1Z4PX

Structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with deoxyriboguanosine 5'-monophosphate
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
b'RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase
publication title Structural basis for substrate specificity of the human mitochondrial deoxyribonucleotidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 64
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1z4pX02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4pX01
5AK4A 4HGRA 3L1VA 4RESA 3L8HA 4PNHA 2DQSA 5AKEA 2RBKA 3OCUA 2B0CA 1ZD5A 3UM9A 5AW8A 3WK6A 1NRWA 4YH1A 1N9KA 1L7NA 3WK7A 2ZBFA 4CNQA 3L8GA 3CNHA 4QJBA 3W5CA 3U7FB 2MSNA 5AKLA 3EF1A 1Y8AA 2HDOA 1O03A 5AKHA 2JAWA 5ALKA 4AP9A 2JGAA 2P27A 2EAUA 1RMYA 1RKQA 5ALUA 1RC8A 1CQZA 3DNPA 5ALDA 1RRCA 5A3SA 3L8FA 4EENA 5AI4A 1VFPA 2G08A 3AR8A 2GFHA 2FUEA 3M1YA 2B30A 2R8YA 2YMQA 2MU1A 1TE2A 3DDHA 4NWIA 4G63A 2YMPA 2O2XA 3ZX5A 4NFLA 4JDPA 3UMBA 1RKUA 3KDPA 3FM9A 1XVIA 4KYTA 3B9BA 3ZTWA 4QQFA 5ALQA 1L8LA 5AKYA 2RARA 2GHQA 1WR8A 2FEAA 2AH5A 3KZXA 4UMEA 2YY6A 1L7PA 2R8ZA 3F9RA 3NIWA 3WK9A 3VAYA 3ZUPA 1EK1A 3L5KA 4Y2VA 3FGOA 4I9FA 2I54A 4C4SA 4AS2A 5AI6A 2FPWA 5ALWA 3ZWKA 3N5KA 3OCYA 3A1EA 1U7PA 2FDRA 3L1UA 1N8NA 3AR9A 5AKKA 2AUTA 5AVXA 3QU5A 3FPBA 1YV9A 1ZRMA 2I6XA 2B8EA 3NALA 2W11A 2QYHA 5AI9A 1AQ6A 4NABA 3DV9A 1QQ7A 2OA0A 3N07A 4E88A 4Y2TA 3ET4A 5ALSA 3MPOA 1Z4KA 2IOFK 3A3YA 3QUQA 3K1ZA 4BKMA 3OCWA 1FEZA 1J97A 3M9LA 3IJ5A 4Y3UA 3NUQA 4YCLA 1Z5UA 3ZW7A 5ALEA 2O9JA 3OPXA 4CF5A 2I55A 3R9KA 1LVHA 3QU9A 4OD0A 3S6JA 3BA6A 1YJ5A 1Z4QA 5AI8A 1TJ5A 3MC1A 3ZVNA 3W5BA 3AR5A 1RKVA 2BDUA 5AM5A 5AK5A 1Z4NA 5AKJA 5AK3A 4EEKA 3E84A 4UM7A 5ALZA 5A3QA 1S2OA 2R8EA 3WGUA 3ED5A 2HF7A 3FVVA 2WHEA 2AGVA 4BX0A 2WF7A 2GHTA 3W5AA 1KYTA 4Y2JA 2WF5A 1RQNA 5AM1A 1K1EA 1RPZA 5AM3A 3A1CA 1QYIA 3B9RA 5IT0A 2HX1A 4YIKA 2G80A 5IS2A 3WK5A 3U7GA 4UAUA 2GMWA 2HEGA 5AW3A 1RDFA 2NYVA 1Q91A 1L7MA 4UARA 2FPXA 2I33A 2JARA 5AW9A 5AVRA 3J7TA 1XP5A 5AW1A 1ZD2P 5AI0A 3EPRA 3N8GA 5AIAA 2FUCA 4F71A 1JUDA 3TLMA 1T9ZA 3N28A 2CN1A 4L6CA 3E81A 5AM0A 4Y2YA 2Q5EA 1ZOLA 4Y2QA 2I7DA 5ALTA 3SF0A 1SU4A 4KNWA 3I6BA 4BX2A 3AR2A 3IB6A 3U26A 1O08A 1RLMA 2JAUA 4I9GA 4XQ0A 1YNSA 3SLRA 5AKGA 3EF0A 4HGQA 2C9MA 5AKIA 3R09A 1YS9A 2G0AA 1ZRNA 3QU7A 4RETA 3ZX4A 3U7EB 1Z4PX 2HHLA 1TJ3A 2ZBEA 2PKEA 5AM4A 1VJ5A 2YBDA 1U2SA 2C8KA 2ZXEA 4ZEXA 4YCMA 4H1WA 5AHXA 4Y2RA 4YGYA 1WPGA 1VJRA 2HI0A 5ALLA 4OCZA 2IOFA 2B82A 3QUCA 3SMVA 3WKCA 3IRUA 3U13A 3OCVA 5AVSA 3KC2A 5AW2A 3NAMA 4L57A 5AW6A 2QLTA 5JJBA 1Z5GA 5AW0A 1J8DA 2YMLA 2HO4A 4C4TA 3L0CA 4DWOA 3PGLA 5AW5A 4BNDB 2G1AA 2YJ6A 2PR7A 3ZVLA 1SWWA 4Y2SA 2GO7A 2G07A 2OBBA 2WF8A 3WKBA 3WK4A 3W5DA 3N1UA 4CE6A 1L6RA 5AI5A 5AVQA 3KD3A 5AKZA 1U7OA 4DFDA 3MN1A 4EX7A 2FI1A 3P96A 2I34A 4JB3A 1RQLA 5ALXA 4CF4A 3NRJA 2YN4A 4AS3A 1ZD4A 3PGVA 1TA0A 3OCZA 2BDEA 1Z4OA 4UU0A 3RFUA 2X4DA 3HYCA 2EATA 2HF2A 1TJ4A 3E58A 3R4CA 5AICA 5ALNA 1RMTA 2P9JA 3QU4A 5ALRA 2W43A 5AVYA 3RF6A 4EELA 1RLOA 3SKXA 2R8XA 4J2TA 2HCFA 3E8MA 5AVVA 3U7HB 2CFTA 2YMMA 2G06A 3L0BA 2ZBGA 1XPJA 2OM6A 3ZVMA 4FE3A 3ET5A 1ZS9A 5T41A 4YCNA 2EARA 3HLTA 3A1DA 2FPRA 3OCXA 4CF3A 4XPZA 1Z4JA 5ALIA 3GYGA 4UU1A 4NV0A 3QX7A 3I76A 4ZEWA 1YDFA 5AKXA 2RAVA 2P69A 2RB5A 4IFTA 5FP0A 4GXTA 1CR6A 4EZEA 1Z4MA 3AR4A 2W4MA 1Z4IA 5AVUA 2JAOA 4BYGA 4ZEVA 5ALVA 1Q92A 3PCTA 3QUTA 4HGPA 3SKYA 4KX3A 2NO4A 4BEVA 3L7YA 2OYCA 4UMFA 3ZI4A 5ALMA 3WGVA 2FPSA 3I1YA 4OFZA 4Y2UA 4EX6A 4BBJA 2IYEA 2ODAA 2PQ0A 2YJ4A 3CZ4A 4KN8A 2CFSA 3I28A 1WVIA 3SHQA 1QQ6A 4Y2PA 3NASA 4XOUA 3WKEA 3MMZA 4IG4A 4FFDA 1WZCA 4UASA 2BY4A 2FPUA 2ZOSA 4KNVA 2C4NA 3ZWDA 2G09A 4GIBA 3UMGA 5ALFA 4HYTA 2NO5A 4HAIA 2B1QA 3WKAA 4UAVA 4B6JA 4DW8A 4HGOA 5ALPA 3KOOA 1T5TA 1NF2A 3QXGA 1EK2A 1T5SA 4UM5A 1ZD3A 1SWVA 2C8LA 3QU2A 1RMQA 5AVTA 2YJ3A 2WFAA 4UMVA 5AVZA 2VKQA 3B8EA 1MH9A 1Z88A 3SD7A 3FZQA 3QNMA 5AW4A 4NAVA 3L8EA 1RLTA 5A3RA 2WM8A 5AIBA 3QLEA 4KX5A 2ZBDA 4FYPA 2WF6A 4J03A 2AMYA 3L0YA 4O8CA 4Y2XA 5ALHA 3U19A 1L8OA 4MUMA 1YMQA 3FPSA 3DAOA 3EWIA 2B8JA 3ESRA 2B1RA 5IT4A 5AESA 4BNDA 2WF9A 2YJ5A 3KBBA 4YIHA 3ZU6A 5AM2A 2YFYA 2P11A 3NANA 5ALGA 4HGNA 4BEWA 5ALOA 3QGMA 2CFRA 4F72A 5AW7A 1QH9A 2IA5A 3WKDA 4G9BA 1LTQA 4DCCA 3WK8A 2Q4RA 2IOHA 1X42A 3UMCA 3AR7A 3ZTYA 5ALYA 2D2VA 4OHFA 1L7OA 3QUBA 3PDWA 3BWVA 1NNLA 3OTQA 1QQ5A 4MWOA 2C88A 1S8OA 4BX3A 1U2TA 4L6AA 5AVWA 4C4RA 2HOQA 1PW5A 4UATA 2ZG6A 5E0OA 5ALJA 1IWOA 3AR6A 2Q4TA 1ZJJA 1U02A 3ESQA 4XE5A 4UMDA 3QYPA 1Z4LA 3ONNA 1F5SA 2HSZA 5AK6A 3D6JA 3AR3A 4UW9A
chains in the Genus database with same CATH superfamily
