2PTQA

Crystal structure of escherichia coli adenylosuccinate lyase mutant h171n with bound amp and fumarate
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
459
structure length
459
Chain Sequence
MELSSLTAVSPVDGRYGDKVSALRGIFSEYGLLKFRVQVEVRWLQKLAAHAAIKEVPAFAADAIGYLDAIVASFSEEDAARIKTIERTTNHDVKAVEYFLKEKVAEIPELHAVSEFIHFACTSEDINNLSHALMLKTARDEVILPYWRQLIDGLKDLAVQYRDIPLLSRTNGQPATPSTIGKEMANVAYRMERQYRQLNQVEILGKINGAVGNYNAHIAAYPEVDWHQFSEEFVTSLGIQWNPYTTQIEPHDYIAELFDCVARFNTILIDFDRDVWGYIALNHFKQKTIAGEIGSSTMPHKVNPIDFENSEGNLGLSNAVLQHLASKLPVSRWQRDLTDSTVLRNLGVGIGYALIAYQSTLKGVSKLEVNRDHLLDELDHNWEVLAEPIQTVMRRYGIEKPYEKLKELTRGKRVDAEGMKQFIDGLALPEEEKARLKAMTPANYIGRAITMVDELKHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Adenylosuccinate lyase
publication title Substrate and Product Complexes of Escherichia coli Adenylosuccinate Lyase Provide New Insights into the Enzymatic Mechanism.
pubmed doi rcsb
source organism Escherichia coli
total genus 179
structure length 459
sequence length 459
chains with identical sequence B
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF08328 ASL_C Adenylosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 2ptqA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 2ptqA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 2ptqA02
4HGVA 4APBA 3NZ4A 3QBPA 2J91A 1DCNA 4BAAA 2O6YA 1FUPA 1AUWA 3BHGA 1K62A 1YFMA 4APAA 5EYTA 3UNVA 4NSLA 3TV2A 4FFXA 1JSWA 2O7EA 3R6QA 1YFEA 1GKMA 1U15A 1DOFA 1C3UA 3E04A 2NYFA 3OCFA 4MX2A 1T6JA 2X75A 3CZOA 4C5RA 4CQ5A 4NLEA 1J3UA 3RD8A 4ADMA 3R6VA 1B8FA 1C3CA 1FURA 5F91A 4C6GA 3C8TA 1KQ7A 1U16A 4BABA 3KDZA 2RJSA 2FUSA 2PFMA 1RE5A 1GK3A 1EB4A 4EFCA 2VD6A 1HY1A 1YISA 5F92A 4C5UA 1K7WA 2PTQA 4C5SA 3GZHA 3NO9A 1TJVA 2E9FA 2OHYA 2O7BA 2O7DA 1Q5NA 2QVEA 4EEIA 2HVGA 1T6PA 4ADLA 3R6YA 3KDYA 2NYNA 1GKJA 1TJWA 2YIIA 3RRPA 2O7FA 1GK2A 5EYVA 2QGAB 3OCEA 1FUQA 4V2RA 1TJ7A 1XWOA 1I0AA 1HY0A 2PTSA 2RJRA 1Y2MA 1TJUA 1FUOA 3GTDA 5HW2A 5D6BA 1W27A 2O78A 1VDKA 2PTRA 4FLCA 4V2QA
chains in the Genus database with same CATH superfamily
4HGVA 4APBA 3NZ4A 3QBPA 2J91A 2FENA 1DCNA 4BAAA 2O6YA 1IW7D 3CRW1 3CRVA 1FUPA 2D28C 1Z4KA 1AUWA 3BHGA 1K62A 1MH9A 1YFMA 4APAA 3U13A 5EYTA 3UNVA 4NSLA 4FLCA 3TV2A 2JAWA 4FFXA 5M0JA 1JSWA 2O7EA 1XL8A 3R6QA 1YFEA 1GKMA 1U15A 2FELA 1DOFA 1C3UA 1Z4QA 3E04A 2NYFA 1Z4MA 3OCFA 4MX2A 1T6JA 2X75A 4L57A 3CZOA 4WNLA 4C5RA 4CQ5A 4A15A 4NLEA 1J3UA 4YIKA 3RD8A 4ADMA 3R6VA 1B8FA 4E88A 1C3CA 1FURA 1XL7A 5F91A 4C6GA 3C8TA 3CI0K 2VSFA 2JAOA 3BWVA 1KQ7A 1U16A 2D27A 4BABA 3KDZA 2RJSA 2FUSA 