1Z4PX

Structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with deoxyriboguanosine 5'-monophosphate
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate specificity of the human mitochondrial deoxyribonucleotidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords 5'(3')-deoxyribonucleotidase
total genus 64
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1z4pX02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4pX01
4EELA 5AI5A 4CNQA 2QYHA 1Y8AA 5ALRA 3UM9A 1YDFA 3N28A 1L7MA 5AVWA 3B8EA 1VFPA 2AGVA 5FP0A 1RMQA 1TE2A 2RB5A 1VJ5A 2Q4RA 4EENA 2WHEA 4ZEWA 1Z4LA 5ALQA 5ALNA 2HO4A 1EK1A 4BNDB 2MSNA 2PR7A 3QUQA 3SHQA 4EZEA 4G9BA 2YMPA 5AVSA 2EAUA 3FZQA 3R4CA 1F5SA 4YCLA 5AKIA 5ALSA 3L8FA 4BEWA 4OCZA 3AR5A 2HCFA 4FE3A 3OCUA 3E84A 3D6JA 2FPUA 3B9RA 2CFSA 3FVVA 1RQLA 3WKCA 2JAUA 3AR9A 3ESRA 5ALKA 3OCWA 1WR8A 2P9JA 4Y2RA 4HGQA 1Z4NA 2HEGA 3ZWKA 2B0CA 2NYVA 3ZX4A 2R8XA 5AI6A 4BYGA 2OA0A 5AM1A 2FPWA 2P27A 4BNDA 4HGRA 5ALYA 5AVZA 1L7OA 2RAVA 5AW2A 3RF6A 3OPXA 5E0OA 1WVIA 1Q91A 2EARA 2P11A 3I76A 1T9ZA 3WK7A 5ALJA 2ZBGA 4BX0A 4UATA 3OCVA 1U7PA 2YMLA 3QU9A 4F71A 5IT0A 2CFTA 2JAOA 2W11A 1NRWA 1CR6A 1J8DA 2YJ3A 5IT4A 4UM5A 3QUCA 5ALGA 3ZVNA 1YV9A 4Y2UA 2CFRA 5ALMA 5AM2A 1L7PA 4UMFA 5AVYA 1RDFA 3IJ5A 3F9RA 5AVUA 2PKEA 1NF2A 2RARA 5AKKA 3EF1A 3ZI4A 2WF8A 2ZG6A 3PDWA 3W5BA 3AR6A 4Y2VA 2ZBFA 4CF4A 5ALUA 3L8HA 3A3YA 4Y2XA 2MU1A 3U7HB 2C9MA 4HGOA 4GXTA 3OCYA 4MWOA 3L1UA 1RKUA 1L6RA 3L7YA 2NO5A 4UMVA 5AM4A 5JJBA 3U13A 4YGYA 1YNSA 1L8OA 2OBBA 3MN1A 4RESA 4FFDA 4F72A 3HYCA 5ALIA 1EK2A 1RKVA 2CN1A 3U19A 1U2SA 4BEVA 1TJ5A 3NALA 4UASA 1ZJJA 2FPSA 4YCMA 3QLEA 1XPJA 4L57A 5ALLA 5AW5A 3ZTWA 3EF0A 5AVQA 5ALEA 3AR7A 3W5CA 3QU2A 3IRUA 1Q92A 3AR3A 4UU1A 1Z4QA 2FUEA 3ZU6A 2IA5A 3K1ZA 2B8JA 3ET4A 1RMTA 2YBDA 3QGMA 5ALHA 2G0AA 4NABA 2HX1A 3U7FB 2Q5EA 1YS9A 2ZXEA 2ZOSA 2FUCA 3WKBA 5ALWA 1RKQA 4UMEA 4JDPA 4BKMA 4Y2QA 2B30A 4XE5A 4IFTA 4B6JA 3HLTA 4O8CA 3R09A 2G08A 2R8YA 4CF3A 5AW3A 1ZD5A 3J7TA 1O08A 5AIBA 3DDHA 4UAUA 5AVTA 3BWVA 5AK5A 4KX3A 2G06A 1L7NA 2NO4A 1U2TA 4Y2YA 3OCXA 3KDPA 4G63A 3ZVLA 4NWIA 1IWOA 3U7EB 1QH9A 4HGNA 3A1CA 4EEKA 2O2XA 2YY6A 2C4NA 2EATA 1YMQA 3WGVA 3WKDA 2RBKA 2B82A 3W5AA 2FI1A 4Y2TA 1SU4A 1Z4KA 2AUTA 2OM6A 4DWOA 4BX2A 2GFHA 4CF5A 4DW8A 3FPSA 2X4DA 4BX3A 2BY4A 5AICA 2B8EA 3MPOA 4GIBA 5ALVA 5AW7A 2WF9A 4CE6A 5AVRA 1T5TA 4OHFA 2IYEA 3M9LA 3SF0A 4UU0A 4AS2A 4YIHA 3L0CA 5A3QA 3ONNA 4HAIA 4E88A 4OD0A 1LTQA 5AI0A 3KC2A 1XP5A 2I7DA 1LVHA 5AI8A 5AKZA 2YN4A 3FPBA 1RRCA 1TA0A 3M1YA 4AS3A 5AKJA 1RLOA 5AKYA 2HSZA 3DV9A 3ET5A 1ZD4A 2GHQA 2BDUA 3ESQA 5ALXA 1RQNA 5AI4A 5AI9A 1ZOLA 5AW6A 3W5DA 2C88A 4L6CA 5AW8A 3QU5A 2HHLA 2I6XA 3A1EA 4Y3UA 3U7GA 2BDEA 4KYTA 4JB3A 4OFZA 3L1VA 4UM7A 5AKLA 3SMVA 3ZW7A 3N07A 3QUBA 1Z4MA 1L8LA 2Q4TA 1AQ6A 3DNPA 3DAOA 3FGOA 5AVVA 2G1AA 2HF2A 4HYTA 3NIWA 3QU4A 3ZUPA 5AK6A 3EPRA 5ALOA 1S8OA 3QNMA 3SLRA 3WGUA 1RC8A 3UMCA 3S6JA 2YJ5A 5AESA 1XVIA 2QLTA 2W4MA 3TLMA 4YCNA 1QQ7A 4KX5A 4QJBA 5AW0A 3AR2A 2PQ0A 3MC1A 2R8EA 4HGPA 1SWWA 4UW9A 3QU7A 5AKXA 5AIAA 3B9BA 2YFYA 4Y2SA 1QQ5A 4L6AA 4RETA 4NV0A 1U02A 1X42A 4EX6A 3ZWDA 1ZRNA 3EWIA 5AK4A 2YMQA 1Z4OA 1TJ3A 5AM3A 5AW1A 5ALFA 5AHXA 1WZCA 2AMYA 2ZBEA 3VAYA 2IOFK 2I55A 3WK5A 3QXGA 4I9FA 3SKYA 5ALZA 3WK4A 2YJ4A 4YIKA 2C8KA 3PCTA 3E81A 5AVXA 3PGVA 4DFDA 3KD3A 3QX7A 5AW4A 2I34A 1ZD3A 4Y2PA 2YJ6A 3KBBA 2HF7A 4QQFA 4NFLA 1RPZA 2IOHA 1ZD2P 3NUQA 3QUTA 3UMGA 2JAWA 5AM5A 3AR8A 4ZEXA 4IG4A 4ZEVA 1K1EA 2HDOA 3WKEA 5A3SA 1VJRA 1RLTA 2GMWA 3CZ4A 2HOQA 3MMZA 2ZBDA 1WPGA 5ALTA 3N1UA 1NNLA 3KOOA 2AH5A 3NASA 2FDRA 2G09A 1JUDA 4H1WA 2C8LA 3E8MA 3IB6A 3SD7A 4I9GA 4KNWA 1N9KA 3UMBA 3PGLA 2JGAA 3ED5A 3FM9A 4FYPA 1PW5A 2G07A 5AKGA 1Z88A 3WK8A 1Z5GA 3N5KA 1SWVA 1Z5UA 1Z4IA 2FPRA 2WM8A 1TJ4A 3OCZA 4YH1A 5ALDA 4MUMA 5AW9A 4J03A 1YJ5A 4UAVA 4XPZA 1QYIA 3NRJA 1QQ6A 1O03A 2O9JA 2IOFA 2YMMA 2HI0A 3AR4A 3ZVMA 3P96A 3CNHA 5AKEA 5T41A 3R9KA 4DCCA 3OTQA 2GO7A 2DQSA 2R8ZA 1Z4JA 3I1YA 3I28A 3SKXA 5AKHA 1MH9A 1FEZA 3L8GA 4AP9A 3RFUA 1U7OA 2JARA 4EX7A 1J97A 1RMYA 3KZXA 4C4SA 2G80A 4C4TA 2I54A 4BBJA 1CQZA 3U26A 4UMDA 2WF5A 4KNVA 2W43A 4KN8A 4XOUA 5ALPA 1T5SA 2FEAA 1KYTA 3L0YA 2I33A 4J2TA 5AM0A 3ZTYA 2D2VA 5IS2A 2GHTA 3L5KA 2WF7A 1N8NA 1Z4PX 3E58A 2B1QA 4PNHA 3A1DA 2B1RA 2ODAA 5AK3A 1S2OA 2WFAA 3NANA 1ZS9A 3L8EA 3NAMA 4C4RA 3WK9A 3BA6A 3QYPA 3N8GA 5A3RA 3GYGA 1RLMA 3L0BA 4Y2JA 3I6BA 2FPXA 4XQ0A 2VKQA 1ZRMA 3WK6A 3ZX5A 2WF6A 4NAVA 2P69A 2OYCA 4UARA 3WKAA
chains in the Genus database with same CATH superfamily
