4YIHA

Crystal structure of human cytosolic 5'(3')-deoxyribonucleotidase in complex with the inhibitor pb-pvu
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
192
structure length
192
Chain Sequence
SVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 5'(3')-deoxyribonucleotidase, cytosolic type
publication title Structure-based design of a bisphosphonate 5'(3')-deoxyribonucleotidase inhibitor
doi rcsb
source organism Homo sapiens
total genus 70
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 3.1.3.-:
pdb deposition date 2015-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4yihA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4yihA01
3QLEA 3ZWDA 5AW3A 1CQZA 4UMVA 5AIAA 3U7FB 4KNVA 5ALJA 4FFDA 3MN1A 5AKEA 2JAUA 2AH5A 5ALWA 1ZD2P 1XP5A 1L8OA 5AKHA 5ALUA 2YMLA 5AI4A 4BEVA 2G08A 3U19A 2B1QA 2HEGA 2HDOA 1YNSA 4BBJA 3KZXA 2YFYA 2C8LA 5JJBA 3ED5A 5AM5A 2C88A 1ZD5A 3N8GA 3WKDA 3R09A 2ZBEA 4F71A 3M1YA 3WKBA 3WKAA 1T9ZA 4AP9A 2NYVA 4J2TA 5ALNA 2IOHA 2IOFK 2C9MA 5AI6A 5AK3A 3NRJA 3IB6A 1L7NA 1Z5UA 4NAVA 2ZBDA 5IT0A 3ZUPA 2WF9A 3I28A 1U7PA 3N07A 4Y2YA 3OCVA 1RC8A 3L1UA 5AKYA 4UATA 1N9KA 2I54A 3QUCA 1RLMA 2ZG6A 2HI0A 3F9RA 3QUTA 3QXGA 2BDUA 4DW8A 2I7DA 3FZQA 3TLMA 2ODAA 2WFAA 3KBBA 2O9JA 1L7OA 1L7PA 3QUQA 3N28A 5ALFA 3SLRA 5AVUA 2D2VA 3I6BA 4EENA 3WK5A 5ALGA 1NNLA 3UM9A 3AR6A 3NAMA 1FEZA 2ZBFA 1S2OA 4G63A 2W43A 1U02A 5AW4A 2ZXEA 3ESQA 3DNPA 4L6CA 2QYHA 3BA6A 1Q92A 5AKIA 3OPXA 2FPUA 4Y2UA 4C4SA 5AK4A 4XOUA 2HHLA 4ZEXA 2FEAA 3I1YA 2P27A 5AW1A 5ALEA 5AKLA 3W5DA 3ZTWA 4MUMA 1YS9A 1Z88A 3EWIA 1JUDA 2JAWA 2R8YA 2I34A 2W4MA 4I9FA 3FM9A 2WF8A 4HGQA 3KD3A 3OCWA 4GXTA 1AQ6A 4ZEWA 4HAIA 2WHEA 4KX3A 1YV9A 3FGOA 1XVIA 3UMBA 4F72A 2YMQA 1WVIA 2R8ZA 4UMDA 4YIHA 3GYGA 3QU9A 2FDRA 2I6XA 2RB5A 3NUQA 4UMFA 1Z4JA 3ET4A 5AKKA 2BY4A 5AVYA 3W5CA 3OCUA 5AW5A 1ZS9A 2RBKA 3D6JA 3WKEA 2IA5A 1Z4MA 4XE5A 1LVHA 3DV9A 3ZU6A 1Z4OA 1RQNA 3MC1A 4YCMA 1Z5GA 3WK9A 2PKEA 3A3YA 5AM3A 4IFTA 1CR6A 5IT4A 1Z4KA 2ZBGA 3R9KA 4L57A 1RKVA 3AR5A 4HYTA 1WPGA 2WF6A 4L6AA 2GHTA 2P69A 1ZOLA 4Y2TA 2MU1A 4EEKA 3HLTA 2MSNA 3MPOA 3PDWA 4Y2VA 2PQ0A 2JAOA 1RLOA 1J8DA 1K1EA 2IOFA 3AR7A 4H1WA 4NFLA 2Q4TA 1QYIA 2YBDA 2JARA 4HGOA 4HGPA 3ZI4A 1EK2A 5AKZA 1RKQA 5AVSA 1MH9A 3OCZA 1U2SA 3L7YA 3VAYA 2CFSA 3WK7A 1O08A 2BDEA 2G1AA 4OHFA 1ZRNA 3B9BA 3U7EB 1WR8A 3AR4A 2Q5EA 5IS2A 5ALPA 2NO5A 4UARA 1LTQA 5A3RA 1VJ5A 1TJ4A 2AMYA 3U26A 5ALIA 3L5KA 3E58A 2GFHA 4BKMA 2G80A 3ONNA 3R4CA 5AKJA 4QJBA 3PGVA 2WF5A 3KDPA 3L1VA 2FUEA 2HO4A 2P9JA 5AW6A 3J7TA 5AESA 3L8HA 2HF2A 2YJ5A 2G0AA 3B9RA 4JDPA 3L0CA 4RESA 3QGMA 3EF0A 1Q91A 4CF3A 1Z4QA 4UM5A 5AW8A 4CE6A 5AVVA 2YMPA 4FYPA 4Y2RA 3QU4A 5AM2A 2YJ4A 2W11A 2G09A 5AK5A 1NRWA 2YY6A 4NV0A 4UAUA 2VKQA 4GIBA 4KX5A 4NABA 1TA0A 2NO4A 2YJ6A 4C4TA 3FVVA 1RKUA 3AR9A 3QU7A 5ALMA 4EELA 3N1UA 3A1DA 2RARA 5A3SA 5AIBA 4IG4A 2DQSA 3DDHA 3L8FA 2I55A 4UAVA 4BEWA 5AM4A 3QUBA 3L8EA 3L8GA 1TE2A 1RRCA 3FPSA 2OA0A 4ZEVA 5ALTA 1J97A 3U7HB 2X4DA 2B0CA 4C4RA 4Y2JA 1RPZA 4EX6A 1U7OA 4KYTA 1TJ3A 2FPWA 3B8EA 3EPRA 3WGVA 1O03A 2B82A 4OCZA 4B6JA 2FI1A 2GO7A 1RDFA 3WK4A 4NWIA 1ZJJA 3W5BA 1XPJA 3QU5A 3AR2A 4EZEA 1RQLA 5AM1A 1ZD3A 1N8NA 4XPZA 2P11A 1YDFA 4BNDB 4Y2SA 2OM6A 2OYCA 5AI9A 4XQ0A 2FPXA 1ZRMA 5ALRA 4MWOA 5AVRA 2AUTA 4YCLA 3U13A 4Y2XA 2HX1A 1F5SA 2WF7A 3K1ZA 4UMEA 1Y8AA 1RLTA 1QH9A 2AGVA 4QQFA 4HGRA 3BWVA 3KC2A 5ALVA 4OD0A 3KOOA 5ALOA 2QLTA 5ALZA 5AVTA 4PNHA 2GMWA 5T41A 3IJ5A 5ALQA 2CFRA 3E84A 2HOQA 3SKYA 1TJ5A 2C8KA 2FPRA 3HYCA 3CZ4A 5FP0A 5AICA 3OTQA 3AR3A 1RMTA 2CFTA 2CN1A 1RMYA 1EK1A 3ET5A 