2PTQA

Crystal structure of escherichia coli adenylosuccinate lyase mutant h171n with bound amp and fumarate
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
459
structure length
459
Chain Sequence
MELSSLTAVSPVDGRYGDKVSALRGIFSEYGLLKFRVQVEVRWLQKLAAHAAIKEVPAFAADAIGYLDAIVASFSEEDAARIKTIERTTNHDVKAVEYFLKEKVAEIPELHAVSEFIHFACTSEDINNLSHALMLKTARDEVILPYWRQLIDGLKDLAVQYRDIPLLSRTNGQPATPSTIGKEMANVAYRMERQYRQLNQVEILGKINGAVGNYNAHIAAYPEVDWHQFSEEFVTSLGIQWNPYTTQIEPHDYIAELFDCVARFNTILIDFDRDVWGYIALNHFKQKTIAGEIGSSTMPHKVNPIDFENSEGNLGLSNAVLQHLASKLPVSRWQRDLTDSTVLRNLGVGIGYALIAYQSTLKGVSKLEVNRDHLLDELDHNWEVLAEPIQTVMRRYGIEKPYEKLKELTRGKRVDAEGMKQFIDGLALPEEEKARLKAMTPANYIGRAITMVDELKHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylosuccinate lyase
publication title Substrate and Product Complexes of Escherichia coli Adenylosuccinate Lyase Provide New Insights into the Enzymatic Mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 179
structure length 459
sequence length 459
chains with identical sequence B
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF08328 ASL_C Adenylosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 2ptqA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 2ptqA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 2ptqA02
1K62A 2O7DA 2X75A 2PTSA 4BAAA 1TJVA 2QGAB 5F91A 2VD6A 4BABA 1HY0A 2YIIA 5D6BA 3R6QA 4C5UA 1C3UA 2NYFA 3UNVA 3R6YA 2QVEA 1JSWA 1GKJA 1EB4A 4C6GA 1U15A 1DCNA 2RJSA 1AUWA 3OCEA 3C8TA 2E9FA 3NZ4A 1I0AA 4HGVA 3R6VA 1Y2MA 1FUQA 4FLCA 2NYNA 1GKMA 1HY1A 5EYVA 4NSLA 4V2QA 4APAA 2PTQA 1K7WA 4C5RA 1C3CA 1J3UA 4ADMA 4V2RA 4EFCA 1GK2A 5F92A 3KDYA 4CQ5A 1W27A 3TV2A 1U16A 2FUSA 2PFMA 1T6PA 5HW2A 1TJWA 2HVGA 1B8FA 4NLEA 1VDKA 1TJUA 2O7EA 3KDZA 1TJ7A 3BHGA 2O7FA 1T6JA 3OCFA 4MX2A 1YFMA 1YFEA 3RD8A 3QBPA 1KQ7A 4FFXA 4APBA 4EEIA 3NO9A 2O7BA 2RJRA 3CZOA 1DOFA 2J91A 2OHYA 1GK3A 5EYTA 2O78A 1FURA 3GTDA 3E04A 4C5SA 1YISA 1RE5A 1FUPA 3GZHA 1Q5NA 2O6YA 2PTRA 1FUOA 1XWOA 3RRPA 4ADLA
chains in the Genus database with same CATH superfamily
2D27A 1XLYA 1K62A 2O7DA 2X75A 2PTSA 4BAAA 1TJVA 4L57A 3RRPA 2QGAB 5F91A 2VD6A 1XL7A 1HY0A 2YIIA 4BABA 5D6BA 3R6QA 4C5UA 1C3UA 2NYFA 3UNVA 3R6YA 2QVEA 1JSWA 1GKJA 1EB4A 4C6GA 1U15A 1DCNA 1Z4PX 4E88A 2RJSA 3OCEA 1AUWA 3C8TA 4A15A 2E9FA 4WNLA 2I7DA 1I0AA 4HGVA 3NZ4A 3R6VA 1Y2MA 1FUQA 4FLCA 2NYNA 1GKMA 1HY1A 5EYVA 4NSLA 4V2QA 4APAA 2PTQA 1K7WA 4C5RA 1C3CA 1J3UA 1XMDA 1Q92A 4ADMA 4V2RA 4EFCA 1GK2A 4L6AA 5F92A 3KDYA 4CQ5A 2RCNA 1IW7D 1T9HA 1W27A 2JAUA 3TV2A 1U16A 2FUSA 2PFMA 1T6PA 5M0JA 5HW2A 