 3I72A 1PWZA 2DFPA 3QXSA 2VUUA 1OH8A 4FYKA 4FGLA 1FLVA 1AS2A 1YIAA 3X2SA 4X7MA 1NBEA 1U8EA 5KJ6A 2ZRKA 3NO4A 4RTLA 5GONB 2YV4A 4QYSA 4Z54A 2WSMA 3EZNA 2WVHA 1XD9A 4ARAA 3QRWA 1JHUA 1ZL2A 3E53A 3FTFA 3GXBA 2L0XA 2XB8A 3D3QA 1UWCA 4GYWA 2O6LA 3UV3A 4IF4A 1NNUA 4JX8A 5EJAA 4WACA 3VX3A 1N5KA 4GR5A 1C2TA 4P08A 4CM1A 4EMSA 3IE0A 2AN4A 2AI3A 1UJNA 4UUBA 2FCRA 2YHIB 5ERYA 2IWRA 2ID7A 2CSXA 1U8AA 2YINC 4W82A 4CQLA 3IURA 3VH2A 4TTJA 4YP9A 1JUDA 1BCSB 3E3OA 4Y9SA 5HF5A 1HQKA 3FYUB 1OI3A 3ANMA 3WZ2A 4DRZA 1WKCA 4XTCS 3FF1A 4RTPA 3BJMA 3KTOA 3NJ4A 2XUQA 3SM3A 5JS1A 1CDEA 1E3LA 2PLFA 3R8XA 5JS2A 2WFLA 4JKIA 4AP5A 2IPNA 5BV8A 4JI2B 4FFNA 2W7TA 2JGRA 1UT6A 1RKVA 2AZ4A 3EBPA 3QOXA 4G9GA 3ACDA 4RJLA 4X94A 1OYOA 1UPTA 4A10A 4Q4AA 4AZWA 1CIJA 2V4UA 2YYSA 3UEOA 2R1VA 3B7GA 4EUSA 1SKUA 4JVMA 3U4GA 2QA5A 1TIKA 5LKRA 3GGSA 3I73A 1Y5NA 4HDNB 3TZ6A 3WK8A 1H85A 4H4CA 3CRVA 1FJGB 2C4WA 2UZAA 1UANA 3Q5EA 1EVQA 3EODA 1OFTA 3PFCA 3TSYA 1E4OA 1RQ7A 2RARA 1UDXA 2DUWA 1ZW6A 3W6ZA 1OWOA 4EI8A 2DM6A 1MABA 3S2SA 4MGZR 1GXSA 3IJRA 1DAIA 3RC2A 2Y3IA 4H6PA 4M9UA 1YR2A 1KETA 1Z4KA 3GFRA 2CLFB 1I4DD 2X3FA 4BQSA 4ZO6A 4FLFA 4KG7A 2GCEA 2HMTA 4DV5B 1G8KA 1ZMXA 2L19A 3SSMA 4ZZ2A 2QRPA 5CFMA 1X7HA 2FPIA 3HDTA 4A2PA 1P3DA 3HLKA 3MBOA 1E6MA 3ISVA 1PGJA 4ESHA 4ID3A 2B8EA 4N5LA 4BO9A 4JDPA 1EJ0A 3NKLA 3LSYA 3QKTA 3ENNA 3NJRA 4TKZA 4KO1S 3MRXA 4HB0A 1TO1E 3SYTA 4C5AA 4EKGA 2KLHA 3IUSA 1EUDB 3GRAA 4NU6A 3GEPA 2PTRA 4UNIA 4S1TA 5CJJA 4OATA 4TPKA 2BFFA 4J0GA 4Y1GA 5DULA 5A3VA 5T6MA 5EYPA 2WFAA 1CR1A 3ROMA 2HU2A 3TL2A 1M8KA 4ZHQB 3HPRA 1CLUA 3A6LA 3L7KA 2B4RO 2ZIAA 3DT8A 2ZJ8A 3N8KA 4M7WA 4XB6B 1GM5A 1XSEA 3DNMA 3SZRA 5CFNA 4MINA 2FP3A 3FFXA 3MD9A 4P3YA 3ZYZA 1E6KA 4DL9A 5BOSA 2XB9A 3OPMA 4G9BA 1XZQA 4HLUA 1YASA 4R2MA 3RTCA 4XLTA 4CM3A 1T34A 1NLMA 4JVSB 3MRVA 1XVAA 3VO1A 1TZBA 1HYHA 4QTUB 3NTXA 1BE8A 2XXAA 4XYBA 2JRCA 4IV8A 1ZN8A 1TM2A 1UZAA 2H4HA 4IDFA 2GN8A 3JQCA 1NI4A 2JK0A 2GEFA 3FVTA 2AWNA 4WN3A 5JCXA 2GPWA 1YA4A 1FP7A 1HETA 2HMWA 1RYDA 2WKWA 3I9NA 1PZEA 2IBMA 1P31A 5ED0A 2BFPA 4PN3A 5E6SB 3VM6A 3VU8A 3VAAA 4D80A 3ZVMA 1EK1A 2YH2A 1N0IA 1G3RA 2P6OA 4IINA 4KYVA 1WU7A 1BXRB 1MIOB 1O95A 2OHVA 3QITA 4PZLA 4HHEA 1YBVA 2QJWA 5EEGA 1VPVA 2JZCA 4DLNA 4I50A 2P9HA 2G3YA 4ZD6A 1IBMB 2OV6A 4IH4A 1TW3A 4DIUA 1FNSA 5IK2A 2Q7OE 3CVUA 3G6WA 4M37A 3JY6A 2XB4A 4PONA 3FUTA 5HKKD 4FEYA 1CR6A 1Z06A 2J9FB 1KR5A 3M5DA 3IXLA 2PIDA 4NENB 1NJSA 5DBEX 1EK6A 2ONCA 4FJ2A 4IQGA 4BUJA 1JKIA 3AEUA 2OOSA 1JPJA 1CY1A 1GSAA 3PD7A 2EP8A 1F1JA 4IVPA 2EBHX 5I7EA 1NMYA 4I9GA 3CY6A 4Z1MA 1BS1A 2K2WA 3VR2A 1FMTA 3N0WA 6PFKA 1JW9B 2FMKA 3PQ5A 1W34A 3W5UA 4Y0VA 1HT1E 5GOTA 2JLYA 4OXXA 2P78A 4BNTA 3HCBA 4HPXB 3VYRB 3G17A 4E07A 2BGUA 2PCJA 1MXHA 3UJ3X 1VHTA 1JHYA 5A0VA 2F90A 4Y67A 5D86A 2I2FA 3RUPA 5A3SA 1BA2A 5LL6P 1B7GO 3T1TA 5FPSA 3UZUA 3WYAA 5K99A 1WUTA 4QWMA 2C82A 2O50A 5JCJA 2AKEA 3RIMA 4G4GA 3ZZMA 4M1EA 2QPTA 3VYSB 1WMAA 4LX0A 2DKFA 1S5PA 2BDUA 2VFAA 3ZS9A 3D3KA 3RVJA 4N9QA 2PY6A 1S3IA 1IMOA 1RS0A 2XKKA 4NV3A 3A1SA 1IAVA 4EA8A 3M82A 1XLTC 1NSFA 2CYAA 2JGKA 2EG9A 2EFJA 2NXCA 2OUIA 2WQZA 4B09A 2P9QA 3KO8A 3NBQA 4US1R 4IEFB 4E6EA 1JZQA 1JHMA 2JGNA 1Z6YA 2OMKA 1W5EA 1DIRA 3AR5A 4DRXB 4DR3B 1SBHA 1TB4A 2GCGA 1RAAA 3AG6A 2B35A 4DANA 1O94D 1YR3A 4DZTA 4YJGB 2EZ4A 4UBLA 2HRRA 3NM4A 4U8HA 