4BNDA 4UU1A 3RF6A 2B8EA 2HCFA 2C4NA 3OCYA 4UU0A 3QYPA 3ZTYA 1Z4NA 3S6JA 4KNWA 2EARA 3SMVA 4HGNA 3PGLA 3PCTA 2R8EA 5AKXA 2YMMA 3N5KA 5ALLA 3SF0A 2RAVA 5AW9A 2EAUA 4BYGA 4BX2A 5ALHA 2Q4RA 3M9LA 5E0OA 3NASA 2B8JA 3WKCA 5AW2A 4CF4A 2WM8A 3ZX5A 2PR7A 2B1RA 4JB3A 1RMQA 1S8OA 1QQ6A 1X42A 3U7GA 5AI5A 3UMGA 4E88A 4KN8A 4BX0A 2B30A 3EF1A 5AI0A 3ZX4A 1T5SA 3L0BA 1Z4IA 5AVXA 3IRUA 1SWWA 1WZCA 3SKXA 3W5AA 3QX7A 1SWVA 2IYEA 5AVWA 4YH1A 1NF2A 3FPBA 1U2TA 5AHXA 4DFDA 5ALSA 4Y2QA 3WGUA 5AK6A 1QQ5A 1KYTA 3NALA 4Y3UA 3SD7A 4YCNA 1YJ5A 2R8XA 5AI8A 1Z4PX 1VFPA 4BX3A 2I33A 3NIWA 3RFUA 3ZVNA 3ZW7A 1ZD4A 4UW9A 1L7MA 1L8LA 4DWOA 1Z4LA 4G9BA 2OBBA 3ESRA 4CF5A 4EX7A 3P96A 5AM0A 4UASA 3L0YA 1YMQA 4AS3A 5ALDA 3AR8A 4RETA 4YIKA 3I76A 4Y2PA 3A1EA 1SU4A 3WK6A 5AW0A 3QU2A 2HSZA 2YJ3A 5ALXA 5AW7A 1PW5A 1T5TA 2HF7A 3A1CA 5AVZA 5ALYA 3NANA 2YN4A 3E8MA 2ZOSA 3ZVMA 3UMCA 2FPSA 4I9GA 2GHQA 3E81A 4OFZA 4AS2A 3SHQA 2FUCA 5AVQA 3CNHA 4CNQA 2EATA 5AKGA 3MMZA 4O8CA 5ALKA 4DCCA 3DAOA 1QQ7A 3ZVLA 3OCXA 3WK8A 2O2XA 4J03A 2G06A 1IWOA 2JGAA 4YGYA 1VJRA 2G07A 4FE3A 3ZWKA 1L6RA 5A3QA 4UM7A 3QNMA
chains in the Genus database with same CATH superfamily
4NYIQ 4B84A 2C2HA 4OPMA 4II2A 4GEGA 3TQQA 3PC6A 3H2JA 3MN1A 3O8OB 4BKUA 2VCEA 3RIHA 4A5SA 3ICOA 3HDHA 1OASA 1U3UA 2GVZC 3RNOA 5DEIA 3JWPA 3BTSA 2CW5A 3LQFA 4DM7A 4MQMA 4PNPA 1XYGA 1GIAA 4R1OA 2O8VA 2IJGX 4OH1A 3AVXA 1M0WA 5ELMA 2I7CA 2PKXA 5C80A 3OZFA 3RLFA 1XQXA 1XNHA 3MELA 2H65A 1UQRA 4HNAA 4F8JA 3RANA 3UATA 1NWHA 3L4JA 1BRMA 3DBRB 2RHJA 4YUYA 2V0CA 4LDJA 1RZ3A 4I9HA 3HU5A 4J1QA 3IPLA 4LVOA 1G4HA 2ZBEA 3PTLA 5EUCA 4RHUA 5C81A 4HNTA 5J4YA 1VYVA 1R1DA 3N2GB 1FJHA 4JUAA 4KXYA 4J2TA 4UBNA 4JBWA 3ZDQA 3I5YA 1Y3CE 5AI6A 2HPAA 4BTVA 3W8RA 1CDEA 1G6KA 4UE2A 5TMEA 3VH2A 2FMXA 3UMFA 3H6GA 2X3UA 1E20A 4CPDA 3HVIA 4PLVA 1R8YA 3IAM6 3TN7A 5DTRA 2PYDA 2C92A 4RDCA 4BZZA 2PUHA 4NE7A 1O94D 4YB8A 2W58A 4DRYA 5J2TA 1VHJA 1OSNA 2I54A 1BDHA 1U2DC 4GOJA 3GTDA 5EHGA 5FO1A 1CNMA 1WE2A 2AG1A 2UVPB 1DQSA 4WBXC 4DTIA 2Z57A 4YRMA 2VBFA 3UJHA 3LK7A 3N5CA 1TZMA 3RHZA 2CVOA 2FPPA 1J90A 2VTDA 3OVMA 4IRMA 2ODAA 1TQ4A 4AICA 2NZYA 2FPOA 1XK7A 4OMCA 4Z99A 1AXEA 4CR7A 4E2YA 1B0UA 1HWYA 3CH7A 2D0IA 3MUFA 5G0WA 1BH6A 5ECYA 1M74A 1RWKA 4DNOA 1L4UA 3KJQA 5K3SA 2O20A 3S2GA 1NNLA 1W4ZA 3ZLUA 1ZN2A 3AFIA 5JW6A 2DBQA 2A9KA 4M46A 5A62A 1TUEA 3OZWA 5I7AA 2DQYA 4H3VA 5KKCA 3HYNA 3A2KA 4RANA 3A11A 3BRCA 5DX8A 2X23A 3BZBA 3PBKA 1NMXA 5KKAA 3G2OA 3UV6A 4OQLA 3FPEA 1XOIA 3CT6A 5FRDA 1XLTA 3AB8A 4JBNA 4ZYXA 5A9SB 3ZJTA 3TPFA 1M0TA 3AQIA 3PQDA 2Q49A 1ADBA 5L6MB 3LCMA 3J80A 1RHRA 3ABRB 4LWPA 4PC7A 2CLIB 4OQYA 1XTPA 3ED1A 1AB6A 1HLPA 4MUNA 2OD7A 3VNRA 1ODIA 3VISA 5JH7B 1XAJA 2F1OA 1TM3E 4B3BA 3JWEA 3H2IA 4OJNA 3RO7A 1RXIA 4Z9YA 3U7QB 2IBTA 1EZ4A 1FY2A 1TW3A 5KX5A 4RMJA 1BXKA 4NX2A 5I4IA 1ISGA 3M82A 3ZU5A 4F9EA 2AJBA 4HWSA 4G2NA 1JUDA 3GJTA 4H4CA 4QU8A 4QA9A 5F1KA 3IOBA 2WU0A 1I4EB 4MGYR 1JYSA 2CKDA 2CMHA 1LBIA 1P1HA 1QBKC 2A3RA 1BKSB 2C03A 2BFWA 1KQOA 3ANSA 2P8SA 2XUOA 1U5AA 3DKPA 3DWFA 4NFYA 5JNTA 2OCPA 1VSUA 4RORA 4DR3B 2JFZA 2G8LA 2ZPTX 2VHVA 1AB5A 1FRFS 2YXDA 3I39X 3I01A 3LUAA 4GQBA 2Q1WA 5IC5A 2M6RA 3V2HA 4Q05A 4J7CA 1P5ZB 5EESA 1BXGA 5ELLA 4YRFA 2KLHA 1HT2E 2YCBA 1YONA 3DC7A 5FV7A 2H7YA 2O05A 3WLJA 2YBEA 2R79A 3WICA 3CEAA 4MQ6A 4WRRA 1UKCA 1EHYA 1XLVA 3GRUA 2C4UA 3PFNA 5H1YA 1NU6A 4JI5B 4J07A 2O8CA 2ZIVB 3ETJA 4U3JA 3H17A 3WBJA 4CKCB 5TVKA 4N3GA 5FFFA 5LZ7A 3WLOA 4BTEA 5H68A 1BW9A 3U4HA 4H4DA 4BNXA 1OWNA 3WRXC 4CNBA 3STWA 1LPAB 1LLCA 4QUAA 3O2NA 2VF8A 4J43A 1RBYA 2UUPA 4ZQCB 4DT1B 4DYVA 1MAUA 1MPXA 