1Q7CA 2OKGA 4QSHA 4CJXA 4ZZ1A 3RAJA 1V43A 2B99A 2CLSA 4Z0TA 1Q6ZA 3OIVA 3RVSA 2RIRA 4GOKA 1RC0A 1W96A 1BYIA 1HDOA 2DUWA 2WJVA 4NJEB 5HS6A 5JJCA 1G7TA 2O8CA 3D2BA 5EHNA 1GVNB 5BQ5A 3WLRA 3QX9A 1PFYA 1XD2A 3THYA 1ADYA 1C3VA 2QV7A 4QTUB 4G0WA 2M2IA 5ALQA 3R6LA 4QHTA 1X8XA 4CQMB 5EQDA 1QMPA 4I0WB 2PL5A 4PZCA 3IT2A 1IIBA 4TLLB 2OCIA 1TJWA 2RGNC 3DAHA 4CVNA 1VGRA 1ZHFA 1HZZC 1E77A 4KR3A 4KG7A 1M6HA 3BH0A 4MMZB 3STVA 2QTWB 2YVQA 4Q4CA 4G0VA 2C9CA 1QIKA 2GR9A 3PIIA 4R0MA 2MDTA 5K3AA 1SUSA 3UUFA 1SKYB 1U5CA 3H5VA 5DLEA 3GTDA 1VJCA 1U7WA 5D5HA 1QCDA 1AK1A 3D6JA 3PLNA 2J0VA 4JROA 3WB9A 3PWTA 2QYSA 4QD3A 4C6HA 2NZWA 4F8JA 5LQMA 2E4AA 1V4VA 5ENDA 2PTRA 1G4HA 1J0DA 2MIIA 2PS9A 1NSYA 2D5CA 2ZAYA 3O3CA 2Q0XA 4OHMA 2YJTD 3BIFA 1U90A 4XI9A 5J2TA 3HI4A 5C52B 3FAKA 4UFPA 3QFHA 4NSLA 2GPWA 3DL4A 1OAOC 3ITNA 3M33A 4KXYA 1NF8A 2XVXA 2B0CA 1M76A 1FFXA 3ECAA 4I08A 5AI6A 1QRUA 4YACA 1V5GA 4ZHQA 3NBYC 1SH7A 3ENQA 2YHIA 3FJ1A 3G7SA 1E2KA 2NN3C 4HDAA 3CGGA 4G5GA 5DCYA 3DUWA 3A2MA 1U81A 3G8BA 4QBFA 5CHEA 5DGIA 1XROA 3DP7A 2X58A 5TR9A 3DM5A 5U4XA 4JUFA 2FVXA 4QJ4A 1BZYA 2A33A 4FHCA 4YWHA 1NP3A 1IHYA 3I1FA 3K9BA 3DZFA 2F90A 1JPVA 3T6KA 1EB8A 1M72A 4Q4HB 4E4TA 5JRZA 5ITWA 4UVHA 4OP2A 3TLEA 5BR7A 1QE0A 2QN8A 4BLSA 4C29A 1FVXA 3QPWA 4R7TA 4CR8A 3TV2A 1GXSA 4Q7MB 1V1MB 3CNBA 3ZDYB 3Q8XB 1K7FB 3OCJA 5KHLB 3BKXA 1RWOA 2XSZA 5E6UB 3SVTA 3S1AA 2JPDA 2V3WA 3NIBA 4G81A 4X9XA 2H31A 2I1LA 3JALB 4RVNA 3AY0A 4RZ3A 3TLKA 4QARA 3FOFC 4YNBA 3NYIA 3JPWA 3Q98A 5HCUA 2HBYA 3SEFA 2IV2X 4M9SA 1XDBA 2EQAA 4U9IS 3DV0A 2P6UA 3V8QA 2XCQA 1JGTA 3LO5A 4INPA 4MVJP 1YZLA 2V98A 2D0PB 2HQRA 4M21A 2E4YA 4KO3S 4DLVA 1K4KA 4YALA 3OT5A 2H5JA 2O5CA 1R8SA 1EKXA 1LPSA 1WE2A 1YRYE 2PX6A 4RY2A 4U8GA 1AVTA 1SHJA 1YDGA 1TA9A 3ZKWB 3WVNA 5K05A 4DEXA 2XZOA 2CK3D 1ABFA 3HE3A 3U13A 1I10A 1NFFA 2A14A 5JJBA 3BZBA 3LOPA 3ROGA 1RWMA 2NZYA 5FI0B 4TYMA 4NHOA 5ULLA 4F3NA 3HH8A 5HCIA 2O2GA 4JJZA 4LIPD 1VXRA 4F45A 2VT3A 3U7RA 1E1DA 1CJSA 4CQNA 1MTZA 4KQKA 1UOPA 5DNWA 4MUJA 1ZSNA 2BMJA 2I8CA 4CTOA 1IOVA 2A0FA 3WFJA 4YLYA 3OPYI 1I32A 2XDQA 3LT5A 4WCVA 4IV8A 5EYPB 1ZD8A 4G5XA 2W0MA 1WSWA 1RCTE 5BR1A 4DM7A 2NIPA 2CDNA 2WPDD 3M34A 3Q5EA 4UUQA 4DIMA 5AVQA 1NBOA 4EKIA 1NZDA 3IRUA 4GD3Q 3G17A 1N6HA 1F6WA 4MVXA 1ZGCA 3T38A 2AG1A 4KACA 3G3EA 3L4JA 5L7TA 3WQHA 4KHPB 4H35A 5DOZA 2ZJ6A 4OLBA 1JF8A 1WUIS 4U7GA 5BY2A 3B3AA 2LGJA 3MA0A 2CC2A 1AX9A 1GY8A 3SLGA 1U15A 2FUCA 4OI1A 3T7IA 4TSRA 3QTBA 1LBEA 2EF0A 1UMCB 4GBMA 3G5TA 3CPHA 3CPJB 3PFHA 4EG1A 1HL7A 3JQ9C 2HR1A 4LYJA 4R2LA 2QNIA 4R2KA 5MHTA 4G1BA 5EIBC 4B71A 2RMKA 3DAFA 1I4EB 3K31A 3F6SA 3NZEA 4QGBA 1MAUA 3TFOA 5DGTA 1ATZA 2BH9A 5LQRA 5EQTA 1FUKA 2QE6A 1YBAA 1IEQA 3HUEA 1NBMA 5JIBA 1K3FA 2XDYA 5KTSA 1T5BA 3PD0A 4JX9A 2HLDA 3BDAA 5FA6A 2XVZA 4GKVA 1K92A 4AJ9A 5SZIA 5IJWA 4R84A 3T1TA 4Q6BA 1V7ZA 3I34X 1D9XA 2G17A 4WN9B 2J7PA 4IOJA 1P0FA 3ZH2A 4P7GA 1V8PA 3DO6A 5DTMA 1VLJA 1GITA 4LZJA 4RHTA 3UJ6A 2J5XA 2ETVA 3KDPA 4EYOA 2WLTA 4B5LA 2QR5A 4DS3A 3M89A 1IWOA 4GOOD 2IEGA 1IM2A 4JXJA 3U7EB 1CUSA 4ECAA 4ZVLA 4JC8A 1NLZA 3A1CA 3GFBA 4JYPA 1B42A 4EEKA 1E3WA 4DNOA 2JJQA 3P9RA 3RV4A 2X8JA 1XRMA 4L9RA 4JLAA 3OZAA 4XIYA 3FOZA 2R47A 3VM6A 3EDOA 2B4KA 4RE6A 3ESZA 3EARA 4XJVA 4CIAA 1JEJA 1MOQA 7ABPA 3CA8A 3SZLA 4I7EA 4DLZA 2ODTX 4NS4A 5E2IA 2P3SA 2QB5A 1H8ED 3ANMA 4AG3A 4BN4A 3GPLA 2GN9A 4RSHA 3UMVA 5P21A 3RKUA 2AUTA 2C5EA 1WQ4A 2O2IA 3FSRA 4JJ4A 1PGJA 4TUYF 5H83A 5BSRA 3UKDA 2YXDA 4B4OA 1HWYA 1ZHHA 3NOQA 2WG1A 2O8EB 2JK1A 4E2XA 2OFFA 3HCBA 2X4DA 4UNQA 4Z3OA 3GN2A 5JWRA 2QU8A 4FMDB 2O2DA 3D7SA 3GPIA 4U4AA 1RRKA 1L3CA 1C29B 2IH5A 1N3LA 1UBKS 2GO1A 3MAAC 2R6HA 3QELA 4O8ZA 4AS1A 1Z16A 3BM5A 1IOLA 2GHIA 3H65A 1PQ4A 2YXEA 3WDSA 1Z3IX 3GPCA 5D86A 3SU8A 5F64A 4XYMA 1FS4A 4W8OA 1ZVKA 4MB6A 3RC7A 4JDUA 4IMJB 3STTA 4EA6A 1Q14A 5B1YA 3WFIA 3UWKA 3ADPA 3JQAB 3NV9A 2PRJA 3FBWA 2PEZA 4GSLA 4N9WA 1UXGA 2F8MA 1H3NA 3FNQA 1QR6A 4AKSA 4PYJA 3IKTA 3IVMA 1N9GB 3BB3A 1ECPA 2F6RA 2W5UA 2D2EA 4G07A 1G3RA 3RD5A 4CM5A 1G5QA 3EFOA 1CWUA 3ZV5A 4LF6B 1U9IA 5CXQA 2FH5B 1AMOA 2FTKE 3C43A 2G4VA 2ERXA 3FJYA 1WTAA 2JLXA 1BKDR 4B32A 2KSQA 2QP9X 3E7PA 1Y63A 4HV4A 1XD8A 3ONFA 2A1UA 2MSDB 1YHZA 2VBFA 3GZHA 1L7BA 3ZGXA 4V2UA 3G9ZA 1WHSB 1NVVR 3H5OA 3L18A 1FDIA 2J9RA 1JFSA 3E1KA 4R69A 4YMWA 4X1IB 5LDGA 3QKIA 1IATA 2G3YA 3KPWA 4P22A 3PTLA 4YBZA 1YE3A 2XHZA 5DHRA 4KQXA 5KVQA 4OFZA 3DCYA 2ZAMA 5K3CA 3SMVA 3PC4A 2PX0A 1T4CA 3PUXA 4AZ0B 1Z4MA 1WWKA 3UWSA 5LM3A 4LJRA 2XD9A 1RXVA 4JFRA 1LWNA 1R4MA 3EEOA 4OUKX 4G24A 2HRQA 4BRWA 2ZWOA 4Y9RA 4OGLA 2HNBA 3BK1A 4EKEA 1OLUB 1EXNA 3OSUA 1PTJC 4CHTA 4AZ3A 2L82A 3ILYA 4CKBA 3ZWBA 1T2DA 3SWWA 2BUCA 1E5LA 1TM3E 4R3NA 1JHUA 4IAOA 3MCAA 3K9GA 3RAGA 1S8FA 3HXPA 2GA9A 5CEJA 1JL3A 2A0YA 4GAEA 3T34A 3UN1A 4CBVA 3EQ2A 1NL3A 2CXOA 1OPXA 4JB2A 2RONA 1W44A 3TLMA 3D6MA 1R6VA 1A7AA 4YRCA 1JSZA 3T4PA 5AUOB 4KHZA 4B3RB 3ONEA 3M4ZA 3PFWO 1N2HA 3C97A 1CJVC 3ZQUA 4FWTA 1XLUA 2RGAA 2W2MA 1OIXA 1WLYA 3WHLA 4FN5A 5AIAA 5IUJC 3VSAA 2WWXA 4FOLA 1EEHA 1FPQA 3WWYA 1C50A 1GSOA 2XYRA 1SCUA 1B93A 2PMCA 3LVRE 4YMLA 3KM0A 4L02A 1H65A 3EGEA 2JLSA 3INYA 1W6RA 1BGXT 4EX6A 2EEPA 1P7WA 2PX2A 2QE7D 3OBIA 1RYEA 4HDRA 4HWOA 3C3EA 4IQJM 2XNDA 5ECDA 3T54A 3OQJA 1NNSA 2I2AA 2LR0A 1OLSA 4OTZA 4L78A 5BN1A 3J7AC 3BYZA 5JYCA 2GBIA 4TXJA 4ZOCA 4LRXA 3CEPB 1XHLA 3RIEA 4TWJA 3W5JA 5J58A 2QTVA 1VCHA 3L9WA 1PW7A 1KK0A 3R4VA 5A6SB 4PSVA 5B3JA 5LQSA 4BC1A 1R6XA 1ZMBA 4I8IA 4UM9D 4V1CB 3ZXYA 4I9FA 1PZHA 4DAOA 2PUFA 4OAPA 2Y8EA 2VK4A 2B35A 2OXTA 4BLPA 5AVXA 1BOFA 2CNWD 3HPQA 5FA5A 5JJ5A 4UPEA 1P9RA 1XNHA 5TJ9A 5ADWA 4PGGA 1GTMA 