1Z4PX

Structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with deoxyriboguanosine 5'-monophosphate
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate specificity of the human mitochondrial deoxyribonucleotidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords 5'(3')-deoxyribonucleotidase
total genus 64
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1z4pX02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4pX01
2Q5EA 2EAUA 5ALXA 4YCMA 1AQ6A 3A1CA 1XPJA 5A3SA 2DQSA 4JDPA 5AIBA 5AK5A 2WFAA 3EF0A 1K1EA 5ALUA 5AESA 2ZXEA 3ZW7A 3SF0A 3N5KA 1L7NA 1NF2A 4G63A 2NO5A 3M1YA 2ZOSA 1LTQA 2PR7A 1Z5UA 1VJRA 5AW4A 4DW8A 5AM4A 3ET4A 3U13A 3AR5A 5ALDA 1L6RA 1L7PA 3E8MA 2P11A 2FPRA 5AVTA 3KOOA 1L7OA 4NABA 3OCWA 4CF5A 2O2XA 1FEZA 3AR4A 4CF4A 2JAUA 4Y2YA 4ZEWA 1WR8A 4Y2RA 2I33A 4UU1A 1KYTA 5AVSA 4MUMA 4BYGA 3L0BA 2G1AA 2BDEA 5AKKA 5ALQA 3QU9A 2BDUA 3B9RA 3QGMA 2I34A 4C4RA 2R8EA 3L8HA 3ZX4A 4BEWA 3PGLA 3UM9A 4BX3A 2C88A 3N28A 4JB3A 1RLTA 1IWOA 4L57A 3CNHA 2JAWA 4EELA 5AK3A 5ALJA 3AR8A 3HYCA 2OBBA 3AR9A 2CFSA 4YIKA 3SKYA 2QYHA 2GO7A 5AK4A 3WGVA 3WGUA 3IRUA 5AKJA 2PQ0A 2AUTA 3ET5A 2OYCA 1PW5A 2ZG6A 5AKYA 4HGQA 3D6JA 4I9GA 5AM3A 2B30A 3IB6A 1U02A 5ALZA 2B1RA 2FI1A 2GHQA 4ZEXA 1YNSA 3A1EA 3WKBA 5IT0A 2I6XA 2FPSA 1Z88A 3ZVLA 3N1UA 1RKUA 2B1QA 5AW9A 3QU2A 3P96A 3L1UA 5ALIA 4HGRA 3M9LA 5AKZA 1Z4JA 4YCLA 1RKVA 4HYTA 4DFDA 5ALSA 4RETA 3WKEA 3QXGA 2OA0A 3QUCA 4DWOA 1TJ5A 2G09A 4NV0A 5AVVA 5AI6A 2HOQA 1U7OA 5AKIA 2YJ5A 3HLTA 4F71A 4C4TA 1XP5A 1Z4OA 5ALOA 3WKDA 4KNVA 1TJ4A 5ALEA 5ALYA 1XVIA 3S6JA 5ALTA 5AW0A 4OD0A 1CQZA 1Z4PX 3DNPA 3W5AA 3DAOA 4G9BA 2GHTA 5JJBA 1QQ5A 1TA0A 1F5SA 2Q4RA 4BX0A 2CN1A 4L6AA 2YY6A 4AP9A 4HGOA 3L0YA 3RFUA 2Q4TA 4UMEA 4OCZA 2C8LA 5ALWA 2WHEA 2HCFA 2G0AA 2IA5A 5AI4A 5FP0A 4E88A 3KC2A 4BNDB 2R8YA 1L8OA 1Z4NA 1RPZA 1Z4LA 2I55A 1ZS9A 5AM2A 5AM1A 3U7EB 1QH9A 4Y2XA 2G08A 5AVWA 4GIBA 1RMYA 4FYPA 4UAVA 3NUQA 4C4SA 2IOFK 3B8EA 2C4NA 2WM8A 3ONNA 2ZBGA 2ODAA 4UW9A 4XQ0A 3WK6A 5AKGA 1LVHA 3BWVA 4EX7A 1T9ZA 2HO4A 2RB5A 1U7PA 4H1WA 3ZTYA 4Y2JA 1O03A 2OM6A 3UMGA 5AW1A 3ED5A 5AKEA 1WPGA 4UU0A 1RQLA 3L7YA 3WK8A 3AR2A 1RQNA 5AW5A 3ESQA 2AGVA 2B8EA 2CFTA 3QUTA 2FEAA 2P69A 5AVUA 1Q92A 1O08A 2WF5A 3MN1A 3N8GA 1RDFA 2WF8A 3NAMA 3QYPA 3KZXA 2JAOA 1ZRNA 2HEGA 3L8GA 2FUCA 4I9FA 1N9KA 1ZD3A 2MSNA 1QQ6A 1Z5GA 3EF1A 5ALMA 4FFDA 3MPOA 2RARA 5AICA 3AR3A 3ZX5A 1U2TA 3I76A 4OFZA 5AVXA 1ZD2P 2CFRA 1RRCA 3L8FA 4PNHA 5AW3A 2FPUA 2W43A 1EK2A 4J03A 5ALKA 5ALHA 3QU5A 4QQFA 3FZQA 4CE6A 1RLMA 2HI0A 1SWWA 3L5KA 3PGVA 4L6CA 1ZOLA 2YMPA 3FM9A 2BY4A 5ALRA 3FGOA 3QUBA 4QJBA 2FUEA 4HAIA 4EZEA 3L0CA 1WVIA 1YJ5A 2G80A 4Y2QA 4KX5A 1N8NA 4MWOA 1JUDA 1RC8A 1WZCA 5AVZA 5AM5A 1ZJJA 1Z4MA 2HF7A 3L8EA 4UM7A 2P9JA 5AI9A 2D2VA 5AI5A 3QNMA 2G07A 2EARA 2WF6A 1S2OA 1ZD4A 2FPXA 4XOUA 1VJ5A 2NO4A 3I6BA 2YMMA 3MMZA 3W5BA 3SD7A 1NRWA 5ALVA 2HF2A 4EEKA 1L7MA 3WK5A 1J97A 4AS2A 3WKAA 1RKQA 5AM0A 5A3RA 2HX1A 3OPXA 3UMBA 3WK7A 5IT4A 2IYEA 4B6JA 3AR6A 4RESA 2MU1A 5AI0A 3ZUPA 4EX6A 4NFLA 3WK4A 3ZVMA 1X42A 3ZI4A 5IS2A 4CNQA 3F9RA 1Z4IA 1QYIA 4ZEVA 4YGYA 3WK9A 4BBJA 1EK1A 3QX7A 5AVQA 3NALA 3NRJA 2P27A 3KDPA 4O8CA 4BKMA 2JARA 1RMQA 4DCCA 3KBBA 1YDFA 3MC1A 3PDWA 4Y3UA 4AS3A 4HGNA 1L8LA 4BNDA 4IFTA 2YMLA 2C9MA 2YN4A 2YFYA 5AKHA 3L1VA 3R4CA 3ZWDA 3W5DA 4GXTA 3SLRA 4YIHA 3FVVA 3J7TA 3N07A 2R8ZA 2WF7A 5ALNA 5ALFA 3A1DA 4NWIA 1TJ3A 1VFPA 4XE5A 5AVYA 1J8DA 1ZRMA 3E81A 2B0CA 3TLMA 4UM5A 1U2SA 2IOHA 4YCNA 4BEVA 3QU7A 3SHQA 2R8XA 3ESRA 3FPBA 3PCTA 1CR6A 4Y2PA 2HDOA 2I54A 1Y8AA 2ZBDA 5AI8A 3EPRA 3EWIA 4FE3A 5T41A 1S8OA 2X4DA 2WF9A 1QQ7A 2B82A 3NANA 2NYVA 2FPWA 1NNLA 2RAVA 4UARA 2HSZA 4Y2SA 3NASA 3SMVA 1YMQA 4KYTA 3I28A 2W4MA 3R09A 3U19A 2YBDA 5ALGA 3A3YA 5A3QA 2YJ3A 4KX3A 4YH1A 3ZVNA 1Z4QA 2AH5A 2W11A 3ZTWA 5AKXA 1Q91A 2FDRA 4J2TA 3ZU6A 1RLOA 2YJ6A 1Z4KA 3WKCA 3U7GA 3IJ5A 1T5TA 4UMDA 3GYGA 1TE2A 5AVRA 3CZ4A 2JGAA 3U7FB 4HGPA 4OHFA 5ALPA 2I7DA 3OCXA 5AW7A 5AW6A 3OTQA 4IG4A 3ZWKA 4EENA 3RF6A 4F72A 2B8JA 3QU4A 4UATA 1SWVA 3FPSA 4KNWA 3DDHA 4CF3A 5AKLA 2G06A 3QLEA 2RBKA 4UMVA 3KD3A 3OCYA 4Y2UA 3QUQA 3UMCA 4Y2VA 1T5SA 2GFHA 5E0OA 3W5CA 4NAVA 2HHLA 1MH9A 3K1ZA 2YJ4A 2ZBEA 3E84A 3BA6A 3VAYA 2C8KA 1YS9A 2IOFA 1RMTA 3AR7A 3DV9A 4BX2A 4UMFA 3U26A 2O9JA 2YMQA 5AHXA 1ZD5A 3SKXA 5ALLA 3NIWA 5AIAA 2QLTA 4Y2TA 2GMWA 1SU4A 2PKEA 5AK6A 2AMYA 3I1YA 3OCZA 5AW2A 3U7HB 3R9KA 3B9BA 4XPZA 3OCUA 1YV9A 4UAUA 4UASA 2ZBFA 2EATA 3E58A 4KN8A 5AW8A 3OCVA 2VKQA
chains in the Genus database with same CATH superfamily