4MINA 2FW0A 4XWAA 2BPOA 3HDVA 2OZKA 3E7XA 1XB2A 1MX1A 2XVXA 4XJXA 1RAFA 1VYTA 4Z9FA 3RU3A 1ZI8A 2BMEA 1BE1A 1JL3A 5I5GA 2E9SA 1W2GA 4KE9A 4X8HA 3TQHA 4XQEA 4Y2TA 3WQHA 2ZXFA 2BCEA 1DIBA 3PXCX 4Q4JB 4DM4A 5KYYB 3NMUF 4EY3A 1Z36A 3PDWA 1V0JA 1TK9A 1XEWX 4FEEA 1RLOA 2IZZA 5H4HA 1YGPA 3ZHOA 3EVTA 2H9YA 4PAWA 3WQBA 3KT6A 3Q8XB 4P3PA 1B26A 3UCFA 1UXKA 4F5WA 3TCNA 1NRIA 5CGZA 4V1CA 4NCBA 3H3XA 4ND2A 4GBGA 3RF7A 4F6LA 4PQEA 3KUDA 4CM8A 3QEOA 5DSZA 3K0SA 2ZCUA 3OM1A 1RYZA 2M2IA 4R1MA 2ZE6A 4N7BA 4D4IA 5L3SB 3L4SO 3KR9A 1E2IA 1G3MA 2PKQP 2ECKA 3D31A 4O59O 5B58T 2BEUB 2WZCA 3K5HA 4WOBA 5T3UA 3GN2A 5DZSA 1E9FA 1KTIA 1XPUA 5IJAA 4A15A 2Z8YM 3QPCA 1TMOA 1Z6AA 5K0JA 5EJ8A 1ECJA 2OV1A 3BUSA 1LDMA 4A8PA 2ZJ5A 3O8OA 1QF9A 2R7NA 3QYJA 4OLAA 3WDSA 3JY6A 1KZ9A 3ONNA 4WDQA 1BC5A 2AT1A 4KH0A 3DS8A 1V9CA 2GARA 4G0ZA 2WE7A 2DKFA 2CHFA 3NIFB 3HNPA 1WY7A 1R6BX 3NTQA 3TMYA 4U7WA 4Y6OA 2W42A 3BERA 1KK0A 4G8DA 1H8ED 3LE8A 3KM0A 2HF2A 2WP0A 4RF5A 2Q3LA 1GCUA 2QMHA 3D2LA 5DASA 3QOXA 3WE7A 3B9RA 3LY9A 4YDHB 1EGAA 5EUMA 3FE2A 1JEQA 1KYXA 4NV1A 2HT6A 5D5QA 1AIPA 4YV0A 1U31A 2G25A 5GIOE 4EOGA 2Q2QA 4OUKX 4PO3X 1G6HA 5AM2A 5BUZA 2RHLA 3PIRA 1R37A 2NV2B 5DLQC 3W5VA 3ULKA 5JG7A 5U9CA 4EHFA 2V6MA 3H6HA 4KX5A 5HRCA 3T5PA 2H2IA 3WY9A 3BK7A 3KJHA 4DQUA 2F8SA 3QPDA 1TGYA 3FVVA 1DLJA 1M5TA 4LY0A 3RJ5A 3WLSA 2FEWB 2DWCA 3ENQA 4WY5A 4ZDWA 3JQAA 1EZZA 4NAHA 3W3AH 2RB4A 1EAYA 3P0JA 2JVKA 1VKHA 4MV0A 1L4BA 2RARA 4V38A 2QYTA 3ME5A 4N5HX 4O33A 3SX4A 3G5AA 3VR3D 4RYDA 2TECE 2V4ZA 1GCAA 5E8JA 5T57A 1SKAA 3V7NA 5IK2D 1DXOA 4FJ1A 2NUTB 2VCYA 2JJ8A 2P9EA 3EQ2A 4JC8A 1X77A 2M98A 5T6BA 1HYQA 1OKKD 2Q7XA 4NQZA 2IS1A 1VYUA 4JQCA 3OQ1A 2VTEA 1WULS 3SWWA 1XZJA 2I2XB 2QL5A 3EDRA 2PJDA 3GZHA 4BXOB 3FPSA 2PCJA 3D1LA 3ITDA 4UHDA 4CEJA 3HR8A 2ZSUA 3NP9A 2W2MA 4WBNA 2B0CA 3LGXA 3NC4A 2VATA 1JDNA 1X7ZB 1K7YA 3Q6NA 4XDGA 1NSFA 3V2UA 4KYTA 3L04A 3VHRA 1OYWA 1V39A 1N3LA 1VL2A 5BMVB 1FSPA 2IS6A 1O03A 3VZBA 3VO1A 1PIWA 4E11A 4QBFA 2D5AA 2ISCA 2BRUA 3LVFO 4HFMA 2ATCA 1I6KA 3L07A 5K0LA 1GAEO 2NACA 2E6UX 2IW1A 3IAFA 3AR2A 3WIUA 4JLVA 4MIKA 4HK4A 1GV0A 3NT5A 4Q03A 3HN2A 3KELA 4DXDA 3M49A 3AY6A 2OOSA 1YDFA 2F1IA 4LGMA 2AJCA 3W9BA 2WSLA 1NBEA 4F12A 1Z2PX 3ZXIA 3M33A 4W8HA 3GLKA 1JA9A 2QTFA 1JG6A 1P4JA 4F45A 4KPFC 3JAWA 5EAIA 5BN1A 3F6SA 1P80A 1SCNE 4ZAFA 3H7IA 1WQ3A 2PGLA 3ZV4A 5EIAA 4C4YA 5JZOA 5HF8A 2HU7A 3TL3A 4KBFA 2C5HA 2YICA 3GVXA 4NR0A 5EOVA 1OBVA 3X1YA 2CUTA 3HZOA 1C3JA 1RYHA 1L1RA 2YV2A 4AMYA 2NUPB 1Q44A 1Z6QA 3PC4A 4WWHA 3YASA 3WLIA 4LF9B 3OZVA 1F9EA 5A0FA 2Q8QA 2O3SA 4X65B 1TQ2A 3HV0A 4UZFA 5CM2Z 4ZVLA 2JJ1D 3FNGA 3K7EA 3R0JA 3W6OA 3W79A 4EMBA 2E85A 3IAS1 1W0CA 2YN0A 4U8HA 1S2GA 2C8KA 5G1OA 3RS8A 1ABEA 2VJOA 4TLEA 1IB0A 1F8XA 3UJCA 4OSOA 5I4KA 5LIPA 5F23A 3RKSA 3Q2KA 3OQMA 5A0TA 3JV7A 5DK4A 4G5SA 2CBZA 1JLLA 2FZLA 1K63A 3DO6A 4HDRB 4EUFA 2VXOA 2PZMA 1OZGA 3F3MA 4HN4B 3CZQA 4URHA 1JDJA 2FQXA 2Z1DA 2YW9A 2EQAA 3ZY3A 1GCOA 1RXUA 2ZKIA 3TNFA 3PUYA 4J49A 3JVUA 4JJZA 1FFCA 1GFSA 3UAWA 3EZ7A 3SMVA 3V4LA 3DOUA 4ZEMA 1DQPA 1XJCA 2IF2A 4HXYA 4IRUB 5DYYA 1S2IA 3SF0A 4WLVA 4CTMA 5DX0A 4FHFA 1J3UA 2Z9BA 1KGSA 3IOEA 3NWPA 4J16C 3L6UA 5DOVA 5ALHA 4S0XA 1K4YA 1R66A 1G8KA 2DKNA 4BPRA 4Z54A 4Q4JA 1QVRA 3ZQJA 1W29A 4CF4A 1C29B 2CXPA 3JQEA 1KHTA 1G4UR 2H52A 1U2GC 4TLCA 2IIQA 3OFSA 4KTTE 2IE8A 2DG2A 3RRPA 2Q3MA 4OYYA 5G02A 5THQA 1Q0ZA 3T12A 4WW0A 3O91A 1EJ6A 3I64A 4I1YA 1SC4A 1CYDA 1KMNA 3R5KA 2XQFA 4PCAA 1IUKA 3EDYA 2JIMA 5TE9A 1MIOA 2SKCA 1GQSA 4MEAA 4PNZA 2JH9A 2H5IA 1WCYA 2A1TR 3B3GA 3CF0A 2XOXA 4DJDC 5L3SA 5HGJA 3GJSA 3PQ3A 1VPVA 