4NU8X 2V6FA 4CODB 2H1RA 1DV1A 1P6QA 3F3KA 3B1FA 3QUTA 4MAAA 2XMQA 1OXKB 1XMXA 2O06A 1JSWA 2O7QA 2OV6A 2OHJA 2ZI7A 3FOBA 4REOA 1Q3TA 5DKFA 4HWPA 4HXGA 3CF4A 1TPZA 2ZYGA 1NVVQ 1VC2A 2OILA 1F2DA 1NURA 4CDMA 1BROA 1VJRA 1A4IA 1M33A 1JDZA 1N2OA 3OIFA 1XWWA 2GMWA 4UBLA 3VDMA 1A8SA 1PDOA 1FFCA 4RTJA 1JDUA 4BE4A 4DXHA 4RV9A 3MMZA 1X7ZA 3Q7SA 3HJRA 4MWSA 5CH3A 3SN6A 5IH7A 2I4TA 1O97C 1UXHA 2JKVA 2RGCA 2P5UA 2Y05A 3NONA 5HPYB 4P4SA 2A67A 3HEAA 4NG4A 1E7WA 1MBZA 4BNMA 2Y77A 2ZSBA 4AF7A 6PFKA 2ZYUX 1G8YA 2Z98A 1IXYA 1ZJ4A 4Z9XA 5HFNA 4CLOB 3R7NA 3K1YA 1SOVA 5HF8A 1GQRA 5DEIA 3ODPA 2JD1A 5K51A 4X7PA 1VE3A 1EVQA 4QYSA 3HVKA 1TECE 4YEDA 3HGMA 2J5BA 3VFDA 2C5AA 3TKAA 1LPPA 5GVRA 1EHYA 4A8TA 1FZTA 4S24A 4FM9A 1O03A 3I9KA 2A9VA 1C9NA 2IOFA 4MP6A 5TPWB 4AVYA 5JO0A 3E2PA 2C9OA 4TL6A 1OX4B 3R9KA 5TPWA 1KPIA 3D4NA 3BXOA 1E3EA 2Y1FA 3CKLA 3ML1A 4RD2A 4ZT7A 1ZCJA 2HQ1A 4OXXA 2TMYA 2BMAA 3VA7A 3I5UA 3ZWAA 4E94A 3M3HA 5BV1A 4FBLA 3OFKA 4MGIR 3R7AA 4YAGA 2BFWA 5K6AA 4CCYB 3UGTA 3NP9A 4FEAA 3TBFA 4PX5A 4IICA 4HL6A 3T9AA 2IXGA 1IJEA 3L7DA 4TZTA 4NYMR 3VPXA 4XGIA 3VJRA 2JAPA 1DIGA 1GFIA 2VHJA 2W43A 4XOUA 1ITZA 1O3YA 2PZLA 1GPYA 2YS7A 3IAUA 5FA8A 1ZITA 3RHZA 3VYUB 3DT6A 4GPTA 5A04A 1K63A 2GFIA 3WJ7A 1NQXA 1JS1X 4YAFA 5HQ3A 3WLOA 3RBZA 4R1TA 3ZWXA 1BA3A 1JMYA 4QBKA 4Q15A 1YI0A 1X1AA 4H08A 4C05A 5I51A 5JQWA 5F5XA 3AP2A 1H6AA 1Y8QA 3I12A 4A16A 1XTRA 5K4GA 1H4SA 4DDMA 1LXCA 3N7AA 4PRKA 3BA6A 1OV6A 1SG0A 5KCMA 1NTOA 2EEZA 1O95C 3B6IA 2OLJA 1XMJA 1E2NA 1L8XA 1XR3A 3IS3A 2NU8B 1XFDA 3R74A 2OLKA 1AGNA 3G5UA 3CY6A 4ND1A 3ZHYA 4AJ1A 2RGYA 3R40A 2WF6A 1DX9A 4ZYXA 3MOSA 3JQ8A 2Q8QA 3MLAA 5TARA 4X3OA 3FYHA 2JCGA 2RC6A 3TR5A 1JNXX 5HF6A 3B82A 4RABA 3X1MA 4FGUA 2LCIA 5TEVA 3LQKA 4WLVA 3OBBA 3WA6A 3I83A 2QDKA 3OZTA 3WQQA 1W36C 5HM6A 4NKRA 4PLVA 5BN4B 3ICEA 1EA7A 4ZCPA 1U31A 1O5TA 1VFPA 2UZIR 2V59A 5FP0A 5A0FA 1SXGA 1G63A 4LWQA 3RBXA 3UJ3X 3VR2A 5JTTA 2IL1A 4UBIA 2EFEB 5HUJA 4U7DA 5HTOA 2IFTA 3KYIB 2Y93A 2P2YA 2W4QA 2VSQA 1R5BA 1F1BA 3E0QA 3FUWA 3MJHA 3W8EA 4BNDB 4F3KA 4BAZA 3KUXA 4PYOA 2Q5HA 3DBIA 4H0CA 4LCEA 4WNYA 2CFCA 5CMLA 3JAWB 3VSCA 2GA8A 2QAGA 5AKIA 3VJLA 3VKWA 1M54A 5FEMA 1FTNA 5E38A 1VGQA 1Y9ZA 2CJFA 2QIOA 1GKUB 4NX2A 3F8WA 4RK6A 4UNIA 3F7OA 3CSDA 1JHQA 3S1LA 3VNQA 3AVTA 5B3KA 2F1IA 4UEQA 3FDIA 1GAQA 1E1YA 4XUGB 1K6EA 1IY1A 1QVVA 4GPBA 4YTEA 4IJ5A 4UPVA 5LBUA 1V3VA 3FVVA 3QRWA 2P79A 1GT91 3NT2A 3SZRA 5CA1B 3EZ9A 1Z0SA 5CFLA 1FSPA 4HVLA 3ABOB 1U80A 3K7EA 2HCBA 3C3MA 2Q6IA 2KJQA 3HZRA 4ID9A 3K94A 1E69A 3ELUA 5U1PA 3ZXUB 5T5QA 5H70A 1SA0A 2QLNA 4ZVKA 2DWPA 1G21E 2H4YA 2VTDA 2FPWA 1DHTA 3CXUA 2ZYVX 3IP5A 3JQ9A 3NHPA 4TTTS 4EUNA 2Q99A 1WB6A 2A1TR 1YIAA 2IW3A 3UICA 3TGPA 1G2OA 4Z86A 4KMSA 2WUFA 4X90A 4YPVA 3QOFA 2Z5GA 3SY8A 3E5RA 1WVIA 4J43A 3E0XA 1G9XA 2WU3A 3QBJA 5AOBA 3AB3A 3K0FB 4HFJA 3ZG6A 2QMZA 2FMIA 4DA8A 1DDGA 1J0EA 1U7PA 1YZFA 4PLCA 4B74A 1G8FA 1FMJA 4DCSA 3KAQA 4OXKA 4HSEA 1A50B 1JXAA 2R2GA 4B76A 2I4NA 2ORWA 4XGKA 3U3JA 2V74B 3GLGA 4UDYX 3A6DA 1ZGBA 4UM8B 4DDVA 4LN1A 1BE1A 2ZATA 1BD4A 3OQIB 3OQ6A 4DZRA 5C8XA 8ATCA 1P8AA 2WUEA 3N0TA 4J0CA 4RF5A 5DSTA 3W1EA 1ZCAA 2AHOA 3T3OA 2XT0A 4ZT3A 4MA0A 3R41A 5AM2A 1NYQA 2VPYA 3PUHA 2FZ4A 1LS1A 2HBRA 3KKEA 3SS9X 4AKEA 2QBYB 1HT3A 3TTVA 4B34A 1WPQA 4RTLA 2J3EA 1LVGA 4TTQA 2PKEA 1KMCA 3LHKA 1KL7A 1N36B 4JYMA 1QOZA 2WF8A 4GQAA 5G2OA 4Q9LA 4RTQA 4G23A 2W6NA 4J9UE 3UW3A 3GJXC 2EKZA 5K99A 2ZRKA 4FC7A 4Y2XA 4Z8YA 5IZCC 3ESAA 1GTRA 4MGYR 5KO2A 1DJOA 1J1IA 4YX9A 1SOMA 5KJCA 1EUQA 1PKXA 1PVDA 1DJQA 2G4CA 5EP1A 5J2UB 3ACBA 1L6RA 4RAQA 3TZQA 4ZDJA 1PJBA 5AM4A 3TNLA 5KNBH 5D1HA 4HVAA 5K8LA 1CTQA 3JZMA 5KX5A 1NDQA 1ZIDA 1OI3A 5G1OA 5REQA 4TT3A 5AH0A 1A97A 3HKEA 1PNTA 1I2AA 2H1FA 2NZJA 3HRIA 3QJYA 2V03A 4IFIA 1EJ0A 3FN4A 3IAM6 3A9CA 1GV1A 1SD2A 3Q3EA 1KZGB 4B7CA 1T2EA 2BFPA 1I9GA 4BTEA 2GCGA 3AHDA 1XF9A 1Z82A 3C3KA 3NO9A 1CLEA 1R6DA 2ZUBA 4PQRA 1U98A 3HA2A 5IP5A 5I4BA 3T5PA 1JQEA 4CW7A 2CXRA 3GJ5A 1SUEA 3ABIA 2AOVA 3AP1A 5M5BA 2ZQ5A 3WB1A 1KDTA 4ZYTA 1Q0QA 1ND6A 1AZLA 1XHFA 3AEUA 1JB1A 3GEIA 3WLIA 3RFTA 4BC0A 3QGMA 5E1DA 1CY1A 3W7VA 1ODTC 3A0RB 3WYBA 4KR2A 1TTQB 5JYEA 2AS0A 3T06B 3KOZA 1JIJA 4HSGA 3G2KA 2JCYA 3U2QA 2G1PA 4P3YA 1AM4D 1HR0B 3B9PA 1NOJA 3PUYA 4M7OA 3UQYS 1RKQA 1X1TA 4P31A 5DHUA 4V1CA 3H9QA 4BKMA 4DDWA 3EHEA 5E6SB 3GGOA 1FXUA 3CLVA 4MW2A 4C20A 5BVHB 2O1EA 1SOAA 1OSNA 2WM2A 4AF8A 1H42A 4WV3A 3M6XA 5G3YA 5GGYA 4Z7OB 4AWAA 1X8JA 4OHVA 1F2TA 3FWNA 3K2QA 3QVGA 2XDQB 4AKIA 2NSJA 3CG0A 2PU7A 3B8HA 4O4JF 5AJWA 1XQVA 1RIIA 3I52A 3CUYA 1JWAB 1O08A 2BSQA 4A26A 5KX5F 2OSVA 1I1QB 1T34A 2AFHB 2V9CA 4E3WA 5KYWA 4BPRA 3CONA 4YBRA 2HL6A 1F1JA 1RTTA 4N0MA 4AZTA 2D7DA 4BO6A 2G4LA 3FCCA 5IT9A 3LTEA 1EQAA 1NQUA 4ASUA 1R66A 1FFYA 1RE5A 2GQ0A 4JX8A 3SHOA 4LHEA 1WPRA 3FY4A 4DGSA 5KJ6A 2FUG1 3GDOA 4X00A 4C7JA 3RODA 2Z6AA 2Q0SA 1P3Y1 1DXYA 2H9IA 2VDPB 2JASA 3W2GA 4E0BA 2JIDA 2YY6A 3KKZA 3SC2A 5L3ZA 2YV5A 3VKVA 4MO2A 1LDNA 1SU7A 3T9CA 1TUBB 4Z7QB 5HOQA 1EBUA 1UZUA 1OASA 3EIHA 3ENNA 3O4RA 4HB2A 2CD9A 2RIPA 4ROSA 3S44A 3ZWYA 3R9XA 2AFRA 