4I5FA 2SCUB 4UPDA 1DTSA 1EA5A 1PS8A 2DX7A 2PZEA 1SKAA 3QWFA 1XT6A 2D2IA 1SCIA 1F17A 2IDJA 5KNDA 2GDZA 1YR2A 2I5PO 2R2AA 3D31A 1SG0A 1YJAA 2WFAA 5FUVA 3X1DA 4AQDA 1PEKE 2CE7A 3PIIA 3TOXA 3L92A 3VR3A 5JMPA 4NYIR 1QCCA 3CVYA 4YMGA 4LBZA 1V8PA 3GVXA 1ENZA 1X19A 1XEAA 2NO5A 2ACVA 4IXWA 5CP8A 3VO1A 1OB2A 1OXSC 3T7AA 3KZ1E 4ZA2A 3I58A 1IUPA 2G83A 4EVRA 3CH4B 1SHJA 2OCGA 2F4VB 1VJRA 4NATA 2XLBA 1J6UA 1Q22A 4GWKA 3R74A 3W9BA 1SBQA 4CM8B 2HWWA 1BEEA 1B26A 4TV9F 4XDZA 4DEXA 5TQJA 3W7AA 1L5RA 2D5AA 5E1MA 4CMJA 4OK3A 3U48A 1TIBA 4UZEA 3RIXA 4H9GA 4HF7A 5E2AA 1FVHA 2ZJ7A 1VCMA 3NGXA 3QLUC 3IE1A 2D1QA 2XTAA 4BTEA 3LQRA 5M29A 1LA2A 1OU0A 1PZGA 2CBXA 5LZ4A 4WHMA 1PQUA 3V4VB 4RPCA 3AEUB 3D5EA 5TEVA 3FRIA 4WJZA 2XT6A 3OEHA 2P1ZA 3IV6A 3ZY6A 4Q01A 2XMDA 1TU3A 2CZQA 2VO1A 3OIGA 4ZQIA 4BRWA 1QU3A 4I4TA 4DS3A 4PHFA 4AJLA 4MUMA 2WP8J 4RKQA 1BCSB 1EFRD 5FBQB 4EHHA 4D4LA 4EJ0A 3NT4A 4U8GA 2PO7A 5T4HA 1AJEA 3D7NA 3C85A 1AO0A 2IEIA 4RANA 5L3QB 3JYLA 1T9BA 1XZLA 3HHEA 1SQFA 4C4RA 1UWLA 2COEA 5BVGB 1V43A 4KGDA 4Y0NA 4ALNA 5K0EA 3GNQA 3FCOA 4FDAA 4H6XA 1H65A 5C32A 4AKGA 3AJ8A 2ZU6A 1FP4A 2F43B 5FA5A 2PL5A 3HDHA 5KX5B 1AS0A 1FLVA 3S4YA 5CNMA 5ADVA 3R7WB 3CVWA 4DR1B 1S1MA 3HJTA 3QUAA 3RRPA 2AX4A 4F8YA 2GPYA 1DSSG 1R16A 2P0EA 1SU7A 3K5HA 1BWSA 1Z38A 2XGGA 3KEOA 3R3UA 1TO2E 4U6QA 2E89A 2NYUA 4RY2A 1VPTA 4FBLA 3CCBA 4YCBA 3A4TA 1CUDA 2OYCA 3R7FA 1PW5A 4MVYA 1EVJA 4A5OA 3MTBA 3PJFA 4LOKA 3EPHA 1TZBA 4I9GA 2YRWA 3MJEA 5KQGA 3NEPX 4X3OA 2AOXA 4XX0A 3F46A 2FW8A 4YUAA 1Z34A 4B35A 4DA9A 1PSWA 1C0KA 1IN7A 1EZ1A 3DFUA 5HMMA 4B09A 3RC9A 1BMTA 3O75A 4OAOA 3RIEA 2WTUA 4TQGA 3EASA 1LY1A 1E1DA 2FN3A 1NW3A 1WP9A 2HM7A 3UIEA 2A9KA 3PJRA 3Q9NA 4RJLA 1EFPA 5CYFA 4ZI3A 5SY4A 5A4DA 2XKJE 4AF6A 3SM3A 3FCEA 3HHPA 2PGJA 1B8OA 4UEKA 1E7RA 3P9NA 5H9WA 5A6SA 1E69A 1SM4A 3BK7A 5EIHA 4I6JA 4YCLA 2PUFA 1O5OA 2F3PA 1QMPA 2WSLA 3AL3A 4FB5A 4ZO9A 3JRWA 4P34A 3WNDA 1FK8A 4X91A 3VTFA 4MKXA 5FWNA 2IYVA 3GWZA 4NFHA 3ZD9A 1N2OA 2WD7A 3MGBA 1Q77A 3IB3A 3F90A 1TJ5A 2G09A 2BCGY 3CZPA 2OORC 3JPYA 1K5DA 2X7JA 2Z2XA 4NV0A 5IC6A 3KYDB 3RKUA 3MGGA 3RUAA 3ZJUA 3S1AA 5F76A 4XDGA 1ID1A 2X6QA 4PGMA 3UHFA 2IH5A 1JQDA 1NF3A 1FFXB 2Z9BA 3KXPA 4U4AA 1AV6A 1AKYA 5BUQA 1RADA 5EJ5A 1CLUA 3EUAA 2Q0HA 3GLUA 3LA8A 2FSPA 1I2AA 4NY1A 3QPDA 2V6BA 5ALTA 5AW0A 3CX3A 4MA0A 5KCMA 5T5QA 2YDYA 2X8JA 4IDGA 3DAOA 3GT3A 1WULS 1UPTA 2FRDA 3OG9A 3LY8A 1TA0A 3GFSA 3GJYA 3SIPA 2I3GA 2CHFA 3SPXA 2WHXA 4YAOA 3IT2A 4JQSA 1K7SN 2YY6A 3VUEA 1JHPA 4GR4A 1C9MA 3TIVA 1RWPA 2C8JA 3VPSA 3WXBA 2IU0A 2Q7DA 3LUFA 2JFGA 3IOMA 3ZE2B 1PX2A 4HXYA 3VR4H 2UYQA 5CEFA 3BRSA 3FKJA 2A4MA 4K6FA 5YASA 3LCJA 1TJNA 1ZN8A 1Z45A 2NZWA 3FAKA 3P9KA 3VX4A 4QSHA 2FPIA 3MD0A 2GN6A 4JWTA 1XO1A 4WGFA 2R1VA 1Z4NA 4H6WA 1MOSA 5GGYA 1SUSA 1A50B 3DXYA 1XZGA 3VDRA 4QJ4A 3ZE8A 4Q82A 3D0QA 4HK4A 1PKEA 3LP5A 2G08A 1E1LA 3WGOA 1QX4A 5AOVA 5IG2A 2WVHA 3AJRA 4D5GA 2AXQA 3C7KA 4G85A 5JVDF 2OLEA 2PL9A 5JFTA 1MG0A 2YY7A 4BKQA 5BUZA 4F60A 5DSTA 3GRPA 2JI7A 4FYYA 4EVQA 2EIXA 2JJMA 3OLQA 1QQTA 5AVJA 1Q1QA 2ZT8A 1DVRA 2R751 1PQWA 4MRAA 4YHBA 4RMJA 1GNRA 4QRDA 2F9MA 1OV4A 2JFOA 2YVKA 3M0EA 5EN4A 3REQB 1X14A 4P7KA 3FMGA 3UMGA 3N0VA 5TX7A 4TKUB 1TX4B 1Y1RA 2NU6A 2PS9A 4MW0A 1TMKA 1CR1A 5IJ9A 1RQNA 1IRXA 2WAAA 5LQUA 1E79D 1GSIA 5JWOA 3EDYA 3S2SA 4DDVA 4LXTA 4PLYA 1ZP6A 1ODCA 1ETUA 2O6LA 4M7RA 1SGWA 1UAAA 4FWBA 3KQNA 1X1TA 3MN1A 3PB3A 3OHSX 1AO3A 4K81B 1VHTA 5BV2P 3PE3A 4JLDA 5J3JA 3LWZA 1HQYE 3KXIA 3ZDYB 3FOBA 2X1HA 3E0QA 2BM1A 2I2BA 1W25A 5DBIA 3L8GA 2RH8A 5JATA 2QSYA 1PHPA 3I9NA 2MSNA 1JA9A 5LA6F 2KPOA 421PA 5FQNA 4EO7A 4YRMA 2KBFA 1AC5A 1OFTA 1RYHA 2WJWA 4KXNA 4MVJH 1D7OA 1TMOA 2WOOA 3WISA 1RRCA 4YWJA 1WQ4A 1Y1TA 2C94A 3MJFA 3G0BA 4DR5B 4EPVA 3ELWA 1V11A 5HS4A 2HCJB 3MUEA 2Z9DA 3CWQA 4KLRA 3DHWC 1Y6RA 3X1MA 4C6TA 3GR6A 3H2IA 4UQLA 4KODA 4BMDA 4L4YA 5THKA 2WU3A 4OHUA 3LFTA 5FI0B 4LQDA 4YCJA 4B6SA 1EDOA 3CY6A 3PA8A 3V8VA 2ZB3A 1X7YA 3OC6A 1Y3IA 1FYFA 2C5SA 3EQ9A 1US8A 2AF3C 3TSAA 2FW9A 2FWPA 3DAPA 2O3RA 3RHSA 3A3PA 2Y05A 2V7VA 4L4RA 1SD1A 1Z15A 4B79A 1B14A 1XDGA 4ITVA 1D4AA 3ADPA 1XIVA 4I5DA 4K9RA 4CUKA 3LGXA 2CVPA 3GLRA 1BMFA 2BBSA 1W0JD 3AHCA 3EZFA 4PLVA 4FGJA 4ZU1X 1KFEB 4YXWA 3EIXA 3W06A 3T1QA 4DCPA 2PAAA 3EQ7A 1XTVA 3FIJA 4H6VA 4QQKA 3WLLA 1O0CA 3NP9A 4D43A 1P1HA 4MWEA 3CPSA 4QWWA 1A9OA 1HNXB 2J0QA 1YGPA 1OPXA 2FZEA 4EI8A 1F6WA 1AKUA 3MCUA 4AO8A 1HYBA 4B8YA 3ND8A 4NYIQ 1FSGA 1X1DA 4L9WA 1T2VA 4G5HA 1BYUA 1NT2A 2J30A 5KTKA 1NR1A 5M3BA 4Q7EA 4HRAA 4C29A 2V0GA 3THWA 2QAJA 4QJIA 2QRGA 3DF9A 1QYDA 4WBSA 2IP4A 2FG5A 2G17A 4M55A 3JZDA 2HMTA 2PVPA 1OIVA 4IIJB 1K5PA 2EKQA 2J9RA 2H00A 1T2AA 1EIWA 3OIFA 1YQQA 3HEAA 4HLUC 1IB6A 1YZLA 2NZVG 3ASZA 4NDNE 4GMKA 2EFDB 1YZYA 2XDQB 4G0MA 1XZJA 2P6RA 1NURA 2FQQA 4XGNA 1WKBA 3PICA 5I7VA 5JZMA 1D4FA 4DLTA 2V65A 3L9XA 3PYLA 4NFLA 1HC7A 2BM9A 3D6HA 4YT4A 2EFJA 3E03A 4N3GA 1F8UA 5JROA 3WA7A 2VSNA 5CCBA 3HFGA 4Z5XA 1U63A 1N77A 1WXWA 1G7SA 2C5FA 4YAGA 2PIAA 3H1FA 4O25A 1E18A 3A14A 3NM5A 3U17A 5DXJA 4XD7A 3VKWA 3OKPA 4E5UA 3WMGA 3D3KA 3UAXA 1YO6A 4QDOA 4BU1A 3CRNA 2C2BA 4FOLA 2GLTA 1NIJA 1NASA 4GPZA 1DJQA 1R4NA 4G4SO 1U9YA 1VL5A 1FDRA 3DQZA 2QVYX 4BRSA 3ESCA 3RFXA 4DOMA 2TSYB 3EVZA 1M9NA 3ADBA 1R12A 2HQBA 1E1QA 4DCCA 3VO9A 3VQTA 4EL0A 1L8LA 4GRIA 4ARIA 2J0VA 2BL4A 4GI2A 2ZB8A 2WTMA 3RVBA 2VPTA 5JAOA 1HT0A 2HLPA 3K9CA 2JHFA 3KZMA 3RAJA 3PHGA 1CJCA 1QCDA 3WGIA 4A1OA 3PJDA 5EVCA 1FVOA 1G16A 4WESA 4YIHA 2DHRA 4XM0A 3TKLA 3WGJA 5KJFA 3VSBA 1P81A 1L7EA 3GT7A 1JBQA 1UKAA 5M34A 2J0UB 5IRCD 4KQIA 2ZB2A 5C5IA 2D0IA 4FT2A 5FPHA 1EKXA 3WQBA 4BFZA 1DDIA 