4YACA 4XIIA 4DIBA 4AZTA 4RZ2A 3WMEA 2ZRLA 3C43A 2OUKA 4HZUB 1GUYA 2DQSA 1Z2PX 1A7UA 2OG1A 1RQ7A 3UFXB 3UM9A 5CEFA 1YU9A 2FN7A 4J75A 4NIMA 4EQZA 1YDWA 4FVTA 1CE8B 4ZCLA 1J8MF 4RCZA 3V9AA 4Z7OB 2QZPA 1L7NA 1GILA 1PL7A 2H17A 1A9ZA 3G0GA 3W5CA 4B6EA 1Y80A 1J6UA 1Z9BA 3EEQA 3WLHA 4N9QA 3DHYA 2GF0A 3ZE6A 1RNLA 3BJRA 3F73A 1W4AA 1KOGA 5FX2A 1GSOA 4I8XA 2IODA 3H99A 2IIPA 1SFRA 3CJRA 2PS9A 2EAUA 1T4DA 2G9UA 1K3TA 1R64A 2ZRAA 2HLDA 3DC7A 3FB1A 3JW8A 2VDVE 4YRFA 2Z2KA 1K5GA 1PGOA 2A0FA 5I4IA 4MV6A 1DS6A 1UP6A 2AEEA 4OSOA 2I9PA 1P3DA 2FUEA 5CB4F 8GPBA 1JJVA 2P8JA 4QSMA 4LMPA 3GLVA 4ALKA 2QTMA 3AUKA 1NT4A 1V8OA 2OZPA 3SHVA 4WZBB 4OU5A 1KMCA 3OU2A 1N2CA 4C04A 1KY5A 1U3DA 1VSBA 1KQGA 3MAAC 5KVCA 5HF5A 2ZRDA 4F1KA 3V6MA 2R85A 5EMKA 1FSPA 3GC6A 2IBSA 4Q4JB 4OK5A 5THQA 3X1WA 3H9JA 2I66A 1L5RA 1L7PA 4IGIA 2OB1A 4LIPD 4NEHB 4PWZA 2W6QA 1QP4A 3ZJVA 1RYNA 3HVIA 2VWHA 2AUNA 2X4LA 3ROQA 2VYCA 4Y9UA 2ECFA 3NEJA 4A36A 2FF5A 2KLBA 4QECA 1QJ4A 3EGXB 2I78A 2ZAYA 3I2GA 2GLXA 4IIEA 1DO8A 3IMEA 3ROZA 5JNVA 2FPWA 4LOHA 4UDYX 3QKWA 3VPHA 2BBTA 5KX5F 3N2GB 3OCYA 5A9RA 4MARA 1X9HA 4TT8A 3ES9A 2UXBB 4I4TF 2BFFB 1JWLA 5H02A 2O2GA 2IEAA 3A6HA 4Q18A 5FCDA 4A27A 1B14A 3JX9A 4L6IA 3QVXA 4PVCA 4NHOA 2RK6A 2VDUE 3I8OA 3SM3A 2EV9A 2Q0XA 1E9DA 3UMMA 1BW9B 1XBTA 2AMVA 2V4ZA 3BCHA 3IPAA 2WAOA 4YO8A 5ITZA 3ISTA 2A9JA 2B34A 3P94A 3OIFA 3L07A 1WCIA 3F6BX 4N82A 1IPHA 1EBUA 4FXPA 1LBTA 1SXHA 1BMQA 4YJDA 3QKRA 1M2OA 3CCCA 4PC6A 4R6XA 1E2UA 5FBHA 1XWWA 1P39A 1QX3A 5EJ6A 3T0GA 4W5TA 1L7DA 2PK3A 2AK3A 2GTPA 5CP8A 3C7DB 3BK7A 3WB0A 1E60A 2LRHA 1FUOA 3M7IA 4QX6A 1N9GB 1FEZA 3PDIB 4N5MA 2Q49A 4XX0B 3CE9A 4DLBA 4YCLA 1PTJA 5ALEA 3BL8A 2BH2A 3WZ2A 3U5TA 3R9KA 1LVHA 2JA2A 1R3DA 3LPMA 1M34E 4F1WA 3GMSA 3INTA 4D43A 2O0HA 4BKPA 1BQEA 1XKTA 5AI8A 5E1OA 3M8KA 3TMYA 1XE3A 1Z3CA 4PWYA 2EKBA 4IJ6A 4FMBB 4NENB 5FUXA 5J5CA 4DA8A 4YJFA 4IPTA 1HC7A 5E6UB 5ERXA 1D4ZA 1ZD1A 3Q9UA 2Z56A 2XF2A 1WVMA 3I5YA 1ZGZA 1QHGA 1EJ6A 1UMDB 1L1RA 2OV4A 4TMZA 4G85A 3CF0A 3SBOA 3R0XA 2B4TO 1PFQA 4GMFA 3KQKA 4BEBA 3G9UA 3RUDA 1A8IA 1JT2A 3HTXA 3NBKA 4CIAA 5A4IS 2NSDA 4MYTA 1NASA 2AGVA 4KGVA 4YJGB 4DV6B 3QXCA 1JHVA 3ZDZB 4M9RA 5EXPA 4GQBA 5SYAA 3COSA 3W3AH 2Q4EA 4H27A 1MH1A 1ZWLA 2K2WA 3FNIA 2IHJA 3E22A 4J1QA 3TM5A 2HCBA 2WWTA 1UWVA 3CLRC 1UK9A 3DTVB 3S8MA 1MZVA 2V3VA 3ACBA 4JUCA 5CH5A 2OAQ1 5IS2A 4HAXA 2A1TR 3HKEA 4OUDA 3OJOA 3GJRA 4UAJA 4CQLB 2ZRKA 2G1PA 1RRFA 3PIDA 4MW4A 4ZYZA 2WJHA 4EHDA 1XDSA 2ZYDA 2QZ4A 2H1WA 1G8FA 1VYVA 3A04A 3UYLA 2Z2JA 2BN4A 4MV3A 1TRHA 3NJ4A 4TV9B 1BVYF 1MGPA 1CVRA 1KVSA 4K5QA 1A9PA 1AU9A 2DFPA 2FEMA 4HCJA 3ESYA 1FX0A 1JHOA 2RDMA 2NUPB 4EW1A 2Y3IA 3N5CA 4EGCB 1NVTA 1SULA 3AG5A 3WYNA 1LCIA 1TJNA 1D1QA 2QUJA 3RB8A 1CP3A 1YGYA 3G0OA 4S2EA 3S55A 4BNIA 3RARA 3DZHA 1SXJD 5TB5A 3ANMA 5IJZA 3CB4A 3F49S 3CISA 1D0VA 3RS5A 3AEYA 1GG5A 1MC8A 3E4CA 3ZU2A 4TWBA 3B20A 3BMNB 3FPGA 3GRAA 4CLRA 2I7DA 3HJGA 1D6JA 5L4LA 2Y2UA 1XTRA 2YHIA 5AWFC 2NUTA 1BE6A 2H7XA 4IG9A 2HMYB 1CZKA 4DE5A 5BOSB 4EKDA 3UA4A 2C98A 1H2YA 2Q7DA 4YP6A 1FMTA 1YNSA 3V7YA 1ORHA 4A1FA 2N75A 2WJAA 4WPGA 2LNDA 4LE2A 4IEEA 3BREA 1WUHS 2PZEA 4E46A 1LSUA 3C7AA 3SIPA 4DBZA 4IFIA 3MRVA 1J20A 3U0VA 3OCCA 2ERCA 3WGJA 1OX6A 4MI3A 1R9NA 1UZAA 2BTOA 2Y71A 5E2IA 4AG5A 4YAJA 3EEBA 4GOMD 1AGXA 2EGGA 4IH4A 4RY9A 4I4CA 4PR0A 1L4EA 4RACA 4ZEXA 4YCMA 3LIIA 3T1TA 1N1GA 2BONA 1FFDA 4M0DA 2ZVPX 4GI2A 4CMEA 4ME6A 3IP7A 5BSVA 5K4AA 2JIMA 3ILHA 1B00A 3BDVA 3QJYA 3GJQA 5KNLA 2CD7A 5J4VA 5ALLA 4DY6A 4MAMA 1MXFA 1TYZA 3CNOA 1E5XA 2ZE5A 1WMDA 1Y34E 4LXGA 1SCUA 3IUNA 1IZ7A 1ZCFA 1EXDA 1N78A 1MGOA 1PR3A 2HF9A 4E5NA 3DLHA 2X9VA 4I55B 2ZSKA 2K6GA 1PP4A 4ZO4A 1JDSA 4D98A 4UJ5A 1P1RA 4H18A 2CV0A 3PEFA 3VZPA 1KAQA 1QH8B 4W1PA 1J25A 1M9NA 1VYTA 2Q5OA 2QRVA 4G5YA 2G1AA 4JR2A 5AW5A 2EKQA 3DVQX 3RUEA 2P2DA 4CKBB 1CDZA 2HBRA 2Q6IA 3I3OA 3ETHA 4I9HA 2QXUA 3PNYA 2C4KA 3AF1A 2FUG1 2G07A 4BN0A 4GSLA 4WZAB 1AO0A 2J6IA 3RFFA 4UD6A 3UJBA 3C3PA 4B44A 3MSXA 1OX4A 3FE2A 4R05A 2Q62A 3GMDA 3W5DA 1O5IA 2PKXA 3C3XA 4ZOCA 4YMIA 3SVTA 3WLTA 2I99A 3HMKA 2GT1A 3CY6A 4AJPA 3P0EA 5T4FA 2CF6A 4IUDS 4PZPA 2FN4A 2VT7A 1JA1A 1OA0A 4PAMA 2AR0A 1Q12A 1FTSA 5EIFA 3DE5X 2W90A 2Z09A 2ZGVA 5KMGB 1GYRA 1IUOA 2G77B 2GXUA 3I53A 2X22A 5IMSA 3WLIA 1JHMA 2PM8A 3PFWO 4FHFA 4N5NA 1EFPB 4O4IF 2WMYA 1MA3A 1CQXA 3DHWC 4FCTA 2ZZKA 3RFUA 1GAJA 1N1DA 1NNUA 2BGMA 1HG0A 3KEGA 4AX4A 4DILA 2K7FA 2VSYA 2C5BA 3GVIA 3KNZA 5BW6B 3USZA 3K7EA 1GO2A 1A88A 3UCEA 1MOPA 1VECA 4MVJM 4EF4A 5FO1A 3K9FC 2BBOA 1E9BA 1XVLA 3B3AA 1PYOA 4MKRA 4OH1A 2W6CX 1PQYA 5ELLA 3UYKA 2C8JA 4C0KA 1QK3A 3FHLA 3V48A 5A04A 1ZH6A 1NM5C 2D2FA 2FPMA 2OBYA 5LMNB 3QELA 2QVYX 1GXSB 2AOTB 1CR4A 2CF5A 2HCFA 1C3LA 4M7OA 3WICA 1JPNA 4DSUA 3K94A 4EUHA 5HOEA 1CJBA 1TU4A 3GFBA 2MINA 4ISCA 2IBTA 3IAFA 2QAIA 2WG2A 3LBAA 1MV5A 1KMMA 3ZVMA 4ZOLB 1HY1A 2WZCA 4MYRA 5DPMA 5K2OA 1DX9A 1RQXA 1Y63A 4FP9A 4QPJC 5GJWC 1GVHA 2REQA 2YXEA 4TXMA 4TUYB 5I9BA 3E3NA 1UDXA 1RHJA 3L0ZA 4TMXA 1XD8A 1NLYA 5ALIA 5FLEX 1U6JA 2O8CB 2IFTA 1JQLB 5JRDS 2O23A 2OO7A 4JEMA 2A5JA 3ZD6A 1EHCA 3UXEA 5C5DA 5BUSA 3GP8A 1L7AA 2YQ5A 1F20A 4WL0A 3KCQA 4Z4IA 2ZJBA 1X1QA 4P7JA 4CMHA 2C7VA 2I4MA 4IHKA 5DN6A 1D2NA 4W8OA 4FLMA 4X1IB 3EGIA 3VZSA 3HO8A 4CUKA 5C8ZA 3HCNA 3IEPA 1Z4MA 5EHGA 4MDEA 3EG9B 1FJGB 1R66A 1KTVA 3PR3A 4ZYVA 2VF8A 5JAOA 1R27A 1W19A 1RRPA 3PUJA 3V8PA 4DLZA 2JLRA 4EYQA 3E9MA 4N12A 4H0FA 2IZOA 3K9HA 3SKYA 3PFFA 1DSSG 4KXVA 1N5LA 1F3LA 1AT1A 2PZ8A 2WJPA 1Y3DE 1MN6A 2X42A 3GLKA 4TS3A 5HIIA 5C81A 5CBPB 2AJ8A 4DYDA 3U3OA 1N32B 3ED1A 4YMUA 