1JR3A 1RXSA 3DLPX 3PC2A 4ITUA 4R4JA 1IZ8A 1KPHA 4UHJA 1JLKA 1A9OA 3LYLA 1JKJA 1QM5A 8OHMA 3H9CA 3BTUA 3NHKA 2UVQA 1AMUA 1U90A 1Z4PX 2ZVQX 4BO1A 2O57A 5FWXB 3U3DA 3NIWA 1FNDA 2VDUE 4G0NA 5JHGB 1G98A 1MOSA 4ND8B 1VRVA 1BJKA 1GJRA 3FDJA 4R5MA 4UFOA 4YT4A 5CH3A 4UFNA 4PC6A 1WZUA 3V7YA 4PTLA 1WVMA 4OHRA 4W9NA 5MHTA 4LK2A 4HDCA 4JITA 5E4FA 1TF5A 1OV6A 2XVZA 3VJKA 1NN1A 2GJSA 4HNSA 4X94A 4ZI5A 5FBHA 4HJXA 1NUHA 421PA 1C8LA 4UBJA 1YK1A 5GOZA 2OFXA 3WYEA 1AZTA 4RULA 2AR7A 5LQKA 2JFYA 3I0ZA 1F06A 4KRGA 1SU4A 3M4JA 2ZTLA 1KI6B 5BSTA 3HQ4O 3A1UA 2Z1NA 5C3UA 3X1KA 3HUEA 4PICA 4YFYA 3KB8A 2QNIA 4HAZA 3QU2A 4DVGA 5CEJA 1KJJA 1T9HA 3D6NB 3T3EA 1KKLA 1T43A 3ZGNA 5C32A 5LFAA 4FN4A 3KZNA 3SYRA 1BOFA 2R97A 2HF7A 3E0QA 1YQWA 3PXUA 4HAVA 4NFSA 4Q3KA 5ALYA 1V16B 1AGPA 1G59A 1Y3DE 1QLJA 2C54A 1QTQA 5G0SA 2QBYA 4BMYA 4Z2YA 3BWEA 2P4EA 4MKGA 1I10A 5JJIA 1XBTA 2GF2A 1Y6FA 5K01A 3BB4A 3TUIC 2BH9A 2W0MA 3LOQA 3SDZA 4M9UA 1PZNA 3PL1A 3TDMA 1N0HA 1KJ8A 1JV2B 1NQWA 5I7SA 5I45A 4A91A 1GD1O 2R00C 3AWDA 1S7CA 3FD8A 1J24A 5DNAA 2YJNA 3DDWA 2P2DA 4K9OA 5IXYA 5FOUA 1TKCA 2XGSA 3BL6A 1QGDA 4JXJA 3ZVLA 3FUXA 3ZKWB 3BG5A 4P3OA 1GUZA 1QGED 4Q3BA 2O2XA 4M0MA 1VMAA 2EFDB 2VZ8A 3URMA 2YFQA 3N2EA 4G01B 4I08A 4TM8A 1P0CA 2PZ8A 3ZWKA 1CD5A 3E5RA 5D3KA 1FOEB 1ZGGA 1TEVA 4WN3A 1T8PA 3O2JA 3O5AA 3RFVA 1JEYB 3K1AB 4L0MA 1MRSA 3FPLA 4DMKA 1KK3A 1JB9A 4IIJF 4XR9A 1HOXA 4GYWA 4UCXA 3FF4A 3TW0A 2WJPA 4OKSA 2FZWA 7REQB 5KTRA 3THWB 1JPVA 1UOOA 2R84A 2FZKA 2R6GA 3PYXA 3SEAA 1AUOA 2AFVA 1RWPA 3W8NA 1PL6A 2QEQA 4G4SO 2JH8A 4FMDB 2NSLA 3GFQA 4YLYA 2OFFA 2YWRA 1EVYA 2BEWB 3HO8A 4H15A 2YNMC 4YYEA 1YNSA 3WLKX 3KUCA 2UUOA 5HNKA 3H3JA 2YFYA 3KV3O 4G5GA 4AJLA 5HCNA 1WWKA 1DGQA 1IWPB 3AL3A 5ANRB 3RSSA 4REMA 3ZHTA 3CVWA 5A7FA 3EFOA 2F43A 5C31A 4DNFA 1Y33E 3NGXA 4I55A 2NYVA 1YB4A 4G4IA 1GPLA 3MG9A 1DHRA 4ERXA 2B9EA 2Z2XA 3GMSA 4RVFA 3TKAA 1I30A 2KQUA 3E04A 4B7XA 1SUFA 4WOKA 1QLWA 1IK6A 4AMUA 2PG3A 3C14C 3JD2A 1K97A 5HX7A 4NCNA 1I7DA 3MWEA 5ESXA 3HH8A 1E6KA 1K8XB 2H5EA 4C2UA 4O4LB 1WIWA 1WSAA 3O0DA 1Y89A 2JD1A 1UC5B 3PQ5A 4R8SA 4PW0A 4MJ7A 4G89A 2PHZA 3I9FA 2VKTA 1T13A 1WKCA 2CZQA 1E1NA 4A8JC 2Q3HA 4DW8A 2AOVA 4Z4CA 2I8AA 1IUPA 1N7HA 4NS4A 2CSUA 3JWHA 4TKUB 4C6RA 4HDRA 2O9JA 2ZJ8A 2ACKA 2QQ0A 1XROA 3GOQA 1F17A 2Q5FA 1PLLA 5HILA 5ALFA 3Q3EA 3DOEA 3TSAA 1K66A 3ONDA 1NBWB 3IE0A 3A7DA 3P94A 4U2BA 4E5DA 5BSHA 2PSJA 4O5OA 3IEPA 4JYAB 2UXCB 2EJBA 1NXOA 3AUXA 4M1SA 5FPHA 4MPDA 3AF0A 1JZQA 1MJGA 1T10A 2F3SA 2CHUA 4NSLA 1JHOA 3E8SA 1THGA 2XGOA 3EVZA 4HXGA 3BWYA 5D51S 4YT8A 2W43A 3I6YA 1E9DA 4CT4B 4F5YA 4L6CA 3MAJA 1PF7E 1YVEI 2XUDA 2PZBA 1WD5A 3DDZX 3EISA 4RHYA 3P9IA 4DJJA 3K9WA 3BA6A 1Q92A 3QPVA 1Z6XA 3HR7A 1SOVA 4HN9A 2YNMD 1NVFA 3ZTTA 3OY2A 3C3AA 2J6HA 4JI0B 3PC8A 1OJ7A 4LG1A 4WJLA 2D27A 3S29A 1TAHA 3ZWBA 1AKQA 1WUKS 2FEAA 2G3YA 2QTMA 3B6ZA 3DYIA 2SNIE 3WX0A 5HKOA 2BGGA 2IS4A 1R6AA 1VCMA 1T9BA 1L4GA 5BXQC 4N1AA 2COUA 4EHAA 2J31A 4XYLA 4Z7JA 1V8PA 2DHRA 2WV7A 2PS9A 1QIIA 1S3FA 1AKEA 3EWIA 2I4IA 1W5FA 2LKDA 3BSSA 1WAMA 1OH5A 5TMPA 3BE6A 1ULSA 4JLPA 4NONA 2ZBRA 3W2HA 4UHCA 2IPOA 2XXJA 3DFMA 2PH5A 1N92A 2UYGA 4FFPA 1I9GA 4OJTA 1QVVA 4ZD6A 2E4UA 4ILKA 4JC4A 4PE5B 2Z3VA 2EWWA 3MGBA 1XZPA 1SD1A 1CZNA 2JFWA 3OU6A 2X86A 1H5QA 3EAFA 4JA2A 5EMJA 1XCMA 1SBZA 1IRXA 2C98A 5FUVA 2G88A 5LNK6 4XD2A 4QFMA 1OWLA 1IZZA 3JX9A 4GNRA 1LI4A 4JAVC 2BFBA 1H66A 2O8BB 1NIJA 3HCWA 2X6RA 3KXLA 4PSAA 1WVIA 3F7OA 3OKAA 2NU7A 3D8TA 4NBWA 3F4SA 4PAQA 1O97C 1P61B 1QFJA 4H1TA 4MRRA 4WXEA 3WZMA 2MHCA 1IAQA 4B9AA 2QJWA 1GVHA 4UTXA 3TNDA 1IY8A 4B3MB 1U0GA 1I2DA 1OFUA 