2PTQA

Crystal structure of escherichia coli adenylosuccinate lyase mutant h171n with bound amp and fumarate
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
459
structure length
459
Chain Sequence
MELSSLTAVSPVDGRYGDKVSALRGIFSEYGLLKFRVQVEVRWLQKLAAHAAIKEVPAFAADAIGYLDAIVASFSEEDAARIKTIERTTNHDVKAVEYFLKEKVAEIPELHAVSEFIHFACTSEDINNLSHALMLKTARDEVILPYWRQLIDGLKDLAVQYRDIPLLSRTNGQPATPSTIGKEMANVAYRMERQYRQLNQVEILGKINGAVGNYNAHIAAYPEVDWHQFSEEFVTSLGIQWNPYTTQIEPHDYIAELFDCVARFNTILIDFDRDVWGYIALNHFKQKTIAGEIGSSTMPHKVNPIDFENSEGNLGLSNAVLQHLASKLPVSRWQRDLTDSTVLRNLGVGIGYALIAYQSTLKGVSKLEVNRDHLLDELDHNWEVLAEPIQTVMRRYGIEKPYEKLKELTRGKRVDAEGMKQFIDGLALPEEEKARLKAMTPANYIGRAITMVDELKHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate and Product Complexes of Escherichia coli Adenylosuccinate Lyase Provide New Insights into the Enzymatic Mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Adenylosuccinate lyase
total genus 179
structure length 459
sequence length 459
chains with identical sequence B
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF08328 ASL_C Adenylosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 2ptqA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 2ptqA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 2ptqA02
1FURA 1U15A 1FUOA 2O7BA 4C6GA 1TJVA 1C3CA 1EB4A 3RD8A 5EYTA 4BABA 3BHGA 3OCEA 1JSWA 1J3UA 1FUQA 1T6JA 1FUPA 4CQ5A 1HY0A 2PFMA 1TJUA 1B8FA 2O7DA 4EFCA 3KDYA 3RRPA 1U16A 1C3UA 1GK3A 3KDZA 1YFEA 2J91A 4V2QA 3R6YA 3GTDA 2VD6A 2QVEA 3R6QA 1Q5NA 2X75A 3GZHA 1VDKA 2NYNA 4EEIA 1I0AA 3NZ4A 2O7EA 1K7WA 4HGVA 1W27A 5F91A 2PTRA 1DOFA 4NSLA 3C8TA 1AUWA 3R6VA 3QBPA 2QGAB 2OHYA 4ADMA 2RJSA 5HW2A 1XWOA 3CZOA 1GK2A 2YIIA 1GKJA 2O6YA 2O7FA 1TJ7A 4NLEA 1KQ7A 1K62A 4C5SA 3TV2A 2FUSA 1RE5A 3NO9A 1DCNA 4FFXA 2E9FA 1HY1A 4V2RA 5EYVA 5F92A 4ADLA 4C5UA 2O78A 1T6PA 3E04A 1YFMA 2PTQA 2HVGA 3OCFA 4FLCA 2RJRA 1Y2MA 4C5RA 2NYFA 3UNVA 2PTSA 1GKMA 4BAAA 5D6BA 1TJWA 4APAA 4MX2A 1YISA 4APBA
chains in the Genus database with same CATH superfamily
1FURA 1Z4QA 1XMDA 1Z4LA 4YIHA 5M0IA 1U15A 1FUOA 2O7BA 4C6GA 1TJVA 4IQJM 1C3CA 1XLYA 2FENA 1EB4A 3BWVA 3RD8A 4A15A 5EYTA 5H8WA 1Z4KA 4BABA 3BHGA 3OCEA 1JSWA 1J3UA 1FUQA 2VL7A 1T6JA 1FUPA 3U13A 3CRVA 4CQ5A 1HY0A 2PFMA 1TJUA 1B8FA 3CI0K 2O7DA 4EFCA 1Z4MA 3KDYA 3RRPA 3U19A 1U16A 5M0JA 4MWOA 1C3UA 1GK3A 3KDZA 1YFEA 2J91A 4V2QA 3R6YA 3GTDA 2VD6A 1XMCA 2QVEA 3R6QA 1Q5NA 2X75A 3GZHA 1VDKA 2D28C 2NYNA 4EEIA 1I0AA 3NZ4A 2O7EA 4WNLA 4NFLA 2D27A 1K7WA 4HGVA 1W27A 1XL8A 5F91A 2RCNA 2PTRA 1DOFA 4NSLA 3C8TA 