1BE6A 1EIZA 5T4FA 2JJ2A 1IXSB 2A2ZA 4NBWA 5LUBA 2GF0A 4EO7A 3PNPA 3MIIA 1ZH4A 4RKEA 2Q3MA 5BSUA 3TLZA 4ZYVA 4DKJA 3DQPA 3MS2A 3RTDA 1Z2PX 3E5NA 3AM1A 1PEAA 1IJFA 1ZBDA 2HMWA 2WOJA 2P8SA 3EIUA 4DW8A 4PGHA 2Z9DA 1CT9A 3D3JA 3EVDA 5AICA 1RM0A 2B20A 5JO9A 2WWTA 3WNZA 4YP9A 3MTAA 1K0FA 1FYDA 2C3OA 3EYWA 2C07A 4HZUA 5A4IS 4KR7A 4WNCA 4QYXA 4R8RA 3BGOS 5CDTA 3WRXC 3R3HA 5EI5A 3DLTA 1U2GC 3DONA 3FSGD 4JL8A 1MZVA 2ZM5A 1N5JA 1K6IA 2ID4A 2D3WA 2RGGA 4UHKA 5CJPA 3BMNA 4G89A 3ZE2B 1I9CA 2EERA 1YBFA 3Q88A 3QQPA 2M1ZA 5CX1A 2VXCA 2I29A 2ST1A 4IKPA 1FYFA 1ZMOA 3JQGA 3K72B 3QEMB 1JXMA 3KKMA 2YZKA 3CLSC 1GUZA 2FZCA 3ZCRA 4W9NA 3DLBA 1OAAA 2WIKA 5DLDA 5JAPA 3UJDA 3DDWA 2XB6A 4KITB 5JJIA 4UHJA 1E0AA 1YJXA 4XXHA 5FBRB 4KPGA 4OIMA 4YASA 5C5IA 2V6MA 1X7WA 1RLOA 3E05A 2Q5OA 4M8NE 4WA7A 1X7YA 2O2JA 2PGNA 4OP3A 5C18A 3DAYA 3Q12A 4DMKA 1DMSA 5REQB 3ZBQA 1W49A 2E5WA 4I1VA 4M9UA 3I0ZA 2BELA 4MQFB 4P92A 4BLQA 5FUQA 4JLSA 4BFUA 4XIFA 3FNFA 2EBFX 2XGGA 2ZRNA 3C6BA 3GAAA 4RM3A 2AF3C 1R3DA 5ECWA 3F1KA 1SXIA 3I9JA 3IALA 1O95D 4YGXB 2IZ0A 1ZSYA 3L7OA 3L1VA 3ROQA 2JJ8A 1QO9A 2ATIA 1ZOSA 4MV1A 4F2HA 1P1CA 1L5VA 1BX3A 1YS1X 2QGFA 4EL0A 3P9NA 4HI0E 4N3NA 3ZQKA 2Z4RA 5JZ9A 3DAOA 3FGOA 4J0GA 5CT4A 4EAQA 5TIIA 5KNDA 3L6OO 1QGAA 4V38A 1QKJA 2HT1A 4YPOA 3NDRA 3MWYW 2JFPA 3D1LA 3JAKB 4GR9A 2WAMA 4MLPA 1UQTA 4O1IA 4RJIA 4ZRDA 3VYRB 4EFMA 3B1ZA 4S1PA 1NU8A 4EG6A 3PJEA 2H4FA 3NHMA 2X5JO 4MHOA 3QHAA 4D42A 2FW9A 1EJ2A 1U7ZA 3SQNA 2OHOA 5L3RA 1TO2E 2MSCB 5JLJA 3KFLA 2HFKA 2R5FA 3FAZA 4KYVA 2YHIB 2V97A 2W4MA 1SBNE 2HHAA 2ZT7A 5KQRA 4RKWA 2FKNA 2PMDA 3TZHA 3U09A 2W2KB 4PAMA 2P65A 3HWWA 4CKZA 4ZVOA 2EKDA 1AUQA 4HNTA 1Y3FE 1M2FA 5F9MA 2VVTA 5KYNA 1KI6B 4GZ5A 5DM0A 1KH2A 2DE0X 2HMVA 4LOHA 1HTBA 5KYVA 2MCFA 4LFAB 3E7DA 3TXXA 2W7TA 6REQB 3WNBA 2ZIAA 1TKAA 2QQGA 5LD2B 1S8AA 4NZZA 3DDZX 1GA6A 4GVXA 4JCCA 3S2GA 4A0GA 2VH2A 3DP9A 4QBTA 2FPIB 4DNFA 4FJ0A 2O7VA 2PXAA 2ZTLA 5DRYA 2K7ZA 5ETJA 1FLAA 2AEMA 2FFJA 5JS8A 1NMQA 1M1YB 5GP1A 1S9DA 1YTLA 1BWSA 5FL3A 4LOKA 3DKRA 2ZVJA 2IOFK 5B3LA 1LSUA 1YVEI 3FWYA 4NBRA 5FOVA 3U7IA 4TOIA 4E2FA 5TEWA 1KRWA 1XBTA 2WVJA 4KQFA 4OKIA 3IQIX 4RMNA 4KQ2A 3V1KA 3A2KA 1GR0A 3LC7O 3M70A 3FB4A 3R0IA 4KFUA 4UVDA 5FCDA 3VOTA 4Z5XA 3QE3A 2JBAA 5EPEA 3NJ4A 3SC4A 3VZCA 3VC7A 1QLHA 1U94A 1E0KA 1WUHS 3I8OA 4K1XA 4QREA 4UTZA 4WK6A 3ELDA 3TDKA 4D4KA 4LF7B 3ADDA 4K9SA 1WXFA 4QICA 3KBBA 1DBPA 4QQFA 1P80A 1XTVA 1E1NA 3HN2A 3F4TA 4DZZA 1DFIA 3DB1A 1H8HA 4WZAA 4CKXA 1KNQA 4RD0A 1EP9A 2XUZA 4MV3A 4M86A 1THZA 4OL9A 1LLFA 4NY1A 2F48A 1NZJA 1W47A 2VXOA 1UEXC 3FNBA 2JLYA 4AO6A 4GRDA 4XVHA 5I9LA 1UM9A 2VYCA 3BZUA 3N2LA 4GLFA 5THQA 1CVIA 2R68A 1LY1A 5J5AA 5C1PA 5A7GA 4NBKA 3OJFA 4WCDA 4PRZA 3FCAA 2ZWMA 2IHYA 1V6AA 2ASVA 4LDJA 1LW6E 3C6QA 5C7YA 2ZSEA 1JJBA 4NMWA 3WNDA 1FFHA 2IUUA 1R4AA 3CVOA 4FUQA 3H0CA 1A5BB 3RUHA 1UR5A 3KXIA 3GLIA 3IB6A 3JQEA 4ZXFA 4UUOA 5JCZA 1L4HA 1R4ZA 1ZICA 3IAXA 4FDLA 3OQMA 4A0HA 3GA5A 4P32A 4ZAGA 4OXYA 3ZE9A 1PZMA 2C7GA 3QFRA 3O8NA 1A7JA 1HDYA 5LA6B 2PYDA 3MUFA 4GFDA 4CDRA 4FEEA 3JZAA 3DGEC 1G5TA 1FNCA 3NR2A 5NULA 2B21A 2YQ4A 1AKQA 2GDJA 1GKYA 2WTAA 3L8MA 1Y3AA 1TVEA 1ZVJA 1HORA 2QN2A 3FB1A 3JRWA 5EFOA 2RJOA 1E3DA 2C77A 5FNVA 4YXWA 4EARA 1QYIA 1VIYA 2ZT6A 3G49A 4MV7A 3HCCA 4CMGA 2XSZD 4BBAA 4ALIA 2CJPA 1IMOA 4MWGA 1EM8B 1SHTX 3CVYA 3CZRA 1M5TA 3W5UA 3HYLA 5C53B 4QPNA 3RO7A 4GL4A 5I3CA 2VRBA 2IF0A 2OHIA 4DAEA 3BERA 4ZK6A 3LDGA 2ZS8A 4LBVA 2H9YA 2YICA 4Z4CA 4WKOA 4YAEA 4YJGB 3JALA 1X94A 4Y2HA 1E2LA 2E6KA 4D3XA 1GUFA 1DAKA 4EX7A 4OUDB 2DHDA 3WWEA 4BZZA 5A3QA 2VJKA 5IPFA 1J8VA 3C0KA 2ZJ8A 2EX4A 2P4HX 1KJNA 3LK7A 4Z49A 3C8ZA 4FI3F 2Y1OA 2R00A 4LNHA 4DSNA 4M9QA 2X4LA 3UMSA 1TO1E 2R00C 5D01A 4M49A 4AY6A 1HFJA 2F00A 2XAAA 4M8IA 4IBOA 3HQ4O 1PJ4A 4BKPA 4EBBA 2OHXA 2D2VA 3P2OA 3GEDA 2C4TA 1GGHA 1B8NA 1RAHA 3VU9B 3VZPA 1Z4PX 1F6DA 1RYYA 3DD5A 4LJAA 2QEQA 1BHSA 3HCDA 2OZKA 2JLZA 3D2CA 1S2OA 1X1RA 5JAZA 3V2HA 2JH9A 3B1YA 3DMHA 1UBFA 2B5WA 3N0XA 4HTFB 4W1QA 3WK9A 5C8ZA 3KJXA 1X3SA 4R1SA 2BJVA 3GGCA 2C2ZA 4G1VA 4LECA 4IIYA 1RYMA 3I58A 1KIFA 4LJ7A 3SF8A 4M0EA 4BJHB 2IHNA 2P69A 3IIMA 3OX2A 1SUPA 1KJ8A 3VPBA 4GZMA 1GIAA 3QF7A 3V2IA 4EELA 5I4CA 5CYGA 3BE8A 3GLHA 3SSNA 4NCHA 1E9VA 1N78A 1XD9A 2Q3HA 2H51A 2YIJA 5K9ZA 1FE8A 4Q3OA 4G5RA 1I3NA 4YRJA 5JSYA 4DWWA 2F3SA 3H8SA 4BB9A 5LNK6 1QH8A 1SCKA 4L75A 3RHFA 5HGJA 5BSEA 2R6JA 3H11B 4J1SA 4EVSA 2UZ1A 2EGHA 3Q5DA 2C59A 3LPNA 3TIVA 4GE3A 3VSDA 5E1BA 4LNAA 3VOAA 2JD2A 4LC0A 5JPDA 4XJTA 1SVOA 3K70B 2D4AA 4BQPA 1TYZA 4XJSA 1BDJA 1I2ZA 1RE0A 3THOA 3H2GA 5LP1A 2AW3A 3GUCA 1YRHA 1ZBQA 1D04A 4KGXA 4DL9A 4NCIA 1S8NA 3O3MB 3OPMA 5FOWA 5C3UA 3UXEA 2C03A 4IZ6A 2PZKA 2R44A 2FFBA 1E1CA 2VRNA 4NAHA 1JA0A 2J6CA 3RYCA 1I6MA 1JEQB 1KJZA 1ZD1A 1KO4A 1BWRA 3HCRA 2FPUA 4BNJA 1UBRS 3Q6NA 1TW3A 3K0HA 3HCNA 3M6VA 2Z95A 4YMGA 5IYZA 2ZR8A 3AR9A 2XNCA 5ARDA 2OXEA 3D3QA 2JJ1D 2COUA 5FBHA 1FP7A 2QMOA 1I4TD 2QDXA 3R0ZA 1GM5A 1GPLA 4O4JB 4L5BA 4X71A 4O0LA 3IV6A 2W93A 3B1JA 4IHJA 2Z83A 1GU1A 3ZX4A 2JHAA 4BYGA 3B70A 4IHJB 1NHWA 4QYIA 1WVMA 2RD2A 2FOIA 4XX0A 