2PTQA

Crystal structure of escherichia coli adenylosuccinate lyase mutant h171n with bound amp and fumarate
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
459
structure length
459
Chain Sequence
MELSSLTAVSPVDGRYGDKVSALRGIFSEYGLLKFRVQVEVRWLQKLAAHAAIKEVPAFAADAIGYLDAIVASFSEEDAARIKTIERTTNHDVKAVEYFLKEKVAEIPELHAVSEFIHFACTSEDINNLSHALMLKTARDEVILPYWRQLIDGLKDLAVQYRDIPLLSRTNGQPATPSTIGKEMANVAYRMERQYRQLNQVEILGKINGAVGNYNAHIAAYPEVDWHQFSEEFVTSLGIQWNPYTTQIEPHDYIAELFDCVARFNTILIDFDRDVWGYIALNHFKQKTIAGEIGSSTMPHKVNPIDFENSEGNLGLSNAVLQHLASKLPVSRWQRDLTDSTVLRNLGVGIGYALIAYQSTLKGVSKLEVNRDHLLDELDHNWEVLAEPIQTVMRRYGIEKPYEKLKELTRGKRVDAEGMKQFIDGLALPEEEKARLKAMTPANYIGRAITMVDELKHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylosuccinate lyase
publication title Substrate and Product Complexes of Escherichia coli Adenylosuccinate Lyase Provide New Insights into the Enzymatic Mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 179
structure length 459
sequence length 459
chains with identical sequence B
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF08328 ASL_C Adenylosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 2ptqA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 2ptqA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 2ptqA02
1C3UA 4APBA 2YIIA 1K7WA 1XWOA 1DOFA 1T6JA 3KDYA 3BHGA 3CZOA 1Q5NA 5HW2A 2O7FA 4BAAA 4ADMA 2O7EA 1HY1A 1HY0A 2VD6A 3UNVA 5D6BA 1VDKA 1FUQA 1W27A 3RD8A 2PTRA 3OCFA 1TJVA 3GTDA 4FFXA 2NYFA 2PTQA 2RJSA 4NLEA 4HGVA 4V2RA 3C8TA 1B8FA 1TJWA 1JSWA 1C3CA 1K62A 4MX2A 1T6PA 5EYTA 2X75A 1DCNA 4C5RA 3GZHA 4CQ5A 1EB4A 1AUWA 5F92A 1GKMA 1GK2A 2O6YA 2FUSA 1YISA 2QVEA 1Y2MA 3NO9A 1KQ7A 3KDZA 3R6VA 1TJ7A 1GK3A 2O7BA 2PFMA 3NZ4A 4NSLA 4V2QA 3TV2A 2NYNA 1I0AA 2PTSA 4ADLA 3RRPA 2J91A 4BABA 5F91A 3E04A 2O78A 1GKJA 5EYVA 4C5UA 1FURA 2OHYA 1TJUA 2E9FA 4C5SA 2QGAB 3R6YA 2HVGA 3R6QA 2O7DA 1YFEA 1YFMA 1U16A 2RJRA 1RE5A 1J3UA 4FLCA 4C6GA 4EEIA 3OCEA 1U15A 1FUOA 1FUPA 3QBPA 4EFCA 4APAA
chains in the Genus database with same CATH superfamily
1C3UA 2JAOA 4APBA 2YIIA 4YIKA 4L6AA 1K7WA 1XWOA 1DOFA 1T6JA 3KDYA 3BHGA 3CZOA 1Q5NA 5HW2A 3CRW1 2O7FA 1Z4MA 4BAAA 1Z4LA 4ADMA 4IQJM 2O7EA 1HY1A 1Z4PX 1XMCA 1HY0A 3U13A 2VD6A 1MH9A 3UNVA 2VL7A 5D6BA 1VDKA 1FUQA 4WNLA 2RCNA 2JAWA 1W27A 3RD8A 2PTRA 3OCFA 1TJVA 3GTDA 4FFXA 2NYFA 1Z4KA 2PTQA 2RJSA 4NLEA 1Z4QA 1U0LA 4HGVA 4V2RA 3C8TA 1B8FA 1TJWA 1JSWA 2I7DA 4NFLA 1C3CA 1K62A 2D27A 4MX2A 1T6PA 5EYTA 2X75A 4A15A 1DCNA 2D28C 3BWVA 4C5RA 3GZHA 4CQ5A 1EB4A 1AUWA 5F92A 1GKMA 1GK2A 2YV5A 2O6YA 3CI0K 