2DJIA 3ANNA 2RONA 4OFZA 3AJRA 1HMPA 3W8RA 1BD4A 4JLUA 4E1VA 5TQVA 4OK6A 1P4AA 1WXQA 3LUDA 4WEQA 3ADDA 3B1ZA 5BWCA 1V5GA 1APBA 2IHBA 2J4FA 4C76A 1JHZA 1X7YA 4G37A 3R5HA 2BJHA 4TRMA 4WXRA 3UCXA 3HXPA 1TUIA 3DUFB 3G7SA 3VA7A 3O2NA 3ND5A 4PGFA 1GNTA 4YS6A 5C1DA 3S1SA 3DXYA 1R88A 2HK9A 4O29A 4DQKA 1V0JA 1W93A 2WYVA 2ZYGA 4CDNA 2YYSA 1PX2A 4DCSA 3AKCA 3KVYA 4EG8A 3SEQA 3IQWA 4K9NA 3HLYA 3ID6C 2M6RA 1IN5A 4HAIA 4QNNA 5DT9A 1Q21A 1TUBB 5FHQA 5G0TA 4UXJA 3LKZA 2ZIXA 3IP6A 1Y6FA 3NC1C 2QNRA 1JH9A 1O94A 3MQFA 4JQYA 4MI1A 4C88A 3RREA 2BBSA 4PQFA 1T5SA 4KMOA 2FEWB 2QD4A 1F2TA 2WTBA 5LL6P 1PNTA 1XZMA 1T3GA 1N0HA 2A1IA 2EC5A 3QU2A 4HJRA 4XYMA 2GK6A 3ZCVA 3MGCA 4O0MA 5CT9A 4ZMRA 4DMMA 3KOWA 2BMWA 4LDPA 2XVXA 1JHPA 3LUBA 3ND9A 4ARCA 1NPTO 1XELA 5AW4A 2QGAB 2GBFA 3FKJA 1PNVA 3NTOA 4X85A 3HY4A 4IICA 3C5VA 1S8FA 3AHJA 4RDCA 4CQMD 4QFMA 5DE3A 1QRTA 4KX5A 2E5FA 3DKPA 4FDUA 3TGPA 2P9CA 4OBEA 1EVJA 1J0BA 4W1SA 5H80A 4HDNB 3W78A 1E0AA 3NTVA 5FUWA 4Q19A 5FEMA 3GX1A 3GGOA 4MW1A 2C1EA 3HN7A 3RYHB 2Z2IA 4X60A 4ZKEA 3QEMA 4O8CA 4PBRA 1BCSB 3LY8A 2D1QA 1QAMA 2GEKA 4BRSA 2YICA 7AT1A 4DC9A 1F4PA 4K28A 3ECAA 3RJZA 4MGIR 2LUOA 1K6XA 3EUAA 3IUJA 4MVJF 1WDKA 3KBBA 1N2HA 2ORYA 3KSMA 1IJFA 4XD2A 4J7XA 4ND1A 3ZCSA 2JFQA 5AM2A 3EEYA 3PNSA 5HRAA 1K7SN 3FCUB 3NBZC 4BB9A 4WKPA 4B2YA 4C0SA 5ALGA 5BQ3A 2QYOA 4XCQA 1I7LA 3QKUA 4M60A 4OH7A 2ZDHA 2VFAA 5IAGA 1GL6A 1T5BA 2J0SA 4AW9A 5EIHA 1KRHA 1RIIA 2Q1TA 1Y6RA 1NVEA 2C9ZA 2DC1A 1C29B 2DPYA 2JFHA 4RNDB 1P7PA 1UKAA 2XWQA 1QH9A 4KQCA 3ICPA 3RO7A 3W8FA 3B5EA 4BHTA 2B9EA 4WGGA 3WK8A 4RF4A 5P8WA 3DH0A 3U7IA 2HN9A 3ZV6A 5BR4A 4HKTA 4N0PA 4TYMA 5IKEA 3OOHA 4WFQA 3VDQA 3NFYA 3HP1A 1RXEA 3OM9A 1A9SA 3BL6A 3ZTYA 3Q12A 5DWVA 2OSVA 1MB2A 2FG7C 3MWEA 4ZODA 1WHSB 2DHDA 1NDUA 1I4TD 1ZW6A 3LX6A 2X7HA 5ANRB 2F62A 3TRDA 4MWOA 3VYSB 1S8OA 3CVXA 4IIVA 4L6AA 4I36A 3VC2A 4QT4A 3NNNA 4HFRA 4ZHQF 4C0LA 2QEQA 3DW1X 3FJYA 1GA6A 3K6KA 2C4VA 1PL8A 4J1TC 4OGGA 4RW0A 5CVEA 3WGOA 2EBUA 1NIJA 2R44A 3GOHA 4LHSA 1RJEA 4AN4A 4J16C 4CDRA 1Z4LA 4B73A 4DG8A 1WLYA 1JHRA 3QWFA 4PZLA 3A1WA 3BUSA 2RGXA 1B8UA 1NIPA 4TTAA 5KSWB 2PKWA 3D6JA 4BNDB 1U7ZA 4JI1B 3VZDA 1M73E 2WKWA 3BHMA 1HDOA 3HYNA 4ND8B 4Y6RA 1FRVA 4ZT4A 5FPSA 4HDQB 3VU9B 2O5CA 1Y9AA 4R1QA 4EJSA 4EHIA 5B6PA 2XCTB 5DXJA 3DLAA 1Z6GA 2G9VA 4G5QA 4ARZA 1ZD5A 5F7OA 1KI3A 3ROKA 4KJXA 2MR6A 4G41A 3UJ8A 3ECSA 1BO6A 2QP9X 1W59A 3IQIX 3EOAI 4J9UE 4FZRA 4PHCA 4CNQA 1XO1A 2WVHA 3GFFA 1WABA 1ZEJA 2ON6A 4F1JA 1ZIPA 5JROA 4E11A 3MGGA 2W0SA 1VGRA 2FSGA 1EUCB 3KE9A 3OT4A 1Z6TA 3GT3A 1A4IA 2VCHA 4Q47A 4URWR 1RI4A 4N0QA 5AKHA 1N5MA 1GA1A 5IC5A 1T8UA 2F1JA 1O8CA 3DQPA 3RRFA 4Z1OA 3R9WA 1JNYA 2ZS7A 4ZO6A 2QRMA 3KT8A 1K92A 4EFDA 3KJEA 4K8OA 3K31A 3DT8A 4JBGA 1QFXA 4YLGA 2IDKA 3H1TA 3U3XA 1UBRS 4E4RA 3DEHA 1XXLA 4EENA 4ZYUA 4TS4A 2QM3A 3KB6A 4HNHA 2XVMA 5EERA 4Q4CA 2OE2A 3IDZA 1SOAA 1Q2UA 1QJCA 2AF3C 3DWFA 2QVZX 4HXFB 3S0JA 2O48X 3JWJA 1Q77A 3DVAB 1Z8NA 2WUDA 3N8DA 4LJAA 5K6TA 1O96A 1JAIA 1T2CA 2O50A 8ADHA 1SXJB 5HCIA 3DZIA 4G86A 3QG5A 1NUSA 4GPZA 4MIEA 3SMQA 3U40A 3FWZA 4FDVA 1X1DA 3LL7A 2WKRA 3OM8A 2VHUA 3CW2A 5B6IA 5CB4A 4WK0B 4CQMA 1C1YA 4M1QA 4W82A 4MEJA 3WLSA 2O2EA 5EWJB 5HIJA 4MQLA 1MNAA 1N7JA 1HPLA 3NIWA 3TTUA 1NJFA 1XAGA 4GMGA 4I6EA 2M2IA 5FJIA 4DIDA 1QQAA 4QUKA 4BP8A 4OYYA 3FTDA 1GFZA 3KXKA 3RODA 2R60A 2IH4A 2Q5QA 3W7AA 4N8SA 4ZXPA 1JU4A 4RFVA 5CMLA 5B57C 1RHUA 3SAJA 3ODGA 1NHWA 1U7PA 1H93A 4B3RB 3U31A 3JQQA 4D9MA 4LY6A 1SC6A 1GN8A 1F1BA 1KP3A 3MJFA 3CR3C 4J3NA 2BMVA 4BFLA 4EI2A 1D7OA 4OJNA 3IO5A 1IXRC 1G3QA 1GZDA 1T6ZA 3N05A 3I45A 1C0KA 4X1YB 4UQLA 4LN1A 4Q9JA 4YP9A 2NSYA 3TR6A 4Q9NA 2JLWA 3T95A 4R1LA 1ZWKA 5KX5A 2DHCA 3B2QA 4LJYA 4LV8B 4PNPA 5EUQB 2HDWA 2D0DA 3E5NA 1TI7A 1TJUA 3REOA 1UBLS 4RTOA 1P33A 3LHKA 1AHIA 1NC3A 3KSDO 4JJ8A 4PPYA 4IIJF 4XDGA 4M0PA 1MC4A 1IN4A 4RYLA 4D8UA 3RVJA 2JD1A 1YJAA 3ET4A 4APBA 1ITZA 2R7MA 2W2TA 1S96A 2D1FA 4MS1A 3ZHTA 4X00A 1MC5A 1S2GA 1VYHA 2W6MA 5HILA 3G0CA 3RSQA 4Y1RB 3OFND 3P19A 2NT4A 2MDTA 3GGCA 3ZK8A 4UBKA 4WIAA 5L6LB 4PTLA 2EOAA 2KJQA 4BP1A 1HX7A 3DWIA 1GSHA 2OBLA 4K8RB 3G02A 2P78A 4TTJA 3V4OA 4YBZA 1EGMB 3OKCA 4I1UA 4RK5A 1TZ2A 5DMXA 3VSDA 1BH2A 1OW3B 1U8TA 1XOIA 3NV7A 4IX9A 4LQDA 3N2LA 1GKKA 4OYHA 1IM5A 1QHNA 1N5DA 5EVJA 5I9IA 1G6KA 1X1BA 2KE5A 5LBUA 1G21B 1K7XB 2O2HA 3E35A 4P3KA 4RPCA 1EKXA 4XQ9A 2PKRA 1SU6A 4YJHA 2Z98A 6NULA 3J81A 5FI0B 2O19A 2AN3A 5JNWA 1UK8A 3G5AA 4WNIA 4X44A 1W36D 3K3PA 2R8EA 2BM8A 4Q16A 3DD1A 3CO0S 2O3UA 1CF4A 2IUYA 2JCYA 4MDYA 2QORA 5KTSA 4FGLA 1ZMOA 4XVQA 1VHDA 4R8SA 4U39A 4PNEA 2V7BA 3KPWA 3ZTTA 2WK1A 3T5MA 4FMDF 1HT3A 3TOZA 2IYPA 3U4HA 3PDJA 4DNPA 2EERA 2L17A 4Q1BA 4QOIA 1QYIA 1UXKA 3KKKA 1T2UA 5GZ1A 2B1IA 2ZANA 3EQ7A 3FZYA 4JA2A 4YMSA 3W05A 1OFVA 4HWSA 1OVMA 3GUYA 4HDMA 4PQRA 4UQOA 4B5LA 3U7GA 1GLGA 3A4YA 2P6OA 1PNQA 1UJCA 1X1RA 3O8QA 4ZT2A 3UHFA 4UNRA 3T5DA 5JHHB 1C4XA 2OM2A 1D2CA 2G17A 2WZQA 3C8MA 4QD3A 3UG6A 2FPXA 4TRRA 1UOEA 2NIPA 2B2XA 5FT9A 2O8BB 3P2OA 4LZZA 2BFEB 3VO9A 1NAHA 2J07A 2PD6A 5JS8A 4LEIA 3IDAA 3DDSA 2EBWA 1XRPA 4O2AF 3V7UA 3ETCA 