4XW2A 5FV7A 4AWXA 1QWSA 2Q9UA 3DAHA 2B0CA 5SY9A 4F96A 3LOQA 2FWJA 4RVOA 2QD2A 5EE0A 2Z57A 3FHLA 5J5CA 4P7JA 1YRBA 2QZ9A 4EFMA 2IF0A 1JEQA 2PANA 4GNKA 2IEAA 3EOBI 2HU2A 1M2OA 4XH9B 1A69A 3K4PA 5A3VA 4Q1BA 4CT0A 4ASUD 3D8UA 5CJJA 1Y8AA 4JLJA 3AP1A 1GOTA 1QNFA 1ZONA 3TPZA 1UM8A 2GILA 1D4OA 3FWNA 4JODA 3OZBA 4GLFA 5E1OA 3NANA 3OZFA 1V9SA 5E6RB 1Y3DE 2PBLA 3HZHA 4R1OA 1KOGA 1UXGA 2ZTVA 1RXVA 3JVUA 4LX0A 1V37A 3NXSA 3R09A 1UDRA 4C7JA 2F00A 1XPRA 1DEHA 1ORVA 3AUJB 1YZKA 3GGPA 1I9GA 5FTJA 3TPCA 3JVIA 4MR8B 3RAEC 3UPTA 1CWUA 2L82A 2QJFA 1EWVA 1HE3A 3JQ8A 3QVWA 4L78A 3WNBA 4FEEA 5HIAA 3RTEA 2J3MA 2Y68A 1P1CA 1P72A 2D1RA 4FJ0A 3FNFA 1E63A 2AOUB 3GLGB 4JOBA 2V9CA 1A4IA 1KPGA 1Z4KA 4QHSA 3RG8A 4DY6A 3ZI7A 3ZHQA 4QPZA 1GNSA 1YAJA 3JS5A 4YVFA 2FQWA 1QIHA 5H68A 2PX3A 1M67A 4Q3NA 1TC2A 3G8DA 1XRPA 2AK2A 1QIEA 3B2EA 3IP1A 3OLZA 1YL7A 3JQFA 1CQJB 3DV0A 3M6UA 1I2DA 3CC8A 3E53A 4HQLA 5CNJA 1IH8A 5EWJA 4BVJA 5AW7A 2BKLA 4D9KA 1JE1A 8OHMA 3QVSA 3OP4A 1QO0A 3TPFA 3WIOA 4MI1A 3HO8A 1CZOA 1DC7A 3FMFA 3LBFA 4AZ3A 2YWRA 4OF4A 1LSJA 3CPJB 2WYHA 1XMVA 4IGKA 2SCUA 5D51S 1EE2A 3EZLA 1AIPA 2HHAA 3FJOA 2YVAA 2G72A 2IPMA 4JDUA 3SEFA 4EJMA 5C9ZA 2QL9A 4XFDA 4RV5A 4QYTA 3BQNB 3PRYA 3ABIA 2I7TA 2GM3A 4DQUA 2AEJA 4DV1B 1R0YA 4G9GA 4O59O 2HHLA 4TMTA 2R86A 1UDWA 2J09A 1PWZA 1DAFA 1KAHA 4MUEA 5UKDA 4RHUA 2J41A 5KYXB 5HF9A 1VXRA 1KYWA 4ZT2A 2EF1A 2UYCA 4B3RB 4R3UC 1J00A 1Y33E 3KZOA 4B1FA 2WM2A 2MSDB 5JT1A 2VNIA 1KK1A 1NQWA 1MAVA 1RVDA 1I3KA 2E5WA 3M2TA 1L6IA 1ZUD1 2V54A 4INOA 4UTOA 2JHCA 3SKXA 4HAYA 5BSFA 5AIAA 5HRCA 3R9WA 2ZRNA 4YRGA 5IM4A 3K0AA 4XB6B 4DV7B 1XU4A 5H3HA 3L07A 3LFUA 2CNNA 4KIJA 3PRKE 1K66A 1JYSA 1EWRA 1Y82A 3EEBA 3Q5DA 3QXHA 3UENA 3RYCB 2BZSA 4HAXA 1L1QA 2J7KA 1MENA 1JG6A 3CKYA 2NO9A 3F5FA 2ZIVB 3M3DA 1QP4A 5I9LA 4ONEA 5ER6A 1VZ3A 4V03A 1R0CA 2GD2A 1SAYA 4WLVA 3PKJA 1X1RA 1DJLA 5L6MB 3IMGA 3K9QO 3FNIA 1GCOA 3LDHA 5FEUA 1L9XA 5D86A 1VKJA 2AJLI 4ZV9A 5G1PA 2EC5A 3CGGA 4Z3DA 3V48A 5ITZA 3ECSA 2Q5EA 2Q9CA 4GF5A 1YXMA 1G6KA 4ZT4A 2Q7OE 3U40A 3VPCA 4CBVA 1R0KA 1PV4A 4JI7B 3ZZ1A 3D5TA 3IAHA 1ONOA 4UULA 3VSEA 2P77A 3AI2A 3M3HA 1K7FB 3NVAA 1LK7A 3ND5A 4KPFC 4WJLA 2HPHA 1D6JA 2XH8A 3HYNA 4HB4A 2NWQA 4D4MA 1O58A 4MSUA 1OXKB 5HQJA 2EFGA 5EC8A 1KZHA 3CONA 4PR0A 1H42A 3BJEA 2IU4A 1K1EA 4M0FA 3PC8A 4BO1A 5IBCA 4EUNA 4A5SA 2DSTA 2WYUA 3JWJA 3Q3GE 4H7KA 1GGKA 3KOUA 3BRWA 4I1SA 5D1HA 4YI3A 1XPUA 1ELOA 5F5LA 4R8RA 5KIAA 3EGVA 3LX6A 2OCXA 2VSFA 3BS4A 3LBYA 5CURA 5FAKA 5KPJA 3TRDA 3GHHA 1AD2A 2CVFA 3C8HA 1JSWA 4ZQBA 4JYBA 1DAGA 4C0WA 4F3KA 2ZWAA 3K9GA 3M4XA 4YROA 4ZYZA 1LH0A 4IKEA 1GO2A 1R8JA 2VF7A 1UT8A 4B3HA 3Q6IA 3TTYA 3GFRA 1JJAA 4F6CA 4Q7QA 1X7WB 4KE6A 3LC1O 5EXPA 2C5HA 4DREA 4GOOD 4K2HA 3IPYA 3WYEA 5TDHA 2FF7A 1R0XA 3P9CA 4LJKA 4A6DA 4WNAA 4AXBA 1JDPA 2GAIA 1E1MA 1WXGA 3UMRA 1XK6A 2NNWB 3KCQA 4FUTA 2BGKA 3LF2A 3OQIB 4TLAA 2PVSA 3PWKA 3TQFA 4HDSB 4I5GA 4BVLA 4C7BA 5EIEA 5IVPA 1T2EA 3Q88A 1PW7A 5EOVA 2FUG6 4NNJA 4BRZA 3HUEA 4BZQA 3FPEA 1IHYA 2H07A 1HT3A 1MZVA 3NWPA 3A0UA 2BDEA 3B7PA 5E7QA 4ZWNA 5AKKA 4V0ME 1DJOA 4AXXA 3OFKA 1W85B 2R1UA 4IJMA 1U2QA 5DGDA 5CB4F 4Z4FA 3IUYA 4KG7A 3RS4A 3SKVA 1M1YA 4NF2A 4GBJA 1QGED 3AMVA 3QX3A 1RZRA 1IVNA 4NIMA 4AP5A 3L8YA 5B7NA 5BNWA 3S40A 3QELA 4LVCA 5ALJA 2AD5A 4NEGA 3FDZA 1WXEA 3GMTA 4YIKA 3KSZO 3O2SB 1X1AA 4YFVA 4GRDA 2PUAA 2QB5A 2X9VA 4H15A 1NUHA 2HA4A 2PS1A 4DC1A 1OE0A 4HNAB 2YHAA 4N7MA 3LSYA 1RWWA 4GQBA 1N0VC 3ZQUA 3A0RB 1VYVA 1UP7A 5KYUA 3ORRA 3OLVA 2ATEA 4ECEA 5ADHA 2XCSB 2YW2A 4FOTA 3UCFA 3ET5A 3HVRA 3CUWA 2H2DA 2EJTA 4J0DA 1DBSA 2WIKA 4JN6B 5K1ZA 5HKLA 3U7GA 1U2GA 3D6JA 4OKIA 3OPYA 1Y7PA 1TK3A 1L0BA 2GF9A 1CUCA 1PYOA 3NT2A 3WRWA 1SUIA 4DVGA 2B4KA 4ZEXA 1NULA 3U4QA 1V4VA 3A1EA 5IT0A 2W2TA 3AFIA 1A97A 1T2DA 4JR1A 4P4LA 5DNEA 3EZ2A 4ICIA 1FF9A 1VCIA 3STUA 4EA6A 2B1QA 4JCOA 5AW9A 4BGDA 2NAFA 3PTAA 4O4LB 4WKBA 4BNZA 1GAWA 1ZFNA 3CSDA 3L4SO 3KHUA 3GCGA 2AFHA 4DWWA 4XM2A 1VC2A 3NHLA 1KNQA 1TEXA 2DPMA 3B9PA 3GROA 1H6AA 4XI9A 4CMBA 3A1NA 4XJXA 2DKOA 4QDTA 5ECYA 2ECQA 1QHGA 4DG5A 4XRRA 3FUTA 4WXYB 1Z4JA 1OLUA 1U3WA 3W8EA 2P6MA 1Y9JA 4Z7NB 1PR6A 2EGUA 4P3NA 1G5RA 2NUPA 1E1RA 3B36A 3GA0A 3AHGA 3QUCA 2X15A 4DWOA 1NTRA 2XDYA 1EP1B 2X0NA 1XA4A 3EN0A 3FI0A 5AJHA 4CFSA 3RUHA 5JCJA 4DZZA 3ZY4A 4KXXA 4B4KA 2QORA 4ZPXA 1D8AA 4AM8A 1RJEA 2BJWA 4R1NA 1S3SA 1VBFA 3F47A 3IAUA 3KT0A 1XV5A 1T6BY 1XKQA 3CNEA 5I4BA 2YCLA 1R00A 1ZN9A 5KSZA 5A0TA 1H5UA 3T3MB 3DMYA 3PD7A 2V7QD 4A03A 1QIIA 4E2XA 1OXUA 3EJ6A 4CMHA 3B78A 1LBTA 2I4RA 2JIBA 2JLCA 3B6KA 5K2MA 2H2WA 3U3MA 2C7PA 4OOEA 5FR2A 4KPYA 4K9MA 2O48X 4HGOA 4WXEA 1I7NA 3GJ4A 3RFUA 1IMJA 4M1OA 4KGVA 4HL6A 3V9PA 4RDCA 4RCVA 4JP8A 1A1VA 2HBRA 4CCYA 1WXQA 2XOKD 3FPKA 4FMCB 3UG7A 4LUCA 4RA6A 3BXGA 2DKFA 4IIJA 2X42A 1P0QA 5I8WA 1EAYA 2R68A 2PLRA 3E3MA 3FOCA 3KNZA 2ATIA 3EXEB 4G0WA 2GDJA 4V2IA 5IF9A 2C29D 3DD1A 3KC2A 4DLLA 3I6IA 3WGKA 3ZZNA 3KHTA 4KUHA 1JFSA 1HZZC 2ROQA 4YECA 4BYMA 4A16A 3AF0A 3CUYA 4GYJA 1XNRB 3Q4GA 1E9VA 5C8YA 4AZSA 3RC3A 5AM1A 4ZK2A 1C80A 2OWEA 1WLYA 1XVUA 1BCSA 3PXAA 4ESHA 1IEQA 