2FUSA 1XMDA 1YISA 2QVEA 5M0JA 1Y2MA 3NO9A 1KQ7A 3KDZA 3R6VA 1TJ7A 4L6CA 1GK3A 2O7BA 4MWOA 2PFMA 3NZ4A 1Z4IA 4NSLA 4V2QA 3TV2A 2NYNA 1I0AA 2JAUA 2PTSA 2JARA 3RRPA 4ADLA 2J91A 4BABA 1IW7D 5F91A 3E04A 2FELA 2O78A 3F4TA 3U19A 1XL7A 1GKJA 2FENA 5EYVA 4C5UA 5M0IA 1Q91A 1FURA 2OHYA 1TJUA 2E9FA 4C5SA 2QGAB 3R6YA 2HVGA 1XLYA 3R6QA 2O7DA 1YFEA 1YFMA 1Z4JA 1U16A 3F4RA 2RJRA 2VSFA 4L57A 1RE5A 1J3UA 4FLCA 4C6GA 5H8WA 4EEIA 3OCEA 3F4SA 4YIHA 1XL8A 1Q92A 1U15A 1FUOA 1FUPA 3CRVA 4E88A 3QBPA 4EFCA 4APAA 4MUMA 1T9HA
chains in the Genus database with same CATH topology
1C3UA 4APBA 2YIIA 1K7WA 1XWOA 1DOFA 1T6JA 3KDYA 3BHGA 3CZOA 1Q5NA 5HW2A 2O7FA 4BAAA 4ADMA 2O7EA 1HY1A 1HY0A 2VD6A 3UNVA 5D6BA 1VDKA 1FUQA 1W27A 3RD8A 2PTRA 3OCFA 1TJVA 3GTDA 4FFXA 2NYFA 2PTQA 2RJSA 4NLEA 4HGVA 4V2RA 3C8TA 1B8FA 1TJWA 1JSWA 1C3CA 1K62A 4MX2A 1T6PA 5EYTA 2X75A 1DCNA 4C5RA 3GZHA 4CQ5A 1EB4A 1AUWA 5F92A 1GKMA 1GK2A 2O6YA 2FUSA 1YISA 2QVEA 1Y2MA 3NO9A 1KQ7A 3KDZA 3R6VA 1TJ7A 1GK3A 2O7BA 2PFMA 3NZ4A 4NSLA 4V2QA 3TV2A 2NYNA 1I0AA 2PTSA 4ADLA 3RRPA 2J91A 4BABA 5F91A 3E04A 2O78A 1GKJA 5EYVA 4C5UA 1FURA 2OHYA 1TJUA 2E9FA 4C5SA 2QGAB 3R6YA 2HVGA 3R6QA 2O7DA 1YFEA 1YFMA 1U16A 2RJRA 1RE5A 1J3UA 4FLCA 4C6GA 4EEIA 3OCEA 1U15A 1FUOA 1FUPA 3QBPA 4EFCA 4APAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C3U A;  4APB A;  2YII A;  1K7W A;  1XWO A;  1DOF A;  1T6J A;  3KDY A;  3BHG A;  3CZO A;  1Q5N A;  5HW2 A;  2O7F A;  4BAA A;  4ADM A;  2O7E A;  1HY1 A;  1HY0 A;  2VD6 A;  3UNV A;  5D6B A;  1VDK A;  1FUQ A;  1W27 A;  3RD8 A;  2PTR A;  3OCF A;  1TJV A;  3GTD A;  4FFX A;  2NYF A;  2PTQ A;  2RJS A;  4NLE A;  4HGV A;  4V2R A;  3C8T A;  1B8F A;  1TJW A;  1JSW A;  1C3C A;  1K62 A;  4MX2 A;  1T6P A;  5EYT A;  2X75 A;  1DCN A;  4C5R A;  3GZH A;  4CQ5 A;  1EB4 A;  1AUW A;  5F92 A;  1GKM A;  1GK2 A;  2O6Y A;  2FUS A;  1YIS A;  2QVE A;  1Y2M A;  3NO9 A;  1KQ7 A;  3KDZ A;  3R6V A;  1TJ7 A;  1GK3 A;  2O7B A;  2PFM A;  3NZ4 A;  4NSL A;  4V2Q A;  3TV2 A;  2NYN A;  1I0A A;  2PTS A;  4ADL A;  3RRP A;  2J91 A;  4BAB A;  5F91 A;  3E04 A;  2O78 A;  1GKJ A;  5EYV A;  4C5U A;  1FUR A;  2OHY A;  1TJU A;  2E9F A;  4C5S A;  2QGA B;  3R6Y A;  2HVG A;  3R6Q A;  2O7D A;  1YFE A;  1YFM A;  1U16 A;  2RJR A;  1RE5 A;  1J3U A;  4FLC A;  4C6G A;  4EEI A;  3OCE A;  1U15 A;  1FUO A;  1FUP A;  3QBP A;  4EFC A;  4APA A; 
#chains in the Genus database with same CATH topology