4Q7MB 3HV0A 4UBKA 2DB3A 1N8TA 3H11B 3H1EA 1N6RA 2NVUA 1O4WA 2A9JA 3WBKA 2SKCA 3K71B 1B42A 5G4KB 4FNOA 3UYLA 4C04A 1K6XA 2OCYC 3PE4A 5FFMA 2RJOA 1AIPA 5JPIA 4IKEA 1ZHHA 3EEBA 4JYAB 1GYQA 1BGXT 3GL9A 1IN4A 4D57A 3JWHA 4KYTA 5K4AA 4UPEA 2I6SA 3PUWA 3NKVA 5KC8A 2X0IA 4S0ZA 5TY0A 4OI0A 3C8TA 2V6FA 1B6GA 1CB0A 2BJHA 2IDZA 2J0VA 2FMFA 2ZZMA 3HADA 3DTNA 3I2HA 2VZEA 1J33A 3ZGXA 3HRKA 4IHJA 4Z3DA 4LJ7A 4UM8B 3KQLA 4N5DA 1J49A 3BIOA 4AY2A 1S7CA 3FZGA 4DR6B 4MWBA 1Z28A 3PJGA 3QWHA 4Z51A 3K20A 5G0SA 1OZ0A 3EZYA 3KRTA 4WLUA 3G1WA 4DHWA 2GTPA 4K28A 1WVMA 2O7RA 3G13A 3HK2A 2BUAA 1XQVA 3HZHA 1CF9A 2FJ0A 2IIBA 1PS9A 1SQ6A 2AR0A 1BKDR 3WP0A 4WE3A 4CKZA 1BAPA 3JQ6A 1IRIA 2H7CA 5DWVA 1YZLA 1DSSG 3A32A 3IH5A 4CDNA 2BR3A 4OHRA 1G7CA 1GCOA 3R6GA 3I09A 1I4EB 3FHJA 4OYRA 3EPJA 1EU1A 3GOQA 3ZHQA 4RFLA 3BGVA 4BB5A 2OBXA 4F7DA 4IIYA 4I50F 3SI7A 4R2IA 1A71A 5FWYB 2FMXA 4RZQA 3DM5A 3FJYA 2EJVA 3EFEA 3G02A 1DFGA 1V96A 2J85A 4RPHA 2Z5GA 1GY8A 3UMBA 1NKSA 1QFZA 2WMYA 1QORA 1DBVO 4DJJA 2I8LA 1DC4A 4LVUA 2YUIA 1UPBA 3E81A 1ID1A 3HYTA 3ND9A 1LK5A 3BRSA 4GYKA 1YJCA 2A2ZA 3HYCA 4URHA 1XNGA 2VAXA 4Z0HO 1KS9A 1V11A 3I23A 4GOOD 3AM1A 1OASA 6AT1A 1WXGA 4L8VA 2NG1A 1PUIA 4N9WA 5CK5A 3W6UA 3L6RA 2D54A 5HGJA 4P4GA 1IVYA 2HWXA 3I83A 3DZKA 4E2FA 1TU3A 3O8DA 2OORC 2P2SA 1VBMA 2PKRA 5ITVA 4ER0A 2UV8A 3A3NA 4YPVA 2NO0A 4EGQA 3HRHA 1VFNA 5BMVB 4CIAA 2R751 4Y6PA 3EZ7A 2JGIA 3V48A 4J2TA 3ZXYA 1JQ3A 2GLUA 1D0VA 3DLTA 3WAGA 3EC1A 4N82A 1YS1X 2O2YA 3HWSA 4G4JA 3TO5A 2H7XA 2WWHA 1WQ4A 1AKMA 1VE7A 2C9OA 4NE9A 4QNRA 1YU6A 1KHTA 1YB5A 4QIHA 5FYDA 1KBZA 3RJ9A 1CZRA 4LNUA 5KNLA 1M6VB 4BB6A 1ZVVA 1ECJA 4F11A 4ALKA 4WJLA 4LG1A 2MR6A 4LXYA 4FCTA 3ROTA 3ZVLA 3NOVA 4DDWA 4WZAE 1XWWA 1YL7A 3QVKA 2NTJA 4R01A 1PO7A 4TYNA 1HNNA 3ORQA 4L6IA 1ZHOA 1TM3E 1DADA 1LI5A 1P2VA 1U5BA 2FEMA 4J16C 1WMFA 1FUEA 5DK4A 1C7QA 3CH5A 1M6YA 3G7UA 2HR1A 5UKDA 1WEHA 4L0QA 2X14A 1YWGO 2C97A 3DUFB 3WK7A 4AX4A 2HBZA 4TSRA 4NCBA 2HSEA 5HUHA 1W6UA 4N6OA 4GBJA 2FZEA 1U65A 2R6CA 4G0OA 1H2ZA 4ZPXA 3FLAA 4D8YA 1F7UA 4LISA 1TYEB 1UOEA 3QU9A 2Y4OA 1FS6A 3HY3A 3I5MA 3Q9LA 4RACA 4QLAA 2IV3A 1KS2A 1T9GR 2YJ6A 3TMAA 4CIVA 4OGWA 2E1RA 4EG1A 1KVUA 4WJKB 4ZAGA 3KB6A 1BG6A 2R62A 3KSRA 4YJ3B 3TDNA 3FLBA 4QDKA 4CMAA 1D2RA 3TUZC 4O3MA 1R4ZA 3KQKA 1K7FB 1T5IA 3JQGB 3B85A 1N4AA 4CM4B 1W19A 1OTHA 1Y42X 2EW2A 2BSQA 4LNAA 5HIAA 4HH1A 3QE2A 3KU4A 2BMFA 4HAOA 3R7SA 2ORIA 1SOVA 2RHLA 3W4IA 3ZDAA 4O8ZA 1WSAA 3AV0B 1MOPA 1RYFA 2B5OA 3OC0A 1NHWA 4J43A 3PICA 3LCCA 4EYSA 2I66A 2Y4NA 4KTVE 5C7IO 4LMRA 3OTHA 3VNSA 1YACA 4HO1X 3NP7A 4ZK6A 4D82A 1F5NA 5C37A 1GFWA 3FAZA 3PTLA 3ELBA 4RM3A 4Z2YA 1KOJA 4N3CA 1WCIA 2RCYA 5K3EA 5K0GA 2IX3A 2CUZA 5JYEA 5JNRA 4Q4LA 1R9GA 3Q7QA 1DKOA 3OTWA 4F96A 1KVSA 3F47A 3VMMA 2HGZA 3TRDA 4X00A 1GT91 4R16A 4DNFA 3U56A 1NRXA 1P6QA 4MW4A 1ZGGA 4GFDA 4DR1B 1X70A 3OVMA 1DRVA 2IF2A 1Y3HA 2DR3A 3TD2A 4RL4A 4ND2A 4CFYA 1ISJA 2QENA 1L9XA 4S0XA 2AI2A 3GTDA 2NNWB 2ONKA 2RGBA 4JSTA 4GMGA 4ER5A 1OH6A 2IU4A 3AUTA 3D3NA 3DKPA 3M1AA 4ID9A 4K6OA 2CE2X 3GARA 1WXWA 3Q88A 4DIEA 4ERXA 2J1LA 4EW1A 5IJ9B 2FWIA 4KO2S 3UHFA 1E2QA 1EEHA 2WM8A 5H4HA 4MW7A 4A3SA 3PRKE 3OJCA 2WJ3A 1IZ8A 3B36A 1JHZA 5EXDA 4ZVNA 3ZGNA 1DUVG 3U3ZA 3GT3A 3SC6A 1GKIA 4B6EA 5TDHA 1W88A 1RKBA 4Q5IA 4ALLA 2PUCA 4JQCA 4K6GA 1T43A 3D1VA 4MWDA 