1XZQA 2GRUA 4U6NA 2Q7OE 1WMEA 5AI0A 1RWVA 1LBIA 3CHYA 3OX3A 3K6JA 5DGIA 1NC1A 4EVIA 4JYMA 5EIEA 1JDZA 4E1BA 4XOIA 5FQOA 3ZQJA 2AJBA 4HEA6 4ZALA 4U6SA 1RJGA 4WQMA 1UWLA 3E81A 3RRMA 4E12A 4LMAA 2O2YA 3A9CA 2WM3A 3NEPX 3UHOA 2Q5EA 3SF0A 4ESOA 3AUYA 3EQZA 1JQAA 2G40A 4MV9A 2O8BA 2XUQA 3NGLA 1NY5A 2I4TA 2EZ9A 5HZHA 4HMOA 1ZL2A 2XYVA 5CPFA 1JEEA 4J4BA 3SZMA 5DI3A 2FUNB 3EF0A 4DNXA 4H7KA 1UEIA 2XY4A 3QYJA 4C78A 1TVCA 2GCNA 3GZHA 3VFDA 5C34B 4R2WA 2RG7A 5KO2A 4KIWA 4DEVA 4RZQA 1P2SA 3HUEA 4BAUA 2VVTA 1HO3A 4GE0A 1RWXA 1TJ3A 2OHXA 4UUAA 4D9EA 4XR4A 2YBDA 1LDGA 2W2KA 1E2IA 3GRCA 4ALMA 4BKUA 3NT2A 2BEVA 2O3SA 1LPBB 4HDCA 4LK2A 2R47A 4NP6A 4XJSA 5TQ0B 4Z1MD 4RTMA 4U0JA 2G25A 4NX2A 2QVLA 3ZW8A 5BNFA 1N6HA 1SHTX 1JEAA 2X8LA 5EL0A 5T6BA 2HC9A 2A5GA 4KFRA 2PQ2A 2DERA 4FT2A 3WYFA 2HQSA 2FFAA 1O97C 3FGZA 2GD1O 4Q24A 3WKCA 3H16A 4ZZIA 4M0MA 1W2GA 4TTVA 5KPDA 2Z04A 4PW0A 2WJVA 5AW6A 3A6PC 2FX3A 3TLGA 3CZPA 1KXZA 3MJTA 4EJFA 1JLHA 4TL8A 1PHPA 1YE8A 2OK7A 4RKYA 2EJBA 5CGQB 2H16A 4F4HA 3AJ8A 3N0RA 3C6MA 2OHJA 3AH8A 4LTNA 5FAXA 4DWOA 4EB0A 3N6RA 4XM0A 5KU7A 1CUAA 4NMHA 5F52A 3GLFA 4OQLA 5JSYA 2J3HA 2QI9F 3C7CB 1VLQA 1MX5A 3H7AA 4N0EA 2VSOA 3AVTA 1K27A 4OI2A 3CX4A 3OJEA 3I2JA 2FZCA 1LQ2A 1ML3A 3FVTA 3IHTA 3N2EA 4OHPA 5EXSA 1FRFS 2HV8A 1CJUC 1OAOA 5AI5A 1S2NA 4J91A 1Z0DA 3Q11A 4FFSA 3L6EA 1GL9B 4N7RA 2PZLA 3WLRA 2J0QA 4CM5A 5TEWA 1Z22A 4BY9E 3SQOA 1KJZA 1QGUA 4JB3A 4YMLA 4CEHB 1XF9A 2EZ4A 4ANFA 3ZD7A 3OWXA 3AWDA 5LVAA 2H2WA 1M2GA 2G71A 3EHEA 2B7CA 2WVGA 4F4JA 4LF4B 1TA0A 2I1VB 4YAFA 4AZ3A 5MN4A 2H1VA 2Y77A 4G07A 1I6KA 4B76A 5JDCC 2EHJA 4H08A 2HF2A 1EEHA 2IC5A 3R4CA 3EGVA 3ZE9A 3R7DA 9LDTA 3F6SA 2ZRGA 2BGWA 1ORIA 3ZJUA 1IHXA 1KK2A 2GFIA 4C7MA 3LC0A 4AG6A 2FWJA 1KOFA 1L4FA 1STOA 1RLOA 2I1QA 3HXTA 5G1PA 2VKTA 3ZJ4A 4CW7A 3THYB 4X1KA 3AK4A 3INNA 5KVQA 4EAAA 2EZUA 4OREX 4JXJA 1A4UA 4QRHA 1P4SA 2X8JB 1WSBA 3NC0C 1IBLB 4I4TB 1GN9A 1T4GA 2BJWA 2XNCA 1CRQA 4MVJD 5DBEX 5JSFA 1FFXB 1N92A 1TU3A 4CCYB 3LFTA 3PP8A 4O5AA 4CMCA 4E3ZA 1P7VA 2A0YA 5MDHA 1USVA 2UUOA 5EESA 5C52B 3A58B 3LF1A 2RHRA 3KUKA 4XPZA 2CBGA 1LSSA 2PUWA 3C3JA 3GLRA 4GICA 4GRDA 5FI1B 3KQHA 5K09A 4J1SA 4OJYA 5JVDA 3SQNA 5IJ0A 4UHFA 4WADA 1S5PA 5AT1A 1PN3A 2CNWD 3ENWA 2CNNA 3EZXA 3THSA 2WJGA 3ACCA 1D9ZA 2NYRA 4KEAA 5HSGA 1IUPA 2YZNA 4HADA 1WCWA 1WQ1R 2HWUA 4WFJA 3CJQA 3JXEA 3CNEA 4LZJA 4MJLA 3CEAA 4DRXA 3R6GA 3CXRA 5M04A 1JT9A 2FLWA 4TMVA 5JD5A 2GN6A 5F5XA 1ZONA 4J07A 3BE5A 1BQ3A 3VTZA 3V8RA 2OBFA 4KX3A 2D5BA 2ILTA 1GFSA 1TMOA 2DFKB 4FFBA 2BMEA 4LQLA 2VJBA 5B2FA 5KJFA 3CC8A 2N9UA 3AOEC 4WBSA 5ALMA 1FP4B 5KNDH 2BFOA 1DTSA 1RWOA 1UPAA 3GA5A 3PPIA 1KKLA 2FXIA 1XCJA 3L7CA 3T4PA 4YA6A 4BO8A 5JANA 4PFQA 1SURA 1J2RA 4FZJA 3GL9A 3JAKA 3IJEB 4KRGA 2WDPA 4G4IA 3F5MA 4J7CA 4IR7A 3IDOA 3O8RA 5D51S 1JW9B 1OZ0A 4YRDA 2NTVA 1P2TA 4L1KA 2QROA 3JQ7A 4Z1MA 4RPGA 2C5FA 3IEXA 4UJ3A 4LGVA 5EPOA 3MS4A 4Y2PA 1BMTA 4EEIA 2ECOA 1AUVA 4LC0A 4M9UA 2P9BA 1YZUA 4N8EA 4UBIA 4WZZA 2XB6A 2XHEA 4DG9A 5I48A 2BY4A 3B6IA 3AVVA 4XWGA 1WQ3A 4W7SA 4YUVA 1JXMA 1GR1A 2ZXUA 4UZEA 4X3CA 1WPXA 2E82A 2DH5A 1HQKA 4E13A 3LX4A 5JD3A 1NM5A 2BGRA 3STXA 3DTYA 3A4NA 2M6LA 4DTCA 2XB8A 4MLCA 5ULLA 4OJKA 4BJ5A 5I3CA 4Y9TA 4TM8A 4L0CA 2ACVA 2BKUA 4AULA 4AECA 3G8DA 4HVLA 3B89A 3DFMA 1NLFA 1WD5A 1ZM7A 2Z2YA 4O02B 4ZC1A 4CUZA 2WI8A 3BXZA 3LUKA 3AUFA 3FF4A 4QWMA 16PKA 3BD6A 4DZTA 3L4BC 3DVLA 4IUBS 4LG1A 4UTZA 3UAGA 1JFFB 3GBPA 3GWZA 1WDWB 4IDAA 2P2CA 3CEJA 1LI7A 1X87A 2IVZA 5E2AA 5B58C 5ICCA 3BORA 4UMVA 1KYQA 2PEYA 1KI7A 5EZYF 4RIEA 4K9DA 1G9TA 3FZQA 2LTAA 2YYYA 4Y1FA 4P4NA 1DFIA 1HOTA 3LRPA 4U8HA 3E9NA 5DBGA 2J9FA 2VDOB 3ONEA 2P30A 3JPYA 2ZQZA 2OVBA 2IW1A 2YFHA 2NXJA 3PGKA 3STUA 1N5OX 5KREA 4I3HA 3L0YA 4EARA 2QW8A 5F7JA 2Q1YA 2IYSA 1E32A 1T0UA 2GD2A 3R3XA 4G3XA 4GM0A 4NYIR 4UEWA 4EECA 1GAQA 1KZGB 4DLLA 3B3FA 3DAOA 1RC1A 3F5DA 3OKFA 2VDQB 4UNSA 2WNHA 1WF6A 2R87A 2ZROA 3CUKA 5T5QA 3SDBA 1HQYE 1SEVA 5AO9A 3SXUA 1WE2A 2VYVA 1MTOA 8ATCA 1FXSA 3MS7A 3LWNA 2YWJA 1IXYA 2I67A 1U28C 2I9KA 3UK0A 1GGKA 2PE5A 4KVZA 4IUYA 3DMTC 1THMA 2AMFA 1WMAA 4QBIA 2H0RA 4MVJA 5D7NA 3QLVC 2GWHA 1JEJA 3Q3EA 2IA5A 1KP2A 2REXB 2QRQA 4UM9D 3ZHSA 1IOLA 3CB2A 4QO8A 1UPCA 2JGIA 4TYNA 1GJRA 2V6GA 2X19A 3EWNA 1Y3BE 4O25A 2D2XA 3JQFC 4BL5A 1OAAA 2CC2A 4IVRA 1QZXA 4ATNA 5K8VA 1E1LA 2FW0A 3PXDA 4D74A 1Z5VA 3PQEA 2H4FA 5DNWA 3Q10A 3FFWA 1L7OA 3DTNA 4Z49A 2F9MA 3X0DA 1P77A 4R3WA 1VLJA 3A2NA 5ESWA 1KR2A 1DIRA 1FNNA 4NU5A 1QQ5A 1DFGA 2HB6A 4PLCA 4C4RA 3IO3A 4B6GA 2I3GA 4GKVA 4OLJA 1DAPA 3SQDA 1E1CA 2A84A 2CLOB 3HACA 4R2MA 2H4HA 4ZO8A 4D57A 2GKSA 1IY2A 1XMPA 1DX6A 3E7FA 2UZAA 4QDTA 1Q15A 2B92A 3ZKWA 1AA6A 4ARSA 4YV0A 1FUUA 2CXNA 1JZQA 4JX8A 2QMHA 4KOAA 1ARZA 1RWQA 1E1NA 1R0ZA 4UW9A 3JR3A 2JKYA 1W36B 2CJWB 2OYSA 5GM1A 1NW4A 2WA2A 4X94A 4OBBA 5AKEA 4B4OA 1QPBA 2XE4A 3ILYA 1IB6A 4U5QA 1M1YA 2XBLA 2NWQA 4NYJR 4U7PB 3HEAA 3N0XA 4HGYA 3VBEA 1QZTA 2C3UA 5AHRA 3KQQA 1C3UA 3MIZA 4RHEA 2APJA 1M66A 3IVRA 3HWRA 4OSEA 5EIBD 1RHQA 3G8CA 4ZV7A 5J63A 5T4BA 3T12A 4YCSA 4M83A 5AKLA 1L3CA 1R10A 1MIOA 1TYBE 2DQKA 3B6EA 