 1C3U A;  2JAO A;  4APB A;  2YII A;  4YIK A;  4L6A A;  1K7W A;  1XWO A;  1DOF A;  1T6J A;  3KDY A;  3BHG A;  3CZO A;  1Q5N A;  5HW2 A;  3CRW 1;  2O7F A;  1Z4M A;  4BAA A;  1Z4L A;  4ADM A;  4IQJ M;  2O7E A;  1HY1 A;  1Z4P X;  1XMC A;  1HY0 A;  3U13 A;  2VD6 A;  1MH9 A;  3UNV A;  2VL7 A;  5D6B A;  1VDK A;  1FUQ A;  4WNL A;  2RCN A;  2JAW A;  1W27 A;  3RD8 A;  2PTR A;  3OCF A;  1TJV A;  3GTD A;  4FFX A;  2NYF A;  1Z4K A;  2PTQ A;  2RJS A;  4NLE A;  1Z4Q A;  1U0L A;  4HGV A;  4V2R A;  3C8T A;  1B8F A;  1TJW A;  1JSW A;  2I7D A;  4NFL A;  1C3C A;  1K62 A;  2D27 A;  4MX2 A;  1T6P A;  5EYT A;  2X75 A;  4A15 A;  1DCN A;  2D28 C;  3BWV A;  4C5R A;  3GZH A;  4CQ5 A;  1EB4 A;  1AUW A;  5F92 A;  1GKM A;  1GK2 A;  2YV5 A;  2O6Y A;  3CI0 K;  2FUS A;  1XMD A;  1YIS A;  2QVE A;  5M0J A;  1Y2M A;  3NO9 A;  1KQ7 A;  3KDZ A;  3R6V A;  1TJ7 A;  4L6C A;  1GK3 A;  2O7B A;  4MWO A;  2PFM A;  3NZ4 A;  1Z4I A;  4NSL A;  4V2Q A;  3TV2 A;  2NYN A;  1I0A A;  2JAU A;  2PTS A;  2JAR A;  3RRP A;  4ADL A;  2J91 A;  4BAB A;  1IW7 D;  5F91 A;  3E04 A;  2FEL A;  2O78 A;  3F4T A;  3U19 A;  1XL7 A;  1GKJ A;  2FEN A;  5EYV A;  4C5U A;  5M0I A;  1Q91 A;  1FUR A;  2OHY A;  1TJU A;  2E9F A;  4C5S A;  2QGA B;  3R6Y A;  2HVG A;  1XLY A;  3R6Q A;  2O7D A;  1YFE A;  1YFM A;  1Z4J A;  1U16 A;  3F4R A;  2RJR A;  2VSF A;  4L57 A;  1RE5 A;  1J3U A;  4FLC A;  4C6G A;  5H8W A;  4EEI A;  3OCE A;  3F4S A;  4YIH A;  1XL8 A;  1Q92 A;  1U15 A;  1FUO A;  1FUP A;  3CRV A;  4E88 A;  3QBP A;  4EFC A;  4APA A;  4MUM A;  1T9H A; 
#chains in the Genus database with same CATH homology
 1C3U A;  4APB A;  2YII A;  1K7W A;  1XWO A;  1DOF A;  1T6J A;  3KDY A;  3BHG A;  3CZO A;  1Q5N A;  5HW2 A;  2O7F A;  4BAA A;  4ADM A;  2O7E A;  1HY1 A;  1HY0 A;  2VD6 A;  3UNV A;  5D6B A;  1VDK A;  1FUQ A;  1W27 A;  3RD8 A;  2PTR A;  3OCF A;  1TJV A;  3GTD A;  4FFX A;  2NYF A;  2PTQ A;  2RJS A;  4NLE A;  4HGV A;  4V2R A;  3C8T A;  1B8F A;  1TJW A;  1JSW A;  1C3C A;  1K62 A;  4MX2 A;  1T6P A;  5EYT A;  2X75 A;  1DCN A;  4C5R A;  3GZH A;  4CQ5 A;  1EB4 A;  1AUW A;  5F92 A;  1GKM A;  1GK2 A;  2O6Y A;  2FUS A;  1YIS A;  2QVE A;  1Y2M A;  3NO9 A;  1KQ7 A;  3KDZ A;  3R6V A;  1TJ7 A;  1GK3 A;  2O7B A;  2PFM A;  3NZ4 A;  4NSL A;  4V2Q A;  3TV2 A;  2NYN A;  1I0A A;  2PTS A;  4ADL A;  3RRP A;  2J91 A;  4BAB A;  5F91 A;  3E04 A;  2O78 A;  1GKJ A;  5EYV A;  4C5U A;  1FUR A;  2OHY A;  1TJU A;  2E9F A;  4C5S A;  2QGA B;  3R6Y A;  2HVG A;  3R6Q A;  2O7D A;  1YFE A;  1YFM A;  1U16 A;  2RJR A;  1RE5 A;  1J3U A;  4FLC A;  4C6G A;  4EEI A;  3OCE A;  1U15 A;  1FUO A;  1FUP A;  3QBP A;  4EFC A;  4APA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...