1VG1A 2IFTA 3KIPA 1OFIA 1HYQA 3NMUF 4OQMA 3ZYZA 1KQOA 4CETA 3U09A 1G98A 2H5EA 4DQKA 2CBZA 5EXEA 5HZKA 4Q9AA 1MH1A 3KB2A 3KYIB 1QIDA 4F9GA 2P9BA 4FYXA 2WJ4A 1M1YE 1NUTA 4RHFA 4Y9RA 3ZXSA 5B1EA 4RUKA 4G84A 3NW9A 3VYVA 1WS6A 4HQ0A 2EJCA 5E3HA 4JVLA 2ZBUA 5B4VA 1XEWX 5F7OA 4PC3A 2R6HA 4FLFA 1ZXXA 4CIXA 4E7OA 1A5TA 2BTEA 1K6IA 2RHRA 3DC7A 3EEIA 3KSAC 3WJAA 3QFCA 4E30A 2O7QA 4UU0A 1Q11A 2QNRA 2Q5IA 1U65A 2XNJA 4JUFA 4NH0A 3GP8A 1KKUA 3ONEA 5HG0A 2C7RA 1PFWA 4TZ6A 5LQCA 3P9IA 3AO0B 5ICEA 2H7CA 5EVJA 2X3YA 3G2QA 2XZPA 5REQA 3BIOA 4PVCA 4D8XA 2PPVA 2JBAB 4EKYA 3RAGA 1V8OA 4H4CA 4MI3A 3ZHUA 4YQFA 1F3OA 1DLIA 1G4HA 1QONA 1FTWA 1XRNA 3LTEA 3RC2A 2J45A 4NJMA 2IEGA 2BGLA 3CX7A 4P9NA 3HKCB 2P0YA 4HXGA 5LBIA 1Q7RA 3TSOA 2Z6VA 2B4AA 2GYWA 3QE9Y 4UAJA 1O95A 5C34B 3X1JA 3O8LA 5TQ2A 3C3CA 1XVVA 3EGWA 3PU6A 1NSYA 3MELA 3RK1A 1FNNA 4E1VA 1EUDA 1E5DA 2DQZA 3KAQA 4HI0E 3SDZA 3P9SA 5B3KA 2OBFA 4AMUA 3G7NA 5IC5A 2OD9A 1T36B 2E4VA 2BFAA 1YWGO 1A5AB 1MLDA 5LJIA 4C3UA 2LDBA 4CEHB 2C1ZA 2FUKA 1L5NA 2I22A 2Z56A 1JFFA 1A3CA 1LI5A 4ROSA 4YRNA 2WOJA 1FYDA 3FGNA 1VIMA 3DKVA 2OXIA 1QBGA 2K5UA 1N75A 3ILVA 3Q3JB 4WKOA 5EIBD 5FYDA 1L5GB 1ZOLA 1WF3A 1Z7EA 2XYRA 2G8NA 2XUGA 3FGOA 2PUVA 4N7RA 3WA6A 2ZAMA 1LRLA 3CLSC 4Z4CA 2J08A 1E2DA 2BRUC 3P0FA 3PS9A 5JY1A 1A0OA 1N8NA 1V9LA 5BNTA 3FTCA 1UKCA 5HTKA 5EJ9A 4RSGA 4LF4B 3IEVA 4KBYA 4S0ZA 4YRKA 3THYA 1F4VA 1XQXA 1DELA 3CPEA 4CI0B 1CLEA 5C3MA 3S28A 2RB4A 1DKMA 2H51A 1EMDA 3EG9B 2HV9A 3HC7A 4OM8A 5BRAA 2OD7A 4BVHA 5BWMA 2ASEA 3OOSA 1DJMA 3A28A 3TEFA 3G13A 5AI5A 2JLXA 2G07A 4RVGA 3IDSA 1B3BA 2GAJA 3G6WA 1IMOA 1EGVB 1Z3CA 4LHSA 1BDIA 3UQYS 4U02A 3ZKWA 5IK2D 1RIFA 2VH5R 4GGPA 1HF3A 1NM5C 1UJ2A 2JGJA 2AVNA 3CU5A 1Z6ZA 1CTQA 2AC7A 4EB6A 1Z7GA 4HQKA 5FKJA 4AWBA 4FIZA 3AY0A 2XUHA 2FPGB 3WSTA 3AF5A 2R6FA 1F3LA 3AF1A 2OQVA 4IXDA 4YJHB 1JHYA 1N5OX 3QVGA 3U4DA 2AE1A 4LMPA 5KYKA 1KY4A 1JU9A 3DD5A 4G0QA 3N2ZB 1EFCA 1Y7IA 2AG1A 2CMFA 1FQJA 2Y1KA 1B6TA 2J0UA 2YICA 4S12A 1KRWA 2C82A 1A8IA 3JY6A 2VPWA 1YJ8A 4AJNA 3FYDA 5EFOA 1RTKA 2IY9A 3ZUPA 4F56A 3D6UA 4K6MA 2WSMA 1J90A 4BDSA 1YT5A 2PTRA 3FCCA 5D8DA 4ENPA 3ZIAD 4ZYTA 5IMSA 5JMOA 5A5EA 4NLEA 1GCUA 3R5SA 1Q5NA 1O89A 2QX8A 4PQFA 5DU2A 2OQ2A 4LYYA 3OC0A 4F92B 2D5BA 2JF0A 1C8LA 3RHZA 4DSZA 1WB5A 3UK1A 4X7MA 3SS8A 3T1VA 4ATNA 1KF0A 2PTHA 2F62A 4FOSA 1ZWLA 1PQ4A 3L7CA 5DP2A 4ZCLA 1L7AA 1GPUA 3TTSA 2VQSA 3KUKA 3ELDA 3IUEA 1P61B 3AG5A 4UUNA 2YC2C 2YOGA 1M2WA 1R6AA 5GVRA 1EX1A 2D0OB 3JQ7B 3SI7A 1RMQA 3O38A 2G63A 1YDFA 3RUFA 4ZYYA 4M9UA 1OZHA 1ISSA 4G0XA 3IAS6 1A9XA 1Z33A 5L3SA 1MXHA 1YKGA 3L7NA 1NJ5A 5BWOA 2P7HA 1CQIA 2DY0A 5DI3B 1VDKA 1JFTA 2QV7A 3E61A 3QPWA 1BD3A 2Y1EA 4FMDB 4R1SA 4DYDA 1Q0LA 1XXLA 2RJNA 5A03A 2ZB4A 3FSGD 2IHKA 4GZMA 1LQ2A 3PIRA 5ETJA 4GXTA 4IP0A 1P19A 4A8HA 3VVLA 1ZICA 1ACJA 4QX6A 2R8ZA 3OHPA 3RIGA 3WHLA 1LW6E 1GUFA 4FDMA 2BMAA 2RGNA 3VTZA 5CNIA 3N0TA 1TJ3A 2H9IA 1VFPA 4Q9DA 3K71B 2UXCB 3AILA 2ZRMA 4R8SA 2JC3A 4RIEA 1OSNA 2FPKA 3LGSA 5DCYA 3V55A 5B2FA 3L6EA 3HRHA 2RFLA 4UE3S 2V6GA 4FR0A 2GKOA 1GEGA 2C92A 2LE0A 3GLHE 4WDRA 2HFJA 5EL0A 4CG2A 1G3MA 1FU7A 5CYPA 3SR3A 1PWEA 2O6HA 4WADA 2G0NA 3ETHA 4J0CA 1RHRA 3QW4B 1MHPA 3ANMA 3RV3A 2J9GA 3K9LA 3PX3A 1Z2DA 4KXYA 4QEDA 1RIIA 4IQ0A 3DMPA 2F6RA 3PEVA 1O6BA 2PH1A 2RDMA 1N9ZA 3K8QA 2F55A 3ROQA 2XHEA 1FS4A 4TS3A 2KW5A 3ZXYA 4GT1A 3EEQA 3GBSA 3T5MA 1JAIA 5E38A 3W90A 2P8JA 3RTBA 2XQVA 1W1IA 1B16A 2PMKA 3R7WA 4MWBA 2QTRA 3ROFA 3TNFA 1GTJ1 3CF4A 4FT4A 4LC1A 1AMNA 4Q93A 4QBKA 4HPJB 3PFWO 1HY3A 3H65A 3H42B 1P0MA 2OCBA 1CULC 5IBRA 521PA 1I9CA 2PH7A 3K7EA 3KEMA 4IJ5A 2PKCA 4GSYA 4Z0HO 1JKMA 1MVNA 4CHGA 5A4IS 8LDHA 1NXPA 4MH0R 1IOVA 5F2OA 1CJTC 1R0ZA 5HFNA 1U3DA 4EFKA 1TE2A 5HW2A 5JR3A 2QHXA 3BJMA 3D4LA 1QAMA 1SUPA 1TQ4A 2QT1A 1RRPA 4HGPA 1FL9A 1MMFB 4OX9Y 3HCPA 4DRXA 5K51A 5MFZA 1VP3A 4M0UA 5FBRB 4UHDA 3NAQA 4EMUA 1P45A 4EENA 1SBZA 2C5LA 3C1OA 1HYGA 3HNRA 1WKCA 3HVJA 3PT9A 2RAFA 1K6MA 1ZJ6A 1PSDA 4INPA 5T3UA 4AJPA 1RAFA 5BY2A 2XZLA 1VLQA 4ZO6A 1UJNA 1Q5PA 3UWKA 4XYEA 4DLBA 4F91B 4WKCA 3ASUA 3GRCA 4KXLA 3DCIA 3RS5A 1JDUA 1Y9DA 1T15A 3IQEA 4MWGA 2XCRB 5DH9A 1QV9A 4BFCA 4MVJD 2CDRA 4ENUA 2P6OA 2WIBA 2X6RA 5CX1A 1ZC3A 2NXEA 1R3DA 4LDJA 5LQDA 3PXXA 1V1MB 2ONYA 3AP3A 4KAJA 1HSZA 4N3CA 3GZJA 3ZHSA 2GZMA 1WSDA 3AK4A 4YFYA 4D6XA 2H6EA 2C8KA 3H0EA 2XMSA 1J20A 2FN7A 2F59A 2JD2A 3WDKA 4OJKA 3P2EA 4OPMA 1L4KA 4U00A 5A05A 2Q0XA 3ZY3A 5K0JA 3CZQA 1T26A 3MMPA 4RGVA 2WINI 3R8FA 5ALLA 3ZE1B 2MTBA 3F8WA 1CB0A 1Y1PA 5T67A 4AD8A 4LBYA 3UB2A 1D3AA 4FB4A 1RFGE 5IFLA 2D06A 2AFHB 2W2NA 2R6R1 3TZ6A 5M5BA 3UCEA 5EIXA 2AB0A 3PHLA 3CGWA 1AOXA 2R7NA 4UAUA 1FSZA 5JHGB 5K6AA 1FLAA 1YA6A 1XE3A 4FGSA 1EGHA 2GHIA 5TJHA 1B8UA 1JPUA 3LDGA 4EWLA 7ABPA 4BE4A 3MLBA 2JJ1D 2LV8A 3DBRB 4NJMB 3AHDA 2CXNA 3G2KA 4WFIA 3WY9A 4LF9B 2OHIA 1N1GA 4ZTUB 5IN4A 1AQ6A 2BKXA 4JJGA 3VU8A 4PZEA 1V6CA 2O2SA 1H0SA 3EMDA 3L1JA 3NHZA 1SH7A 1CRLA 1UMCA 4IJQA 2Y2UA 2ZU0C 3OI7A 4YASA 3VSAA 5JD6A 1QDLB 1BE1A 5FO1A 1L4BA 1Z3IX 3M6WA 4HN2A 4MR9B 1KI6A 4L8VA 1CYDA 2WMNB 1NVGA 2RD2A 2P40A 1P73A 3FYUC 3RRNA 