3U4DA 3T3IA 1XZFA 5INTA 3ZD9A 5HF5A 3USZA 2BTQB 3E3MA 4BNDA 5AVZA 2QAGC 3C8MA 2NGRA 1Y81A 2A4MA 4Y6PA 2WTMA 4GX5A 1TZBA 3EIXA 3K30A 4FFMA 2P5SA 2V9PA 1C7FA 2V7QD 2ZB4A 3NC4A 3NCHA 3S1SA 2HJGA 1W5FA 1VSUA 3MT9A 4D9JA 4MKRA 4OLHA 5JISA 1PE0A 1O6CA 4PPFA 2GEUA 3RUCA 3AUSA 1C81A 3TWOA 4BQSA 5HYVA 4AMZA 3F5DA 3GUUA 2A86A 1ZW1A 2AOTB 3LXMA 2FRXA 3UO8B 4BVBA 5HGXA 3JQAD 1LF0A 4U0KA 4ZAWA 4A8JB 1WXQA 3U16A 4UVEA 2Q0HA 4RTPA 4QUGA 1CF4A 3HACA 3BCSA 3O21A 3AGQA 3LUAA 1ACMA 1EGVB 2OVFA 2ZIWB 4AIIA 4LY6A 1M0EA 2IX3A 4H6PA 3MUOA 1KO5A 3VUFA 2RGBA 4MMYB 1HV8A 2OORC 5DM2A 5KZMB 1RZUA 2QENA 5K1ZA 1U3GA 4MYRA 4K8OA 2OPHA 4C6RA 4A9AA 1B41A 1MT3A 2JFZA 2BBOA 5ESWA 4PC7A 3MILA 1SVUA 1ABBA 4OXIA 2XWSA 3G5AA 1GKKA 3HA7A 1HE4A 4PSCA 4QVGA 4DV3B 3PUVA 2Y6VA 1H5NA 1JLLB 1E1RA 2BFEA 4J1QA 2VC2B 1BSVA 4DLKA 4EJMA 5IASA 5L6MB 1WZ2A 3QKRB 4V0MA 1EFAA 1R5JA 3HHPA 16PKA 3CH7A 3G2HA 4W9MC 1PLLA 1VLZA 4OQFA 3FR8A 4GOXA 5L7YA 4AKTA 3OPQA 1ORRA 4I1UA 2WUVA 2I7VA 4IO0A 4OMCA 3CEHA 3SXJA 4TXHA 4H3KB 3I45A 2HRZA 3DPUA 5BWNA 1YNOA 4LY9A 3U1BA 3QY0A 4H2DA 4OU5A 1OUMA 1RKVA 2HT6A 4Z9BA 3VU9A 3AI7A 2HF8A 3KOXA 4IIGA 3NALA 4RKRA 2BJHA 3P9IA 2XQIA 1O94A 1D2CA 1PGQA 2A0XA 4HDQB 4YCSA 3PF9A 3QBVA 5BN5B 3ED1A 4FHEA 4MQ6A 5EQJB 5C8DA 2J85A 4KPFC 1K8QA 1UBUS 2H0RA 4Z4EA 1RQPA 3COZA 2HF9A 4EB3A 1A95A 4KIUA 3GJ0A 1ANKA 1Z0KA 3GN1A 1OT5A 2FLVA 4KFSA 4MV0A 3BXXA 2Z04A 2JD0A 4V0ME 2IYRA 1G3IA 5HW2A 1Q92A 1R4MB 2QTAA 4UHDA 2FR1A 4WA8A 3L77A 3RS2A 2XB9A 3UJPA 3PR3A 1T26A 1DEXA 4BS9A 3F8TA 1NWHA 2CHFA 2HMAA 3ET4A 3I39X 5D6NA 3RTAA 3K05A 2DRIA 1YHNA 1ULZA 4N03A 3R6VA 4ZU3A 4D0LB 4OI0A 3HJHA 2XB2A 4RF3A 1K3UB 1NV9A 3AUFA 3CWZA 2IVZA 1RBQA 2JA2A 5JFGA 1OTYA 1X7WB 2R8RA 3VH4A 3EDCA 1FDSA 2WZQA 3CTMA 4XTRA 3K15A 3TOVA 2ZTMA 5KYGA 5HJ2A 5IF3A 1R10A 2AFVA 3JD1A 1QCYA 2QN7A 3B3GA 3PYMA 5CLQA 3WMGA 1C3XA 3NEPX 3E4DA 2DHRA 4D3YA 5JSQA 1MFZA 3KZVA 4EBFA 3BN3A 1U65A 2AFHE 2VG8A 4IZHA 1II9A 3H04A 4GKKB 1ZUHA 1JECA 1UINA 1J49A 2DY0A 1HXHA 1PR1A 1SKUA 1I3OA 2DAPA 2G72A 2OC4A 2OV3A 2QE7A 3DDHA 4YUAA 4YPFA 4KTTE 4PZLA 2VJCA 1AD2A 1RWVA 5D6OA 1MXHA 1S2LA 3CX3A 3KT0A 1EVLA 3CW9A 4RELA 6AT1A 5I4KA 3H2ZA 3IAS1 1J99A 3I37X 1FQOA 4R51A 4Q3KA 2QK4A 3S81A 3K8ZA 2G40A 2BEKA 1M83A 4HDCA 5HJ5A 4BNNA 1QIFA 2P3QA 5IXYA 4GYYA 3SEAA 2ZCUA 5GV7A 1U99A 4C0WA 3DCIA 3F6RA 1G6KA 2C4NA 2GTHA 3L8YA 2RK6A 4OOEA 3ZUGA 2QTVB 3K5PA 1HY0A 3GBPA 1L1RA 1MJ5A 1LWOA 4N7MA 3B2NA 4AUNA 5A4DA 2O2YA 5A9SB 2ECKA 4Q1AA 1TKCA 3KTFA 3V8VA 4URYR 3ZN2A 3A1WA 3LCCA 1KKLA 3NRBA 4DANA 4QWWA 4QGSA 5FWXB 1SUBA 1TEXA 4P4UA 4TQGA 3UAYA 4AI6A 3R9WA 4OIFA 5FPKA 3U3DA 5IMSA 2QVLA 3RHTA 3W06A 2PAAA 3NKLA 3QXHA 4BX2A 1OFHA 3NM4A 1F4VA 3H1AA 1PK8A 3LUPA 3R6DA 4LMAA 5FOSA 5B58T 1FP4B 4RY0A 4EA7A 3L9XA 1HLGA 2VF4X 5HS4A 1K7YA 5TXGA 3DZGA 2XPCA 4E70A 4B84A 2GBCA 2XECA 2P9QA 1YB4A 3OLVA 4OHFA 1Q2UA 1Z8DA 3CF0A 3KUUA 1ZNZA 3BB1A 3M9LA 3TS1A 2V5VA 2QUKA 3VR2D 3W4JA 2V1UA 5HK9A 5D3MB 2CLDX 5AXCA 4MKHA 1KY3A 2J3KA 3FWHA 2ADOA 4OD0A 1H69A 2JJYA 4J0EA 1QG0A 3DW1X 4JI2B 3DE1X 1OBHA 1PI3A 1T3TA 3A3KA 3ETJA 5H4HA 1GL6A 4CG0A 3KC2A 4NE9A 4JUBA 3WGLA 3TQOA 2D2XA 2DTEA 1T91A 4LZWA 2IU0A 1VSTA 1PDVA 3PZBA 1FUIA 2J9FA 3W5HA 1IEWA 3L1KA 4YXWD 4F1WA 1LV7A 4JP1A 2ZZMA 1HSOA 2YN4A 3Q2OA 3A27A 4MPTA 3KYDB 2I3BA 2E9FA 3KFVA 1FNNA 1PK9A 1XZHA 1B43A 4XDGA 5DHTA 1KPHA 5EY5B 3EH2A 4UJ5A 3M6IA 1HNNA 4REQA 2IZ7A 3AL2A 3O03A 4HP8A 3RWBA 4B2IA 2QM8A 1I2DA 2Z09A 2FSFA 5EIEA 3KTDA 1K7XB 4O4IB 3K6RA 2ET6A 4LTNA 4OF4A 2PUVA 3LC1O 5FI5A 4QUAA 3RF7A 1G6OA 3GB9A 2XTZA 4LNUA 4OK3A 5BOSA 3DLHA 3STWA 4L6CA 1BQ3A 4Q1VA 3CWQA 3ZHQA 4UD6A 4KYTA 4CKWA 1ULTA 3KALA 1RWXA 1M0TA 2AFIE 1BKYA 3JY6A 1Z22A 1RPTA 3CCFA 4LZLA 2P9ZA 4FHGA 5JSKA 1IUPA 1G2QA 3HDYA 3U56A 1DSSG 2PGAA 2CYBA 1ZRHA 4KLRA 3EISA 1R18A 1TRKA 2H63A 3NUGA 3EVCA 4MTLA 4ZYWA 5AK6A 5HVNA 1TO6A 4WNAA 2XJ4A 4QUIA 5CX4A 4H7HA 3VO1A 3B5JA 4X8LA 4RTOA 3M1IA 2AXNA 4Q02A 5U4QA 4BV3A 1E6UA 1Y1SA 1ZIPA 2EKQA 2AKAB 3NQ41 4HB0A 4Y0AA 3V4LA 4BCCA 2BGKA 1PGOA 1QQ7A 2VJQA 4ZVSA 1F0PA 4IIJA 4MGEA 4F4FA 1TT7A 3Q7RA 1BXZA 3AR2A 2P5YA 3RYHA 3GLFE 5IN4A 4K9KA 3ZWNA 2X3YA 2IV7A 3E3AA 2XX3A 1QGUB 4BRSA 2G0TA 4KBFA 4QT0A 1SCIA 2EXXA 4N8DA 3UFXB 4H15A 4RLSA 4BCDA 2GEVA 3B9BA 3L7KA 4P80A 1N4AA 5BORA 1ZI6A 3JX9A 1EFKA 2J7PD 2RHWA 3EXHC 2VNAA 4J1TA 5FLXA 1NC1A 3ABQB 3AY7A 1LSOA 3BXFA 3GD5A 3I72A 4ACBA 4P5EA 6NULA 2OP0A 1VRWA 1XZJA 1GZ4A 2ZPAA 1ZVMA 2Z2IA 1S3IA 3GO4A 3O2JA 1D0IA 4R68A 5EKUA 4BQEA 5BMVB 4D9IA 1TJ3A 3JAKA 5AM3A 5FWDA 3G13A 5AW1A 2ZITA 1AKRA 1HFWA 3A10A 1IXKA 3DXXA 3LUHA 3R5FA 4GWKA 4JIGA 4PLWA 5ALFA 5IAKA 5BN3B 3I5MA 5L7WA 1LJUA 1LNZA 1YL7A 2EFGA 4Q4AB 3HU1A 4LPSA 1E96A 1JI0A 4FGLA 3TQQA 2O8DA 1MJNA 3Q9UA 3QKUA 2W00A 3ZD7A 1OXSC 1K75A 4R2WA 1W29A 1QSGA 2UZ0A 2X8JB 4LBZA 5G1PA 2GPBA 3UWMA 1XZQA 3KTAA 3QXGA 5B1SA 1G8JA 1USIA 2F43A 4QQKA 5H80A 5ALZA 3UW1A 4RKFA 3AZOA 3W2EA 4B82A 2YJ4A 2N75A 1ZEMA 3O73A 1RXUA 1WB4A 1E5TA 2FR8C 3O2SB 4FFBB 3E81A 4OQDA 2PT9A 4RHCA 3F98A 2HMTA 1DO8A 2CMGA 1I2CA 1V9SA 1WXGA 2YRFA 3OY2A 4N8EA 5JBNA 4NMMA 4Y2PA 