1X7ZA 1UQUA 4HAZA 3TSOA 3KSAC 3W90A 1OASA 1R1DA 2P62A 4NY1A 2JIBA 2XUAA 3L02A 3V2IA 3HABA 1MPXA 4EGAA 5IEJA 3AI3A 3GZTB 1Z47A 2I1LA 5A4FS 5HRUA 3C3CA 4AJ2A 1CBUA 1XNGA 2QR2A 2IOYA 1R8SA 3IVXA 4NOLA 1BN6A 4URFA 4Z9AA 4MV0A 1PO7A 3QEJA 1QRAA 3PXCX 1MABB 1Q57A 3U4CA 4L5JA 1ZR4A 1XZBA 1EVLA 4O4HF 5CX4A 3ANTA 3RIMA 4NULA 3TINA 4WN9A 3OF2A 4BX8A 5IG2A 4GOKA 5I5GA 2D1YA 1NMQA 2MU1A 1TE2A 4KI7A 4RUKA 4EF5A 1JIIA 2O52A 1UZMA 3E9ZA 1DMRA 1ZISA 4CLOA 2E6KA 4IM7A 5ICSA 3Q7SA 1T1JA 4B2PA 4MO9A 4LZOA 5GIOE 4PAWA 4KYTA 3AUSA 3TX6A 5DSZA 3ZTWA 4M0KA 1IN1A 1F8GA 2OILA 2PTSA 1RWMA 2XWSA 4JX9A 2FPPA 5ALQA 1RRGA 1U0LA 3AY0A 3WL6A 2HSWA 4DB2A 3DEIA 4F3TA 4XGNA 1AZTA 3KOXA 2YY6A 3BE8A 2JLZA 1ZJZA 2XUPA 5IZCC 5JO9A 3HKDA 1K6MA 1UQTA 5LZ5A 2PUJA 1T91A 4PSKA 3EFEA 4ID9A 4F7DA 3H4IA 1JDBB 4G0QA 4J1TA 3WB9A 4LX0A 5A4DA 3ZE7A 3GD5A 1Z63A 2FDXA 4F9GA 1ADBA 1E0DA 1WUIS 2HT6A 2HZBA 1F6BA 2JZCA 5AFSA 2JAXA 3IB3A 4L8YA 3KYDB 4PCLA 1U7UA 1R7RA 2IWRA 3AF2A 2Z6VA 5EJAA 4JR0A 3FUWA 1CD5A 1PSDA 4PHTA 5CT4A 4ZYWA 3OFVA 2A1TS 4QNRA 1G5IA 2QYHA 4Z4HA 3Q1KA 1Y5IA 3CRZA 3GDHA 4I5EA 4CBVA 3V2GA 2XLBA 1UT5A 1X9GA 3WO1A 3DV9A 3PKIA 2PN1A 4U02A 3KLMX 4AJHA 1LPNA 5FXMA 5F9HA 3SQLA 1BG6A 1H2EA 3DLTA 2XIQA 3TK1A 5CDYA 2PUBA 3RAPR 5FQNA 1H42A 3WRWA 1J07A 5I7UA 1WSDA 4XAQA 3H97A 4KFUA 1IONA 2IHTA 3Q15C 4W1RA 4US2R 1C4KA 4L8FA 5FHRA 4ZYXA 1ESZA 1N1EA 1Y6JA 4OJQA 1RZVA 3H2YA 3NUQA 1T8TA 2AEMA 4W4TA 1Y8CA 5AVJA 3OPXA 4AB1A 1XA4A 4OG2A 3X1KA 1ZW1A 4IJMA 1CHDA 3UK6A 5JH7A 1SCKA 1JI0A 3H2IA 2A0UA 1G9XA 5F98A 4QEDA 5JFGA 4PCAA 3PD0A 1W7AA 3MC1A 4OQYA 3GOQA 5DHAA 2NZUG 2XKJE 3QXXA 3TO5A 1DJQA 1B16A 3B8HA 3SXJA 4JJ7A 1PT9A 3UHAA 1Y81A 3VXKA 3WISA 4GS5A 4EEKA 2YIMA 5DCWA 2VDWB 1EUZA 4A23A 2QP3A 2XMCA 4UM7A 3DCYA 3ILXA 1E5TA 2XIJA 1SHJA 3ED5A 3PXXA 4V0ME 2BPOA 2DGDA 5B53A 4WFKA 2WHEA 3KOUA 2OFWA 3EZGA 3NBQA 2PFSA 3BE4A 4G6ZA 4JSTA 5AH0A 3UMRA 3VOBA 2VQSA 4A6EA 4AY3A 4BMCA 1LRKA 1Y7LA 4BNFA 3VJLA 2GHTA 4HB2A 4QTUB 3RRXA 2WSSA 1M1XB 3N7AA 2V6IA 4KXQA 4W5QA 1FQOA 2RHBA 4L2IA 2PO5A 5DASA 1B8PA 1QK4A 3EIFA 1G41A 5AR1A 4YT8A 2R6DA 2II6A 1W49A 3IKLA 1I5EA 2O8NA 4G5SA 2AXNA 2IIBA 2HA3A 4YIKA 1NBME 3QMWA 1UXOA 4US1R 1F6DA 1F9EA 5EJMA 4YECA 3WK5A 3ZOKA 2CNDA 3HQ4O 2RGEA 2O6HA 4BU1A 3OSZA 3PTLA 1IAVA 3ND6A 3UHJA 4D4IA 7ABPA 1QANA 2D3TA 1UPXA 1UM9B 3HBMA 3L04A 2XE8A 1H69A 2YYAA 4MB0A 4H17A 3T7EA 4BVHA 1A8SA 2G72A 2CXOA 2B98A 2I33A 2JJ1A 2PX5A 3N6VA 4GMHA 4Q1CA 5CK5A 5CM8B 4C6SA 5K4HA 1EX7A 2EGUA 2KB0A 2I29A 5KKAA 2AJCA 2NLOA 4P80A 2HGSA 2SNIE 2FUCA 4YHBA 5BSKA 4QOSA 3BCRA 4HDKA 1AUPA 2BE7A 5IH7A 1MORA 1M2VB 3R3VA 3B38A 3KS9A 5CTAA 1G0NA 3JWGA 1VRCA 1MJHA 4EUNA 1JG6A 3S81A 1U9CA 3GA7A 3ZS8A 4D4MA 4O2AA 4YYEA 2WC1A 2X0IA 3ZI7A 4IRXA 1XJQA 3WJ7A 1BDIA 1TTTA 5BQOA 1N6IA 2ZIAA 1VBNA 4KNWA 4Q9AA 3I6BA 1ZRHA 1HRKA 1T15A 4J2HA 4I3GA 3AI7A 1HA3A 3ZD9A 4EOGA 1YH3A 3IE0A 1XSEA 2QUKA 3LX5A 1ODTC 1BIFA 1M8JA 2CHGA 4X1OA 1UIRA 4ZHQB 3HCRA 1CJKC 1TK3A 1YS9A 2AC7A 4UQPA 3EQ9A 1RWBA 2Y27A 1L5KA 4B6PA 3C7KA 4DOMA 3H4TA 3IX7A 1AMNA 5KTRA 1NVXQ 2IYVA 3KPJA 5DN9A 4Y6QA 2R5FA 2X5JO 3UT5A 4D97A 3KTAB 1VL8A 2I6UA 1MEEA 4DR1B 4WKGA 4FDTA 5BR1A 5A3VA 4C20A 1U9IA 3JQ8A 4H7PA 4MKFA 2ZXEA 1V1MA 1C80A 5DISB 2QRHA 3HWWA 3GEHA 1N6NA 2H1HA 3Q5GA 3AINA 4YGYA 3B9QA 4QGSA 4H7JA 1J0EA 2XKAA 4CM7A 4E33A 1N6KA 2A9OA 1GLNA 1Y1RA 3L46A 1P7YA 3OZDA 4RVCA 3JQ9C 4JA0A 4Z8YA 4EVQA 3F2IA 1TDJA 2LD4A 3LK7A 3RFTA 1GL7A 1XQVA 2TMKA 1IE3A 1V8ZA 3JRXA 1Z8FA 1J2JA 3SICE 2R4UA 1EFDN 1H2BA 4M53A 2P6PA 4MPPA 3VR6A 4WK2B 3TTSA 1UC8A 4C7BA 5H8WA 3AFMA 3KKLA 4L5CA 1ODJA 2OY0A 5B1YA 3S2FA 3NORA 3AXSA 1IZYA 2WHXA 2PRIA 1NR1A 3ZV3A 3EG5A 1EVYA 1PS8A 1V6AA 3RG2A 1A3CA 3LPCA 1HQDA 4F3KA 4DYHA 2H1IA 1U0RA 2A30A 3U3KA 4BNLA 2XHZA 1T0JB 2ZYTX 4Z9BA 2C2OA 1U7TA 4AICA 3E4DA 4RAOA 4WH0A 2IH2A 3G2HA 4L50A 1INLA 5JUWA 3HZOA 5CVVA 3T3GA 1JFRA 4JMLA 4N49A 4XYEA 4EBFA 1GD1O 1NQAO 2XUOA 4GFDA 2AR7A 5CM2Z 2ZM5A 3M6FA 3TLCA 2OAGA 2RHCA 4KR6A 7MHTA 2DX7A 3EPJA 2GJ8A 4ENPA 5HJ2A 1V11B 4AUMA 1DV1A 3D5TA 2ET6A 3FYUB 1J5XA 5G0VA 4NBKA 1ZMBA 3C97A 2O3RA 2BDEA 1C7EA 1TKCA 1Z4OA 2B5VA 1YOVB 2ZYVX 3DP7A 5FBKA 2BCGY 4RA9B 1QOQB 4K9MA 4KQHA 4M0UA 5D00A 3VPCA 5HFNA 4PR3A 4BFYA 2IS2A 2PRZA 4GEGA 3FKSD 4EHKA 1VTKA 1N3YA 3O1JC 2VHYA 2W43A 2JH8A 4KKVA 5BUQA 2IPMA 1NG9A 3VKGA 1OPXA 1Q44A 5KNBD 1E3WB 2C42A 4DMCA 3GARA 3GEMA 2DXIA 1D3AA 1WUJS 4ZCMA 5AVVA 1YUMA 1XN1A 2CL5A 3KJQA 1OFUA 1NV8A 3GNQA 4BN5A 4N41A 4MDHA 3UB2A 1XDGA 2VDLB 3RVMA 3VM6A 1ILWA 3GPLA 2FZVA 4UM9B 1PFUA 1QSGA 5KDLA 3RSFA 3QKSA 4JLBA 4Z5XA 1Y6ZA 2Q8NA 3AYXB 5JNUA 2IW3A 2M32A 2OO5C 1W94A 2MMCA 3KJXA 2J6HA 4NJMB 3BMXA 3KE8A 1SHLA 4M55A 1M6VA 1MQ9A 3UAVA 3C98A 1GNLA 3I0NA 3SK0A 4WKBA 1I9CA 3WQSB 3UAYA 4EUSA 2AEJA 1W2WB 4G5FA 1JJBA 4NZMA 4PC3A 4ID3A 5FP0A 2AG5A 4OP3A 3TBKA 3E1GA 4PG6A 3TTWA 3W0LB 4EI8A 3GGSA 5AVUA 4OGFA 4BYGA 2ENUA 1Q92A 4AWAA 5FBRB 2Q5HA 4BGEA 3UXYA 3PWZA 4OVKA 1HT0A 5CT6A 1TFUA 2NM0A 2C7RA 4ZQFA 3FSGD 1BX3A 4WY5A 1T36B 2PS3A 1ZNZA 2XADA 5EMNA 5B7PA 4N76A 1SC3A 3CMMA 5A7GA 2YYZA 4X6UA 1Y1KE 1EE1A 3S27A 1RP7A 