1GPLA 2UZIR 1JKXA 1ZCJA 4J1NA 2D1FA 3M1YA 2PY6A 3CO5A 2CLFB 4MQMA 2F48A 4NZPA 4A2PA 2B5VA 2GXAA 1US8B 3TXYA 4QFDA 3E5MA 2PU5A 2ZRIA 5DX1A 6ADHA 1X9HA 4YMVA 1IK4A 2HMWA 1JLRA 5IEJA 4QM6A 3EAFA 3GJQA 4DMLA 1V26A 1QIJA 1MF7A 4CKEA 2PXXA 2PLNA 4NENB 1NMZA 1AS3A 1OT5A 2HQSA 1GRNA 4W6QA 1GEEA 4GWLA 1WOYA 3RWBA 3ZCVA 2VLBA 2ZDHA 2W6CX 4PZYA 1I6MA 1SCQA 4EPWA 2Q9AA 9MHTA 3G6KA 4K6OA 1DIOB 1NBMA 5IVIA 1U8ZA 2GN1A 4O4HF 2DCMA 1XEXA 2PKWA 1NY6A 2DULA 3OE7D 3DOJA 3PE6A 4MUBA 2UDPA 5AQEA 2AVDA 4IZHA 1IM5A 3KR0A 3PR2B 1T3HA 1BA3A 3B9RA 2WD8A 1KRXA 3IELA 3UY4A 3GLFB 3T5CA 1QAOA 4RIHA 4N03A 1GGFA 3GHYA 2CYAA 4BQNA 1R8YA 3VPBA 1NWHA 4L57A 2ZUWA 4CQMB 5BV8A 1RRKA 4EEIA 4Q1AA 5LNK6 4FLEA 3JD4A 4H1VA 1U7TA 4L3OA 3IV9A 2D7DA 5EGNA 1TGVA 2V3CC 2QTGA 5C8ZA 2QXUA 1NMXA 3MWDA 4GGOA 2B34A 4CEHA 1OOEA 1F2TA 2XUKA 3FWZA 3QPUA 4MKFA 3RJMA 1XMPA 4HB3A 3GELA 4FKBA 5IAJA 3UPDA 1W36C 1DKLA 1ODJA 1U6KA 2CBGA 4HQOA 4LXQA 3UWMA 4HDQB 4IEEA 4UBMA 2HNAA 4N0PA 3NGLA 1G4AE 3D7LA 3KR2A 3MM4A 5K3BA 1JHXA 4JQCA 2BFWA 3DZIA 1DLJA 2C84A 3GJ3A 3BCHA 3MWEA 4QUDA 5CB0A 1QTQA 2OECA 3OJLA 5KVVA 1C8VB 2F3QA 2H1CA 4IQ4A 2VHCA 1NQUA 1R64A 4CV2A 1ZPDA 2WZBA 5DBOA 4P5EA 2WT4A 2PH3A 2N47A 1K86A 3K0FB 5E6SA 4DBZA 2VAWA 4CLRA 2ZRAA 2AYYA 1M7HA 1XG5A 3KT8A 5J58A 4L27A 3NETA 5DX8A 2CKMA 3CI0K 5IKMA 3OPYI 5AJXA 5GPBA 2HN9A 5K8TA 3JD3A 1VHDA 3EIWA 7YASA 4PG7A 5CXQA 4HH0A 4C0QC 2XYPA 2RGGA 3QXSA 2FSVC 4BP8A 3AL0C 2C07A 2CXXA 3S2FA 3I45A 3M9LA 4BV9A 2OWDA 4DB4A 3D6VA 4AO6A 3DZHA 4X41A 3P32A 5LYJA 1AQUA 1C7ZA 1Q0UA 2X9LA 3HN7A 3RRZA 3UAZA 4O1IA 1LJ8A 4DFDA 4EFDA 1TO1E 3DO6A 3AM4A 3C5VA 4XYMA 1DT5A 2CLDX 2QTCA 4IS2A 1NF8A 3QBEA 2HOQA 3WSVA 2FZ5A 3Q5EA 3WP0A 4J6FA 2XUIA 1DI0A 2IEZA 5AJUA 4RPHA 4RZIA 5EP1A 5CB4A 4UD6A 1WVGA 1ZISA 2PTSA 4HDKB 2GN0A 4YP5A 1X7ZB 2JLRA 2ZUBA 4G0OA 3LRXA 1Z5PA 2OKCA 2CSXA 1QF9A 3HUFA 1JX6A 2F8TA 4TV8F 4AG6A 1P5JA 3DNPA 4HAWA 2B8WA 5JXWA 5LMCA 1JQEA 2Q3MA 2QLBA 3AWIA 2YXLA 2Y4NA 1PTKA 1KC1A 1VGRA 5EIFA 4YXFA 2FX3A 2PMFA 3L1HA 3MAGA 1IXZA 4GX5A 3IKMB 4NV3A 2FX2A 2UZ1B 1RWOA 4ALLA 5KYNA 3PGA1 4Z7JA 2QGZA 4ZYLA 3T1NA 3EVCA 5LMUB 3J81A 1RI5A 2R66A 1ZYUA 1GADO 1YQWA 3REFA 1HDYA 3OZIA 4JBXA 3ZHOA 4MYRA 1DKNA 3AP2A 1EWTA 3LUGA 5AO9A 5C8XA 3B1WA 5A7GA 4D96A 1VG8A 3KT6A 4B0PA 4EARA 2GEFA 4BXOB 1UBRS 1PNQA 1XA3A 1GYPA 3ZHTA 4A36A 1NHGA 2FX5A 4E88A 3ENNA 3IUSA 4H7JA 4OJYA 5HOQA 4TWAA 3UJAA 5ILOA 4KEAA 2FW6A 1Z4LA 4ZPJA 1KY5A 1ZS9A 5F3RA 4I3GA 4X62B 2DLDA 4GOND 5E6UB 1G19A 1CRWG 4PN3A 2HV8A 3TZCA 4UFPA 3PNPA 1XD9A 3AJDA 3U7EB 1EM8B 2CJYA 5J23A 3TJZA 5B36A 1S1CA 2D7JA 2NYRA 3HXLA 3PSHA 3QVJA 4XFKA 5KKNB 3CNOA 3Q6MA 5LU9A 4B4OA 2NUTA 1SIUA 1KJ8A 4P82A 1I3MA 1X7ZA 1N2ZA 1QRAA 2H3EA 2MSCB 3HN2A 4G8JA 3G23A 4PINA 1SOAA 1XJWA 4UW9A 3MXOA 5F1OA 5I9IA 1YNOA 1Z6XA 1RI4A 2FPPA 1RJDA 2O4UX 3BB1A 3H9CA 4YAEA 2R1VB 1N92A 4MHOA 4Q9HA 5TPZA 3S81A 3KFLA 3IAFA 1XN4A 4R5HA 2PTGA 4N49A 5HJEA 4PZCA 2LPMA 4JELA 2BI4A 2V97A 3ZU3A 2Z3VA 3F67A 1A7JA 4ALMA 5L3ZA 1B42A 5AKEA 1HDCA 2HSJA 2E21A 3QXCA 2WKPA 2JIQA 3WK8A 2P67A 3F98A 3F6BX 1WO8A 5AW5A 3KQLA 4ERNA 4M1TA 4YJFA 2WMDA 2OL4A 3FZEA 3OIVA 3QTLA 5FNZA 3UO8B 1P7YA 1EXMA 1I1HA 2XCQA 3K8ZA 3VC7A 5BMVF 1NVDA 1PJSA 1H9BA 3MT9A 1P74A 3DMRA 4B40A 1JHQA 5HDBB 5BRJA 1EX6A 3CFYA 2FZGA 3CXRA 2GNAA 2RGBA 1ZI9A 1TRKA 4I9FA 1NV8A 3A9SA 1JLSA 4PAOA 4IIGA 1BXGB 4PAGA 2PGDA 4OQLA 3BERA 4JU8A 3JALA 1OXXK 2ORED 2XNCA 2XMBA 3OCJA 1ZD2P 4F0JA 5C1DA 5K0TA 2C2YA 2XZTA 3Q3VA 4N0DA 3AUSA 4BWGA 2Z5FA 4UFOA 5EMNA 1H4QA 5DLQC 3VOAA 2QN8A 4LDRA 1XTTA 4PU0A 3FHCB 3S2UA 1E79A 5IXJA 5KYUB 4J0EA 4KHPB 4NCXA 3HEBA 3JYPA 1DCFA 4JASB 4LV8B 3W7VA 1VLHA 4DARA 3QU5A 3DP7A 4LY9A 3HY6A 1XJ0A 3BFKA 3G2NA 4YDSA 1PUIA 4PZZA 4V1CB 1ZW6A 2C2WA 2CMDA 1SWWA 3LY9A 1YL6A 1TUGA 4CCYB 5FH9A 3LVBA 5EWMB 4ENSA 2JAQA 2ZR0A 3DKIA 3GGJA 2ZWOA 3UV6A 3ZIUA 3K0SA 3EC7A 4GPEA 3RTDA 4BNKA 3ONVA 4UKDA 3RU3A 3COPA 5DGXA 4YRAA 2G80A 4JGGA 4KX5A 3GB9A 4BQQA 3H6KA 1YCDA 1BX1A 3MJ4A 3BGWA 5AM5A 3NHWA 2I66A 4BEWA 1N7JA 2JRCA 5JASA 4DCGA 4D9MA 3WGQA 4B47A 4NAUA 3GRFA 2JLBA 3PENA 4TL9A 1H23A 4G1BA 4UU8A 2XMGA 3MMXA 1L4NA 2V7BA 1U98A 5I7WA 2D2FA 1ZCFA 3MBIA 4PIMA 3WYNA 1KE2A 2QL7A 2UYHA 3RVOA 3UHAA 4EMBA 4OI0A 4WLNA 1TJYA 1SRRA 1XF1A 2NO4A 1DRJA 1SVKA 3Q5GA 4ES6A 1ZXLA 5TRTA 3DONA 3W8DA 1B8NA 1JDTA 2JK0A 3CLRD 4P92A 3JW8A 3A25A 5DHUA 2Z83A 1IOLA 5COAA 4Q4CA 5TMPA 2VXBA 1G3IA 4N3AA 3COZA 2VDRB 4B0OA 1L7MA 1SD5A 5DHSA 1RYEA 1IN4A 1VIAA 3HK2A 4MYSA 3V4RA 4NBLA 1K98A 3LF1A 2BE9A 2H57A 4Q6WA 4TS1A 4U2BA 2W9XA 3FYSA 4UBLA 1WY7A 1M2OB 3TJMA 4RJJA 1GLGA 1UBGA 1WB6A 3WGMA 4B6JA 3CLRC 4IFIA 5HEKA 1TM1E 1IDN1 5HBRA 1Y8RB 3BD8A 2PEZA 4EPXA 4N48A 3EGDA 4A0RA 4CTMA 4OHXA 4RBNA 2ZUEA 2VQ6A 3AW8A 4I4IA 3WWCA 3LUCA 4IVNA 2AR9A 1CF9A 2X13A 2P9TA 2PM8A 1TL7C 2CWWA 1WNTA 3IUNA 3FW1A 3WK9A 4EG3A 2DFDA 1UC8A 1WUYA 4GD3Q 3I6QA 4MLCA 4IL5A 1CUUA 5AVQA 1QCYA 1EH5A 1GG8A 1KBQA 3NRJA 4KKVA 4B6GA 2ZYDA 5SICE 1WZIA 4NBWA 3T5DA 1BSVA 4GZ5A 4RVNA 1LLFA 3AIMA 5JH7B 1J7KA 1NOKA 3BK2A 4AJ4A 3SS9X 3NZEA 3CZCA 4TGLA 2PZJA 4IDBA 3NAGA 3FRJA 