1U7ZA 3PQFA 2PL1A 4P4LA 4PXYA 3A31A 3S8EA 2I7XA 1E2PA 1P1RA 1QO0D 3HCWA 3I9LA 4WOJA 1G6HA 2G40A 1G5IA 3V6MA 2JLSA 3PWTA 5A7GA 6ADHA 2RMKA 1RHJA 1O08A 4X6YA 3G8DA 3N0VA 3HLYA 2P1RA 1H8ED 1UK6A 3JCZA 3PJEA 2NGRA 4J9VA 4ZEVA 5K2OA 1RI3A 4CGYA 5B4UA 4MK4A 1IZZA 3N2ZB 3D59A 1NSTA 4Q12A 4YQZA 2BFWA 1P39A 1USUA 3KU1A 1X9GA 1PNVA 1UQUA 2ID8A 3BULA 4ZZIA 5HOQA 3PR3A 2IYRA 2GBLC 3KBOA 4QXRA 2I2DA 2A67A 1TRHA 5EHGA 4MWTA 3DOUA 3NATA 1UBGA 3F2IA 4PZPA 5D6OA 3LA6A 3ZI4A 4GVPA 4E1VA 2ZXUA 3UG7A 3VHXB 3DL2A 3L8MA 1EM8B 1MX3A 2BFEA 4YRAA 1R8JA 2JAWA 1BE0A 1AHIA 2Q5CA 3BWMA 1RXUA 3RHZA 4I9UA 5K8TA 4I19A 3KKLA 5CH5A 3SVTA 4GSYA 3LHIA 2XZDA 1WHTB 3HUUA 5YASA 4HNTA 5AHXA 5AW3A 3R6DA 4YPOA 2CXQA 3NCTA 1O94C 4MWZA 1R8YA 1YJAA 1NBMA 2A5DA 5FL3A 2VDPB 3BE5A 2BBTA 4K87A 3A25A 3F7OA 1ADGA 3AH8A 3S2FA 2C2ZA 4EO7A 2ZREA 1P4RA 2AI1A 1H1LA 2ENWA 2O4CA 3GLRA 3VOBA 3BRWD 3DMNA 4K9SA 5DCWA 1SXQA 2W2PA 1U9IA 1EMDA 1K8XB 2VUSA 1KH3A 2WIDA 3AWIA 3AZQA 2C98A 2ODTX 3DV2A 1Z5WA 2H1LA 3PLNA 4JL8A 4TMWA 5A6SA 3KWLA 5F5XA 1L5LA 3IR6A 2DHDA 4EKYA 5LDHA 2O8CA 4I1OA 2YYYA 4F2DA 2PMKA 2POQX 2Z4SA 3K09C 3RH0A 2HMVA 4PZ0A 3AR6A 3MINB 4YH1A 5FAKA 1NNSA 3RIXA 4ZYLA 5AM5A 4F1KA 2FX3A 2XZTA 2DHRA 3T34A 1KY3A 3AR3A 3QUBA 3H5IA 2ZI9A 2VDWB 4URVR 1GL6A 2WNSA 2Q8QA 4BX9A 4C4TA 3G9UA 4LRXA 2Y1XA 4G09A 4YEDA 1XPOA 1N2JA 2JLUA 4V0OA 3IRUA 4Y1EA 1OA1A 4TL9A 5FHQA 4C06A 1X3LA 3TL3A 4HQ6A 1RRFA 2WJVA 5DP1A 3L4BC 3AESB 3JAMA 1ZGBA 1VTKA 1NASA 4FZ3A 1G2IA 1G64A 3DQQA 1YL6A 4KMOA 3ROQA 4D9MA 1YI1A 3ESYA 3OX4A 2FDCA 3WYCA 1ZONA 2A1TS 3DDSA 3IKVA 5IVIA 4M9RA 3Q8WA 1CUCA 3WQSB 2FUG6 3BILA 4KODA 1J4AA 3NEJA 2ADFA 3LCRA 3VISA 1JYEA 1P74A 3RHTA 4DCPA 2QTTA 3HE3A 4HQFA 5CDYA 4WA7A 1HG0A 2WAXA 4MVJG 4N3BA 3IVRA 2ANCA 3L46A 3QGMA 4FP9A 5G0WA 1IHOA 5C8YB 1PE0A 4ZU3A 2GFHA 4QXQA 5AWFC 3R0VA 3HKEA 1N2IA 4YACA 5EIFA 4EW6A 4FE7A 3TD9A 3CJRA 4BMOB 1J8YF 2GVDC 2Y99A 2NU7A 1G20B 3IMEA 3NYRA 4OF4A 4QC2A 2PA0A 3ROFA 1E7YA 1E1KA 2ZIGA 3MTIA 1MU0A 3PRHA 4BMCA 4X61A 1E64A 4JLMA 3VPGA 5I01A 1EXWA 4GZ3A 5C18A 2ZP1A 3VI4B 2FMTA 4RO0A 3NX4A 4KU4A 1NN1A 1QE0A 5BR7A 1BN7A 2W2TA 2XUIA 2V59A 1X19A 1JSLA 3SHTA 3T06B 1LDMA 1MC5A 1PG0A 3EXG1 5HCIA 5B1IA 5JECA 3DZ8A 5K5EA 4JB2A 2CSUA 2BHSA 1F6BA 1LLUA 3TKAA 3UHJA 2XB2A 3H1TA 1LBIA 4NYJQ 4F56A 3CEHA 2FPGB 3B6KA 3HZZA 3D2AA 4IJMA 4EY3A 1IXKA 1WDMA 3WRYA 1N9ZA 1IM8A 4LJ8A 2XZLA 3BMQB 2JHGA 1T1RA 2YOHA 4ZRDA 4IV5A 5ALZA 1XFAA 3ADDA 1PSWA 5BSFA 1IB6A 4YRLA 3WGGA 1RJEA 1RM4A 2W6IA 4KUEA 4NG4A 1RFLA 3TTXA 2ZCJA 1XKLA 3NAQA 1OXSC 3OY7A 2P62A 3WNBA 2IXBA 1U8YA 1BA3A 1NJGA 2GARA 2Z1MA 2CHEA 5BW5A 3W77A 1Z2EA 2GBIA 2PRJA 3B2NA 1JFVA 1T2NA 5AH0A 3ONWA 1M8JA 3D4OA 2GZ3A 3UB2A 1I1HA 2AG6A 3Q8LA 3ADKA 4KQXA 3I9JA 2NSDA 2O54A 4FW9A 5I4BA 5IZCC 1K9SA 1OAOC 1HA3A 1U1FA 1N9GA 2YHAA 3KVRA 1QR6A 4Q47A 2UVDA 2ZRDA 2FK7A 3TSOA 1LDBA 3HP4A 2IXEA 1K08A 4B4WA 5TQ2B 3W3AH 3FNBA 1PBTA 4AJHA 4NJOA 4OJMX 3CE6A 1EBUA 4X7PA 1SOUA 3RR2A 3C6XA 3HXPA 4KN8A 3RO7A 2WWIA 5DXJA 4QUKA 2BE7A 1CQWA 4ZJZA 2WJ4A 3R3YA 2CL0X 1CC1S 2BRUA 4H17A 4LN1A 4YT4A 1XZDA 2CXTA 1R4MB 2WM3A 2ZZNA 1BXKA 1RPJA 2CBZA 1TX4B 3GLGE 1ZICA 2RGCA 4DV3B 1UIMA 3KQYA 3UN1A 2ZEJA 4C78A 2WWGA 4FLMA 3TTSA 1GGVA 1TCAA 3G6KA 1FDWA 5LZ5A 4QODA 3AP3A 3LLVA 4R1NA 5BSWA 5IWAB 3TKYA 4C2UA 4EYQA 4W63A 1TM5E 2ZSKA 3D6VA 