3U19A 2JAWA 1TJWA 1XL8A 2HVGA 4YIKA 1B8FA 4NLEA 1VDKA 1Q91A 5M0IA 4NFLA 5H8WA 1TJUA 2O7EA 3KDZA 3U13A 2FELA 2D28C 3BHGA 2YV5A 1Z4IA 2O7FA 1T6JA 3OCFA 4MX2A 2VL7A 1Z4LA 1YFMA 4MWOA 1MH9A 1YFEA 3RD8A 3CI0K 3QBPA 1KQ7A 3BWVA 4FFXA 4YIHA 2JAOA 4APBA 4EEIA 1Z4JA 1U0LA 3NO9A 2O7BA 4L6CA 4IQJM 2RJRA 3CZOA 1DOFA 2J91A 2OHYA 1GK3A 5EYTA 2O78A 1FURA 2VSFA 3GTDA 3E04A 1Z4KA 4C5SA 1YISA 2FENA 3F4SA 1RE5A 4MUMA 3CRVA 1XMCA 1FUPA 3GZHA 1Q5NA 3F4TA 2O6YA 1Z4QA 3CRW1 2PTRA 1Z4MA 2JARA 1FUOA 3F4RA 1XWOA 1TJ7A 4ADLA
chains in the Genus database with same CATH topology
1K62A 2O7DA 2X75A 2PTSA 4BAAA 1TJVA 2QGAB 5F91A 2VD6A 4BABA 1HY0A 2YIIA 5D6BA 3R6QA 4C5UA 1C3UA 2NYFA 3UNVA 3R6YA 2QVEA 1JSWA 1GKJA 1EB4A 4C6GA 1U15A 1DCNA 2RJSA 1AUWA 3OCEA 3C8TA 2E9FA 3NZ4A 1I0AA 4HGVA 3R6VA 1Y2MA 1FUQA 4FLCA 2NYNA 1GKMA 1HY1A 5EYVA 4NSLA 4V2QA 4APAA 2PTQA 1K7WA 4C5RA 1C3CA 1J3UA 4ADMA 4V2RA 4EFCA 1GK2A 5F92A 3KDYA 4CQ5A 1W27A 3TV2A 1U16A 2FUSA 2PFMA 1T6PA 5HW2A 1TJWA 2HVGA 1B8FA 4NLEA 1VDKA 1TJUA 2O7EA 3KDZA 1TJ7A 3BHGA 2O7FA 1T6JA 3OCFA 4MX2A 1YFMA 1YFEA 3RD8A 3QBPA 1KQ7A 4FFXA 4APBA 4EEIA 3NO9A 2O7BA 2RJRA 3CZOA 1DOFA 2J91A 2OHYA 1GK3A 5EYTA 2O78A 1FURA 3GTDA 3E04A 4C5SA 1YISA 1RE5A 1FUPA 3GZHA 1Q5NA 2O6YA 2PTRA 1FUOA 1XWOA 3RRPA 4ADLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K62 A;  2O7D A;  2X75 A;  2PTS A;  4BAA A;  1TJV A;  2QGA B;  5F91 A;  2VD6 A;  4BAB A;  1HY0 A;  2YII A;  5D6B A;  3R6Q A;  4C5U A;  1C3U A;  2NYF A;  3UNV A;  3R6Y A;  2QVE A;  1JSW A;  1GKJ A;  1EB4 A;  4C6G A;  1U15 A;  1DCN A;  2RJS A;  1AUW A;  3OCE A;  3C8T A;  2E9F A;  3NZ4 A;  1I0A A;  4HGV A;  3R6V A;  1Y2M A;  1FUQ A;  4FLC A;  2NYN A;  1GKM A;  1HY1 A;  5EYV A;  4NSL A;  4V2Q A;  4APA A;  2PTQ A;  1K7W A;  4C5R A;  1C3C A;  1J3U A;  4ADM A;  4V2R A;  4EFC A;  1GK2 A;  5F92 A;  3KDY A;  4CQ5 A;  1W27 A;  3TV2 A;  1U16 A;  2FUS A;  2PFM A;  1T6P A;  5HW2 A;  1TJW A;  2HVG A;  1B8F A;  4NLE A;  1VDK A;  1TJU A;  2O7E A;  3KDZ A;  1TJ7 A;  3BHG A;  2O7F A;  1T6J A;  3OCF A;  4MX2 A;  1YFM A;  1YFE A;  3RD8 A;  3QBP A;  1KQ7 A;  4FFX A;  4APB A;  4EEI A;  3NO9 A;  2O7B A;  2RJR A;  3CZO A;  1DOF A;  2J91 A;  2OHY A;  1GK3 A;  5EYT A;  2O78 A;  1FUR A;  3GTD A;  3E04 A;  4C5S A;  1YIS A;  1RE5 A;  1FUP A;  3GZH A;  1Q5N A;  2O6Y A;  2PTR A;  1FUO A;  1XWO A;  3RRP A;  4ADL A; 
#chains in the Genus database with same CATH topology