1AUWA 3R6VA 4MUMA 4E88A 3QBPA 2QGAB 2OHYA 4ADMA 2RJSA 5HW2A 1XWOA 3CZOA 1GK2A 2YIIA 1GKJA 2O6YA 2O7FA 1TJ7A 1U0LA 1KQ7A 1Z4IA 4NLEA 4L6AA 1MH9A 2JARA 1K62A 4C5SA 3TV2A 2FUSA 2JAOA 1RE5A 3NO9A 1DCNA 4FFXA 1Q91A 2E9FA 1HY1A 4V2RA 4L57A 3F4SA 1Z4PX 5EYVA 2FELA 5F92A 2JAWA 4ADLA 4C5UA 2O78A 1T6PA 3CRW1 3E04A 1YFMA 2I7DA 2PTQA 2YV5A 2HVGA 3OCFA 4FLCA 2JAUA 3F4RA 4YIKA 2RJRA 1Y2MA 2VSFA 1Q92A 1Z4JA 4C5RA 2NYFA 3UNVA 2PTSA 1GKMA 1T9HA 4BAAA 5D6BA 1TJWA 4L6CA 4APAA 4MX2A 1YISA 1XL7A 3F4TA 1IW7D 4APBA
chains in the Genus database with same CATH topology
1FURA 1U15A 1FUOA 2O7BA 4C6GA 1TJVA 1C3CA 1EB4A 3RD8A 5EYTA 4BABA 3BHGA 3OCEA 1JSWA 1J3UA 1FUQA 1T6JA 1FUPA 4CQ5A 1HY0A 2PFMA 1TJUA 1B8FA 2O7DA 4EFCA 3KDYA 3RRPA 1U16A 1C3UA 1GK3A 3KDZA 1YFEA 2J91A 4V2QA 3R6YA 3GTDA 2VD6A 2QVEA 3R6QA 1Q5NA 2X75A 3GZHA 1VDKA 2NYNA 4EEIA 1I0AA 3NZ4A 2O7EA 1K7WA 4HGVA 1W27A 5F91A 2PTRA 1DOFA 4NSLA 3C8TA 1AUWA 3R6VA 3QBPA 2QGAB 2OHYA 4ADMA 2RJSA 5HW2A 1XWOA 3CZOA 1GK2A 2YIIA 1GKJA 2O6YA 2O7FA 1TJ7A 4NLEA 1KQ7A 1K62A 4C5SA 3TV2A 2FUSA 1RE5A 3NO9A 1DCNA 4FFXA 2E9FA 1HY1A 4V2RA 5EYVA 5F92A 4ADLA 4C5UA 2O78A 1T6PA 3E04A 1YFMA 2PTQA 2HVGA 3OCFA 4FLCA 2RJRA 1Y2MA 4C5RA 2NYFA 3UNVA 2PTSA 1GKMA 4BAAA 5D6BA 1TJWA 4APAA 4MX2A 1YISA 4APBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FUR A;  1U15 A;  1FUO A;  2O7B A;  4C6G A;  1TJV A;  1C3C A;  1EB4 A;  3RD8 A;  5EYT A;  4BAB A;  3BHG A;  3OCE A;  1JSW A;  1J3U A;  1FUQ A;  1T6J A;  1FUP A;  4CQ5 A;  1HY0 A;  2PFM A;  1TJU A;  1B8F A;  2O7D A;  4EFC A;  3KDY A;  3RRP A;  1U16 A;  1C3U A;  1GK3 A;  3KDZ A;  1YFE A;  2J91 A;  4V2Q A;  3R6Y A;  3GTD A;  2VD6 A;  2QVE A;  3R6Q A;  1Q5N A;  2X75 A;  3GZH A;  1VDK A;  2NYN A;  4EEI A;  1I0A A;  3NZ4 A;  2O7E A;  1K7W A;  4HGV A;  1W27 A;  5F91 A;  2PTR A;  1DOF A;  4NSL A;  3C8T A;  1AUW A;  3R6V A;  3QBP A;  2QGA B;  2OHY A;  4ADM A;  2RJS A;  5HW2 A;  1XWO A;  3CZO A;  1GK2 A;  2YII A;  1GKJ A;  2O6Y A;  2O7F A;  1TJ7 A;  4NLE A;  1KQ7 A;  1K62 A;  4C5S A;  3TV2 A;  2FUS A;  1RE5 A;  3NO9 A;  1DCN A;  4FFX A;  2E9F A;  1HY1 A;  4V2R A;  5EYV A;  5F92 A;  4ADL A;  4C5U A;  2O78 A;  1T6P A;  3E04 A;  1YFM A;  2PTQ A;  2HVG A;  3OCF A;  4FLC A;  2RJR A;  1Y2M A;  4C5R A;  2NYF A;  3UNV A;  2PTS A;  1GKM A;  4BAA A;  5D6B A;  1TJW A;  4APA A;  4MX2 A;  1YIS A;  4APB A; 
#chains in the Genus database with same CATH topology