4WTOA 5JSYA 5AM1A 2OBNA 1PP4A 4H4EA 3WKBA 3K8ZA 4AECA 1ESEA 1HK7A 5IKOA 1DV1A 3SXJA 2J6BA 2X9QA 5LXTF 2EKZA 2YOGA 4YDRA 1DEOA 4IY1A 3V4ZA 4F93B 4G65A 1L7BA 3UOWA 3QKIA 3MAGA 3SHVA 2WE8A 5CFLA 2EWMA 4Q4HA 5A7HA 1DJMA 5ES3A 3T0IA 3HCFA 3SFTA 1EJ2A 1XK6A 3MTAA 2REOA 3GGOA 2EX4A 5K1ZA 2X7XA 1CB7A 1UIRA 2V1XA 5ELLA 3CW8X 1T8YA 3U7IA 4MVJP 2FW1A 4ENSA 4IBOA 4OH1A 2R6R1 4DIDA 5HTOA 1DXYA 1NTOA 3NAMA 3C70A 4ACAA 2XYHA 1VJDA 4LI0A 2DEUA 5TEVA 4DPLA 2H2AA 2I6GA 2PGNA 4MNTA 4MARA 3GP3A 3ZHZA 3SKXA 1UINA 2AG0A 2F8MA 1AT1A 4MRAA 1PR9A 4D8WA 3I8OA 1B3BA 1H65A 3N5KA 1SY7A 3ASZA 3PC2A 3WICA 4C0QC 3GQVA 3P97A 4EHJA 3PC8C 1P2UA 2IGTA 1KL7A 1R66A 2CLSA 4EUNA 5JISA 4RMIA 4LBVA 1WUYA 1PJ2A 1L5YA 3Q11A 4PRKA 3P52A 3IS3A 4HYTA 4G37A 4NNJA 3ROGA 2YDYA 4Y9UA 1I6WA 1XWIA 2W2MA 4ZOLA 5AT1A 3GJ6A 2XYVA 4B32A 4CQMB 3LUFA 1JFFA 1EKXA 3CZ4A 1VSUA 3EQ7A 2PT6A 1JEQA 2ZB2A 2RD2A 1J99A 4NH0A 7ABPA 2BFNA 4LIPD 3QKRA 4HSEA 1NMEA 4KX5A 2JIBA 2BY4A 2CLOB 4UBJA 4QPDA 4URXR 2QR3A 3PXGA 1OWMA 4DA8A 2QXTA 2OXEA 5AVWA 1DARA 1RCFA 1E6WA 2R65A 4L15A 1FNDA 1VDZA 3E5MA 4LMBA 4FK8A 1XP8A 4AG6A 4QJ3A 2BGGA 1N1EA 3KJGA 4RK6A 4GRAA 3GLIB 2FSSA 1LTQA 1P3JA 3ESCA 4RVUA 1I7PA 1DO2A 3EIEA 3QTLA 5KNBA 3SG0A 1EHYA 1HQYE 3M1IA 1NR5A 4XWOA 3UYKA 4RPJA 1DKQA 3OD1A 1Y9ZA 3L5KA 2H16A 4K86A 2HLNA 2HWKA 1NY6A 2JGEA 5BN1A 4YY3B 2Z98A 4QUJA 1VLQA 1NI3A 2VTEA 3EC2A 4WCDA 3SJZA 2JGLA 3C7AA 3CVJA 3DEFA 4HPWA 4LDRA 4P54A 4DS3A 1ULAA 3BXZA 4EEZA 4EO9A 3OCEA 3G2QA 3BXOA 1J42A 3SVLA 4UPDA 3P0RA 2VBFA 4Q18A 4Q9LA 4BQOA 4MVJA 1KFBB 3O0DA 4I2VA 2OR3A 2ZB7A 5L3QB 4KDCA 4OYHA 1ADCA 1ENOA 4DQLA 5A4MS 3RBVA 2AEFA 3SJ7A 4I1UA 1Z0ZA 4J1SA 2O8BA 1FBNA 3EUEA 4P3XA 3RS0A 3W5IA 4BPBA 3ESRA 3C15C 3LT0A 4V1CI 3IPAA 1EP3B 3ND5A 3RJZA 4OHFA 4J3NA 2EJTA 3NWBA 5I4IA 5AJUA 4V1CB 2ZSDA 3KR0A 3FGOA 1GR0A 1RWPA 2F43A 2V6JA 1DOHA 2OD9A 4IXWA 1RC8A 3IP7A 1YHNA 4HUQA 5IF3A 5DSZA 1UBHS 3A06A 3EWAA 4E51A 3T5PA 3FHOA 4BNKA 1VLMA 3I9OA 4HRAA 2HFJA 3ZDEA 4UTNA 3I45A 1I33A 3ETCA 3GJ4A 3HKDA 1KZ1A 2BLNA 2KM1A 3T7TA 4DCSA 1I6KA 2RK3A 1CQIA 2X7JA 4P3OA 1YK0A 1V8BA 4MUNA 4DN6A 4QULA 2LIVA 4CLRA 1AV6A 2H00A 4CODB 1ILWA 1RPZA 5T4HA 4TRNA 3SS9X 2Y1OA 2XIJA 4GLLA 5JYBA 4U7TB 1JJ7A 1L9KA 1BC5A 3U4IA 3GZNB 4Q7EA 5EXXA 4D5EA 1UEXC 2PL9A 2CBGA 5KOIA 1JWLA 4MW1A 3KXIA 3JVVA 3L0PA 1HI9A 1SXJC 2PBLA 1B14A 1BGWA 1JVNA 3NHKA 3DE2X 5ITZB 4DCGA 4RWEA 3KKPA 1P4HA 3TI9A 1NATA 3ZZ1A 1RQXA 1KVTA 3CLSD 16PKA 1L8LA 3T7RA 1T0HB 4BRZA 3DV9A 4AQYB 3TPZA 4OI2A 2QTZA 3DWIA 4Q4DA 3EFBA 3WLKX 2ZCVA 1SEVA 2RHCA 1DWQA 1OIXA 3FUCA 5HW0A 1SBNE 3ASUA 1XD2A 1FUOA 1NVEA 3QEMB 2QAGC 5TJHA 1UOPA 2AG5A 3SD7A 1Z4LA 1SVIA 2EFEB 1BTOA 1NBHA 3KJQA 4B2LA 5CVTA 1XXHE 4U2EA 4PANA 4ZOLF 3K0AB 3TLYA 4BN0A 1FUQA 3OEYA 4B3HA 2RJNA 1BFKA 2FZ4A 2PBFA 1B3RA 3MYRA 3W4JA 1BROA 2IYZA 2ZUUA 1MQ9A 3DFKA 1YFZA 3LKDA 1KOLA 2VH2A 5ITWA 4KQIA 3MS7A 2HA4A 4FFVA 3ZHSA 3P8ZA 1NYLA 4P4SB 1W29A 3MFQA 1SC9A 5AHWA 1KZ4A 1RMYA 3HVHA 2OXFA 5LQDA 4QUDA 4AG5A 4I4CA 5CXUA 2FW9A 3ND6A 4Q21A 3BICA 3RYIA 4X1OA 3E15A 3WLEA 5IUNC 1QVRA 4B4DA 2GB4A 1E9RA 1GQSA 1XVVA 1DO8A 1P7YA 2EARA 1CX9B 5BN4B 2BW0A 5EIBC 2WTBA 4LUCA 3T54A 3IOYA 1R64A 3KXLA 4TTSA 1FQOA 4YR9A 1ODCA 1S4QA 5KWEA 4EVQA 3IP9A 1UJ6A 2H7YA 1UDWA 2WU0A 4HWKA 4CF3A 4KLNA 4DWWA 3UMFA 1X7XA 2F3TA 3ZV6A 5DX1A 3T95A 3HN6A 