1ZVQA 2D1RA 4LVCA 1XD9A 3CNLA 3SEZA 5L51A 1IRXA 5ES4B 3KQOA 4BBJA 1XU4A 4Q3AA 3GUHA 2WE8A 3N53A 3OCEA 3RVSA 2OFOA 4MEAA 3RIGA 2WILA 1L5OA 1WUTA 4MTCA 1M2JA 4NPAA 4EHLA 3VTAA 4IGAA 1SBQA 3I2FA 4OB7A 3SHQA 5JZVA 1XRLA 1NI4B 1Z5ZA 2CYBA 1XA0A 1DQSA 2NSJA 5ERGB 4QGGA 5JDCA 3PTAA 4L95C 4X20B 4MB2A 4C06A 3TZCA 4WSOA 2PPVA 3E04A 1NQTA 3IPLA 4QJ3A 1GYQA 1N0VC 1P1BA 1QGZA 1CEEA 3PC7A 4EB3A 1XJ5A 2J3DA 3NU1A 5ALFA 2GM4A 2OESA 3KEOA 2YJTD 4D3XA 1FRZA 3NYRA 5EWLA 3NDBB 4PYQA 4LF8B 1Y1TA 2WWYA 2PMDA 2Y76A 3U62A 1NQ5A 2O07A 1MKYA 2AXPA 3OZAA 3PEEA 1ELOA 5DHPA 4MXDA 4R68A 5F35A 4HBZA 4RTQA 1SWVA 1P9OA 2NGRA 3AVQA 4HRAA 3QYAA 3I61A 2GEFA 3AUXA 1GXSA 2VEDA 4J0IA 1JSLA 1NLMA 2EJCA 4L75A 5TVKA 4XVUA 2VKQA 2J33A 4MJ7A 4ZPXA 4M3NA 2WR8A 4LVNA 3O93A 1J23A 3F6CA 3BS4A 3PTZA 3B70A 4K3VA 1CNMA 4TLMB 3TEMA 1SUWA 3PC6A 3T7JA 4YRSA 4P5EA 3BGSA 3IOYA 2DPMA 1SUBA 2PXAA 5BWBA 4PM4A 5H82A 1YDHA 2YXLA 2ZSDA 4AMZA 4Q7QA 1U0FA 1U0JA 3LF2A 4B81A 1QFYA 1UJ2A 3D3JA 5DZSA 4XGRA 4X92A 3CV3A 1ZYUA 3DL4A 2ZFUA 3H7IA 4PY2A 2H9IA 3WIBA 1OI3A 4Q9DA 1XKXA 3UJDA 1CR0A 4W5JA 5DF1A 3K20A 3GT7A 4Z86A 3TNDA 3U19A 3FPSA 3V46A 3VBCA 1G59A 2FOLA 3FMFA 3FKSA 4IKEA 2XTNA 1P9NA 3RQSA 1QBGA 3AOEA 6LDHA 5HUHA 4OP1A 4NK4A 4D8TA 4HPJB 4JOSA 3SXPA 2A1UA 1NUHA 3LM8A 3EIUA 3FCEA 1M8PA 4HH1A 3IEVA 4LXHA 3S44A 5BW8A 4S05A 5K3OA 1M0EA 3DV0B 2F3UA 1PZHA 3HRIA 2UAGA 4U7JA 2PZGA 4OI1A 5EMHA 4J29A 2VF5X 1XIVA 4TQAA 1BZYA 5IVKA 1BRTA 3A9RA 4BZPA 5AVKA 3FJOA 4TWIA 1LNQA 2OTCA 1Q1NA 4KBGA 2HA7A 3PPWA 5FLYA 1LTQA 2RBGA 2PMKA 3INRA 1IMJA 4C3OB 2CXHA 4R7ZA 3TQQA 2WIAA 3DMHA 4TLEA 3ZQ4A 3RU9A 3UMCA 4K3UA 4MIKA 2JGNA 5HJ7A 2PH1A 1KO7A 3PDWA 1XAHA 4JP5A 4OMCA 2PUAA 1GHTA 5FUVA 1MNQA 1M2NA 3DVSX 1JHDA 2HK6A 4FR2A 4LJ8A 5IMBA 4WBXC 2FGKA 3GFTA 3K9BA 3U3ZA 4LJLA 1PW5A 3MINB 4UATA 4V3BA 1P4HA 2PKQP 5CDFA 1N2CE 1VC2A 5H83A 5PGMA 5L3SB 2BD0A 2XQKA 1DUVG 3ITNA 3TQRA 2BGIA 1BJRE 4U9UA 421PA 4ZP1A 3A10A 3PHLA 4WINA 3IALA 4R6WA 3TQTA 3L4BA 1JQBA 3WMFA 4V03A 2BF7A 5FUQA 4ZAZA 2NU6B 5DTJA 4C4PA 4E2FA 1AHPA 3I2KA 2FR1A 3RFVA 1Z68A 5JQGB 4DBLC 3DR5A 1WDLA 3G2OA 3L1VA 3P9YA 5HGJA 4DJTA 3VH1A 3ICOA 1ZMXA 1L9KA 4MRPA 2IEGA 5GIPE 3R7LA 4NYIQ 3X1JA 1NMZA 1LJLA 4NPHA 5AW8A 1K88A 1SB9A 1T2NA 4JU8A 4RTPA 3I12A 4YAKA 1JDTA 4HF7A 5IJ9B 1ISPA 5K3BA 2WLSA 1OMOA 4D82A 1FZTA 3IQGX 1BVUA 1QH1A 5BYKA 1SA0B 2QN8A 1BWSA 2OGSA 3PQ6A 4M8LA 2HDOA 4TGLA 2EU8A 3B6JA 4IQGA 4P5DA 3HVKA 4R5HA 5FOTA 2JLVA 4IOMA 1SVLA 2WD7A 2A5FA 2X4GA 3ADBA 1K4MA 3EXHC 4RA6B 4C08A 4U2DA 2CFOA 1AB6A 3SS7X 3V4LA 1Q50A 2AFIE 3JQAA 4F21A 1I7NA 1UMBB 2X3UA 2Z5FA 4GX5A 2ZYIA 4BS9A 3ABIA 3CUSA 1EVIA 1SVUA 4KP7A 1QLJA 2YH2A 1EEXB 3RIHA 1I0IA 4KXXA 3KPYA 2GCOB 4K1XA 2C58A 3QLVA 2PZBA 2QUZA 1X14A 3IAHA 5FYDA 521PA 3SDZA 4ZK2A 1R8YA 5JAPA 2CMFA 3ZK9A 3LY5A 2YMPA 4RABA 3WWCA 2P5YA 2CYAA 3KKEA 4IMJB 3JQFA 3SBEA 1IJKA 1QDUA 4O4HA 1CLEA 4IDDA 1YU6A 4PSCA 3FM9A 3JATB 5F3DA 1D0SA 1R2QA 3TNFA 5FKJA 4TLAA 3HEMA 2GEBA 2RARA 1QIIA 3A9SA 1UC5B 4YY3B 2GNAA 3L6RA 2A3NA 3ONWA 1YQWA 5C80A 3FPEA 4KIJA 1IIBA 3LC2O 4MWTA 3W1WA 5K8LA 1KGDA 2O1XA 2VWQA 4RNCA 4ESVA 3NHLA 3EYWA 2CVFA 2ZWVA 3PUVA 4QBTA 5TV2A 1UBJS 2DQ4A 4DCJA 4U00A 3U44A 3TAXA 3UQYS 2PMEA 5K03A 1C9JA 3PXUA 5ALWA 1XFDA 2CLEB 1HDZA 2EKPA 3K9CA 4ZMSA 3D31A 1FYWA 3KD2A 5K05A 4HNQA 4UUBA 1T8RA 4A8PA 5BV7A 4L02A 3JASA 4FQ5A 5J9FA 4NCNA 3ZD8A 4YR7A 4NYJQ 2WTUA 3GXOA 1YFEA 3UMYA 3FCSB 1C30A 4DQDA 3U1TA 3TVTA 4A26A 3K8YA 1FVXA 4UE2A 3HXQA 5JCZA 2A67A 2KWIA 2B8EA 2JI6A 3GH3A 4MQMA 5MHTA 1SOVA 2V5UA 1ZAKA 3RQIA 1AQ6A 2Q9UA 3PHGA 1ZH4A 1C0LA 3I73A 4N7BA 1Q1AA 1QQ7A 2BFMA 3AETB 3I34X 1OGIA 5LYJF 1W4LA 1GPYA 4L8VA 3FFTA 4MUJA 3FOEC 1SQGA 2WU0A 3NHZA 4GH5A 4CQNA 4DXDA 1G20A 4AUNA 2CK3D 2IPAB 4U2FA 4I14A 5BN5B 1CF2O 1GRQA 2TMGA 2VDMB 4YRKA 2NQ8A 3HCWA 3FRHA 2OOKA 3TRJA 2B78A 2MMGA 2W9XA 2DCMA 2VTEA 3V6LA 4CKEA 2F3RA 3LQ2A 1FNDA 1TU0A 2FSIA 2P3OA 3M6AA 1U2ZA 2HMVA 4MTLA 4UEJA 4X8OA 5TXGA 3RVQA 1HH4A 1O7JA 2GVDC 2R97A 4D79A 2NO6A 3FHTA 5CD9A 1MAHA 1XTIA 1X2BA 2AX4A 1EUCA 4JWKA 1MX1A 1D2GA 4FEGA 1ESEA 1YJ5A 3TAUA 4Z4QA 1Z4QA 1GRCA 3D6AA 4HWOA 4CF6A 1NULA 1P5RA 1PQWA 1DPFA 2P35A 4PGMA 5GY7A 5BXQC 2BGLA 4DKXA 5TIIA 4B4DA 2G6TA 1VDZA 2QNBA 1T24A 4RH0A 1TK2A 4G4SO 3B36A 4QXOA 3LYAA 5AKJA 3Q3IA 4ZU6X 4DPKA 3K70D 3QFRA 4F96A 4YLEA 3CLKA 2V4UA 4OI0A 4A5OA 1OYYA 3HGMA 4MAAA 2X5OA 2QMYA 1G55A 1RJ9B 5FWXA 4E31A 3UK1A 1L6IA 2QMQA 1N5IA 2Y1LA 4QJ4A 3SCZA 2Z57A 1S3IA 4WMLA 5U4QA 1X1SA 2O5VA 4DBVO 1HY0A 1CUGA 1SY7A 2QVGA 2YXDA 4WESB 3MW8A 5D5QA 4Z9XA 2HJHA 4QYIA 3U60B 1GFIA 2LBPA 1Z07A 3OVMA 1BTOA 3WGLA 1QHYA 1VMAA 2HX1A 2WOJA 4RSHA 3WFIA 3QE9Y 5EWJA 3WLOA 1DJLA 1GZSA 1LPSA 1P6UA 2CSUA 2KW5A 3DHEA 1Y48E 1CJVC 2EX1A 2OCGA 2GMWA 3DMNA 1YRYE 1BYUA 4PRYA 4X41A 4DQLA 3ZDCA 2YC2C 4MHTA 5HKAA 1ONSA 1D2RA 4KPFC 3U4DA 2A59A 1LLDA 1KI1A 2BSAA 3O3MB 4HWRA 4Q4HA 3FSJX 1JIQA 4IBOA 4MRAA 3Q0EA 3R5FA 4R1TA 3CI0K 3LJKA 1A7JA 1S7GA 2VHQA 5THXA 1YRBA 4C0HA 5I45A 2CLMB 4S12A 1XTBA 3U9SA 2YWBA 5JMTA 2QXTA 4KWTA 3BIWA 5FTLA 3VR5A 1IY9A 2JFZA 4DYVA 1HY3A 3E15A 5HIMA 4X1YA 