4QKQA 1V8FA 1E3SA 2ODEA 1Z5OA 3HU5A 3OE5A 4MWCA 2BD0A 3NETA 1ORTA 1VXOA 3OX1A 4CMAA 5JFOA 2BHLA 2JAWA 1OH8A 1RXIA 1JKIA 1XN1A 4QNNA 5E2AA 1UAAA 1JYEA 4EF6A 1IG3A 4UQPA 1NI4B 2V7GA 2PWZA 3RVPA 4A2CA 3R6TA 1X0VA 2V5UA 3DULA 1MDBA 4MVJD 1T25A 2G6BA 3OZFA 3K0EA 4ZQBA 2ONJA 3I4FA 2JDIA 4LMPA 5KKNB 1WZIA 5T4EA 3DEZA 4UE2A 4W5TA 5ERXA 3NBKA 1PYDA 1I3CA 2NO1A 4PQEA 3L4BA 2AH5A 3GLHE 2ACVA 2WUWE 1N2SA 3P4YA 4NATA 2Q8PA 1AV7A 5B4TA 3I6ZA 1UP4A 4BY9E 2N47A 4KYUA 3WLPA 1SVSA 1TU3A 3L0OA 1V35A 2X2PA 4FS3A 3UH0A 1VBKA 2P77A 3WIVA 4BGUA 3DF7A 1GEEA 4EFNA 4YJKA 4EFDA 1OH6A 5JJKA 3OE4A 3HB1A 4FLFA 4RJKA 4WESB 5KC9A 1FW6A 4KWHA 3K9FC 5FBZA 1OIVA 1V6SA 1ETUA 1T5HX 1T24A 2NW6A 3EIOA 4XPZA 1DBRA 2JIPA 4JITA 3NFRA 4KCGA 1XCMA 5ERGB 4ER6A 4EUKA 3BB4A 1KYIA 3I2GA 3QFCA 3ZE1B 4Q00A 3NPAA 1UXJA 2VLIA 3D1JA 3CNHA 2FPKA 4E15A 5KQPA 1U0FA 3AW8A 1E61A 2XT9A 1WBJB 3LC2O 1AIPA 4TZKA 1DXOA 5K6AC 2I0FA 3SKXA 4M36A 2PWYA 1VRCA 5HKLA 5LWHA 2V7EA 3A4LA 1EVEA 3GUHA 1XAGA 4BVLA 3TTTA 4MDEA 2OB1A 3PWZA 1E9SA 2QXTA 3WNCA 3E8XA 3AMVA 1MIOA 3K9LA 3EAGA 4FIDA 4UBNA 4M1YA 3X3HA 2SICE 4RDXA 2E37A 2EKLA 2R79A 3CE9A 2AFHA 5LLDA 5BWBA 2GVZC 2QNBA 2OBMA 2H4WA 4KN8A 5KNBA 1CE8A 4FKZA 3CVWA 2J7KA 1XZBA 5FNZA 2ZUFA 4G36A 2ORVA 4UCQA 1ZNWA 1VKNA 1CERA 2HSEA 5KVAA 1EFRD 1TYEB 1T13A 5FPTA 421PA 2EG5A 3L5KA 2XMPA 4Z53A 4P83A 1L5FA 1UK6A 1ICIA 1ZNYA 2P6OA 4XD7D 3KPJA 3ZDXB 1O95A 1GLNA 2HV9A 3PYXA 3UGJA 2BGGA 3N7TA 2QJOA 4GP7A 4I9UA 4Z0NA 1RAEA 4PG6A 1DDIA 1SB9A 1R6AA 2ZRIA 4MI1A 2X8AA 2F9FA 2FSVC 3R6WA 4ZO4A 1S3SA 4UEKA 5GPBA 1S02A 3NCTA 3GYGA 3GJSA 3IUYA 3L0BA 4KDRA 4YJFB 5DGXA 5BSGA 3EN0A 1XTBA 1EFLA 2IQIA 2MHCA 4UCXA 3VPGA 2PSJA 3WL8A 1KI2A 1XJ0A 1DT3A 1P0QA 2XDWA 4HN9A 2R4QA 1GPDG 4RXTA 3TE6A 4GXQA 3MHTA 5LU9A 2QN6A 4RIGA 3HFJA 3QMPA 5DCLA 2VDWA 2EX1A 4DLSA 3MRXA 4CNQA 2WJ6A 1IVNA 3SZGA 1GV0A 3KE9A 3PX3A 2H1WA 3FJOA 2QTBA 5EERA 3AF4A 1FQWA 1PQWA 3B8EA 1UUFA 1FU8A 1EFPA 3P27A 3PQ6A 3K6KA 1XZPA 2R6R1 1N92A 1TDJA 2WIAA 3CLRC 2NZXA 4EHKA 1TUIA 4BDTA 3ZCUA 3OTGA 3HC7A 2NU6B 2OAQ1 3W7BA 1DOHA 1ZN8A 4MNTA 4MIEA 1GLVA 4EOGA 3V7NA 3Q0IA 4JJ7A 5M29A 1C8BA 1DEKA 5IAGA 3H6KA 3R4CA 4B8WA 4TS9A 5JALA 1EX9A 4HPWA 1ULAA 4YJHA 1DMRA 5ALSA 5ER6A 5GAJA 5KTKA 1RXYA 3HKDA 2YDXA 4TYPA 5E6SA 5HK8A 2ZCJA 4Z4QA 3GLIE 4MKFA 2CNLA 5IG2A 2ZYTX 3TW8A 3AUXA 3KQQA 4ESHA 5EMMA 3ZLVA 4K5QA 4RHYA 2Y1KA 2K2WA 1SFRA 3KX2A 4JU8A 4CUZA 4AJKA 3LW7A 2O54A 2AZMA 1QZUA 1AXGA 2ADMA 2ESRA 5D3KA 3QE4A 2V55B 3HSKA 1D2AA 2NACA 4X5OA 5EMKA 3UJ7A 2PUDA 1HT0A 3H16A 1M8FA 2R1VA 3DE7X 4O2BA 3R2JA 1LCIA 1L7RA 4N3AA 1DC8A 3MFQA 4DRZA 4K86A 5BSKA 1JHVA 1U8XX 1W59A 4B3XA 4HUTA 4LZNA 1FYWA 2GRAA 2GYYA 5BT9A 2XRMA 2F3PA 2X9NA 2X23A 5AHOA 4AULA 3CUWA 4ND6A 1ENPA 2O0KA 5C31A 2VDQB 3LWDA 4UCFA 2MINA 2QT0A 1L7OA 2VBCA 3KL4A 5L9AA 4UCWA 4O3MA 3KE8A 4NZMA 3RYFA 1XN4A 1PT8A 2EARA 3K9HA 5LMZA 2YV4A 1TA4A 2A94A 4FMPA 5C81A 1O96A 2V7TA 2VUSA 3L4SO 4EL5A 3LL4A 4UATA 1QH1A 2XKJE 1KSFX 4QXAA 1F17A 4R9UC 2O1XA 4WHMA 5AP9A 5G0VA 4RA9A 4YP1A 2VP0A 1FDRA 2Z0MA 3BSFA 3PD7A 4LW8A 4E5PA 3CF4G 4Q03A 1Z75A 3OOHA 4X93A 1CR6A 2RCNA 3DR3A 3D6UA 3E3LA 4JH0A 3X2FA 4AY4A 5JG7A 1HNXB 4QECA 4PY2A 1J39A 5I7AA 2IEIA 3GNSA 1CB7A 4XSGA 4E5SA 1EK0A 3UPUA 1AXRA 2JATA 3EQ9A 1CUVA 4PXSA 2XWJI 3PC2A 3N2IA 4DV0B 1T3GA 1IJKA 1JILA 4UTOA 1SKAA 1VE7A 2F1JA 1KEPA 2OO5A 5AKKA 1U8FO 1OGIA 3ZI4A 2HWUA 2O0JA 2OCLA 1Y9AA 4MQ4A 3PDWA 2OO5C 1YI1A 3AR6A 3SM9A 4W5HA 1WSAA 2GK7A 4JJEA 3P97A 2BRUC 1ORHA 4DV2B 2BI4A 2C9MA 3OCYA 3TD2A 3Q8KA 3D3KA 2WWIA 1ZGZA 2D06A 2XITA 2XZPA 1JG4A 1JHYA 2JGNA 3W4KA 4HWGA 1CRZA 2NO5A 5BNFA 4OB8A 1RVV1 5HZKA 2O3QA 5HDQA 3S7ZA 4DJJA 4CUJA 3RAFC 1MORA 1T9HA 1E79D 2DTDA 1G20A 4Y9TA 3IMGA 3OF3A 1TU4A 3N74A 5KTMA 2A57A 1XKTA 4LGMA 5ALIA 3FTEA 4QRHA 5BUZA 2YW2A 1JAIA 4FILA 5CPFA 4ZRNA 3EGDA 4F9TA 2WILA 3MTBA 1WB5A 3DC7A 2ZBUA 3A37A 3IMCA 4FYVA 1MW8X 1NG9A 5CNKA 3Q15C 3L05A 2G5GX 4CTJA 4JLUA 2XNSA 4ZOQI 3NIFB 4EVRA 3TLXA 1LK0A 1ZUIA 2ISSD 3T3DA 1HY1A 1EAYA 2HU8A 3QLEA 4R8MA 2F8TA 5G4KA 3AQIA 4W4TA 3ZYZA 1JEQA 1NY5A 2QJWA 2QKYA 3EEFA 3L84A 4OU4A 2M6SA 5JWHA 3T3EA 1V71A 1JEYA 4IM7A 3FPAA 1QP4A 4F96A 3CUEF 3I5YA 2ZIGA 2WQ7A 1JKJB 1Z26A 5JAIA 1ABEA 3ZU6A 2TS1A 4O25A 5JD3A 4QU5A 2J0QA 1UMKA 4TV8A 3QHPA 2PWAA 5F77A 2HJSA 3TAXA 1P31A 4KOEC 4LE1A 4FOSA 3NJRA 3LL7A 1AUOA 2R7AA 3KYCA 4DLUA 3B60A 3MT0A 4RFLA 3V4SA 2ID9A 2WHXA 2WWRA 2WHPB 4LZPA 5KWVA 2PA3A 5NLLA 5IJ9A 4IEEA 3O95A 3I9V1 4TRNA 2YX1A 5B6PA 2DU8A 5BURA 3GFPA 3BBLA 3NJ8A 2H1VA 4XQEA 1D8TA 4GNRA 1U63A 2YJNA 4Y2QA 1OB2A 2X2FA 3B13B 2H4ZA 2MWMA 4OBXA 1J20A 3OA0A 5ADUS 1Q21A 1B14A 3NAZA 4ZU6X 2XUOA 1WBBA 1NSTA 1RWKA 3BX1A 3ZJYA 2Q9AA 4RPCA 3DLAA 4K40A 4BLVA 3U5ZB 4LFBB 1GNRA 2CDBA 4QG3A 1KJ9A 2GN1A 1T4CB 2WI8A 1ZD5A 3MWLA 3ETDA 5JDIC 1E60A 2J30A 2P9HA 5G3ZA 4WDQA 4OO3A 3K1AA 1X8LA 3U7JA 4N82A 4WFIA 2BMVA 4IMRA 1XDZA 3BF8A 4Y30A 1RI2A 1LPNA 2CLOB 3NWJA 5AYVA 4B7ZA 2C82A 5HUQA 4LC1A 1O0BA 1Z34A 1U2TA 1RTKA 3MWEB 5CT6A 1TFRA 1LD3A 2LDXA 1P6XA 2BMDA 1OREA 3RREA 3AVXA 1E8MA 1SO8A 3FFWA 3O31A 3LKBA 4NWIA 5EIWA 4AQDA 