2A7QA 5JQGA 1SIOA 1ZNXA 1ZRMA 4DCUA 4LVNA 1U0BB 2I03A 4O0LA 1T29A 3CBGA 3X1MA 1T2CA 3DE4X 3CJQA 3GLTA 4V02A 5L3SB 4MVJF 1C9DB 3B1FA 2AE1A 4L16A 5J5AA 1E8DA 1HT2E 3PK0A 4LTNA 1CYDA 2C0PA 2GF2A 4I4TB 2VSNA 3B9RA 4I5DA 1ST2A 4KN9S 4Q1DA 4KX3A 4WV3A 1Y3FE 4NCXA 1RQLA 1X9IA 1WY5A 1WW8A 3ZE7A 1MAVA 4TL7A 1PAUA 2P35A 3A1WA 4HV4A 2XQFA 3L3BA 2Q1WA 1QZXA 3STXA 5JRDS 1JKMA 2ANBA 1GFZA 1TPZA 2RHWA 3C3XA 2FK8A 1Q77A 4X3PA 1F3OA 1DB3A 4Y7DA 2HCBA 1TT5B 3A6DA 3M6XA 4OJKA 4HR7A 4PU0A 5TE9A 4RTQA 3WRWA 3OPQA 4KWHA 5IBCA 1E79A 2FPPB 1TPYA 2I7VA 3U3XA 2IEAA 2Y1EA 3BZWA 3UMGA 1QRSA 3HFJA 2O5CA 4IILA 4DYVA 2DSTA 4LOKA 4CI0B 2A5JA 4PY2A 2GFIA 5JZMA 3DCJA 4GRIA 1I13A 2FRVA 3Q72A 3U7RA 4Q9NA 1E66A 4NCIA 3CA8A 4V24A 4WKNA 4F4FA 2AQIA 1QIGA 3M5WA 4B4OA 3DAHA 3NDPA 2CXHA 2B78A 2QD5A 2B5VA 1V5FA 2XZPA 5CVEA 3OICA 4X6LA 1NOIA 2ETVA 4Y3UA 1JBKA 1J8VA 1Y34E 2HK9A 2CYCA 3AVVA 2V5AA 4L22A 3QXHA 5I8WA 1RBYA 2Q9CA 3BD8A 1ZEMA 2UZ4A 4FX2A 2AFIA 3QQPA 2HU8A 4ZMRA 1E2HA 2OG2A 3P32A 4BX0A 2NU8A 1HQCA 2YVQA 2ZR8A 4ZI7A 2CXSA 3UKDA 4YJ2F 1VKNA 1SMKA 1V5WA 1VG9B 4MR7A 1MRSA 2FWNA 3MUFA 4C01A 4I9HA 1PCXA 2VJBA 3NBXX 2IOFA 3ZTYA 2BEUA 1GQRA 2IDMA 3EXHC 3IIJA 2C1ZA 3UC5A 4EB6B 2Y2VA 3DBHB 3NKFA 4REOA 4COKA 1NU8A 5LWQA 3OJWA 4Q1EA 2DP4E 2ZBGA 2RJ3A 4Z4FA 4CMBA 3G2JA 3IP8A 3CF2A 3H9QA 4LY9A 4RADA 1E1DA 4XR4A 1LLQA 4ES6A 2YS6A 3OQBA 4BL5A 5B57C 5B7PA 1W5BA 4FR5A 1O87A 4ITRC 3S99A 2ZIWB 3QY0A 1BMFA 1MW9X 3S7ZA 3WLSA 1O77A 3FIUA 1C41A 3KD2A 1A2KC 4ANFA 5H5JA 4F5YA 4L0DA 5FPQA 2VXCA 1DEAA 3RS7A 5J43A 3RS9A 1XP5A 5TMEA 3OUUA 4G8DA 5BSMA 1XQYA 2AJCA 3U3JA 5DW3A 5HF6A 3JXEA 2G09A 3AF4A 4RYDA 1GCGA 4FZRA 3OZ7A 3I61A 3Q6IA 3EG9B 5K8UA 3FOAA 1DX4A 3SIWA 1A82A 3QOFA 3VOAA 3N2KA 2FWJA 1BMDA 2D7JA 3B13B 4MYHA 4LHYA 1X42A 4MQ5A 3CV3A 4RVFA 4EDFA 1ECBA 1OIWA 3UMYA 4ONEA 1NQUA 1BXGB 3M9WA 4LPKA 1QYCA 4TSFD 2ES4A 3GFVA 1Q6YA 3GV0A 4H59A 1Y1QA 3ITNA 1TUGA 2PMEA 4EKNB 1J70A 1GV1A 1K8ZB 3TYXA 1NXSA 3D4NA 5C7LO 3AQIA 3B48A 2JJ2D 3G2IA 1QGYA 1UWVA 3F1KA 1E7RA 3MJFA 3WGNA 3ZCQA 2VJLA 4TMTA 4QBTA 4JC0A 1GZHB 2FA9A 5CJPA 3RJTA 5LB2A 5IVDA 5IXYA 1VG0B 4XB1A 4X66B 4U4AA 1W96A 5EXSA 4IH1A 4BNZA 5FO1A 1JI0A 4RF3A 3CNQS 4TV9A 2Y1LA 1MTOA 3ZKWB 2QDKA 5DTJA 4KR2A 3ZWVA 2XI4A 3FYSA 2EZ9A 2WK1A 4XSHA 3FCEA 7GPBA 2B3TA 4QXAA 3PPVA 3IDFA 1ZUNA 4WCVA 4KREA 1LLDA 1N1MA 3IODA 4PO8A 1Z6PA 5FUWA 1MO5A 4DM3A 4NMLA 1KI3A 2ZRAA 4D3SA 5EHZA 5BW6B 3RUFA 2ASEA 5GZ3A 4LFAB 3O3CA 1SIBE 4XIFA 3DF9A 3GDOA 4UFPA 1XZKA 1MX5A 1DQSA 1KSJA 1Z8NA 4GC9A 4KDRA 4FN4A 1NW3A 2ZYWX 5DGIA 2YRWA 4CKYA 5KYYA 2VH5R 3MBKA 1PWEA 2YY5A 3WL5A 1LH0A 5FRDA 3OHMA 2CXXA 1XTVA 5A0TA 1ZU5A 3CF4G 3R3VA 1K5GA 3FWNA 5DTQA 4CM7A 2JGDA 2V6MA 3L1JA 4OB7A 1E1QD 4PQRA 3OE1A 4KWCA 4DMFA 4C7OB 3HXKA 4D96A 1YZQA 3IUEA 4GX1A 1HKHA 4KIFA 2NIPA 1YVRA 4I14A 5ARDA 2W4QA 3G3EA 1H4SA 1IUKA 1JV2B 1BYUA 1K5PA 2DQ4A 1OXUA 1PEAA 1WDKA 1A5TA 1MAWA 3SQMA 4BNFA 3SFZA 1FJXA 3ITEA 2O20A 3JZMA 1E4YA 5A5VA 2FE4A 3KHSA 4ZEOA 2X8JB 1DZIA 3KOWA 3B8HA 1GG8A 1VI2A 3L93A 4MP8A 5J1TB 1NGSA 3RT1A 5DF1A 3U39A 2DLDA 3FX2A 1VB3A 4AMUA 1XHEA 4BKRA 2V65A 4ZJPA 5DHAA 2YWEA 4YQEA 2F3PA 3PC7A 3FRHA 3ICWA 3LK6A 1DAGA 3IVMA 4BFUA 3GPLA 1AKUA 2Q3FA 4R71A 1QDLB 2HUNA 3IALA 3M5CA 1W4ZA 1PF7E 4X1IA 5IUJC 1DAPA 1YB6A 4GU5A 4BMNA 4BXOB 1FURA 3WO0A 3FTQA 4AMGA 5DPMA 