2IDJA 2VDOB 2VHUA 1D2MA 2ZTSA 3GQVA 3I9NA 4Q7LA 4KVAA 3N0XA 3UT5A 2EKPA 3OKPA 2GPAA 1KI6A 4U0KA 1UBKS 4P32A 3TIIA 2D5LA 4PG8A 5I4BA 4ZHSA 4IDFA 4DNQA 2EZ4A 1GADO 1X7GA 1TVCA 3WBKA 3I2KA 2JBAA 1X15A 2Y1KA 1JJFA 1NPTO 4GRAA 4ESHA 3UUWA 1XA4A 2RGUA 5IG2A 3F73A 3R75A 3L49A 3QLJA 4BRUA 3ZH2A 1Q5PA 2DY1A 5DW3A 1A3CA 3TINA 5JNLA 1P39A 2ORIA 3DHWC 1T9GS 3WO0A 3PI6A 4X85A 4D96A 4J8PA 5EJIA 5DNUA 5ITVA 1H2FA 2MSNA 4I1OA 3ZNNA 4D9MA 3CU5A 4NH4A 2XLCA 2VNKA 3ACDA 3D1JA 1E7SA 4Q1CA 2CV2A 4KQFA 1ZX1A 5B6JA 5JDIA 1BKDR 3ILSA 3LY5A 2Q4TA 2QQFA 4X7MA 1NVDA 2PIAA 3D2AA 4GMDA 4ROTA 3WZ2A 1SKUA 1GARA 2H2FA 2A0KA 2O2EA 2QB5A 1YL5A 3DDSA 4CQMB 2P3QA 3ZS8A 3ZLBA 4B3TB 4KACA 2R4QA 3AVUA 1C4XA 4CF7A 2ZRGA 1OFGA 4DHWA 2I4LA 4RF3A 1A5AB 3THSA 5JQGB 4TKMA 4OJMX 3OLCX 3QW2A 2XB8A 5FUBA 5TC4A 3WV5A 4GZ3A 3UGKA 2VSNA 1FFSA 1YFMA 4QPCA 3AY7A 3K1AA 1HZJA 1G8AA 3MNFA 4PIPA 3M5WA 4HDNA 2BTEA 1O97D 1YS4A 2CBXA 1KFCB 3NHMA 3OFNA 1GNTA 2VAPA 3C6XA 3OQBA 5K05A 5KEIA 5B58C 3VTKA 2OM2A 4NBLA 4EJ0A 4FB4A 3TEMA 2ZSFA 1OBFO 3MWGA 4DIEA 1P9RA 3AVYA 4OH7A 4QJBA 1G8MA 2H07A 1MQ8B 4I46A 2V1UA 3K4QA 5FJJA 3EFHA 1VXOA 2F62A 3QA9A 2X7XA 3OTGA 3N70A 4Z53A 5AESA 3HEMA 4RACA 1KC1A 3ZVRA 3ZJUA 1A5SB 3DE6X 1P9LA 4G5RA 4MPPA 1H9BA 1EFCA 1XZDA 2VHXA 2WWFA 4N0EA 3L8CA 4NZOA 1Z4QA 3LQKA 4UM5A 4DSOA 2FETA 4PLFA 4MCJA 1W44A 2QZSA 5KPJA 3ZIAD 1ZG3A 2GHRA 1DKMA 4Z3KA 5LMUB 1MIHA 1V95A 5IPFA 1NRWA 3V4OA 4EHKA 3QVSA 1SCBA 2P9CA 3GN1A 4P4LA 5JAMA 3AXSA 1TA0A 1H1TA 2XF8A 4CMKA 4FB5A 4HWOA 2N9UA 5CU7A 1FTGA 3PZBA 1ZMRA 5JZSA 1DCKA 2VJCA 2FGJA 5KVQA 5CITA 2IS2A 2J5KA 4O4LA 3CX7A 3D4BA 1X38A 4RY8A 1YB1A 2C83A 4MWGA 1ZI9A 4NFHA 3SICE 3TV2A 1NI3A 2FLWA 2I4MA 2PX4A 1YQTA 3PXDA 4ARIA 3EQ7A 1FUQA 2DQZA 1OIXA 3I53A 1P3JA 4J7UA 1KBOA 3Q8LA 4UAVA 3BILA 2MMGA 4INZA 1E2FA 5I7UA 2O5EA 5A5GA 4LJYA 2E2WA 4PO8A 1PO7A 1YZFA 3MWLA 1SAYA 5IUKC 3TLJA 4A0QA 1VHDA 3E61A 3K96A 4TTJA 4YMGA 1PNQA 1I7LA 4XYEA 2FGKA 2HUNA 3EGDB 3AJ8A 3ER9A 4OOEA 2XDQB 4D44A 3MTIA 3LO8A 2A0WA 3TOSA 2EV9A 4C4RA 2J0UB 4LSMA 1QR2A 4IHKA 2IKQA 4KUHA 4L8FA 1AA9A 1TJYA 4KGZA 1QIDA 2JGKA 3M2PA 5EG5A 2IEDA 4TSRA 4ALIA 1LZKA 1LFAA 2FPWA 2GYWA 4F1KA 4MDEA 4GICA 3QWIA 3ILVA 4OCZA 4FYJA 3O8LA 1Z75A 1U2QA 4Z0HO 1JTFA 1ZH4A 2PMBA 3SS8A 4AUEA 1KDZA 1Q1BA 1Y5LA 4XUGB 5F5LA 4PXAA 3ONVA 3U17A 1ORWA 3TD2A 3BJEA 4N39A 1SCQA 2MSLA 3Q5GA 3T8YA 1E7RA 1WUTA 4IJ6A 3MBIA 4PTZA 1D5CA 2JI4A 1OC4A 1OAOA 2P67A 2PAAA 2X3FA 3JYNA 2DR2A 2XRMA 3EEIA 4YCLA 3U7RA 3KETA 2C7GA 2H0QA 4HNRA 1T3GA 4QAJA 3U39A 4H7HA 4UMEA 4X7BA 1N2CA 3ICWA 4FWTA 3QNWA 1WU8A 1FE8A 1I0AA 1AT1A 1KH2A 4I1IA 4QYSA 5DLDA 2AD1A 5JBIA 4LZOA 1P5FA 2ZYIA 3BJZA 1EVQA 1QK5A 4N18A 1IVYA 1Y7HA 4C0QC 5IYZB 2ZRPA 1J0DA 4AF7A 5JYBA 1WPXA 2HNKA 4MKFA 2A5DA 1MO6A 3K0FA 5AVTA 1BG6A 2FWPA 4AYXA 2XBLA 3INYA 2VJAA 2Q50A 4KL8S 5BURA 1XKTA 2OWEA 4ZT5A 2HOQA 1ORHA 2V0NA 3BFJA 3I8OA 4XLTA 2DMRA 3VPBA 3WIDA 1Y3FE 2OGWA 3MTQA 5FP0A 4FFWA 2XXAB 4B3RB 4GL2A 2XUHA 3OTQA 5KS2A 2JGNA 3AR3A 4RK4A 4QPNA 4DIKA 5JNVA 1HORA 1LBHA 3E1KA 3VJRA 3TRDA 3N74A 4OSEA 2ZUCA 2HF8A 1J2UA 3JYQA 3UFXB 1ZCAA 4DUYB 3AVPA 1ZMOA 1DJQA 1Q6YA 3F7TA 1PFUA 1IZ9A 2DSNA 3LP8A 1E3WB 1SN7A 2XMPA 4KU4A 1VCHA 1XQ6A 3ZTYA 5IKPA 3KYDA 1T8TA 3HM9A 3OLZA 1HT1E 4L2IA 3S6JA 2XRYA 1HDOA 2EX1A 4R2JA 3G23A 3OIFA 4NY1A 4C2AA 4UREA 2E6KA 1Q7GA 1GL6A 2QAGA 3AYZB 1QPZA 5AKXA 3ZW9A 1Q1QA 1MB0A 2PGDA 3OEHA 3CUEF 3RR2A 1SB9A 2EAUA 3E22B 2WR8A 4TRJA 5T3YA 4C5CA 2CFCA 5CW2A 3Q0EA 5ESWA 2Q4RA 2FRVA 3BIWA 4RL6A 4COOA 4DR2B 3PF9A 5KC8A 3AUYA 4QYWA 3ZY5A 5DHQA 1APBA 1GQOA 1UF9A 2QX9A 1U28A 1VKOA 5FOSA 