 1FUR A;  1Z4Q A;  1XMD A;  1Z4L A;  4YIH A;  5M0I A;  1U15 A;  1FUO A;  2O7B A;  4C6G A;  1TJV A;  4IQJ M;  1C3C A;  1XLY A;  2FEN A;  1EB4 A;  3BWV A;  3RD8 A;  4A15 A;  5EYT A;  5H8W A;  1Z4K A;  4BAB A;  3BHG A;  3OCE A;  1JSW A;  1J3U A;  1FUQ A;  2VL7 A;  1T6J A;  1FUP A;  3U13 A;  3CRV A;  4CQ5 A;  1HY0 A;  2PFM A;  1TJU A;  1B8F A;  3CI0 K;  2O7D A;  4EFC A;  1Z4M A;  3KDY A;  3RRP A;  3U19 A;  1U16 A;  5M0J A;  4MWO A;  1C3U A;  1GK3 A;  3KDZ A;  1YFE A;  2J91 A;  4V2Q A;  3R6Y A;  3GTD A;  2VD6 A;  1XMC A;  2QVE A;  3R6Q A;  1Q5N A;  2X75 A;  3GZH A;  1VDK A;  2D28 C;  2NYN A;  4EEI A;  1I0A A;  3NZ4 A;  2O7E A;  4WNL A;  4NFL A;  2D27 A;  1K7W A;  4HGV A;  1W27 A;  1XL8 A;  5F91 A;  2RCN A;  2PTR A;  1DOF A;  4NSL A;  3C8T A;  1AUW A;  3R6V A;  4MUM A;  4E88 A;  3QBP A;  2QGA B;  2OHY A;  4ADM A;  2RJS A;  5HW2 A;  1XWO A;  3CZO A;  1GK2 A;  2YII A;  1GKJ A;  2O6Y A;  2O7F A;  1TJ7 A;  1U0L A;  1KQ7 A;  1Z4I A;  4NLE A;  4L6A A;  1MH9 A;  2JAR A;  1K62 A;  4C5S A;  3TV2 A;  2FUS A;  2JAO A;  1RE5 A;  3NO9 A;  1DCN A;  4FFX A;  1Q91 A;  2E9F A;  1HY1 A;  4V2R A;  4L57 A;  3F4S A;  1Z4P X;  5EYV A;  2FEL A;  5F92 A;  2JAW A;  4ADL A;  4C5U A;  2O78 A;  1T6P A;  3CRW 1;  3E04 A;  1YFM A;  2I7D A;  2PTQ A;  2YV5 A;  2HVG A;  3OCF A;  4FLC A;  2JAU A;  3F4R A;  4YIK A;  2RJR A;  1Y2M A;  2VSF A;  1Q92 A;  1Z4J A;  4C5R A;  2NYF A;  3UNV A;  2PTS A;  1GKM A;  1T9H A;  4BAA A;  5D6B A;  1TJW A;  4L6C A;  4APA A;  4MX2 A;  1YIS A;  1XL7 A;  3F4T A;  1IW7 D;  4APB A; 
#chains in the Genus database with same CATH homology
 1FUR A;  1U15 A;  1FUO A;  2O7B A;  4C6G A;  1TJV A;  1C3C A;  1EB4 A;  3RD8 A;  5EYT A;  4BAB A;  3BHG A;  3OCE A;  1JSW A;  1J3U A;  1FUQ A;  1T6J A;  1FUP A;  4CQ5 A;  1HY0 A;  2PFM A;  1TJU A;  1B8F A;  2O7D A;  4EFC A;  3KDY A;  3RRP A;  1U16 A;  1C3U A;  1GK3 A;  3KDZ A;  1YFE A;  2J91 A;  4V2Q A;  3R6Y A;  3GTD A;  2VD6 A;  2QVE A;  3R6Q A;  1Q5N A;  2X75 A;  3GZH A;  1VDK A;  2NYN A;  4EEI A;  1I0A A;  3NZ4 A;  2O7E A;  1K7W A;  4HGV A;  1W27 A;  5F91 A;  2PTR A;  1DOF A;  4NSL A;  3C8T A;  1AUW A;  3R6V A;  3QBP A;  2QGA B;  2OHY A;  4ADM A;  2RJS A;  5HW2 A;  1XWO A;  3CZO A;  1GK2 A;  2YII A;  1GKJ A;  2O6Y A;  2O7F A;  1TJ7 A;  4NLE A;  1KQ7 A;  1K62 A;  4C5S A;  3TV2 A;  2FUS A;  1RE5 A;  3NO9 A;  1DCN A;  4FFX A;  2E9F A;  1HY1 A;  4V2R A;  5EYV A;  5F92 A;  4ADL A;  4C5U A;  2O78 A;  1T6P A;  3E04 A;  1YFM A;  2PTQ A;  2HVG A;  3OCF A;  4FLC A;  2RJR A;  1Y2M A;  4C5R A;  2NYF A;  3UNV A;  2PTS A;  1GKM A;  4BAA A;  5D6B A;  1TJW A;  4APA A;  4MX2 A;  1YIS A;  4APB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...