2Y6UA 3IGFA 1X7ZA 1OQAA 2PV7A 4LYEA 4P7BA 5CGZA 1WTAA 3O4VA 3CZPA 4PVCA 4Z1OA 1RYZA 2D3TA 1O6CA 4KQ6A 2PUEA 1I2MA 4IG9A 2YMMA 3JQAB 4A91A 5ERXA 1SOWA 3EW9A 2W42A 2C7RA 2BI7A 2W8BB 4ARIA 5IJ0B 2FEWB 3I5XA 3OHSX 3L49A 4WPGA 1FTYA 4F12A 2L18A 1XCJA 4CLEA 1WXIA 2W2VA 1XYGA 1VLLA 3E3MA 2OC4A 4CN8A 3Q15C 4BQEA 3VNAA 3WWZA 3DOFA 5L7TA 4FEGA 5F7XA 2BGNA 1IW7D 4F4CA 1MFZA 1ULBA 1KRWA 5FNZA 4JOSA 2C83A 2BT4A 4GOXA 5AICA 3TLGB 4YV7A 1NFQA 4H6VA 4DDHA 1DKNA 4HZGA 5ALVA 3L84A 1S2MA 2P2CA 3DVAA 3ISTA 4XPIB 5BR1A 1KEKA 1YI0A 1YR8A 4U2CA 1FSZA 1G8PA 1TCBA 3KM0A 4CL2A 3L41A 4MYSA 3V55A 4C20A 1I6LA 2PQ6A 1FQKA 3USES 2QWXA 2IYLD 3J7TA 2CLCX 4R3WA 4E08A 4NE7A 3NTRA 1W59A 2OBYA 5AVRA 1EP9A 1G6OA 4I3HA 1EBFA 1JXOA 3ZV4A 1GUDA 3WK6A 1FJHA 4HNVA 5I5GA 1UM9B 3KKKA 3LCJA 3NAGA 4LDZA 1RLOA 2CN1A 2QG4A 4LYFA 3RD5A 4AZSA 2WQ7A 2VP4A 3GY0A 4PLGA 1NONA 1LRKA 4JYBA 1RQRA 1Q1GA 1XN1A 2OENG 3PNPA 4PPNA 4TV9F 1IJEA 1PTKA 3HDJA 1GNSA 3OCVA 2AG8A 1K7WA 2G9NA 4DCTA 3LY5A 3OD5A 3H5TA 2PWAA 2II6A 5BNZA 1HOXA 2Y71A 5K4HA 3WHLA 3OLWA 3R3XA 4FFOA 5ALWA 1J8MF 2XKAA 1KYYA 4EMBA 1HE3A 1T4GA 1TMGE 3FFBA 3ZK9A 5FBVB 1V9SA 2QT9A 4C30A 4OQZA 1J20A 2SECE 2PZEA 3PNYA 2DUMA 2YQ5A 4KPUA 1REQA 1Z2OX 1SD2A 2GPBA 1JWBB 5DX8A 1G7TA 2G71A 4QDTA 1YGPA 4A26A 1DMSA 3QW4B 4MTCA 4MUYA 2ZB4A 4D6XA 5KQRA 4XR9A 2VEDA 1UXOA 2Z8YA 4JXJA 5EI5A 4KLZA 4KQHA 3NWEA 3P27A 1UFQA 5FPHA 4M46A 3TNJA 3RVNA 5K3FB 3M8KA 4XYLA 4HDSB 4CWAA 4H7EA 1M1XB 2C88A 2G9UA 3LBFA 4K9OA 1HDIA 4KDFA 4KQGA 2GM4A 1KO1A 4HGQA 1MEOA 2I0FA 2BUBA 1BWRA 3NHSA 4ZMSA 3VZSA 3HA5A 3OO1A 1AQJA 3MUNA 2R4TA 4JT9A 5I4CA 1H6DA 1FX1A 3AU9A 2YY6A 3VR5A 1PQUA 1E6EA 1VM6A 1D6SA 1IJKA 1JQLB 1K27A 1OHHD 2HO4A 3HO8A 3OFVA 3OZAA 2FDXA 5A0FA 3V2IA 1JMKC 4D7AA 3L4JA 3U61B 1HYBA 5KB3A 2JHCA 1IVSA 1KAQA 4TLLB 1CYEA 5P8WA 3P94A 5DYYA 3QWBA 4UVIA 4LQDA 1QBKC 4I6GA 2PL3A 3BDAA 3DC2A 2ZT8A 1NQTA 3V7FA 2I6TA 4B5LA 5ES4B 1E2KA 2WHXA 1U2ZA 1ES9A 3SYMA 3UPDA 1FMLA 5E38A 4KRXA 3O92A 4AJLA 2RONA 1PJ8A 1ZI9A 3OEHD 4RFSB 3D5EA 3X1JA 1D0IA 3S29A 3J80A 3ZDFA 1U8ZA 4P98A 4PNZA 2HV8A 4QNMA 1YUNA 1BDHA 3ZDDA 3WSTA 2V3CC 1KMIY 1ESZA 3UJCA 3BEOA 4O4IB 3PDCA 3GYBA 4DCVA 5KYKA 3G9QA 3AJEA 3HVIA 2PXXA 3OF2A 4GMDA 2P91A 4HAUA 4P6VF 4AS2A 2JKZA 2Z2XA 3V8BA 1II8A 2EHDA 3H18A 3EBLA 1VKOA 3H84A 3CUEF 4G5QA 4HDKA 3O84A 4F45A 2WYIA 4NX2A 4MGHA 2FUKA 3FTCA 2H0RA 4YWHA 4MWOA 1Y7HA 3DOHA 3SEZA 1NDQA 3FNFA 1EDBA 3T5TA 5IANA 3TG8A 1XB2A 3EJWA 1E6LA 1L7PA 2VH1A 4YV0A 3JQRA 2OYRA 4XIGS 2O3SA 1T6ZA 5BR8B 4AZTA 5H3CA 3O8OA 3REQA 2BD0A 2BHNA 3VQTA 3BB1A 3NNDA 1T9DA 3RFUA 3EA5A 1ULUA 3I76A 3PU6A 4GVXA 4TLBA 3B3JA 5HVNA 1G19A 4AWBA 4HH3C 1ZINA 4HDQB 3A9WA 1FSPA 4ZZ3A 2SKDA 3LOQA 2E49A 2NUPA 4B2PA 1QYVA 3OIFA 3MW8A 2ZVDA 2JBAB 3A2LA 1FFCA 1KYVA 3K3PA 3PUYA 3QMVA 4JP5A 4CLOA 4A5SA 4QG7A 3WK9A 4UTVA 1B8OA 1L5HB 3MMXA 1F1BA 5FBZA 2D5IA 4BZZA 3U5TA 2YRFA 1QGUA 1ZH8A 4FFLA 4PG4A 5D7BA 5B7NA 5JZVA 4CEHB 4MR8A 1L4MA 3HV2A 4FILA 4AAYA 3X3HA 2VHVA 2C1EA 4Q1BA 2D1SA 1WPRA 3E70C 3AJDA 5CK4A 1I01A 2HDNB 4BJHB 1UQTA 5TJ9A 3V7WA 1E1NA 4HUTA 3WLPA 4FGUA 5CEEA 4BTLA 1FFEA 3BD6A 3CSSA 4M7OA 5JLAA 4AK9A 2ZUDA 4C07A 3VH1A 3DZHA 5FWNA 3DWGA 4JENA 1LV7A 2ZIFA 4AYWA 4XQEA 3BRQA 3U3OA 1CS4C 5F73A 1T6NA 4AROA 4EI9A 3LZCA 1SU7A 1SZJG 3U4QB 2VNJA 4BP3A 3D6AA 1XWFA 1ZCJA 2HCTA 