3H1PA 2GJ9A 1IEWA 4K9RA 4NDAA 1GAQA 4ZWNA 2NPOA 3O1JC 3FOAA 1G9TA 1DOFA 1YR3A 4W8OA 1THZA 4XIJA 4U5QA 1V5FA 1IOWA 1OPRA 5GM1A 2ZJFA 5EMKA 4PPNA 3I4FA 4M7WA 5JQGA 3RVSA 1KAMA 4C0BA 4P7FA 4KOEC 1TRKA 5CXSA 1IN7A 1ECPA 1SC9A 3UTCA 2CMGA 4B8YA 1IJKA 1ZUNA 2F55A 1X70A 4IDGA 1COZA 2QVXX 3M70A 3ROPA 5C8VA 2PX6A 2LDXA 5BXYA 3TFOA 1OI2A 1R4NA 4GKKB 3IBTA 4KQJA 2KBFA 3U5ZB 4FDAA 3ZW7A 1EWVA 1RCUA 4Q82A 4QTUB 2PKYX 5KNCA 3QLUA 1EFVB 2X7HA 2GTIA 3SG0A 4ZRMA 4L16A 3GAAA 3M6VA 3FYUC 2I7TA 3I2FA 1N4AA 3AFMA 2AG6A 4WCFA 4WT7A 2JB9A 4NYJR 3D3WB 1XYYA 3NR2A 3GEMA 4ZT4A 5ALDA 1TCCA 4TTAA 5TSDA 1NN3A 4R98A 4B4KA 3OU2A 2QNRA 1F6WA 3BRWD 2UVDA 2XZPA 1O7JA 2Q21A 4K6GA 4MV9A 3SXJA 1C4OA 3O6VA 4J6EA 4OUDB 5K0GA 2J3KA 3FDXA 4X1IA 1YFEA 1KZ4A 4AMVA 2R751 2WSSA 3IQXA 1VBFA 4YAOA 4ZQIA 3VTFA 2N47A 3QA3E 3DH0A 4JI3B 3CISA 3WGMA 4DTCA 1K98A 2SICE 1G63A 1NY5A 3LRTA 1E9SA 4FCWA 1YZUA 1MOZA 1YZLA 2W2KB 3D59A 3R6GA 2OY0A 4TMTA 5E6RA 2ZUFA 4KWHA 1JYEA 2JFVA 1PP4A 1QHXA 3IFSA 4AY6A 3DTVB 2BUCA 3HJHA 2I6QA 5KDLA 4HVAA 2V98A 4LQDA 1AS0A 3VZPA 3I58A 4ZV4A 1KYVA 1JDVA 1R0RE 4F38A 1RI5A 3GGSA 1VLVA 3PFGA 1YB6A 5J1SB 4HTFB 4UEQA 4OL0A 1EHIA 1H5NA 1H0KA 2NADA 3QUAA 5DI3A 5JT1A 5ERGB 4I50A 4LKOA 4P6VF 1VMIA 2FFBA 1PWZA 2BF4A 2PRZA 3GUCA 3NJRA 4J94A 3KKMA 3V8BA 3ZLVA 2R68A 2XA1A 5TQ2A 1LDEA 4LRWA 1UANA 1M34A 1XTSA 1ZA1A 4M89A 2PE5A 1ZSNA 1OFTA 1X1CA 3IEVA 2IP2A 2J0UA 2JBHA 1AG9A 1XR3A 3DNMA 1CG6A 1C5KA 4KJXA 3VTZA 1WHSB 1XWOA 1NN5A 4KLCA 4JI8B 1JKFA 3NW9A 4FD3A 1T2CA 2PTSA 1ESDA 3JTEA 4H4EA 1YUNA 1ZM4A 1NYRA 1SIBE 1GPWB 1Q0RA 1Y7TA 3IYLW 3U7FB 4KNVA 1QZXA 2NAPA 2RAPA 3A32A 3FNFA 1FU8A 1FRQA 1O5IA 2X75A 3GVCA 3UKJA 3B36A 4G9GA 3V4ZA 5DSTA 3NOVA 5JRDS 5FXMA 3RV4A 3EPKA 3DHVA 3MINB 4M99A 3HDJA 3NYQA 1D03A 3OIWA 2H2HA 4H17A 2OAEA 2GBGA 3E03A 2RCYA 3AH8A 4MAMA 4XD7A 1M2OA 1V26A 4YS6A 3O8QB 1AHIA 4LFCB 3VC7A 3WS7A 4K6HA 1ANKA 2ORYA 1US8B 2BSXA 3AUFA 5LLTA 2YDXA 3OX1A 1BCSB 3OX2A 4OATA 3REQA 2AWOA 3K5IA 3WGQA 4GKJB 1PZHA 3L6EA 3EQ6A 3WKBA 1ULUA 1T9ZA 3D02A 4H3SA 1HMYA 2WK1A 2IW3A 4K5QA 2CVFA 3SQLA 3LBHA 3D4PA 1XDDA 2C9MA 2JHFA 4GBED 4PPGA 2WUWE 4TWJA 4FIZA 1GILA 3GX1A 1J07A 1Z5UA 5F5NA 2YXEA 3LQYA 4BV8A 4HZIA 4JEHA 2FV8A 4LRXA 2CL0X 3BSYA 4G0YA 5JAQA 2PD4A 3N07A 3CWCA 3EVEA 1RC8A 1Q16A 1SK8A 1SOMA 3TQIA 4KVFA 2O50A 4UATA 4X3CA 1C7RA 4P84A 2KSQA 1PR4A 1FURA 4IDDA 4N4AA 5B3AA 3RS0A 9LDBA 2VQEB 2CYCA 4WBNF 3SLGA 1NIPA 1ZOPA 1CRWG 4MP3A 4QRDA 2OC4A 4FKMA 4CR6A 4NJEA 3A04A 3OTWA 4ASUA 4JLBA 1E7QA 1WP4A 2PVPA 4N9WA 3A6JA 2Q5LA 3A25A 3MYRA 1U6KA 4IIGA 4LYEA 5GVRA 2QYSA 2F9MA 3HFSA 5LIRA 4ZI2A 1F3OA 4RTKA 2AJTA 1OAAA 2HPZA 4L4SA 5KCZA 4Q19A 4D26A 3DE4X 2FR8C 4LJ6A 2KHZA 1TPYA 4WDRA 5AHRA 5AOBA 3PQ8A 3DV2A 3OUTA 2NTYC 3UM9A 1L1QA 2DZDA 4ZKDA 1U0FA 4REQA 5CYGA 1EFRA 1GITA 2WE8A 3T9BA 3VDNB 3PD7A 3E22A 2JAQA 1DCFA 4ZC8A 1U02A 2JJ2A 3QPWA 2EDCA 2QROA 3MOGA 4CMEA 1Q0HA 5IXJA 2IU4A 1Z29A 3TWOA 1TC1A 3DYVA 5C7OO 5HW2A 1FP6A 4YI5A 3AHHA 1YR7A 4J6FA 1QUEA 1UOEA 1B1CA 4FC7A 4V24A 1HE4A 4BMXA 3AFGA 1GGNA 3UWPA 1G20E 2A59A 4GOKA 2ILTA 1PTJA 1ZVJA 3AEUA 3RTCA 2IHJA 4AM8A 2YVLA 4YUXA 3EXAA 3SY8A 2P27A 3AWIA 4NECA 2X0FA 4LJ4A 2YOFA 2NXJA 5TQ0B 1YHYA 5AKLA 1TVMA 1ZRHA 4X3OA 2E5LB 1PYDA 4UPEA 2GHIA 3R3SA 5LBUA 1HQDA 2IIBA 3SIPA 1ZXBA 2AKEA 5DGCA 5KNDH 4J0KA 1R9JA 1W25A 4JP5A 2IZ0A 2VJYA 3I8XA 4WADA 1EB8A 1L5MA 2YZNA 5AQ1A 1N0IA 3NHRA 1PDOA 2GUGA 5IVHA 5JSUA 3U7GA 1ECLA 1DJMA 3AC0A 3UF0A 4EA6A 4QELA 4EYEA 1Q15A 3R6VA 1JKIA 1REQB 1ZL0A 4JY7A 5EXPA 1WUJS 3FW1A 4LOKA 4BP9A 4D9HA 1TM1E 4ER5A 4QRHA 4H3HB 2H6EA 1AHHA 1QCCA 2I6TA 