 2D27 A;  1XLY A;  1K62 A;  2O7D A;  2X75 A;  2PTS A;  4BAA A;  1TJV A;  4L57 A;  3RRP A;  2QGA B;  5F91 A;  2VD6 A;  1XL7 A;  1HY0 A;  2YII A;  4BAB A;  5D6B A;  3R6Q A;  4C5U A;  1C3U A;  2NYF A;  3UNV A;  3R6Y A;  2QVE A;  1JSW A;  1GKJ A;  1EB4 A;  4C6G A;  1U15 A;  1DCN A;  1Z4P X;  4E88 A;  2RJS A;  3OCE A;  1AUW A;  3C8T A;  4A15 A;  2E9F A;  4WNL A;  2I7D A;  1I0A A;  4HGV A;  3NZ4 A;  3R6V A;  1Y2M A;  1FUQ A;  4FLC A;  2NYN A;  1GKM A;  1HY1 A;  5EYV A;  4NSL A;  4V2Q A;  4APA A;  2PTQ A;  1K7W A;  4C5R A;  1C3C A;  1J3U A;  1XMD A;  1Q92 A;  4ADM A;  4V2R A;  4EFC A;  1GK2 A;  4L6A A;  5F92 A;  3KDY A;  4CQ5 A;  2RCN A;  1IW7 D;  1T9H A;  1W27 A;  2JAU A;  3TV2 A;  1U16 A;  2FUS A;  2PFM A;  1T6P A;  5M0J A;  5HW2 A;  3U19 A;  2JAW A;  1TJW A;  1XL8 A;  2HVG A;  4YIK A;  1B8F A;  4NLE A;  1VDK A;  1Q91 A;  5M0I A;  4NFL A;  5H8W A;  1TJU A;  2O7E A;  3KDZ A;  3U13 A;  2FEL A;  2D28 C;  3BHG A;  2YV5 A;  1Z4I A;  2O7F A;  1T6J A;  3OCF A;  4MX2 A;  2VL7 A;  1Z4L A;  1YFM A;  4MWO A;  1MH9 A;  1YFE A;  3RD8 A;  3CI0 K;  3QBP A;  1KQ7 A;  3BWV A;  4FFX A;  4YIH A;  2JAO A;  4APB A;  4EEI A;  1Z4J A;  1U0L A;  3NO9 A;  2O7B A;  4L6C A;  4IQJ M;  2RJR A;  3CZO A;  1DOF A;  2J91 A;  2OHY A;  1GK3 A;  5EYT A;  2O78 A;  1FUR A;  2VSF A;  3GTD A;  3E04 A;  1Z4K A;  4C5S A;  1YIS A;  2FEN A;  3F4S A;  1RE5 A;  4MUM A;  3CRV A;  1XMC A;  1FUP A;  3GZH A;  1Q5N A;  3F4T A;  2O6Y A;  1Z4Q A;  3CRW 1;  2PTR A;  1Z4M A;  2JAR A;  1FUO A;  3F4R A;  1XWO A;  1TJ7 A;  4ADL A; 
#chains in the Genus database with same CATH homology
 1K62 A;  2O7D A;  2X75 A;  2PTS A;  4BAA A;  1TJV A;  2QGA B;  5F91 A;  2VD6 A;  4BAB A;  1HY0 A;  2YII A;  5D6B A;  3R6Q A;  4C5U A;  1C3U A;  2NYF A;  3UNV A;  3R6Y A;  2QVE A;  1JSW A;  1GKJ A;  1EB4 A;  4C6G A;  1U15 A;  1DCN A;  2RJS A;  1AUW A;  3OCE A;  3C8T A;  2E9F A;  3NZ4 A;  1I0A A;  4HGV A;  3R6V A;  1Y2M A;  1FUQ A;  4FLC A;  2NYN A;  1GKM A;  1HY1 A;  5EYV A;  4NSL A;  4V2Q A;  4APA A;  2PTQ A;  1K7W A;  4C5R A;  1C3C A;  1J3U A;  4ADM A;  4V2R A;  4EFC A;  1GK2 A;  5F92 A;  3KDY A;  4CQ5 A;  1W27 A;  3TV2 A;  1U16 A;  2FUS A;  2PFM A;  1T6P A;  5HW2 A;  1TJW A;  2HVG A;  1B8F A;  4NLE A;  1VDK A;  1TJU A;  2O7E A;  3KDZ A;  1TJ7 A;  3BHG A;  2O7F A;  1T6J A;  3OCF A;  4MX2 A;  1YFM A;  1YFE A;  3RD8 A;  3QBP A;  1KQ7 A;  4FFX A;  4APB A;  4EEI A;  3NO9 A;  2O7B A;  2RJR A;  3CZO A;  1DOF A;  2J91 A;  2OHY A;  1GK3 A;  5EYT A;  2O78 A;  1FUR A;  3GTD A;  3E04 A;  4C5S A;  1YIS A;  1RE5 A;  1FUP A;  3GZH A;  1Q5N A;  2O6Y A;  2PTR A;  1FUO A;  1XWO A;  3RRP A;  4ADL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...