4MHSA 2AEMA 2OECA 4RLQA 4EPYA 4GKJB 2J8ZA 3JQ8A 1YHZA 5CM2Z 1KMHA 2B2CA 2F8LA 3T15A 2Q5LA 3TRKA 2NQ2C 2VP9A 4EW3A 3VKHA 2JCSA 1U7HA 3PJRA 1WV0A 4J8PA 3HUEA 4LCBA 1XNHA 4Y2UA 3E7DA 5IEBA 3K4PA 2GZ2A 1JQ5A 3HHPA 5AJYA 4YRZA 5HQ3A 1W0KD 3AHCA 1NBME 2JARA 1XVUA 3O21A 5JCOA 1C1HA 1EVYA 3ZLJA 3PXDA 1YRAA 4R7ZA 4MKIA 1HO3A 1U16A 1M2KA 2H2GA 2P0EA 3BL5A 3N1UA 4R41A 4APAA 5LBIA 1Z75A 3GJQA 1RHKA 3WLAA 3WGMA 1KY2A 1HXHA 1IN8A 2A1UA 4MRSA 3SX0A 5KVQA 2QL9A 5T64A 3SC3A 4IJQA 1L4EA 2A6PA 2ZJ7A 4YO7A 3GGDA 4C4XA 5HG0A 3ANNA 3VKFA 3Q8MA 1MOZA 1L7RA 4O4LA 2V4MA 3L6CA 4KV9A 3O3NB 4BWFB 3EXIA 5DM70 3GJYA 3IKJA 1A2BA 4GECA 4C6RA 1S9HA 1S8NA 4C2TA 2OV2A 4R6XA 2GF9A 1WO8A 3NHPA 2VC2B 3OZRA 2ALJA 2E6KA 1FVOA 3W2IA 2CHVA 4MWGA 1EDZA 1NX6A 1Z37A 4REQB 4FOLA 4YYEA 2CK3A 1Q7CA 3L07A 4TM8A 4CW7A 4MICA 1C7EA 2RI1A 2ZR9A 1THZA 1UMDB 1VBKA 3WKDA 2BHLA 1Y7PA 3H42B 5G3YA 2QN1A 3U3KA 3RIGA 4NMHA 4ZMBA 1Q0TA 1ZFNA 2XHEA 1XMOB 4JELA 4UBIA 2QR5A 1BS2A 4MUGA 1CHDA 4C0WA 3AV3A 2P77A 3JWEA 3P2MA 1U0FA 4UBMA 5K45A 2E5LB 2W2OA 1YDEA 5LB4A 4DV4B 4Z9XA 4HN9A 3QXJA 2Y76A 1XAIA 4JAVC 4RGBA 4AMVA 3AFHA 4UC0A 5KYWB 3F67A 2XMSA 4YRTA 3EYAA 3O73A 3S5UA 3JRNA 1JSRA 1ARZA 1RRPA 2HA5A 3V3TA 4L9WA 4RLFA 2ZVQX 4XTRA 2P11A 3SSNA 5B3JC 1ZCZA 2EQ5A 5G02A 4KR3A 4PNHA 4BU0A 1YIOA 2H2IA 4MQMA 2X0DA 1IB0A 1IM2A 2JKVA 1X7WB 1VI5A 2Y93A 3WISA 4RZHA 1TKAA 4LJRA 4QAJA 4EG8A 5KJ1A 1I0ZA 2P0AA 2VRCA 5K8IA 3INRA 4XX0B 4Z9AA 2GN0A 3GX1A 3KZOA 3OZIA 4P7GA 2XTNA 3FOWA 4X1YB 4C7JA 3ZCSA 5MDHA 2QVLA 1EUDA 2RGWA 1TO2E 4NRDA 2B82A 2FU5C 1L2TA 5I7UA 4L2IB 5I5EA 3AONB 2JFFA 5A05A 1E5VA 2CDBA 2QN7A 3IO3A 1H0HA 2W43A 2A1IA 3GLVA 3PEUA 5DH9A 4N1AA 1LFDB 2OHGA 3IJPA 4FS8A 4M98A 4CV2A 4KH1A 2EOAA 4MGKR 3RYCB 1I4LD 3S1AB 2NYRA 2M6RA 2WWTA 4HB3A 5DM4A 4ZTZB 4YRRA 1EK0A 1JQEA 2CUNA 5A62A 2XOXA 3ELUA 4N7RA 1P7WA 3ESZA 5LZ9A 3AF3A 1IOWA 2P2NA 2UUOA 3KQQA 4G01B 1AV7A 4QNNA 4F6RA 4MQEA 3DBRA 3MGGA 4RORA 4F04A 4MMYB 3H16A 1RABA 4HMQA 1NE7A 1F8YA 4GPBA 2J5XA 4IZHA 3LFUA 4RXUA 1TM1E 1NV9A 1XL0A 3ME5A 1ENPA 1GN8A 3M49A 2D28C 1GOTA 2A88A 2FJUA 4D41A 1Y6GA 1QIMA 4H31A 5H3LA 4E15A 5JAMA 2O8FB 2FN9A 4ZT7A 2C0QA 4DWVA 5I9MA 1VCIA 1HPLA 2OILA 3GGJA 4DEXA 4FBLA 1LQTA 4OXRA 1GTG1 1AUXA 2BCEA 4D9KA 4UAUA 4GBED 3BOSA 1ONOA 4PFKA 4Q66C 5A9SB 5GVRA 4PYMA 1TFUA 4GR9A 1R0LA 4FGZA 3UT0A 2QUBA 3RSQA 3AY0A 1MAAA 1MIOA 3B52X 3BWBA 3G0OA 4B6RA 3FNEA 5JS7A 2BJVA 2G82A 2BHTA 4TN5A 3URKA 2OHFA 5FOQA 3B3AA 2YQ4A 1KI6B 2W6JA 1N3LA 4UPVA 1Y8AA 4HF7A 4O4LF 2XQJA 1WCXA 2L17A 3A6FA 3HN7A 4UUOA 4LOLA 4V2IA 4WXEA 1P81A 2OA0A 5GWXA 3WDLA 4GNRA 4DNOA 2JANA 3LUCA 1Q21A 1L5GB 1KO7A 1T9KA 3OM9A 4HTFB 1TLTA 1EQAA 3V7YA 4GPEA 4GX5A 4A7PA 4BP1A 2E9FA 1JA1A 2YNMC 3GDWA 4IDGA 3PTZA 4OK5A 4Z2AA 2GERA 1FBTA 2WF6A 2OHOA 1TZ2A 3CONA 3IMFA 4C14A 4Q3AA 2GEVA 5JWOA 1M3SA 4HKTA 3V4VB 4X44A 1PFUA 3HVRA 2I67A 3UT5B 3K1JA 2XE4A 4WT7A 4XRGA 1EAMA 1V1MB 3JWGA 4X91A 3EGXB 3M9LA 2W2LD 4G0YA 3GCXA 4QOHA 3EVDA 4WNYA 4E03A 2VBGA 1W47A 1ESCA 1P80A 1BHJA 3CIOA 3O75A 5K8JB 1RXVA 4JR1A 3BK7A 2D0IA 2VHTA 3IPCA 1WU8A 2J9XB 5HFJA 2YMPA 4JI1B 1FP4B 1IAQA 2IEBA 4IMIB 3A6JA 1M2JA 3H2SA 4DLAA 2VDLB 2XUDA 3GDFA 4FZ5A 3FBWA 5ALMA 4AIRA 4F84A 1M2EA 2PVPA 3EX7C 3HJAA 1WMSA 3TDMA 2FQYA 4EUFA 1L8OA 1Q74A 1RHMA 1AS3A 2ENUA 3QBEA 5A9TA 3REFA 2GHTA 3ZHOA 1PNRA 