2V6IA 1EDOA 3QOWA 5KYTA 4G09A 4Q3DA 3N7UA 1ONPA 5E1OA 1BMDA 2A92A 5ER6A 5EKSA 5JAIA 2BONA 3D9QX 3NVMB 1VLZA 4KPUA 1J9ZA 3C7AA 4GUDA 2F9FA 4FCVA 5CA1B 1NT4A 1NU8A 1E0DA 2V74B 1JXOA 4TVBA 5F3DA 3AGPA 3PXEA 1ENYA 4UHFA 1W8IA 3JALB 4FEYA 4MRSA 3FFAA 3W3AD 4D97A 4DLRA 3LQRA 3OHSX 5D01A 2OV2A 1SQ6A 1YACA 3CRMA 3D6JA 3LXXA 3HLKA 4JR2A 2QMZA 4LF7B 1AC5A 1WG8A 3C3BA 4J90A 3R8CA 1LLQA 2CDRA 3L0IB 5A03A 4WFQA 1L7DA 3R7FA 4L76A 3N6XA 1YJ8A 3KYBA 5MGNA 3PHBE 1BVUA 1TVKB 3MC1A 1ZEMA 2FG5A 2R1TB 3MCZA 4Z9AA 3EC7A 3H18A 1OBHA 2PWYA 3GMIA 1PNTA 2HM7A 4C6TB 2X6TA 4P4SA 1CR6A 1YZYA 2DHDA 3NBAA 1AGXA 1K86A 3A05A 2ZBGA 1V11B 2VO1A 4IDCA 4FFBB 2P8JA 3R9KA 3ZZTA 2ADOA 4BMOB 1AH2A 2VZEA 1PS9A 2NU9A 2IEGA 3ZWPA 1PZEA 1QUFA 2GHTA 2C31A 1YFZA 4MRMA 5K0TA 2QD2A 3OPVA 1JFLA 5BSVA 2O7RA 4RPCA 4RZ2A 5B1HA 4BCDA 3MQ2A 1PJRA 3IULA 1DWOA 1NASA 4G1VA 3R7BA 2W6IA 4L5BA 2WWVD 5U1PA 3DBHB 2QVLA 1M1ZA 3SEQA 1VGVA 5C35A 4Q48A 3TFQA 1MO3A 2ZUBA 1WABA 4N6OA 1B0AA 3GD5A 4KIFA 1TAQA 2IYSA 4D4JA 4J0QA 4EY6A 3KLBA 4J9UE 1EDDA 1W85B 3T3MB 3GW8A 3AUJB 1UJ5A 1UXOA 1PCXA 1YVUA 1FP4B 1V8ZA 1P44A 1FFXB 3UFBA 2OCKA 1U0HC 2Y9PB 2W90A 3DVSX 4Y1RA 2Z0MA 4F3RA 1MH1A 2BZSA 3DLCA 3OQHA 1E5XA 4WZZA 4R2WA 5FYQA 5BPHA 3DBLB 2NO5A 2P6RA 1QO7A 1VJ5A 1Z0IA 4LZNA 1U1CA 4N03A 4GZ6A 2OGZA 1AGNA 2CEKA 5AOCA 3SSNA 3HXQA 1IHPA 2BTOA 4GI1A 4DDWA 2BGRA 1VFNA 4IIUA 2O0HA 1TDJA 3SSMA 2Y93A 5LU9A 2J9GA 5J2UA 1EM6A 3PYMA 4BNUA 3RVOA 3T95A 2H2GA 2BDTA 5T5QA 1JDUA 2P4QA 1EK5A 1XN4A 3NCTA 3GB9A 2CNWD 1UKEA 2ZB7A 3VR4H 2AOWA 3O8QA 3I4CA 4FOOA 5M29A 1FTSA 2FWAA 2Q0XA 2B34A 1FW8A 4KPGA 4AZ3A 3T7EA 4MB6A 4DCGA 3DZIA 2BM9A 3MTAA 1PJZA 2CHQA 2FE4A 3PR3A 4B76A 4RMNA 1UZMA 4NCXA 3UA4A 2VDPB 1DTWA 1RNLA 3BF7A 2GQ0A 1RQPA 1AK9A 1RJFA 2GK7A 4RPGA 5JR3A 4G84A 2Q0QA 2JFXA 1KWGA 2I9PA 1GKIA 1SY7A 1UMKA 1Z3IX 3KFVA 1DXHA 2Y1WA 4RGBA 5CUQA 3V5NA 4B7CA 4DXHA 1G16A 2ZYGA 3FKSD 3KSMA 3MJTA 3OJOA 3QXSA 4Y8VA 3AUSA 4Z3DA 4N41A 3WI7A 2M1XA 3ETEA 4RJIA 4YPFA 4W6QA 1K6IA 2G5PA 4MUFA 3UQZA 4P2GA 4GLBA 4O4HB 4NMWA 4TYNA 3G02A 3EIEA 3EZYA 2FG6C 1KF0A 1T8UA 2Q5OA 4K6MA 3GPIA 4X3PA 2CUZA 4GLFA 1U99A 2D8MA 1M0SA 3K9GA 1B8OA 3MAAC 1RAGA 2FXVA 1IB6A 2AKAB 2D1FA 1U0LA 1K08A 2O06A 5DLPA 3U3RA 4CBVA 1KVRA 1GG5A 3NBZC 4C06A 5BO5A 2RD2A 4WERA 1IWBB 4KRYA 2OG1A 2IEBA 3QEAZ 5D6OA 2EOAA 1OIWA 5TMDA 1RRMA 2RG7A 3F67A 2PZGA 2J7PD 2GDJA 4QOSA 4U63A 2DEUA 4TZTA 1FXWA 1T4MA 3C5EA 2QJRA 2X1LA 2WJZB 3OO0A 2XE4A 3KEGA 1UEIA 4MMXB 2H4XA 2ATEA 1NA5A 1IHXA 1KSHA 1YUMA 1V5GA 5EKUA 4E1VA 2H2DA 4LTNA 1PEAA 3WIEA 2H4YA 1VMDA 4FC6A 4P7KA 2YQZA 3UT0A 3WLNA 2C20A 1BMFD 1IUOA 1KPIA 2OZLB 2WYVA 3MTEA 5DHPA 4PFJA 3SYMA 3UOWA 4BFWA 1NNEA 1B2RA 4B6FA 1UR5A 3T1HB 2ZR8A 3GCZA 3H75A 3HUTA 1I1NA 2BEKA 3QVTA 1CJMA 2ZI5A 2P11A 1BHO1 4I55F 2JLYA 1U0OC 2OCBA 4WXMA 1T9AA 1TLFA 4XQ0A 4GZ5A 2RJOA 1F51E 1GGHA 1M2VB 3MJHA 3CR8A 4RJ2A 4LW8A 4B2LA 3K0CC 1PDVA 2C9OA 1MABB 1ZCJA 5GV8A 2QMYA 2CK3D 2DFLA 2ZTVA 4S05A 2J5QA 5GGXA 4X0EA 3H3FA 4P4NA 3A9TA 3TG2A 1Y34E 3KQPA 4WZBA 5IN4A 4JBYA 5L3VA 1Q0UA 1FYVA 1D2HA 1NQXA 2PKRA 3LBIA 3UANA 1V6CA 1WA5A 4ZHQA 5JRZA 5THXA 4MYUA 1I1QB 1VXRA 1VL8A 5I9TA 3HTXA 3EAGA 2QLTA 3L9WA 2P5SA 4QUIA 4EF5A 5KTPA 3DB2A 2J0VA 1TMKA 3SP1A 3DO8A 1DC6A 4Y0VA 5C1PA 3PNVA 4PYIA 1OA0A 2JFFA 3IJ5A 1YC5A 4GP6A 1ZXXA 2B35A 1YSCA 2IPAB 3KSDO 2AR0A 1NOJA 1EVIA 1UBSB 2A9RA 3B1FA 4LXHA 1V7QA 4PG4A 4BFXA 4MKIA 4HC4A 2G76A 5JCXA 3G8CA 4X20A 3X2FA 3E7PA 1LXCA 2V55B 1RI2A 3T4UA 1E3DA 4BNDA 4KO2S 2XYVA 2OORA 4FS8A 4X61A 3RF6A 5JZBA 2NVWA 4UBOA 1LH0A 2A5YB 2CNLA 3HBJA 5FYDA 2WNSA 3RQSA 1KRHA 1IATA 