4XFJA 2WRZA 4MA5A 5DSXA 1LI7A 5FX2A 4QJ3A 4M1WA 1KDRA 2YXLA 5JEDA 1AT1A 1D6SA 4FYIA 4RM2A 1ZQ9A 3DYIA 3V1YA 1QU3A 5EUCA 1BXGB 3HJBA 4RPJA 3SOZA 1GFSA 5BWCA 2CDCA 3A14A 3MJSA 3PDIB 2BFCB 4QUHA 3TSOA 1NVDA 4TUYA 1Z45A 4X20A 5KMGB 2AIRA 2QN9A 2Q5QA 4NFYA 4P5DA 3VBEA 1NLYA 1BU8A 5IANA 1M8GA 3HFGA 4IQ4A 1DAHA 2H4HA 1G8SA 1ZQ1A 1DKQA 4OFXA 3DS8A 3WB0A 2IYUA 4DWOA 2C7PA 2HYIC 2ZI5A 2HRDA 4MK4A 1G8HA 3OEWA 1TCCA 4LDPA 4IJUA 3LZ6A 2XRFA 1NQTA 4JJAA 4A5SA 2AN5A 4S05A 3AVUA 1IQRA 2OHHA 4DR4B 3B38A 4OXRA 1V5EA 5AW7A 2PNJA 2OQVA 3LRTA 4RPLA 3HNOA 5AVRA 4BV8A 2NV0A 4D3FA 1NJSA 2FR8A 3FGZA 1U0HC 2Q1XA 2Q1UA 4GI3A 1T5TA 4YONB 2HCJB 4TLEA 5T8KA 5TQ0A 5BXYA 1SKYE 1PT7A 3DB2A 2HA0A 4RX1A 3WV4A 3E6AA 4TKMA 4E3ZA 4F5DA 5I8PA 2NU6A 1RP7A 4PLPA 2AMVA 4EI9A 4L72A 3QV2A 3VDRA 2YHSA 3JRXA 3OUZA 2GK6A 4ETNA 3IVRA 3ZCSA 1FJXA 4F0JA 4O33A 2XZDA 4MS4A 4EJSA 1GUBA 1MEJA 1Z15A 3URMA 3K4PA 5AI8A 2YWCA 2FP4B 4BDSA 1QRSA 1FDTA 4WCFC 3VPDA 2QZSA 3LVFO 4H6XA 5C8YF 2N9UA 4IL5A 5DBIA 1LLDA 3E1GA 3COSA 1DWPA 1NYLA 3RU7A 1OTXA 1M2WA 3TRFA 3HHEA 1BYUA 2YINC 4LV6A 4OGGA 3WADA 3U60B 3ET5A 5LZ9A 3BMCB 3P0RA 3L2OB 1NI4A 1RWQA 4LYFA 1X8KA 2VHTA 5K45A 3PXUA 2HTFA 2VF2A 3ICWA 4JHLA 3VU0A 4BO4A 5ALXA 1PJSA 2QRMA 3F4KA 3GCXA 4IY1A 1HZJA 4RYDA 4H1UA 1X7XB 2C2GA 5HILA 2POCA 1UFOA 1PGNA 1DRUA 4F2DA 2B5OA 1ZUD1 4URFA 1BH2A 3OTWA 4UBJA 3B1WA 4L9SA 3U7GA 2P9FA 3L5OA 4Y9SA 3ADBA 1VKRA 3EA5A 2UAGA 1A27A 2GYWA 4PU0A 2WAXA 2GASA 3ZEIA 4M55A 4B3BA 4KPYA 5T6BA 2FSUA 4C5BA 1U7HA 2ZFUA 2R8OA 2J8ZA 1IK4A 2D5AA 3DKIA 2VTKA 1PQPA 2WJPA 1Z6TA 2HF2A 3AEUB 3HFRA 3HV2A 3PU6A 5FBQB 4A7PA 4CEJA 1CDOA 1EESA 4HWRA 3PQCA 1N4DA 4OLFA 1Y3CE 1QH1B 4GBED 4IQFA 4JK3A 3Q2KA 3ORFA 2LD4A 5TC4A 1NXQA 2XUQA 2RCYA 4YO8A 3KSAC 1DCMA 3GEPA 5H16A 4AJJA 1RC8A 3PR2B 2V45A 4MW4A 4XM2A 3B1XA 3ZHXA 3R3SA 2XWPA 3RLIA 2Q4BA 4NENB 1FRVA 1CF9A 4Q66C 5IAOA 3P4XA 4XWOA 5BWLA 5F2NA 4L4XA 4MINA 3GLVA 1H05A 4IS2A 4OLJA 1JIQA 2W71A 4TMXA 5HA5A 3ZHBA 5HZGA 1PFGA 1XALA 2FCRA 5EWLA 3LUJA 4PG4A 2X8LA 1UZMA 3ZZMA 2EIHA 3BVPA 4AMGA 4BVKA 5L4LA 2XUFA 4LHXA 4O29A 2HFJA 2OZLA 3NDJA 1EP2B 1VPVA 2FPGA 2FPIA 1YQGA 2PZMA 4PG8A 4MX8A 2OK7A 4NV0A 2F1HA 5E7JA 4P93A 3WX0A 1KH1A 4FW9A 4DM4A 3HA5A 1OLUA 1PL6A 2BRUA 2R751 3U3OA 4FD2A 2QORA 4MWTA 1CUAA 1N2EA 3D64A 2ZBEA 4IKEA 1U0BB 1H1DA 1L5RA 2B0JA 5CHYA 4BLUA 4S35A 4D4GA 2P30A 2FR0A 3TJRA 5AXBA 4Z9YA 5C35A 1NYRA 1Z2OX 3FTNA 2P41A 2JVIA 2OORA 4HX5A 3VPCA 1DT5A 1SQGA 1AG9A 3NTRA 1R0LA 4RD6A 5E9WA 2FFAA 3QPDA 3W9BA 1DEOA 3PICA 1OBVA 4F3RA 5F9HA 1K88A 4D26A 2R6CA 1QONA 4IDNA 2PANA 2R48A 2VP5A 5DDIP 4ZC8A 1E1CB 4WXYB 3T7CA 1DLIA 1UF9A 2I03A 5L95A 4RO0A 3TIXB 4AUMA 5KMGA 1P1HA 2VTVA 4QO8A 5E3HA 2ZE6A 2B7BA 3H5NA 2H1LA 5DHQA 2VDRB 4BMDA 2D54A 1MO4A 4Q1CA 2PMWB 3WTCA 2EFYA 2G1KA 2O3TA 4N0PA 2Y0CA 4E4RA 3CH5A 3KSUA 3AR8A 5TV2A 3CBQA 3SQDA 2YVAA 4NBLA 4UJ3A 4NOJA 1P9OA 1GZ7A 4KEAA 3TSAA 1R5NA 4E2WA 1MEOA 2DM6A 1QHHB 3OA2A 3SE7A 3TRHA 5LQJA 2F3RA 4CMJA 3QW4B 1DADA 4FGZA 3A6HA 4Y6LA 3NASA 4KIFA 3LV8A 4XDHA 5ALTA 4CGYA 4EGAA 1V7QA 1ZGAA 3E9RA 2OLEA 1NBAA 2C8LA 1YOVA 2ONKA 3I6QA 2GCIA 1LDMA 2ANBA 4BMPB 2ZSFA 2J07A 4FKMA 1C30B 3U48A 3HMKA 3ZNPA 2IP2A 1S2GA 2E4ZA 2WWGA 2VZLA 3AVPA 3KQVA 4MR8B 3ED5A 4R40A 3U0BA 3VHXB 2O8FB 1WHTB 1NA5A 3ILXA 3ZZNA 2EW2A 1P4JA 1R0YA 1V25A 1Z5VA 2D1SA 3T15A 1N77A 1AKVA 1UMDB 1OZGA 1Z5UA 1T1RA 4OJKA 4RH1A 4TLMB 3RIHA 3LHIA 5C46F 3FHOA 1WSBA 2C78A 2NM0A 3EG5A 3BMQB 2WD9A 5K3SA 1YRLA 2PYIA 2YFKA 1SULA 2W6JA 3G8YA 2E1PA 4APBA 3N0WA 2SNIE 4BV9A 1RPNA 2A5JA 4G09A 4QXMA 5IVKA 3GGGA 3EBOA 3K0AA 3GLFA 3UT5B 4IGEA 4IGAA 3DOJA 4RXUA 1FC0A 1IWBB 4P58A 4E5VA 3GGDA 3F49S 3S55A 1N5OX 1YGPA 1EE2A 2I87A 1MC5A 3BIOA 3GEEA 2OR3A 3OEHA 4YDSA 4EY3A 2XRZA 2ZZNA 1ZJ6A 4NYIR 2HXGA 5KPDA 4WK2B 1EAMA 4BJ1A 2AK3A 3IP9A 3Q8LA 3V8NA 1PO7A 4C4TA 2FG6C 3DG9A 4BBZA 4RFSA 3F46A 1FFAA 4CMHA 1Z7GA 1NPDA 1YMUA 3RVMA 4DR6B 9MHTA 1J3UA 1VYVA 3B5EA 4UMDA 4TTVA 4JCOA 1JDVA 1WLSA 5AJUA 3BFVA 5DIFA 7YASA 3CO5A 4BQOA 3UA3A 5D3QA 3T4XA 1TAUA 1U3TA 3L7LA 1IZ0A 4M54A 4BXOB 2WYOA 2I33A 1EX1A 3G1WA 4V02A 3TXAA 4DWJA 2QVZX 1GL9B 1KETA 3FBGA 1DJLA 3KU1A 3DCJA 4GC9A 3NMUF 2OT3B 3M4NA 4N40A 4OV6B 2P7HA 1IAQA 1WU8A 4UTNA 1NUUA 2QGZA 1RYBA 3A1DA 4CLHA 1UZNA 3FMPB 3OFSA 2FSSA 4IRMA 4L28A 1Y3IA 5AK3A 2AOXA 2VT2A 1GNTA 3DD1A 1FYXA 1CP2A 1V26A 2Y4NA 2JANA 2BC9A 2IEDA 4EG8A 1OW3B 4TSKA 3Q1LA 3IBCA 3O9VA 4XQ0A 1O6BA 2QPOA 2JK0A 2P0AA 3A11A 5FUXA 5LCXA 1RIFA 3FE2A 1QGOA 1DJNA 1NVKA 2GFQA 1ND5A 1QH0A 2VF7A 4WDRA 5DVZA 1PR9A 2ATEA 2GAFA 2WSLA 1IBSA 3U4CA 3ADKA 1NG1A 3RVQA 2HREA 4B87A 3TOZA 1AXEA 3VNVA 1YDFA 2WU1A 4QOFA 1N32B 3ZCPA 2I1VB 3E9NA 3TH5A 1G5FA 1NBMD 1Q3KA 1TE2A 1W46A 2ERYA 2QRKA 2O6HA 2RB5A 2YRWA 4PBRA 5DTEA 1BC5A 4K6HA 1YR7A 4X1KA 4Z4HA 2Q50A 1A82A 2FCAA 1QRRA 3FLEA 1XAIA 4UOQA 3SKVA 4J0DA 4QG7A 5BRNA 4UTPA 2YWJA 1JAXA 5JHGB 3ZV7A 2CXUA 4ZKDA 2EAUA 2D2IA 3VR5D 4ARVA 4DQXA 1T0UA 1CNFA 2HMYB 1ZESA 2IY7A 3ENWA 3GAMA 4H18A 1PJ8A 4V0SA 2ZDGA 4B35A 2IZ6A 1QNFA 3FKQA 3ZDCA 2K2QB 4WUVA 1XCPA 1O6GA 3INNA 4HFRA 4R1QA 3SDSA 4C0HA 