1RHJA 3PBKA 3IXQA 4TKZA 2WB2A 2YFYA 3OPYB 4PO3X 3AUYA 5K2OA 3NC0C 4C04A 3ISTA 4N40A 1EU1A 1RWKA 2OHFA 2V7EA 2XQIA 3HUDA 5DM0A 5KWSA 4ECAA 4MAAA 2YV3A 1KZYC 2ZDGA 4EW6A 3M6MD 4Q7JB 3KQHA 3GQBA 4OMCA 4RD2A 2FDXA 2QTVB 5LOVB 2Q2QA 2FHSA 5HWSA 3IP8A 3HR8A 4MPPA 2WFZA 4OFXA 3SS7X 3GPCA 1YR3A 1EI9A 1NW9B 2Q6KA 1WDMA 3NVDA 5DW3A 5ILQA 3SOZA 3ZCQA 3FYUA 2WHPA 5L8VA 1QSGA 1ZK4A 3LNTA 3G2HA 3TI7A 1N0WA 1W4AA 1GPWB 4BB9A 2OPBA 5F33A 2L18A 5TE9A 2XZDA 1CR6A 1JLKA 1ULZA 2Z8YM 3C0KA 4AROA 1ORDA 3EB9A 3F7OA 3MWEB 3KR9A 2A3RA 4S1TA 3EWIA 3ZDQA 4DNQA 3JQEA 2X0RA 1F8FA 1OBVA 1BRTA 2K7ZA 1F48A 1E8NA 3N59A 5I9TA 1I4TD 1RAGA 1VPLA 2P91A 2RAVA 1Z0UA 4LJ8A 4JBYA 4Y2SA 3DE0X 6CHYA 2Z95A 2LD4A 1RPAA 3CZMA 1PF7E 1IYZA 1XHLA 2OCKA 1YVUA 4GMHA 4GYKA 4UVDA 4BCDA 1KDYA 2YBDA 1E99A 3CISA 4FFSA 3OA2A 1L7VC 5KVSA 3AFMA 4GE3A 1JB9A 5L4SA 1E6UA 1M8PA 1P33A 3ND6A 4QQNA 2Z2YA 4CMKA 4WOPA 4F5ZA 1FFYA 1QMGA 3HL0A 6REQA 4ZOLA 4MQ6A 1JNXX 3V1NA 5JSHA 1S9DA 4IHAA 2A5FA 1MB0A 1BJKA 1RRFA 1GQRA 4HYQA 3PDHA 5BYJA 1L1FA 2VJLA 1BE8A 5K7SA 2RCNA 2VDWB 1J8YF 4GAEA 1DIAA 2O2HA 1OIXA 3N6RA 1DMSA 2H85A 4XD7D 2ZWVA 2YY5A 3U7FB 2R62A 5CU7A 1VE7A 2C03A 3F5SA 3SNKA 2HA5A 3VTAA 3EHDA 3MOGA 3PHIA 4XVHA 1KI3A 4L95C 5BQOA 1J99A 4NHOA 4D4KA 1ITZA 2OP0A 2JIZD 2CGEA 2J5KA 1KSHA 3H18A 3UUEA 4RTSA 5CT9A 3DZGA 1Z08A 1QHXA 2WJGA 4LJ9A 3QU4A 2HQRA 2XBLA 2CFCA 4KAFA 4X6XA 1E77A 1MAHA 1D6SA 2WC1A 4MJXA 2WDPA 4D41A 5JCPA 3U81A 1MFZA 1REQA 1VM6A 2F1JA 3ID6C 2V98A 2YWDA 3PNVA 4FBMA 4A10A 1SA0A 2D2EA 5E9AA 1O6CA 2Z04A 3CEHA 1PJAA 2PZGA 2XAUA 2ZBEA 4OP3A 5FLXA 1AQJA 5I5GA 5CH3A 4JVSB 1KU0A 1R8XA 5B4UA 1Z17A 4BX2A 2X58A 5EP2A 4HLQB 2GJ4A 4AKHA 1ZWKA 1KJYA 3IIEA 3WJ2A 3LT5A 3X2EA 1PX0A 4DM3A 5LYYA 1LDEA 3WO1A 3C5EA 3ETJA 4ITRC 1KWKA 4QT4A 1EG7A 1ISIA 1QLHA 1I94B 2BP7A 3LT2A 2EX1A 2A9VA 1LZKA 1E3SA 4XPZA 4GECA 1OXBB 2TS1A 3MWFA 1W19A 4AIRA 1HEIA 3U39A 3W3AA 5ITVA 1ILEA 4OXYA 2ZBFA 2EATA 3CB2A 1M1ZA 3LFHA 1P4RA 5BORA 1IUKA 2HREA 1VG0B 1MIHA 3WLMA 2EFYA 1DAPA 3FGZA 1J23A 2GAOA 1UOEA 4QASA 2Q6TA 2Y1CA 1OC4A 2W2VA 2CHGA 1MO6A 2JS7A 4LNAA 1KAEA 3ROKA 3OLYA 2FEMA 3P2OA 1AZWA 1ZJ5A 721PA 2ZB7A 2ILTA 3RCBA 1XRRA 5HA5A 4TWJA 3RC7A 4KJXA 1ZIYA 1ZIXA 5CFRA 1KQ3A 2CY0A 4LJ4A 3T7KA 4BCCA 2NVBA 4KVZA 2RHBA 5T6MA 3V1LA 3LSTA 1OD6A 4QOIA 4U7JA 4YRFA 1RP1A 4X93A 1UAGA 5HGXA 4PZDA 3QMMA 1PBTA 4F1JA 4DPLA 1FQOA 2EBHX 2H92A 2GEJA 2PT5A 5ERYA 1GFZA 4P81A 4PY2A 4L3VA 1ABEA 4HB0A 3LY5A 2HHCA 2O0JA 1AQLA 2NQTA 4ILKA 1CVRA 1XRLA 4YA6A 3E0XA 4GMGA 3CKMA 5H4HA 5LBUA 4NH4A 1I4WA 1AV7A 2N9UA 3WMRA 4B7ZA 3FG9A 1XZIA 3R7LA 1CPYA 2V5UA 2WSIA 3JQBC 5GM2A 3SXUA 2BP7B 2HA0A 2J46A 1GQYA 3V7YA 4RMNA 4TT8A 4LE0A 3DFIA 1K4MA 2QRJA 4MQEB 2B21A 2ETVA 2VP2A 1C1XB 3DMGA 4FN4A 1Y4DE 4RK4A 5CIWA 2N1BA 4LVUA 4H3VA 3ZWBA 4CIBA 4LFAB 3E2IA 3I9JA 5LBTA 2G88A 1BHSA 1RQPA 2WNIA 1U0JA 4N8SA 1L7PA 3UXYA 3WJ7A 1MABA 1KDVA 3IOYA 2QX9A 1LXCA 4QPDA 4U5QA 1L7OA 1Q1BA 3FYTA 3TMKA 1RU3A 4J94A 4UM8B 4AAYA 1TYEB 2HT1A 5LWHA 1RYYA 4CF5A 1I32A 4C7VA 1QPZA 3OTOB 4F2HA 1W5AA 1Z5OA 3FVTA 4OHKA 3AF4A 2QT0A 3A31A 1JL3A 1N4AA 3DBHB 1RAIA 3KQVA 3HJGA 3IT0A 1MABB 5C7LO 1JEQB 4HWRA 1DBRA 5FULA 5CD1A 2ZK7A 1Q84A 4JJ6A 1ZEMA 4UBJA 5J2UB 1NA5A 1UJBA 3BL6A 5AWFC 2BDUA 3BMCB 2HCBA 3C43A 3R3XA 3CT4A 1KFJB 2J7PD 3ICEA 1AZTA 3QKTA 1K97A 4I5EA 5GOTA 1XKTA 2IQ5A 4LKOA 4NTZA 1TEZA 2H65A 3GJXC 3W05A 3WOHA 1TZKA 1FDUA 1V6AA 2G6BA 4GNRA 5D3MB 1K7WA 5FL3A 2QJOA 5KTPA 5MHTA 4TYWA 4EUEA 3UT6A 1NI4A 2R3SA 5JPIA 4B33A 3GFQA 4CKBA 4P93A 3ZS9A 4H7IA 2YWGA 2PUCA 3OEHD 1H2EA 2O50A 5DEIA 2NACA 4JR2A 1L5ZA 1CZKA 3M81A 1EVLA 4K9OA 2HC9A 3HWWA 3DOHA 1G66A 2WV9A 4YP7A 3PHBE 1NUUA 3PC4A 4D3FA 3EDQA 4HFRA 4JS0A 1C0LA 2V9ZA 1LK5A 1M2GA 1ODSA 2PRIA 4XD2A 1JTVA 4DUGA 3A06A 5JEEA 2AXPA 3O6VA 3DUWA 1SHLA 4TMFA 2VJMB 1Y5LA 3T1TA 2NSDA 3PI6A 2J3JA 4I55F 3CNNA 2Q5HA 1DCKA 1S7CA 4BPRA 3HGQA 5AUPB 4CM9D 1OGYA 1MV5A 1JPNA 1GPAA 2GX6A 2JK1A 2XYHA 4LRYA 4BLRA 3AQIA 4OATA 5F5NA 1KMMA 2DHDA 1N0HA 2ZYIA 4H3KB 2I71A 1Q2XA 2F43A 3OSZA 4FBGA 1HQKA 5K03A 3JQFC 2XNDD 5E9JA 1I2CA 1RKVA 1V0JA 3DH0A 4O02B 1KZ1A 1YR1A 5E4YA 2H2FA 1QOPB 4H18A 3RYIA 821PA 4IXMA 4O4IF 1DC6A 3VJMA 1ZK0A 3A9UA 1YUNA 3TKAA 1KERA 3FZGA 1VLLA 5AKIA 4F6RA 3HLTA 1QBKC 1WX1A 1UDAA 4AY5A 2R6CA 4OQEA 4C4TA 4LFCB 1XZDA 4DE5A 3PV0A 1GAQA 3KKQA 2C7GA 1FFBA 2D74A 4XFJA 2VT3A 1NBMD 4M9RA 4URWR 4DIEA 3OE4A 4GMFA 2BGGA 1G4UR 1COWD 3ASVA 3AKDA 4MIEA 2G77B 3Q7PA 1Z2OX 1UZLA 2RI0A 5CX4A 2C7OA 3IAXA 3HO6A 5DGCA 3IILA 4IWXA 1ZR2A 3ZCTA 3ZV7A 5E1BA 2QVCA 4ZI7A 2VZ0A 3TDMA 1QVVA 2JAPA 1RYMA 3PNLA 4O8ZA 1O1YA 3BL5A 4W7HA 2DR3A 4DAOA 1UJMA 2VF2A 3CHYA 3A4LA 2EEPA 1M74A 4C30A 3TCXB 3ZY2A 1QIFA 1Z7YA 2IYYA 3I30X 3AZQA 2CLOB 3VJKA 1KJWA 1LBEA 4WVLA 2PQ2A 4TKVA 5A5VA 3JARB 2GBLC 2IHTA 1VMKA 4UTZA 1Q74A 4CEJB 2RK6A 1O3YA 2D5LA 4BO0A 2XKKA 3IXMA 1QE3A 1HE2A 4KGZA 4QBFA 2FY8A 3FWHA 1ML3A 5BSHA 3FHTA 4D5EA 2BTQB 4DR4B 1L7QA 4D8TA 4JZYA 1ZOSA 5L51A 1M34B 4JYCA 2BFEA 4PAWA 1QUEA 2A9RA 4DLVA 1B6RA 1XTQA 2I8LA 3CT6A 4UUMA 3V34A 2WJJA 1HORA 3IDOA 3MWLA 4UU7A 4H4EA 1DBWA 2IF2A 