2PFMA 1RE5A 1GK3A 1Z4JA 1EB4A 1XMDA 4EFCA 2VD6A 3F4TA 1Z4LA 1HY1A 4NFLA 4MUMA 1YISA 3F4RA 4YIHA 1T9HA 5H8WA 5F92A 4C5UA 1K7WA 4IQJM 2PTQA 4C5SA 4L6CA 3U19A 3GZHA 3NO9A 5M0IA 1TJVA 2E9FA 3F4SA 4MWOA 2OHYA 2O7BA 1Z4IA 2O7DA 2VL7A 2RCNA 1Q5NA 2JAUA 2QVEA 4EEIA 2HVGA 1T6PA 4ADLA 3R6YA 3KDYA 2NYNA 1TJWA 1GKJA 1Z4PX 3RRPA 2YIIA 1XMCA 2O7FA 1GK2A 1Q91A 2JARA 5EYVA 2QGAB 2I7DA 3OCEA 1FUQA 4V2RA 1TJ7A 1XWOA 1I0AA 1HY0A 2YV5A 2PTSA 2RJRA 1Y2MA 1XLYA 1TJUA 1FUOA 3GTDA 1U0LA 5HW2A 5D6BA 1W27A 2O78A 1VDKA 2PTRA 1Q92A 4L6AA 4V2QA
chains in the Genus database with same CATH topology
4HGVA 4APBA 3NZ4A 3QBPA 2J91A 1DCNA 4BAAA 2O6YA 1FUPA 1AUWA 3BHGA 1K62A 1YFMA 4APAA 5EYTA 3UNVA 4NSLA 3TV2A 4FFXA 1JSWA 2O7EA 3R6QA 1YFEA 1GKMA 1U15A 1DOFA 1C3UA 3E04A 2NYFA 3OCFA 4MX2A 1T6JA 2X75A 3CZOA 4C5RA 4CQ5A 4NLEA 1J3UA 3RD8A 4ADMA 3R6VA 1B8FA 1C3CA 1FURA 5F91A 4C6GA 3C8TA 1KQ7A 1U16A 4BABA 3KDZA 2RJSA 2FUSA 2PFMA 1RE5A 1GK3A 1EB4A 4EFCA 2VD6A 1HY1A 1YISA 5F92A 4C5UA 1K7WA 2PTQA 4C5SA 3GZHA 3NO9A 1TJVA 2E9FA 2OHYA 2O7BA 2O7DA 1Q5NA 2QVEA 4EEIA 2HVGA 1T6PA 4ADLA 3R6YA 3KDYA 2NYNA 1GKJA 1TJWA 2YIIA 3RRPA 2O7FA 1GK2A 5EYVA 2QGAB 3OCEA 1FUQA 4V2RA 1TJ7A 1XWOA 1I0AA 1HY0A 2PTSA 2RJRA 1Y2MA 1TJUA 1FUOA 3GTDA 5HW2A 5D6BA 1W27A 2O78A 1VDKA 2PTRA 4FLCA 4V2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HGV A;  4APB A;  3NZ4 A;  3QBP A;  2J91 A;  1DCN A;  4BAA A;  2O6Y A;  1FUP A;  1AUW A;  3BHG A;  1K62 A;  1YFM A;  4APA A;  5EYT A;  3UNV A;  4NSL A;  3TV2 A;  4FFX A;  1JSW A;  2O7E A;  3R6Q A;  1YFE A;  1GKM A;  1U15 A;  1DOF A;  1C3U A;  3E04 A;  2NYF A;  3OCF A;  4MX2 A;  1T6J A;  2X75 A;  3CZO A;  4C5R A;  4CQ5 A;  4NLE A;  1J3U A;  3RD8 A;  4ADM A;  3R6V A;  1B8F A;  1C3C A;  1FUR A;  5F91 A;  4C6G A;  3C8T A;  1KQ7 A;  1U16 A;  4BAB A;  3KDZ A;  2RJS A;  2FUS A;  2PFM A;  1RE5 A;  1GK3 A;  1EB4 A;  4EFC A;  2VD6 A;  1HY1 A;  1YIS A;  5F92 A;  4C5U A;  1K7W A;  2PTQ A;  4C5S A;  3GZH A;  3NO9 A;  1TJV A;  2E9F A;  2OHY A;  2O7B A;  2O7D A;  1Q5N A;  2QVE A;  4EEI A;  2HVG A;  1T6P A;  4ADL A;  3R6Y A;  3KDY A;  2NYN A;  1GKJ A;  1TJW A;  2YII A;  3RRP A;  2O7F A;  1GK2 A;  5EYV A;  2QGA B;  3OCE A;  1FUQ A;  4V2R A;  1TJ7 A;  1XWO A;  1I0A A;  1HY0 A;  2PTS A;  2RJR A;  1Y2M A;  1TJU A;  1FUO A;  3GTD A;  5HW2 A;  5D6B A;  1W27 A;  2O78 A;  1VDK A;  2PTR A;  4FLC A;  4V2Q A; 
#chains in the Genus database with same CATH topology