3W04A 5TSDA 4CKCA 1G19A 2FSUA 4F71A 4NMXB 3THWB 4XD7D 3S70A 3W2EA 5TGZA 1C7RA 1HFWA 4FYIA 1C4OA 1CY6A 4TZKA 4IDQA 4TVOA 3MZ0A 4WAUA 4E6EA 1G8AA 3DDZX 1T5LA 1WS6A 2OHVA 4UDOA 5D01A 2B83A 5HJEA 1K6JA 3NBUA 3A6GA 4QUAA 2UXDB 4RX1A 1QZ3A 3KX2A 1EP1B 2ZDGA 4QOJA 1N4DA 1PTKA 4BFCA 4IXNA 1AF7A 3LL4A 3DZCA 4CLDA 1GZ7A 3KAPA 5HUJA 1I0ZA 4Y1RA 3PC3A 4Y1GA 2GPYA 1HYBA 2PR2A 3IUMA 5JV5A 2B99A 2KQUA 3MJEA 1I30A 4BRUA 2V5VA 4JUFA 1L4NA 3K73O 3DD5A 4O4JA 4DR2B 2PDAA 1ADCA 1ZQ9A 3FMOB 1YK0A 3SN6A 1FMCA 2JHFA 2OZLB 1JKXA 3EFHA 4IDOA 2FZLA 2R7LA 3M6LA 3JWHA 3QRWA 2YV1A 3D6NB 4FEYA 4IF6A 4QEZA 4DSOA 3VC7A 4TYYA 1NTRA 3EPLA 1DRVA 1KGSA 3G2MA 4RVDA 1A9TA 5CHEA 1MIHA 5GWXA 3V4SA 5ECGC 4EG1A 2D0IA 3OU6A 4IKPA 4ND2A 2FJUA 5BV8A 1KTIA 2C7OA 3NKLA 1XVTA 4LYJA 5JR3A 4Y2RA 4XJTA 4JS0A 3SZGA 3UJ9A 2JPDA 5EPEA 3N2NA 1VL1A 3LTEA 5CNKA 2P4QA 1L4KA 1SOMA 2EFJA 1DG1G 1XYYA 2Q3EA 3AHGA 4OCZA 5KWIA 1FBNA 3L8ZA 1P60A 2EG5A 3VYVA 1XQ1A 5KYXB 4DKJA 1D5CA 3OCVA 1J9EA 4EY4A 1QE5A 3N2KB 4QQ8A 3ZWAA 3ROGA 3E05A 1KHTA 1XLTA 2Z5VA 5COQA 5FLKA 5KB3A 1XKLA 5AW0A 2WQZA 5CURA 4JC4A 1NF3A 1K7FB 3HC7A 1DG9A 1QXSA 2ACKA 4V0NA 3W2IA 4B85A 1RHMA 4JB2A 3MHPA 4R2XA 3PVSA 2VF4X 2VTBB 1E4VA 2R7NA 1RRMA 3A3KA 4Y0VA 5AOCA 3Q3JB 2B69A 4OHUA 1LB1B 5EFOA 3KSBC 1O54A 3RCBA 2WTEA 2JRCA 1ZZGA 4C2TA 5AXAA 2XUJA 4NV1A 4UU8A 1L6RA 2PT7A 3O8OB 3KZCA 5AKZA 5EKUA 2TECE 2AZTA 2VNKA 3AM4A 3LBFA 5CBKA 3PYLA 2E4WA 3AVWA 4RZ3A 2X58A 2O2DA 1SRQA 2Y92A 2IDMA 5FOSA 4NBTA 7GPBA 4EB6A 4X7PA 3GIDA 2X9NA 3DZBA 4S0ZA 5EKDA 1QV9A 2O57A 5B2ZA 3W8NA 4YPVA 1HK7A 3QVGA 4HFMA 821PA 2W8BB 3RM3A 3WAJA 2CVZA 2WWRA 3K0FB 3S2UA 1HBJA 3ZHRA 3GJ0A 3NLLA 3V5NA 2Z83A 2Q3DA 4KW7A 4F3YA 4F2DA 1SC9A 4BO7A 2RI6A 1YSCA 4ZI2A 3KR0A 2ZUTA 1NUAA 4DPLA 3DLIA 4JYPA 5C0OE 1G64A 1HE3A 3IDFA 1DAMA 4J8PA 5LA6B 3ZY2A 4A0GA 5JFOA 3QV1A 2ZS9A 3GFSA 3FYUC 3JRNA 4GYYA 5ALRA 3AUUA 5IARA 1N4AA 5AVYA 1DIOB 3THRA 1SQ0A 2GZSA 3D4IA 4OHXA 1G291 4LYYA 2ZCUA 3FHCB 1QHSA 2O3JA 1F3OA 1FSFA 4FYKA 4HH4A 3TN7A 3UGKA 2JGFA 4ECEA 3VGJA 3I72A 1WIWA 2DKOA 2D5AA 2PA0A 4JL5A 5D87A 4YALA 3NVAA 3UXHA 5ISMA 3RVPA 5LD2B 2X2EA 1P0IA 3HJUA 3HJBA 2GZRA 3E7XA 4FHCA 1JR3D 1Q7TA 3PL1A 3TVYA 1E9RA 4D8XA 2NZXA 2NZYA 1WG8A 4INOA 4MRVA 5DX8A 4D9BA 1N0UA 2VQ3A 1CJSA 2G6BA 2HR1A 3JQ9A 3Q87B 3H2ZA 2OV1A 1Z2CA 5MF6A 4HPXB 2BWJA 5IU6A 4L85A 1L3BA 2GXSA 1QB7A 2R86A 4I46A 1LSOA 3BICA 4Q7MB 1L2TA 4XD7A 5HGXA 5LOVF 1SBTA 1TM4E 3E1KA 3I76A 1AMUA 3X2SA 1XCPA 2AFHE 2B94A 2OP0A 1OOEA 2W6PA 3BRQA 3FVQA 2DUJA 3GF4A 4C4YA 4CLEA 3QVLA 2RB5A 1WOMA 4D8WA 2Y0PA 2H08A 4M49A 4GXTA 4D5EA 2PY6A 3H2SA 4EZEA 3L6UA 1XCMA 4IWNA 3ONFA 1QNLA 4DCGA 4ND4A 4RDIA 3OWHA 3QBJA 4R9VA 1EMDA 4L07A 2ZCJA 1XTPA 3S8YA 1PD1A 4OL9A 3IE1A 3KT3A 2DWCA 2XXAA 1UJ5A 1UK7A 2NTJA 4OFWA 1P45A 2F43B 1C7QA 3N0TA 4MPJA 5HE9A 3RUPA 2PL1A 2PD4A 1CRWG 5HIAA 2VJDA 4DHWA 1XMQB 3G1WA 1QGED 4P92A 5BURA 3F7NA 2IYEA 2BHNA 1VOTA 4Y2HA 4BNYA 5BQXA 4I2NA 1VPEA 2JIPA 1RE5A 4RMIA 2PXCA 1DKLA 2WHPA 2X0JA 1HT1E 5I7RA 2FR8A 5KWEA 3OLCX 1O6GA 2JNWA 2A8YA 1JX6A 5DK4A 1QQ6A 3I37X 1VBFA 2E49A 4EH1A 4XSHA 1HNNA 3MMZA 3C8DA 1SKBA 4PX5A 1Q6YA 4FSHA 4C0AC 1WB9A 1JB9A 2P77A 3DYVA 4CKYA 1S02A 5H4GA 1Y37A 3MAGA 4HNAA 4KRXA 1OA1A 2F90A 4UDNA 5K0BA 1PCXA 2BEUA 2FW9A 4B82A 2BL4A 3V1KA 3ZLBA 1T13A 1GCAA 1XVUA 1GTZA 4H4DA 1K0FA 1FMLA 1ABBA 1TEXA 4DW8A 4B4UA 1UBFA 3IELA 4EZIA 3F5QA 3GNLA 2DG2A 4IQ4A 3DAHA 5G40A 3TCNA 5K8CA 2R62A 3DM9B 2ZSHA 3HA2A 3L1KA 3UUWA 5DLDA 2HO5A 1SCQA 4JCCA 1AKTA 3ZHCA 3GRRA 5EEGA 5HE8A 5TNXA 4WWHA 3PL5A 1U80A 1VKJA 2QPOA 3D6HA 3FIUA 4JITA 2V65A 4EPYA 2MYTA 5KOIA 1FYEA 2OO5A 3TUIC 3AJ9A 4G0OA 4HWKA 3O2SB 1Z88A 3QWAA 4X84A 2ZUVA 1BD3A 4NAVA 3TPFA 1RRKA 5HS4A 2FQYA 4YDRA 2ANBA 1UPUA 4NF2A 1BHSA 4DR7B 4OIMA 2ZBDA 1QG4A 4K9QA 1JDNA 4CQJA 4RV4A 4P86A 2CMDA 1TTQB 1Q0RA 2H65A 2BBWA 3IHWA 4RZIA 4AYWA 3JALA 5TPWA 4YAWA 1O77A 4A0FA 3PE6A 3ABRB 3EY4A 2NW6A 1DPGA 3G8AA 3DGEC 1YQEA 4G36A 2XYRA 4HHEA 1H5NA 4MPDA 1VHQA 3EWIA 2B8JA 3ESRA 4PIVA 1QLHA 1P8AA 3GJTA 2RH8A 4AJKA 3SR3A 1ONOA 3H1AA 1A7AA 2I03A 2WF9A 2DOKA 2CLHB 5JSHA 2JGLA 1WJGA 2H57A 2CUTA 2FW1A 2B7LA 1TQ4A 1LDNA 4N54A 3UWMA 3LE8A 5HMMA 3HDJA 2BC9A 3EUWA 2W00A 5E1MA 2YUTA 2UVQA 3MYRA 3OM1A 4MVYA 1PD0A 1U3UA 4G24A 5F3RA 3A25A 1EWVA 4IMPA 1U3VA 4ZQGA 1TF7A 1KOLA 2F9FA 3IA2A 3WMGA 2BHRA 2VHTA 3C6KA 5DLYA 1NXWA 2Q4RA 1DZ3A 3TLJA 3SQWA 4GGPA 4IOKA 3HBFA 4JJEA 1A9YA 2G76A 3HR4A 4JELA 3EIXA 3QUBA 1GA4A 4MYDA 5ALYA 4H3VA 3BWVA 1ZSVA 3I6ZA 4ZQBA 3RABA 1PJLA 2V9ZA 1NVGA 1FFAA 1OC4A 2IHZA 2IHKA 3G5MA 1JB1A 1SELA 2I4OA 2HOQA 2XKKA 1PL0A 1G4UR 1EA5A 5ALJA 4URHA 3E9DA 3AMVA 3SG0A 3EY9A 3C7TA 1G5QA 4PINA 4PZCA 4AK9A 5C1BA 4GYWA 4GQIA 1EFVB 2ZJ4A 4RPKA 5D5HA 3QA3E 4RK0A 3W3AD 1I7DA 1PJ8A 5JAHA 2RAFA 4ZTUB 1K7WA 4MLPA 4O63O 3AY7A 1M76A 2QTCA 4Y6SA 1F0KA 2RBKA 3I8XA 5G0WA 1P9WA 3C85A 3NONA 4HQNA 1JEYA 2Z95A 2H0QA 5FWYB 3S68A 2GAOA 3IOEA 3O0DA 4LC1A 4WNCA 1OXVA 3P5BA 1EVKA 1CCWA 2AR9A 2C97A 4FCCA 4R9NA 4HLUC 4M1SA 4Z0PA 3RUCA 3WK7A 2JLAA 4DG5A 4LJ7A 2V45A 3CNHA 2HU5A 3EXG2 3G13A 3DBRB 4DLKA 3WRXA 1QP7A 1Y8AA 