4INJA 3DDNA 1A96A 4MW9A 3N75A 4C06A 1TM3E 2GSDA 3L7AA 3FY4A 1XCOA 3RVDA 3VR5H 1KRHA 2P0AA 1V5GA 3EZ7A 3M7IA 5EMHA 5AD1A 2WM8A 3HYRA 2ZJOA 1Y5IA 4NCKA 2DJ5A 3EGIA 3TW4A 4KR3A 2RBGA 1QO7A 1Z0IA 3KB1A 1GGNA 4EX7A 4ZMRA 1T9ZA 3R6DA 3V1KA 4N8EA 2AR7A 3Q72A 3I04M 2Z3WA 4MK4A 2CZGA 4L4UA 4B3CA 4DGSA 4H1WA 2XKBA 4W82A 1T6XA 4MQBA 1XLUA 4FR5A 3QF4A 1SZJG 2E4ZA 1GAJA 1TFUA 2VIIA 2A59A 3DVAA 1DRUA 1Y4SA 3DTVB 1RLUA 4RL4A 4Z6KA 1V47A 3EIFA 1ZUNB 2PUDA 1SUAA 3M70A 4PCAA 4RE6A 5C1PA 5HOEA 1KETA 2D8MA 3SGLA 5FOSA 1F4LA 4QJ3A 4LTNA 3HDYA 3QUTA 4DIMA 2K6GA 5I4KA 5I7RA 1ZKDA 3BFXA 1Q92A 1JE0A 3JQPA 1T36A 1NYLA 2WF5A 2ERXA 3LUPA 3PFIA 4HRYA 4C7KA 5KYYB 2BSAA 5I8PA 5M04A 2BC9A 3C45A 4JX8A 4EHJA 4S1PA 3Q8XB 2XHZA 3LH5A 5T6BA 3TQCA 4MV6A 1QHHA 2IXTA 4LI3X 4DKJA 1E60A 1JEJA 4US0R 3PQ8A 5DYYA 4COKA 5ITWA 1FU4A 3JD1A 2P3SA 1HH4A 2JA1A 2RARA 3H11A 5A9SA 3IO5A 5GJWC 2W6ID 1U2TA 4Z53A 3K1AA 2GFQA 2H7VA 2JVKA 5GV8A 2FN9A 3TIGA 1FUOA 1KYZA 2XZOA 1MW8X 2AX3A 1P2UA 3A4NA 1I10A 1QZTA 2ATXA 3T34A 5IAOA 4JYZA 4G1MB 3PVCA 4C6HA 4DF3A 2UUAB 3UV3A 4DC0A 1KVTA 2VQDA 4PPQA 1Z75A 3QBVA 5DNAA 3ZDZB 4YJDA 4GR9A 2ZYVX 1NI5A 2H9YA 4RKRA 2M9MA 3KRTA 2AXNA 1R6VA 3K5WA 4EHFA 1BU8A 1K6JA 4G5RA 4TL6A 2BZ1A 3ZIAA 1Y3FE 2O2CA 4I9HA 4NU8X 5ALRA 3GA5A 1WBDA 4XM1A 1P1IA 5CA0F 2EXXA 1WDLA 1YF3A 3PC7A 1OI7A 3ZE6A 3GFFA 1GZHB 3E7XA 3IDAA 1E7QA 1L5HB 2ZSBA 3LW7A 4PICA 3M1IA 1ZI6A 4B3GA 3LLUA 3PC2A 1JZQA 3TL6A 4ZHQB 5H8WA 1NVAA 5FAXA 3ITNA 5LLTA 5CLJA 2VQ3A 3DQQA 4O4IA 5IHXA 4Y6RA 5FNVF 4I4TF 5FNVA 4F84A 1W1UA 3HWSA 3SZRA 2RBEA 4KB5A 5C5CA 3OMLA 1JR6A 4JJZA 1GL6A 5EUMA 5BSVA 2PBZA 3OHMA 3KSRA 2R1TA 4UTRA 1QQBA 5IDXA 3GPLA 4XJTA 2JLWA 4H08A 3OOYA 3OJWA 4JLMA 3EG5A 4ZANA 3KQSA 4LNHA 3HLYA 4Q4JB 3V8BA 4WWHA 4I55A 2IS4A 3P7MA 4F8EA 3ZK9A 3O4FA 2FK7A 4FKMA 4V39A 4F3TA 3MK31 1CSEE 1TJ7A 2BCEA 2JEOA 3WK5A 4BIIA 4QLAA 1UFRA 1NDQA 5EKTA 1F7UA 3FA2A 2B5WA 3HNOA 3RIHA 1MW9X 1XGKA 2HGSA 2GM5A 1CT9A 1EYZA 1XZKA 2HX1A 4XIYA 1YBMA 2XBMA 4CHTA 1U8AA 1QIMA 1V2GA 2Q8PA 3N2GB 1UQTA 3QPAA 1UQRA 4MPRA 4UNSA 1DOFA 5B4TA 5KUTA 2RGNC 5KTYA 2JLSA 4PSCA 5IH7A 3BREA 5D87A 4JY7A 5AICA 3VPHA 3HFJA 4PYMA 1IBSA 2C77A 1FE8A 4P08A 3IUJA 5IZCC 2DPXA 3E7DA 4RGBA 4Q47A 1F0PA 3C2QA 4OHZA 3CX4A 4YNBA 3B8HA 3HY4A 4MJLA 1H1TA 1NN0A 4RGQA 3PEFA 4TLLB 5CDYA 5JDIC 1N7IA 3SQWA 2H4FA 3INRA 1JIQA 4CJXA 2HT6A 1S5PA 4YRPA 4DQLA 3PUWA 3R75A 4C4YA 3EC1A 1ZDMA 1LSOA 1PG2A 4L0CA 3LUBA 3PQEA 2EBFX 2GCGA 4XPIA 3ROZA 4RGYA 1DOHA 5B6IA 5BPFA 3G82C 1XTUA 1SHKA 2GN8A 1T3LA 1T2CA 4JLNA 3I64A 2JKYA 1OFUA 3PYXA 3VYRB 3PITA 4H7PA 4OFBA 3UT5A 1E92A 4LKRA 2D3TA 2RGYA 3VZRA 4AIIA 2HJ9A 2XMPA 2I7XA 3OWOA 5F1KA 5REQB 3DVQX 3RVJA 3PEWA 4BPBA 1E2GA 2WLTA 2QI9C 3N8HA 1MN6A 4CKWB 2BR4A 4M1ZA 1GZ3A 3A1DA 2QYTA 3FVWA 3TVYA 1YOVA 4OQQA 1JILA 2BZ0A 3I5UA 1DC3A 1G8KA 1J8DA 1QWOA 1U3TA 1TZCA 1YZQA 1Z73A 2HDNB 1NNUA 2MSEB 1TF7A 4HNSA 1WMBA 4TYMA 4J4BA 5D3QA 4KAXA 1WDTA 3FUVA 4E0BA 1Y34E 2H3HA 1N57A 1GA6A 3NWJA 4TKMA 5D5HA 1QZXA 1E1QD 1OBOA 3FNHA 2R6JA 5LQSA 3CQ9A 4YN3A 3RUPA 1UXIA 2XIJA 2WUFA 4XLZA 2JPDA 1I0ZA 1DUVG 3BVPA 1TMYA 3GBVA 5TMBA 3ZCPA 4HBGA 4CR6A 4B3SB 1I6WA 1Z0JA 3VYWA 2QRUA 3G7SA 1T1JA 4BMCA 5KZMB 5LP6F 4XB1A 1PJRA 2PX6A 4D9JA 4RH0A 1C7IA 1QGDA 1UDXA 4EAQA 4MS3B 3D5QA 3OF2A 4NESA 2JA2A 1AHPA 5KYXA 4UARA 1KGSA 4HHEA 3A6EA 5ARCA 3HACA 3NDPA 4DIUA 5FXMA 2CJWB 5CA0B 1XL0A 3EW7A 1I01A 3JTEA 1NW4A 2OZKA 5KOJA 4XIIA 3L0SA 3DZKA 4G8BA 3QELB 1UFQA 2W2LA 4N1AA 4AJ2A 1GNVA 1XTIA 2Y0CA 4MI9A 3X44A 1MT0A 3HCNA 3KZCA 2XCLA 4KR0A 3LY7A 4BX8A 4RADA 4XYGA 3QOWA 4CV3A 3EZXA 3TG2A 2HA7A 2Z4TA 3KFVA 4MVWA 3RYHB 4BEJA 1U7UA 2Q2OA 3GRYA 4JFRA 4M9SA 2RMKA 1J2EA 2TMKA 1PKXA 2BEJA 2GESA 3K53A 5G4KB 4EUKA 5HUJA 4BGIA 3PT5A 1XAJA 3W3ZB 4EOGA 4FSDA 4ZN6A 2RE8A 4YYZA 1MV8A 4Q16A 3OTWA 4XVQA 3CEPB 3TNJA 5KREA 1RBYA 1EJBA 3Q0EA 2E82A 3I2FA 3OCXA 4IH1A 5JS8A 1YI0A 1PV1A 1VYUA 3G0HA 4G26A 5FBZA 3BGVA 3L6UA 1X3LA 3OX2A 4UDOA 1KOJA 4EG0A 4O2RA 3C3BA 4QU0A 3GY0A 4U2FA 1IY2A 4C07A 4WNAB 5IVDA 2VRWA 3EFEA 3HP7A 3RVRA 4KMMA 2AT1A 3W3AD 4F4CA 4IKOA 4CT5A 2NP6A 1N6IA 1RM3A 2ZBPA 3FNQA 3KZKA 1UZUA 5B58C 3GEEA 3TBFA 3TZKA 4A6XA 3DUFA 1NAHA 4FN5A 4HNUA 4JI0B 3T1YB 1BQ3A 1MO3A 3DV9A 2Y92A 1MAAA 3K2QA 4GXQA 2ZS9A 4NQZA 2B0JA 4NI5A 1B3RA 2JGDA 4BECA 1K2VN 4EEZA 2EERA 2N0SA 1KMIY 3LU1A 3BRQA 3HRKA 4ISCA 4KBFA 4MRMA 5EZ5A 4BE9A 2D6FA 2O8CA 2BFFA 1QM5A 1WV1A 1WSWA 2PV0A 1ND6A 2P68A 5EZYA 1E2LA 2C4UA 3GEHA 3E7PA 4DLPA 3UGTA 4FM9A 1YKSA 4CIAA 1ZM7A 1HDZA 1A9YA 1NN5A 3IBCA 2WW8A 4E5NA 4CEIA 4RTKA 4EG4A 4ODIA 4KO1S 2IZ5A 1LCIA 1RRVA 1XAIA 3NFYA 4DRYA 2O1WA 1DO2A 5AW8A 5BT9A 4GLLA 4FYVA 5FUMA 2W2PA 3V42A 4N5LA 4RE5A 3U3JA 2ORYA 5EMJA 2VF4X 2CNOA 2HSDA 3GLIB 1CJVC 4FDUA 2D5CA 2FEKA 1DQNA 1PJTA 4FLMA 3O8BA 3H5AA 1W87A 1YB5A 2Q28A 5LQJA 3EULA 2W7TA 1VBKA 5E9WA 2E49A 4JDPA 4JGBA 4D97A 3EVEA 1I0LA 3RSFA 3EF0A 3N0RA 4XWGA 1OY1A 3I0NA 5DNUA 1G5IA 4C21A 5FWYA 5DTQA 2ALJA 2ZJ2A 3SF0A 1TO6A 2RIRA 3GQVA 2IH2A 1MIOB 3A8TA 4CM8A 4M2LA 1JXOA 2YWHA 1S8AA 3QQPA 3V5NA 1XMOB 1RI3A 1YRWA 4IFEA 2RGUA 3G2MA 