3KWFA 2ZAMA 3ER6A 1XNQB 3M4ZA 1BRTA 1Y33E 3D31A 1M0SA 3QLTA 4U7FA 4AL4A 3QUQA 4MV9A 1TTPB 1XJCA 3ENZA 2VJPA 4YJHB 1KK0A 1Q22A 4H7IA 1T1GA 1UJ2A 2X1VA 1LPNA 1AY0A 1ESDA 1LF5A 2R85A 4HWRA 1Z2CA 2CC2A 3AUAA 3K9NA 4G2NA 4J2OA 4RPKA 2DXIA 3K9CA 4RE5A 3H11A 3K4QA 3QLVA 1GPBA 4MHOA 5K3DA 4E11A 5A04A 2AUTA 3WL6A 5L53A 5JS6A 1GRRA 1V7QA 4EITA 3QTBA 4UMFA 3LT2A 3PVZA 4NBWA 1WX1A 4RELA 4DSNA 1Y9EA 2WZBA 1U8UA 1XDBA 2A0FA 4XW2A 3NT2A 5KQLA 1BE6A 1E3EA 1YDWA 3ECSA 3FSGD 4HNSA 4RA6B 2Q4EA 2V7WA 1JTFA 4DMRA 1ECGA 1QBGA 1BHO1 4P58A 4W5TA 2J87A 3AI3A 3AFNA 3H87A 2AC7A 1NP7A 4OO3A 2XWBF 2J3IA 4EL0A 1YGYA 4HGPA 2R9VA 3SHFA 2ZUFA 3HRIA 3KEQA 1R1DA 4QKQA 5KOHB 1JVBA 1RI1A 4FWIB 5DGTA 1P8AA 4FYWA 4S2EA 1TJNA 2DY0A 4ASUA 1K75A 5KNCH 4JBIA 1CUIA 2GZDA 2HDOA 2I3ZA 1EWYA 4IHQA 3ZHXA 2B8WA 1LNQA 4FONA 4UMVA 4EQ6A 1KFEB 2H1VA 2UVPB 5F23A 1OFUX 4W8GA 5B1EA 2GAJA 3KOXA 5CG2A 4B44A 1GGKA 4QHYA 2ECQA 2FRDC 1I4WA 2B0JA 4HDRA 4HEA1 2HPZA 4P92A 3ZZNA 4RU1A 5T8KA 4X1KB 3F6CA 2H1SA 5IDXA 4CIDA 3W5CA 1IZYA 3GGPA 3EOBI 1TGVA 4HS4A 5IC5A 5L3RA 2AJBA 3GPIA 1FP2A 2X0KA 4I6JA 1F4VA 1NVVR 2IU6A 3H0CA 4MVJE 1Q7GA 4U7PB 2GLXA 3TSAA 3PUJA 2NZVG 4M53A 2YZGA 4PIMA 1RC1A 3TQIA 1E1YA 5D6NA 4ZA2A 4INJA 3QHAA 2PUHA 4FR2A 4KXMA 4LJ6A 1ORVA 1GCAA 3G2HA 2ZCUA 1YMQA 4MQLA 4B8ZA 2PZJA 2ZE8A 1BYIA 4NBUA 3B1XA 5IABA 3P9QA 5AVYA 4CTNA 2AUMA 3QH4A 3TOZA 4ZVLA 2PUDA 3GYGA 3ZVKA 5A5GA 1UKZA 2W8ZA 2BDTA 2OCLA 1XTKA 2NZJA 3JATB 4UXJA 4RFVA 2Q3CA 1R5OA 3FOEC 2BCJQ 2R1TB 4TTQA 4FBGA 1ZK2A 2FMIA 4UAJA 2OTCA 4U7JA 3W9UA 4EF5A 3HB7A 3I30X 3RWBA 3L0IB 1RWBA 1DQNA 2Z9CA 5D3KA 2C7VA 2GRAA 3C1AA 1WXXA 1XO1A 2XWQA 4G97A 4X54A 4P2GA 3CINA 4BRUA 4C6SA 1ZK1A 3GG9A 3CH6A 4D0GA 2O5RA 1HLFA 3LUBA 2GUGA 4Y9TA 2R8YA 3TV2A 4H3SA 5EUBA 4DLVA 1N6IA 4ETNA 1CR0A 2WV9A 1CQJA 2H29A 3AHFA 1J21A 3C3AA 3HBFA 4DJTA 5LQJA 2YC2C 1R00A 3OU6A 1EFTA 4NIMA 2POCA 1DC7A 3FTDA 4UXIA 4K9RA 4YGYA 3WIBA 4MO2A 5H9WA 2HHHB 3EZXA 4DEYA 2ZRMA 3VSEA 3BTVA 3O74A 5KHAA 3G59A 3A1NA 1BQEA 2UU9B 5A5EA 1RRVA 1SU6A 2OHJA 3CN9A 1QG0A 1EXDA 4M7RA 4GQIA 2A0WA 3PNBA 1DU4A 2RGNC 3DOOA 2DHEA 3FZYA 3PGXA 1ZCFA 3R7NA 2ZRNA 3MS2A 2WWWA 3OE7D 4OV6B 2VUTA 4A0GA 5BNIA 5JJIA 1RIIA 2WHQA 3N2GB 3JV7A 2LGJA 5DB4A 1XPJA 1M54A 4WFQA 1GPH1 1ECCA 2J3JA 2WA2A 1LVHA 1F6DA 3D8BA 5JH7F 2AZDA 2RHHA 1U0GA 2VWGA 4J0JA 2YYAA 3EVZA 3EXFB 3MWEB 4GPIB 2RHMA 5C4MA 2FW6A 3SYLA 3IQWA 5IAOA 1NYTA 3E3AA 3IQFA 1VZ3A 4B35A 1J25A 2G9RA 4M0PA 4XGQA 5B1YA 3THXB 4QUBA 4B46A 1CCWA 1IL0A 3O7WA 4OXYA 1QXSA 3CEAA 4XVCA 1OLXB 4DXAA 3HU2A 1K6JA 3A58B 4MJXA 4PG6A 4PW0A 5HIJA 2FZ5A 4OLFA 1GIAA 2CNWA 3U40A 4BNDA 1HY0A 1C3LA 2VSXA 1RQPA 4HADA 4ND3A 3ZWXA 1ZEJA 1M1NB 1D7AA 1K2VN 1L5ZA 3LCMA 5G1NA 1SB9A 1WB4A 2OGUA 3FPJA 3EOZA 3ZBPA 3P9IA 3PE6A 5EAIA 4PWYA 1UZUA 2EEPA 1AUQA 4PPQA 1VHDA 2HHJA 5IBRA 1QCCA 3T7SA 4D26A 4AMZA 4Y9RA 1PFVA 1W5TA 1WKBA 3E5RA 3HUTA 1N6LA 4NH4A 3I34X 1FYWA 1CK4A 2VNAA 4DNPA 3MWDB 1Y8RB 3BBLA 3ICVA 2WSBA 5KHLB 5CTJA 2RH5A 1OLSB 4PM4A 1MAHA 1E6UA 1L6RA 1M66A 4L0MA 5AIAA 4DDTA 5IBPA 4ZIRB 3ZWPA 4NAVA 2W6NA 1GTVA 4F97A 5BNWA 1CNMA 2WZDA 3C3PA 4LJKA 1WLYA 1D4ZA 2EATA 3JD0A 5AOVA 4LE1A 4RSHA 5E4YA 3HL4A 5BSEA 1P1FA 2E4UA 3NBMA 2G4LA 4P84A 5CDUA 4P0QB 4NOJA 4YJGA 3B3GA 5IJ9A 2C77A 1WETA 4C08A 2DWOA 2XECA 4KB5A 2KPOA 2PX6A 4NU8X 4CT4B 3JD4A 3QVWA