 4HGV A;  4APB A;  3NZ4 A;  3QBP A;  2J91 A;  2FEN A;  1DCN A;  4BAA A;  2O6Y A;  1IW7 D;  3CRW 1;  3CRV A;  1FUP A;  2D28 C;  1Z4K A;  1AUW A;  3BHG A;  1K62 A;  1MH9 A;  1YFM A;  4APA A;  3U13 A;  5EYT A;  3UNV A;  4NSL A;  4FLC A;  3TV2 A;  2JAW A;  4FFX A;  5M0J A;  1JSW A;  2O7E A;  1XL8 A;  3R6Q A;  1YFE A;  1GKM A;  1U15 A;  2FEL A;  1DOF A;  1C3U A;  1Z4Q A;  3E04 A;  2NYF A;  1Z4M A;  3OCF A;  4MX2 A;  1T6J A;  2X75 A;  4L57 A;  3CZO A;  4WNL A;  4C5R A;  4CQ5 A;  4A15 A;  4NLE A;  1J3U A;  4YIK A;  3RD8 A;  4ADM A;  3R6V A;  1B8F A;  4E88 A;  1C3C A;  1FUR A;  1XL7 A;  5F91 A;  4C6G A;  3C8T A;  3CI0 K;  2VSF A;  2JAO A;  3BWV A;  1KQ7 A;  1U16 A;  2D27 A;  4BAB A;  3KDZ A;  2RJS A;  2FUS A;  2PFM A;  1RE5 A;  1GK3 A;  1Z4J A;  1EB4 A;  1XMD A;  4EFC A;  2VD6 A;  3F4T A;  1Z4L A;  1HY1 A;  4NFL A;  4MUM A;  1YIS A;  3F4R A;  4YIH A;  1T9H A;  5H8W A;  5F92 A;  4C5U A;  1K7W A;  4IQJ M;  2PTQ A;  4C5S A;  4L6C A;  3U19 A;  3GZH A;  3NO9 A;  5M0I A;  1TJV A;  2E9F A;  3F4S A;  4MWO A;  2OHY A;  2O7B A;  1Z4I A;  2O7D A;  2VL7 A;  2RCN A;  1Q5N A;  2JAU A;  2QVE A;  4EEI A;  2HVG A;  1T6P A;  4ADL A;  3R6Y A;  3KDY A;  2NYN A;  1TJW A;  1GKJ A;  1Z4P X;  3RRP A;  2YII A;  1XMC A;  2O7F A;  1GK2 A;  1Q91 A;  2JAR A;  5EYV A;  2QGA B;  2I7D A;  3OCE A;  1FUQ A;  4V2R A;  1TJ7 A;  1XWO A;  1I0A A;  1HY0 A;  2YV5 A;  2PTS A;  2RJR A;  1Y2M A;  1XLY A;  1TJU A;  1FUO A;  3GTD A;  1U0L A;  5HW2 A;  5D6B A;  1W27 A;  2O78 A;  1VDK A;  2PTR A;  1Q92 A;  4L6A A;  4V2Q A; 
#chains in the Genus database with same CATH homology
 4HGV A;  4APB A;  3NZ4 A;  3QBP A;  2J91 A;  1DCN A;  4BAA A;  2O6Y A;  1FUP A;  1AUW A;  3BHG A;  1K62 A;  1YFM A;  4APA A;  5EYT A;  3UNV A;  4NSL A;  3TV2 A;  4FFX A;  1JSW A;  2O7E A;  3R6Q A;  1YFE A;  1GKM A;  1U15 A;  1DOF A;  1C3U A;  3E04 A;  2NYF A;  3OCF A;  4MX2 A;  1T6J A;  2X75 A;  3CZO A;  4C5R A;  4CQ5 A;  4NLE A;  1J3U A;  3RD8 A;  4ADM A;  3R6V A;  1B8F A;  1C3C A;  1FUR A;  5F91 A;  4C6G A;  3C8T A;  1KQ7 A;  1U16 A;  4BAB A;  3KDZ A;  2RJS A;  2FUS A;  2PFM A;  1RE5 A;  1GK3 A;  1EB4 A;  4EFC A;  2VD6 A;  1HY1 A;  1YIS A;  5F92 A;  4C5U A;  1K7W A;  2PTQ A;  4C5S A;  3GZH A;  3NO9 A;  1TJV A;  2E9F A;  2OHY A;  2O7B A;  2O7D A;  1Q5N A;  2QVE A;  4EEI A;  2HVG A;  1T6P A;  4ADL A;  3R6Y A;  3KDY A;  2NYN A;  1GKJ A;  1TJW A;  2YII A;  3RRP A;  2O7F A;  1GK2 A;  5EYV A;  2QGA B;  3OCE A;  1FUQ A;  4V2R A;  1TJ7 A;  1XWO A;  1I0A A;  1HY0 A;  2PTS A;  2RJR A;  1Y2M A;  1TJU A;  1FUO A;  3GTD A;  5HW2 A;  5D6B A;  1W27 A;  2O78 A;  1VDK A;  2PTR A;  4FLC A;  4V2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...