1OZ0A 4UHCA 3JYOA 1D5WA 2QTTA 2ZUTA 1LTQA 3DEIA 3LUKA 3HJAA 3W79A 3DZBA 1EUYA 5EUBA 1G6HA 3E22A 4HLNA 2J3EA 4LHYA 5HF8A 3SEZA 2HSWA 4Q4HB 3TRKA 3WGZA 2AZTA 1YZUA 1ZH4A 4QLBA 3HYLA 1T5BA 3ZD8A 2GVZC 3OE5A 3GN2A 1QKKA 4JHLA 3QF4B 3ER8A 5D3ZA 1UUFA 3U62A 4OO3A 2W2OA 3KOOA 1B4DA 4I1IA 4NABA 1DNPA 4MROA 4RPIA 1CY6A 2ACKA 4BFSA 3TD6A 4NMLA 2KJQA 3L02A 4PFQA 4P36A 8GPBA 4FEYA 4Q9KA 4KR6A 4XUEA 1E2FA 2QJWA 5FOWA 4KV9A 2GBCA 1KQPA 3ZH9B 5L6LB 3K70C 2TMDA 1HURA 3O0DA 4N18A 4AG3A 1GZ4A 1F20A 1FJ2A 3W2EA 2AG8A 5CLHA 5EE5B 3IR5A 5BN5A 1OFHA 2HYDA 3GWGA 4Q7KA 2XECA 3A4IA 3DMDA 1AHHA 2ICAA 3BG5A 4C87A 2AMLA 4MRNA 1ECPA 4REMA 3IMCA 4NENA 5HFJA 1JWBB 4ZVNA 4ZJZA 2HFKA 3ZYCA 3E3AA 3RS8A 3UM9A 2DM6A 5EINA 4BX3A 3SE0A 1TYAE 1IWOA 2R87A 1HETA 1GYRA 1XK7A 2V5VA 5FO0A 5TNXA 2QBYB 1JKIA 3Q0TA 5SYNA 3UJNA 1V96A 1FRQA 1JQ5A 3RAPR 4DXAA 4U7GA 1QRTA 1HWYA 1UPCA 2R8RA 4K87A 3FPJA 4PPYA 2QRPA 5J1TB 5JBNA 1ZRSA 3I83A 1Z5NA 1NBWB 4L0MA 4P1ZA 1IZ0A 2FF5A 4KP7A 1N9GB 3R9XA 4F46A 1AZLA 2JIDA 3H2KA 5AK4A 2QRQA 5CLIA 4FDTA 2VJCA 1LC3A 3PXEA 2ID4A 2CD7A 2O23A 2XQJA 3NHAA 1WABA 1K7CA 3BMQB 3NTLA 5EP4A 3SZGA 1KEEA 4K46A 3ZDDA 3K0EA 2EGHA 4QYWA 2LCFA 5CRIA 3K0CA 4QELA 5KNDD 2ZRKA 3UOAB 3OZCA 1ZMBA 4MLZA 2QE6A 1PUXA 2OO3A 3F49S 4QFCA 2PGIA 2ZS8A 2BSXA 3V3TA 2QDXA 1YE3A 2B30A 4J2HA 3GF4A 1WNFA 1UMDA 3VRHA 2R6DA 4LXUA 1TW2A 1FDTA 2LIVA 2O05A 4QQRA 4AF8A 4C1BA 2Y93A 2ZLBA 4TT3D 4X1KB 4R2HA 1T5IA 2QXTA 4JUCA 3EXHB 3PHCA 3GJTA 2NMVA 2BKVA 1WG8A 3WB1A 1CYEA 4J4HA 4G23A 4LG1A 1YJBA 1D2RA 1VKOA 1DOZA 2I2AA 2ID9A 4O08A 3DP9A 4OJQA 4XASA 2WUGA 4D9IA 1F4PA 4W5OA 4RTMA 4X3CA 1NIPA 1N6OA 2H7XA 2WD7B 2XUAA 3L7LA 4LSWA 1B1AA 4M9QA 4OSOA 3ZCUA 4GL2A 5DLYA 2QTHA 2IXAA 5FFMA 2P3QA 1KPHA 2VPQA 3CH7A 1J5XA 3JASA 4ZHSA 4WJKB 2AN4A 4QSMA 3S2IA 2I03A 1W47A 1W75A 2QN7A 5LNK1 3LKBA 1OI2A 3KJEA 1P9NA 1L3IA 3K5IA 3WI7A 1P17A 1SXJB 2QQ0A 1HQDA 5DHQA 2IYUA 1V39A 4X94A 1A2QA 3G17A 1V9CA 4W1RA 3STTA 4EKEA 3GXOA 3NC1C 1RYDA 2VLIA 2GZ1A 2CVQA 3AY6A 1JJ7A 1R6UA 1VRVA 1EEXB 2COUA 2GD0A 2VOJA 3FD8A 1Z13A 4PPFA 5K0NA 3HXPA 1GVHA 3UATA 1I30A 3LHFA 2QLFA 4DLRA 1AKEA 2W6OA 3OAAD 5FF9A 5H1YA 2WZDA 4C4OA 3PEEA 5BURA 2HBYA 1RQ7A 3L3BA 4N5NA 3NX4A 4OD0A 2VNSA 3WDSA 3D2BA 1F2TB 3W4JA 5EYPA 5FOTA 2B9EA 5A4KA 3W5AA 2XVMA 2CNKA 4ZI5A 4AZVA 4G5OA 4GKAA 5E95A 2VWPA 5F35A 4H6PA 2NYAA 4J0QA 1D9XA 4UXHA 5BVHB 3VGJA 2DT8A 2ZE5A 3WQSB 3RARA 3IQGX 3PYMA 4C9BA 1AUXA 3OECA 4E03A 5KSWB 8MHTA 4ZVUA 2Q4TA 4JBIA 1LS6A 3K16A 5CH8A 1M66A 1IN5A 2VYVD 1T9KA 3A1UA 2WHEA 4ZVPA 4YP0A 4EYSA 3JQ6A 3OU2A 1GRCA 1RJ9B 1Y5RA 1J0CA 4R9NA 4WK6A 5D3MA 5AI4A 5F5XA 5L7YA 3ZS8A 1HNWB 4HDOB 4ENVA 1DGQA 3DM5A 4DA0A 1IZYA 2VUTA 1XNGA 2J3QA 4ID9A 1H3NA 3IUPA 4B7AA 3ZGZA 4OXIA 1PGJA 4GOXA 3GJ6A 4X0EA 2VDLB 3MTJA 5BW8A 5A06A 5BQPA 5JJCA 2VNJA 2CUTA 1TUIA 4K6HA 1Z6YA 2R47A 4EHBA 4QQ8A 5ESWA 1EDBA 1BX3A 5U4XA 4X1OA 2CYCA 1JQJC 3I32A 2KB0A 3ZHVA 1W93A 4JJ7A 4A0HA 1CZRA 1U16A 1NGSA 4YPOA 2B6HA 3NUQA 4M0DA 3AEQA 2GK7A 2W6ZA 4OXNA 2HMAA 3NFRA 3RASA 3BSFA 1L8XA 1PR2A 1M1UA 1YBVA 1E89A 1NE2A 3IALA 3KJXA 2OKGA 3NR2A 4PX2A 4RCYA 2ZTUA 4BS9A 5JECA 4H7EA 3BWVA 3BD6A 2RSLA 4QXRA 2QW8A 1A4RA 1XALA 2OHVA 2R7KA 2VYFA 1S2LA 3H99A 4NSNA 1BOFA 2DQ4A 2GBFA 3H2YA 4Y0VA 1T13A 1BKYA 1K9SA 1VKZA 2OZPA 3VH3A 2QRMA 3DBLA 4HTFA 1T1SA 1NNI1 4UTNA 2WJPA 1SCJA 1IJFA 1ADCA 1J8VA 1N25A 3K09A 3K0AB 2ECKA 4J3FA 3IVMA 3ED5A 1TM2A 4HEHA 4JT8A 2QL6A 4B8WA 3A7EA 5FCDA 4EGCB 4RA6B 4HD8A 4QTYA 3L4JA 3IQXA 4ZC8A 4DWJA 1OWNA 1PZFA 1A88A 1J2UA 5BXQC 2P69A 2YRXA 2H2AA 2OYSA 5CCDA 3RS3A 2C0QA 4HG2A 1E5TA 3NBMA 3AYXB 1M6VB 3OE1A 3N7AA 2FR8A 4OXKA 1WCYA 3KZXA 4GS5A 1JT2A 2YWEA 3HKDA 2R4TA 2JGLA 3GZTB 1FMCA 2DTDA 1W9MA 3AI3A 4F5DA 4EPRA 5TMEA 3DG9A 3LDAA 2FUNB 2OBLA 2OXTA 3QY0A 4A2CA 1JEEA 3RSOA 1ODTC 1DG9A 1J3UA 2EGGA 2QGFA 2QX6A 3HKBA 3OY7A 4RWEA 4ZC1A 4O33A 4URHA 1Z28A 1JDNA 1B2RA 1ULUA 1SUDA 3F1LA 2FZWA 2ZIFA 2FXIA 1ZQ1A 3UUWA 5FA6A 3HDJA 3IDFA 5IXYA 1FTSA 4Q34A 5L3SB 2EHDA 3SNHA 4P3XA 3VSDA 1ZGBA 1Y9EA 3NBUA 4XUGB 3U44A 1DC8A 4C1NA 3CF2A 1B2LA 4PXSA 3CTMA 3KOXA 1ADFA 2P90A 5IANA 1Q0TA 1JJFA 2NU7B 3VGPA 1XHFA 1JWLA 2O5VA 5JO0A 4LXGA 1LX6A 3UK6A 1ODIA 1NL3A 4B6EA 2F9LA 5G1NA 1CE8B 1WQ1R 2Q07A 1DAEA 4M99A 5DCWA 1C1HA 1HMYA 4PN7A 1JSZA 2Y4OA 1V3VA 1YRQA 5K8UA 5B7PA 4RA9A 4JQYA 4U2EA 1JA1A 4Y2QA 4G3XA 2YCBA 1CUHA 5JQGB 2W6PA 1YJQA 2I91A 1EE1A 3RH0A 5KPDA 4CU2A 2WAYA 4ENTA 2A88A 2V6FA 2BW0A 4I6GA 1E4YA 1G2QA 1DCTA 3MZ0A 5JIBA 4WW0A 4JR0A 1Y89A 1QYCA 3BB4A 4OU4A 3L9WA 4ARAA 3OU6A 4PPNA 1JXQA 4M0KA 1N6HA 2NADA 4PCLA 3SYTA 3T41A 1LFDB 3FFXA 1K3UB 1S2OA 3LAWA 1H2BA 2CXHA 4LSMA 4NAHA 4JJAA 1X2BA 1M3SA 2J3KA 4MO9A 5KDOA 3WNQA 1RPTA 1TCBA 3M49A 4X63A 4ZZ2A 1I2ZA 3PWTA 5ENDA 4DRXB 3STYA 2VYQA 1UBLS 2D8AA 2FPLA 2PWAA 3HR4A 4MV0A 2X14A 5FTKA 1WJGA 5GWXA 1QKJA 3ANXA 2QL5A 1J97A 5HQ3A 1AE1A 4AS2A 5EMMA 3CLSD 2UXDB 4JT9A 1MZPA 4WCFB 1JDBC 4IAOA 4E08A 4YI5A 4XOIA 4M9CA 4EY3A 1JNYA 2G0TA 4DB2A 1PG5A 3F4TA 2VL7A 3TLGA 4CQNA 1NJSA 3BC1A 4UNNA 5KX5F 1QCZA 1AF7A 2JFXA 3FJYA 1UINA 3N9IA 3SE7A 4DNPA 1QG6A 4Y6PA