3DE5X 2IZ5A 2R11A 3A58B 1JFLA 1KTVA 4HGYA 2HWXA 1LBIA 4C0JA 4OQXA 2AKYA 3NH6A 3GLRA 4C3VA 4LY3A 2C0PA 2NXCA 4Y1RB 1ZNQO 2L19A 2CY0A 1VL0A 4J7XA 5K3FA 4OY3A 2Y71A 1Q12A 4PC6A 3FD8A 4NICA 1HEYA 4XD2A 1P6UA 5G0SA 4E13A 2AWOA 2HEGA 3ZWKA 2Q6KA 3EGXA 4U5QA 3UWDA 2J09A 4I46A 5HIIA 1P4SA 2BMEA 2R87A 3NHZA 1N2CB 3VO8A 2XB4A 1ZK4A 5HRAA 5K4HA 3ANXA 1HDCA 1LU9A 4G86A 2YKGA 3CNNA 3M7IA 5JQGF 4HLNA 5CBPA 2GTIA 1VBMA 3DNFA 3OC6A 4ND3A 5CDGA 3MSCA 3VDXA 2K87A 2RHTA 4IVQA 4L22A 1EI9A 1KJIA 4RD4A 1Y7IA 3ZHZA 1DBIA 1JWBB 4GRIA 1V2GA 5G0TA 1N6IA 4QGHA 4TS1A 3G0BA 4NCJA 5CLJA 1E3JA 4P7KA 4N6NA 2G67A 5HQTA 3KOYA 4WINA 2JGDA 1OQAA 2CL6X 1JP7A 2H92A 1K97A 3E9YA 4GGOA 4LTMA 4BQQA 5CD9A 5LYJF 5F1PA 1SC1A 3K0AB 2YJ3A 4GM0A 5JAHA 3WGGA 1Q7TA 1RS0A 5GIPE 3E5MA 1CP3A 3MPUA 3GX1A 2J32A 4Y2UA 4F4JA 4Y7CA 4IF6A 5EJFA 4XM1A 5CEFA 3QWAA 1WOYA 4I6GA 4AK9A 3BIXA 5JS6A 1EX7A 4M1EA 4W8GA 2DLDA 5JI3E 2HLDD 3EF1A 1E1RD 1T9CA 4X1YA 2PBLA 3ZDDA 3RNLA 3U7QB 3N2KB 3G8AA 1QK3A 1ZH6A 3O4GA 4LXYA 2G9QA 3LA6A 5FV4A 5HWSA 3TJMA 3BEOA 3GG9A 4ZQCB 3PVSA 2OO7A 3JCZA 4BO1A 1ECJA 4QTXA 1WZUA 2XUIA 3H9CA 3A6JA 1EVIA 3LPMA 3O4HA 4HEHA 4OGWA 4TWZA 1MQSA 4UBKA 5CLIA 1BXKA 4BUZA 3N3BC 2EJTA 1OPRA 5ECYA 1QHGA 2CEKA 3DEKA 3LCRA 1ENZA 1MX1A 1W93A 3SR4A 4DIEA 5DYTA 2ZSAA 1P5JA 2YHUA 2HLHA 2UUAB 1W94A 4J0HA 4KGZA 1LSSA 2PT5A 5JQGB 1EXMA 1J00A 1M7GA 5IJ9B 2GESA 1FUPA 4PZZA 1B0UA 4LZOA 1C7ZA 1GGKA 3FKSD 1ZKMA 3ZWWA 1R4NB 1XVTA 4UASA 2Q45A 4GRAA 1B3RA 2FZGA 1C9KA 3NV7A 5H68A 3RYIA 2HWYA 2DF8A 3F7NA 1NRIA 5T3UA 1KC1A 3PENA 1IBLB 4DSTA 1QFZA 2B3TA 2BEWA 4GVLA 4Q9JA 2QF7A 3W8DA 1Q0TA 5LKAA 5DX8A 5DISB 2JGJA 4WRRA 4DG8A 4YUWA 1ZN7A 5BW6B 3JQPA 1CFZA 1XZNA 1TTPB 4O4IF 4C4YA 3AWIA 3L7JA 2PSHA 5CCEA 1TU0A 3FVRA 2PGXA 2ZU0C 3KWLA 2CHUA 1Y1QA 4NYJQ 5ALHA 1G5IA 1Q1GA 3SZOA 3FVQA 3WBBA 4WT7A 3IC5A 4LJYA 2Z6VA 5A71A 1EFTA 4JI3B 1ZUNA 3O91A 4X7MA 3JSAA 4TVOA 1NMYA 4KU4A 1R1DA 3FGNA 1W30A 3UJ9A 4C76A 3WWCA 2OQIA 2XBMA 1XAJA 1JEDA 2D3TA 2X6RA 3PUWA 2FG5A 4LOLA 4PYRA 5HF9A 1PU2A 4ARIA 3SMQA 2G5TA 4DLRA 2CLEB 3OE1A 1KF0A 1ODJA 1MB4A 2E5FA 5BQPA 4PIPA 5CJ2A 1DZ3A 2P9EA 4PSAA 4C04A 4DEVA 3FTQA 3LHDA 3TQFA 1RI4A 3GEBA 3DOUA 2QQ5A 2YWHA 1XWOA 3C16C 2QZ9A 2VK2A 3J7TA 4TVSA 4LX0A 5HNKA 4R1UA 2A7QA 1CUYA 1E6KA 3RUDA 4BZXA 1N1MA 2FZWA 4QEZA 3THXB 1QZ3A 1QNLA 2HGZA 4M1MA 4QOHA 4HZIA 2EL9A 4TKUB 4CQLB 3CV3A 3LQ1A 4JC4A 1BCSB 3OHSX 1SIOA 4K81B 5KYUB 1URPA 2QX7A 2VSXA 4F38A 2SCUA 1F48A 2Q8NA 1TZ2A 1K4YA 1EWYA 1JAYA 3CW8X 3WXMA 4E31A 3UF0A 2PQ6A 1SXHA 2BEJA 2Z58A 2JLVA 4QUKA 4WY5A 3FOCA 1U8YA 1VBNA 5IEJA 2X6QA 4L5IA 3KB1A 3EQZA 4RADA 4RK7A 4Y98A 3BICA 1NQOA 1N9ZA 1BAPA 1MQ8B 3OQVA 2YHBA 3HUDA 3GJ4A 4ZCMA 3VHXA 2KB0A 2HNAA 1Y8RB 3ZZ1A 4KQIA 5F4ZA 1YDEA 1Z6YA 3OPYB 4P3PA 2IBTA 1CS0A 3L46A 4F9FA 3RS4A 3AJ8A 4TYNA 4EI8A 1B23P 1NAIA 1KKUA 3QFSA 4LOIA 2P9CA 4ZAZA 2VWQA 4QJIA 3NOVA 3TZBA 4FEGA 2IGBA 5EWJB 2FFQA 4LYEA 5TT0A 2VSNA 3AVQA 3C4VA 4CE6A 4D9HA 3G0IA 3PUJA 4QUEA 4DT1B 1XVAA 2WR8A 5C32A 8OHMA 5BV2P 2GBLA 5JXGA 1NIPA 1NVAA 1L4LA 3C1AA 1EFCA 3CNQS 3UT5A 5BV0A 1QBGA 5KTOA 3ND5A 1AQJA 3SF0A 2Q27A 1BG6A 1Z25A 1CDZA 2GRJA 3R5TA 4DHEA 3HTXA 2BCJQ 3L0CA 1G42A 1P7VA 1DG9A 1T4DA 2R60A 3CGWA 1W4LA 3C6ZA 1NQ5A 3LP8A 5K0GA 5M7EA 4QZVA 1B1CA 4INOA 1JDNA 4JBIA 2OCBA 4RJLA 1D07A 3PEEA 4IYJA 1IQUA 2I4LA 2VYND 1KAOA 3BBPA 3PEUA 1UPXA 1D8AA 2B98A 2NG1A 2WQ6A 3JU3A 1LVHA 4CM6A 3Q11A 1OILA 1H94A 2HQBA 4QODA 4WFQA 3TOXA 4C4OA 4ECEA 3CUKA 4D3ZA 5K8TA 3KIPA 3M5PA 3E5HA 4JKYA 1STOA 2D1FA 2CMDA 3QF4B 4PBTA 1B6TA 2XDAA 4B3CA 5B7GA 1X39A 5I7VA 1PK7A 4MRMA 4QFMA 3HGTA 5IKOA 5LUAA 3Q8MA 1YK1A 2PIAA 4YHHB 1E3MA 1HLPA 1X1QA 4OHKA 1G64A 1QLWA 3CG4A 5KWEA 3F6PA 2X8WA 3HLYA 2IHBA 2O6LA 3BHNA 3QFFA 3PCRB 3F47A 4D82A 2E3JA 2EDCA 1GZSA 3C7DB 4F6RA 4CLXA 1GRQA 5IAEA 3UMJA 1GCGA 3ESQA 3DLIA 3AEKA 1XTKA 4HTFA 2HUPA 4P38A 1L1FA 3TNYA 2I6TA 2V0GA 1JLSA 1TYAE 4MV4A 4BVGA 3T1YB 1AGRA 3C3AA 2R7KA 1AO3A 2YUTA 3IAS6 5LPNA 1C3OB 2WA1A 1C8VB 5DBOA 4YJ3A 1O54A 1NUPA 4OQPA 1KI8A 1H4TA 4IEFB 4NU6A 4U00A 5AKLA 3WAGA 1U2QA 2EWWA 3F74A 1OF1A 1OWMA 1TJNA 3H5WA 3TN7A 3C1OA 4YDQA 1KZ6A 4MR7A 1WMSA 1MIOB 4ROTA 2WWVD 4YCJA 2F8SA 3B36A 1FA9A 1QG4A 2PS3A 2G1AA 2J87A 3NIWA 3QU4A 1UJNA 4MYHA 3ZUPA 4N49A 4NARA 4X8MA 4F8EA 5KQLA 3H9BA 3EPRA 3FPLA 2QTLA 3DXFA 3H8WA 3ZGVA 3GZNA 3RROA 1QB8A 5MN4A 1GR1A 1S8OA 4QPPA 1KAHA 3WISA 4EW6A 3BORA 3SLRA 1FF9A 4K87A 2FB9A 5JVDA 1E9RA 3Q2IA 3WGUA 2FRDA 1T2NA 3H1TA 2V4UA 4BP3A 1RR6A 2MYTA 3RUAA 3FUVA 1OV4A 4PAGA 2P0EA 1EVZA 3CIOA 4ES6A 2UU9B 2X15A 4JBLA 1S4MA 4ZZ0A 5C5DA 3STUA 1C3EA 4XFDA 2DFPA 3S40A 5EHZA 2DLCX 4BQNA 3HWSA 3U3RA 1JVNA 1LGYA 4HXFB 3ZI0A 1YAHA 5FWNA 1NNEA 2EJUA 1EBBA 1Y48E 4IIVA 3ER6A 4L2IB 1TGYA 2COEA 2GAOA 1OX6A 4K6KA 2GKOA 3M8KA 2NPFA 5EJ7A 2ZXUA 2GUWA 1FQKA 2WJZB 1BA2A 3UAOA 3PQ7A 2XH8A 1U2RA 2F67A 2MMCA 1XHEA 3ZGOA 2AFIA 4BNKA 1V5WA 2GZDA 2Q4EA 2AUNA 3KSZO 4L6AA 5IYZB 1ZZEA 1GLGA 2PA0A 2HJWA 1SKQA 4DWVA 2ZROA 2FX3A 3EWIA 4H6WA 1S2MA 2C04A 1IPFA 3OUUA 1A9YA 3PHBE 4EQZA 3RTGA 1GFWA 1MXFA 3GMIA 3PC8A 3HVUA 3WRYA 5F3WB 1SELA