4ENVA 1FY2A 2VXCA 1OR8A 1UC9A 1VCMA 3WMRA 3GVXA 4BWFB 1XRNA 1Z6AA 3O31A 3M4XA 4KUEA 3JVEA 1ILEA 4YFYA 2IU4A 3MWGA 2HT1A 2GZ3A 5KOHB 3GJ5A 4Y67A 3TTYA 3TLBA 3DF7A 1M34A 5J2UF 1ZM9A 2OGWA 3UBMA 3DOUA 4B7AA 3I9JA 4FI3F 5K0LA 3JQPA 4A92A 4UCQA 3CLVA 4M2LA 1H8ED 1O87A 4KR9A 5BSTA 4CG2A 3ZQ6A 1XK6A 4DDMA 2X9GA 4XWTA 2HIAA 4DHEA 2F1HA 4FMCF 3C6BA 1JKFA 3LCUA 5K0NA 4JEUA 3LLUA 1SVSA 3OP1A 3KZKA 3INGA 2HD4A 1U2QA 4LNUB 4MKZA 2WVAA 3NDPA 5DGTA 4V1CI 5EP2A 1IBCA 4M4SA 4WN3A 5JBNA 5K7SA 4M21A 2RGNC 3QEKA 1XVIA 2VQ6A 1DVRA 4WJLA 4XFJA 1KPIA 3VSEA 5GVSA 1BVHA 2A7XA 1ZK3A 2R25B 3VRHA 2VXBA 2JD2A 1AKUA 2XQVA 4MQ5A 6CHYA 1YCDA 4Q0MA 3P2KA 3WB2A 4KQXA 3M6UA 2C5GA 4C0BA 4ZREA 4X91A 3DOCA 3QBDA 3R6LA 1T9CA 1UDBA 2PGOA 3C16C 3EDRA 1P2VA 4AYXA 4BE7B 4K2AA 5SY6A 5DM2A 3WSVA 5JPCA 4BFUA 3MWKA 1E77A 1KF0A 4RFLA 1K66A 2GB4A 3UPDA 2VG8A 2WJWA 3HKCA 3LZ6A 3LIPA 1I4WA 1R6XA 1XNHA 3O75A 5I9MA 3ZH2A 5JT1A 2J3LA 4MCAA 1VCIA 4BU0A 1H65A 1MA0A 2VLBA 1JIKA 3F46A 3OA2A 1RSZA 5JY1A 4EITA 2JKZA 2DUMA 3P26A 4BLWA 1AKRA 2N1MA 2BRUA 1V2GA 2QG4A 4J0JA 4WFIA 1D8AA 3T7KA 2HTFA 1JGTA 3ABSB 3DP9A 3LPDA 1H94A 1VIDA 4EZBA 4MVJP 3D7KA 2G70A 1V96A 1ISFA 2C04A 1HL3A 3FF1A 5FF9A 1LDBA 1RE1A 5ED0A 3LY7A 10MHA 4FW8A 5F1KA 1WXDA 3WTBA 3JQEA 1J24A 4E5PA 4B83A 3J7AC 2DHEA 2IEDA 4LA4A 3NXKA 5CH3A 4MGHA 2P2GA 1R3UA 1CZNA 2AI2A 1Z4KA 5IFLA 4HAOA 3UMSA 3EXHA 3KVRA 4B3TB 2ZS8A 3L4SO 3RS7A 1W52X 4KITB 4P0QB 3QK7A 2CL6X 2PTQA 1A69A 2WSIA 4KI0A 4MGEA 1YS7A 1EVEA 1KQNA 4BP9A 4KV9A 1NZDA 1C9MA 1OGJA 2A5DA 3OI7A 3V4PB 1IVSA 3HXOA 3K4PA 3COWA 2HHJA 5DWDA 4DANA 3GGGA 2YZMA 2BI4A 4WT7A 3FAKA 1YCGA 4MJXA 5HRCA 4WTOA 3E2PA 3OP4A 5FL7A 3L79A 1KR5A 3IULA 5GONB 1FLNA 2PT9A 4MUBA 3RHZA 1SVNA 4DMHA 1KI6B 3U61B 3NCHA 1TCBA 1E9VA 3GLHB 3QUAA 1X8JA 2OG2A 5JSZA 4E22A 1IHDA 2E4ZA 1LW7A 4NOKA 3F3YA 4X45A 1QV7A 5LSAA 3S29A 2FPKA 3R7WB 1PU2A 4M1EA 4OGWA 3VR2A 3FCYA 3EZ2A 4KXMA 1Y7HA 4X71A 3AJDA 4LBVA 1F8UA 3RT1A 1ZM2A 3WE7A 2HA5A 3JD1A 4Z51A 1E89A 3DDCA 2ECPA 4ETMA 4AUKA 2JC3A 4D45A 4GAEA 3ELWA 4H4EA 3QFHA 4KZPA 4N5IX 4NJEB 5TPZA 2Z43A 4A10A 3LT1A 2ALJA 4B8ZA 4CMIA 4E2ZA 1KJIA 3R0VA 4P53A 1IHYA 5HP4A 1QP8A 2D2EA 2JFGA 2HK7A 3L9XA 3LVQE 3MBKA 2GZDA 5A5EA 4HWGA 4S35A 1MO2A 1Y8QB 1T5DX 5A02A 2HWYA 3M70A 2ZSJA 1MQSA 4QDZA 2G1JA 3AF4A 3TSAA 5D1HA 4O3MA 1DIHA 3MS2A 2JK1A 1QCYA 3PLNA 4P38A 2AJLI 5C9ZA 3BZWA 3AP2A 3SJBA 2RG1A 1RPTA 2V5AA 3LQRA 5SZHB 4DLUA 5B55A 5HNKA 4NLEA 2BFCA 5CA1F 4TYPA 3W5SA 3EXEA 4YPOA 4YJ2B 1LW6E 4X6YA 4D9CA 1KRWA 4BC0A 1XI2A 2X3FA 3JS5A 5DW3A 4IJUA 5A6SA 5E7IA 4FE4A 3EDQA 1USIA 2YR0A 4DDTA 1UKBA 2B5OA 3ZHQA 5DHUA 2CHUA 2QRLA 5ALTA 4RXMA 2P6RA 3GEIA 1GTJ1 3CCFA 3HRHA 4RTSA 1XYVA 3BIXA 3FRIA 3M2PA 4H6VA 5JS2A 1RZRD 2ZUEA 4F8YA 1J00A 4MHOA 3I9LA 5KYUA 1AMOA 2RAUA 4AX8A 1RAAA 2CLLB 4UE6A 1KU0A 3L0OA 2V7UA 3URMA 3IYLW 3S2SA 4A0QA 3EUFA 2PX4A 4L73A 4JBHA 1K63A 4BNXA 4RIFA 1KVQA 1C1HA 3K1TA 4M9XA 5T4HA 4BNMA 1QYDA 4ZD6A 1GPUA 1PF7E 2ZBEA 1EE9A 3O2QB 5JFTA 4PAQA 4ZT3A 1UBCA 3TMKA 4FKZA 1ECGA 1V9LA 2R8BA 3ZWCA 3JARA 2FMUA 1YFZA 2ES4A 1DARA 2GNPA 3JCZA 3OC6A 3OZBA 1HE2A 5A5VA 4PFKA 4RD3A 4BAGA 1M8GA 2HI0A 3AUJB 1KFBB 3REQB 2VDWA 4OHCA 4KK4A 5BWLA 2E18A 5CAEB 4DA0A 3AB3A 4B32A 1SG6A 1HETA 3DBHB 1HZJA 1HV8A 3T5PA 2XOKD 2XZPA 4MSUA 4ADSG 5LZ9A 4ZOBA 5I8PA 3A2MA 1P0CA 1MMFB 3ZWQA 3PC4A 1KNXA 5JJBA 1YS6A 1I6WA 2PAAA 4U2GA 3S3TA 3UJHA 4YUWA 4AKGA 1U8ZA 4UDXX 4D44A 1ESCA 2YMLA 4HPWA 2OV6A 1HGXA 3O74A 3H5WA 2QTBA 3NHWA 2UUBB 2QV0A 2CDRA 4OJMX 4E1AA 1BJKA 3CLUD 4JSYA 4B71A 5KYWA 1X8KA 4MV1A 2ZJ3A 4OA8A 1WU7A 1Z25A 4RHUA 3DBLB 1QAOA 3ZDFA 4CMAA 1YB7A 3C5CA 3DZFA 4NE7A 3PHBE 4J0EA 4MYSA 1E4EB 1IBKB 3JVIA 2O8EA 5C5CA 4OF4A 4B3CA 1UM9A 1VG1A 3HGQA 4HDRB 5F2EA 4F6CA 1WMFA 1T35A 1K7EB 3C87A 3D8TA 3R1IA 2XAAA 4H60A 2FWPA 4ZO9A 5J47A 1SN7A 1XG5A 4J0HA 1XWIA 1BX1A 1ND6A 4PRLA 2ZTLA 4CEJA 3PNBA 1CETA 1Y42X 2DRIA 2PPLA 4JUDX 1I2CA 1HKUA 1NONA 2H5IA 3I58A 4KDCA 1MJGM 3RJ5A 1K06A 3V2UA 4CPDA 4DLWA 3OCZA 3IBFA 2ZRMA 1OXSC 2Z6QA 5JXWA 1R0RE 2ZIWB 3INYA 2Y0CA 5CLIA 1K9SA 3GG9A 2WMDA 3OFSA 4ZAXA 3RUIA 3G1UA 3SDSA 4DC0A 3TI9A 5EJ4A 1XZHA 2YWHA 5HG0A 5DTIA 3COJA 3RC8A 2GN4A 1D1SA 2XSZD 1ENZA 3F1KA 4GZLA 4LY0A 3TZKA 1ZK4A 2NU7A 4C05A 2Q3HA 1SKMA 4XGKA 1PT8A 3SS9X 4B31A 3CRMA 3U7HB 4JZKA 4L4RA 1OHHA 1CVLA 3DMGA 4BMOB 4KU4A 3TB4A 5J4HA 2C4TA 4R71A 4MVJH 1B4DA 1FP6A 5JE8A 3WWZA 3U48A 3PYXA 3AW8A 3WZMA 3SBXA 4WI1A 1ZS9A 1VLHA 4A82A 4OXRA 5ICFA 2REOA 1J0DA 1CQIB 2GSWA 1V45E 3FLEA 2Q5JA 4NATA 4QTTB 4F6RB 2GILA 3MWDB 1J22A 4PSUA 5LD2C 3PEVA 1JNXX 1RWNA 3NQ41 1KA9H 1VDMA 2F2TA 3PRYA 4GBJA 4QUBA 1KDVA 4COKA 3C6QA 2X75A 1SBNE 1UT6A 1IULA 4G65A 3QPCA 3SSOA 3TLAA 3MTAA 2J0VA 3GLIE 1KBOA 1TLLA 4DDVA 2Q0SA 3U3MA 5BSGA 1BROA 3OTIA 1JE1A 1L7VC 2YTZA 2W4MA 3F4SA 2JFBA 3V32A 3V4FA 3R5SA 3CS3A 1JKJB 5CX1A 2VP6A 4ZJZA 3HJTA 4X8LA 4I50F 4BP3A 1RJFA 3CPSA 4I1YA 4QO7A 1UBHS 5LYJB 3S40A 4V2UA 5SY4A 4EABA 1NVBA 1LS6A 4UMFA 1IBMB 1EM8A 3EVZA 3MGAA 4H31A 1NVDA 1UMCB 5H16A 3WGVA 2I6FA 4G97A 4EPVA 3IEIA 4CM1A 4M0FA 4ESHA 1RI3A 3DFKA 3CLSC 4R2LA 3QBVA 5D6OA