2ID4A 3E9MA 1GSOA 1KARA 2LUOA 2OGUA 2VDVE 3HKEB 2IYVA 3UK0A 3WGIA 5HJ7A 4TTIA 1HKHA 4Q66C 3P1JA 4C6TA 4ECAA 1XTJA 4UVIA 3RC9A 1V11A 3EN0A 4D6PA 4DBLE 2Z3ZA 1BZYA 2J41A 2JATA 2HVGA 4P5EA 5AH0A 3B5JA 5HUQA 2HT1A 1SKYE 4U00A 4DBZA 1P91A 4NPAA 3RUIA 5IHXA 1H69A 3ND7A 2DPYA 3SYLA 4IMRA 5JXWA 3UCXA 5L3QB 2D5CA 3FJYA 4FT2A 4JB3A 2CXXA 2GPSA 2DUMA 3ICPA 3QENA 3H8VA 4V0ME 4URXR 1XI2A 3NH9A 4MQBA 3OC6A 1CRPA 3T0FA 2DWPA 2VA8A 4EB6B 3TRKA 4C4PA 4P2BA 3HKCA 5BYAA 2BTQB 1FSGA 2IYLD 3AJEA 5JCOC 1CZHA 2XNSA 1C41A 1VHQA 3NWBA 1U1GA 2Z4TA 1FP4A 1POXA 3GEHA 4OL9A 4YP6A 4E07A 2AN9A 1GQRA 3II6X 1DDOA 1KHHA 3VBEA 5IUJC 4MTLA 3JZIA 1XJ0A 3IBGA 3P0FA 1U2TA 4LRSB 5AHXA 4JXZA 1E2EA 4G0QA 2QRMA 3GZNB 3KJIA 1UPCA 1DAPA 4Y3UA 1NG1A 1NFFA 2X4GA 1SHLA 3K53A 4A0GA 2C2MA 3KT8A 3CF2A 4ZO9A 3CJTA 3ND9A 2PLWA 3VNVA 4G4JA 1LI7A 3KZOA 5DYWA 4IDEA 4G37A 4PX2A 3K70B 4X7RA 4AWBA 5EZ6B 4B80A 2BD0A 4PFSA 5EXTA 5FT9A 2W2VA 2I76A 1BH2A 1ZSYA 4R1QA 4U2GA 5B3KA 3EZLA 1NHWA 3L01A 3HVJA 2ONYA 3B20A 1NQUA 3OF3A 1RYBA 3T61A 3LRPA 4TYQA 1E69A 3RNLA 3FX2A 3O4JA 1VPTA 2ZSKA 3ZI7A 4IFBA 4ECEA 4LDPA 4HAWA 1C80A 1YD7A 2QS9A 3H8SA 3QF4B 1WB5A 3NAZA 1VA4A 1V41E 1KY2A 3CUUA 2M6SA 3MWDA 5SZJA 1H3EA 2CYAA 3P2IA 5JDCA 3D0QA 3FYTA 5T4BA 2Q8PA 2FUSA 3AJ9A 3NDJA 2IZ1A 4H6PA 4JUCA 5IVPA 2O2ZA 2ODNA 3B6MA 5HMLA 4EF4A 2HHHB 3KT0A 4OFXA 3G82C 1NGSA 2P3OA 2VNIA 2IH4A 5HOQA 4EKNB 1OXBB 5FBRB 4XWOA 1GKKA 1XWIA 2C3MA 1CQJA 1Y8QB 3UWMA 2ODPA 3KHTA 3LZDA 4PBTA 2VYND 5CFZA 3VI3B 4X8MA 1T26A 4EVQA 3E8MA 4EW2A 1N1GA 3GT3A 3LA8A 3NAQA 1OI7A 4GXQA 3I04A 2GHQA 3CGGA 1IM5A 1MAWA 4IOMA 5F1PA 4EJSA 3F8WA 4ZCRA 3LVQE 4ND3A 2AR9A 1L3CA 3NH6A 3OCJA 2RK4A 4EFLA 3DVAA 3MJSA 4NS1A 4UTPA 1Y9ZA 4PZZA 2EKQA 4QNNA 2EFYA 1JFFB 2JIZA 1G8PA 3OT5A 5H3CA 1P4GA 3AERA 2RHDA 3GRAA 3WWEA 3ZCVA 4BZWA 2DFTA 1LD3A 4KUGA 3TXAA 2GM3A 1BX0A 1KIAA 1P7PA 2VCHA 3DNFA 2I1WA 2W5UA 3KKPA 1HZZC 5PGMA 4DSUA 1Y9AA 2REOA 3BBLA 4FMDF 3CMMA 4OVKA 1L7RA 1LPOA 3UJ8A 2WABA 4M2LA 1F0YA 1U9IC 1Q0SA 3AT1A 5DYTA 3EZGA 3SOPA 5IJ0A 1ID8A 2OZLA 1QC5B 1T4CB 2X19A 3E3MA 4OXYA 3WQSB 3EZ2A 3PFKA 4QQNA 3U6KA 3CX6A 3VZDA 4XGQA 4XWGA 3K30A 4XX1A 1O96B 1MG0A 4UNNA 1K0FA 5ALWA 2Q1XA 3A1SA 3E5MA 1W34A 3R77A 3TAHA 1CR4A 1G2OA 1TM7E 3QKTA 4GPZA 2PH3A 4HQNA 5DPMA 3TIVA 3A9SA 1OZ0A 3OWOA 3VNSA 5LMNB 2JGLA 1MC5A 4EGAA 3QX9A 4E4YA 4F7WA 1M2VA 1SBCA 1OFVA 3CUKA 2RKOA 4POOA 2PYIA 1JPNA 4LHEA 4ND1A 2A30A 4FIDA 1ODCA 3QMWA 3OP1A 1B73A 2OV6A 2OQIA 4H77A 4E70A 3P2JA 5JYDA 2X8LA 1DNPA 2O5RA 3Q87B 2XUZA 4XYGA 3W5UA 1GPUA 1VE5A 2QQGA 1D0SA 4O4LF 4ZIRA 3CZRA 4P83A 4YJDA 1EWQA 3R09A 5F7ZA 5LA6B 2WMNB 4EGFA 1C9EA 1XRPA 1R18A 1YI0A 2LRHA 1A5TA 1I9CA 4FDTA 3D5TA 3NFYA 4K2AA 1A72A 1A7KA 1XG5A 2B4KA 1J2RA 4DR4B 2A58A 3HP1A 3ZIUA 5H59A 1H9CA 1WZIA 1XPOA 2WJGA 5HYVA 2JJYA 1L7NA 2HIHA 5EGSA 1C1DB 2H51A 1G7RA 5HJ2A 3TOXA 2CMKA 4CL0A 3H7AA 4E31A 5E6UB 3OU7A 3HCEA 5DGTA 5EMNA 5HF5A 1IQ0A 1MDBA 3DD1A 1KE2A 5EGNA 1QS0B 1CUDA 3AOEC 4DQDA 4JH0A 3OA2A 1V4VA 2V5AA 1RQXA 3EK2A 2ZVPX 1PT6A 3V97A 3PGMA 2HI0A 3H2GA 3U40A 5FR2A 4WJKB 4A73A 3QKUA 9GPBA 4D9IA 1QRSA 5JAOA 5AJZA 1DEAA 1L7OA 4P4TA 3QUQA 1USIA 5UKDA 2PGOA 1G0OA 2R7LA 2VRWA 1BYIA 2X0RA 4ZANA 4MS3A 2IXFA 3GNLA 1YMUA 4Z1OA 4DLZA 1Y98A 3HKEA 2XQGA 3RJMA 5D3ZA 5JSYA 1SZPA 2FMTA 4LZWA 3HVUA 4OBWA 2P1DA 4DF3A 1UP4A 2GXAA 2ZBFA 2FKNA 3KG2A 3D43A 3ICCA 1XRMA 1AHNA 3N8HA 4G63A 1M6VB 4UCFA 2I2FA 2HQSA 2XCTB 2D1RA 2HQOA 4BLUA 4UD6A 4G25A 2R11A 4YCAA 3CUWA 2FR1A 2DUUA 4QUKA 1JJBA 4BBPA 1CUFA 2XECA 5I5EA 2P5TB 2E0IA 1ZAYA 3IMCA 2PGNA 3BJIC 4OQXA 1XALA 2RC5A 1NF3A 2O8EB 2WMOB 1Z6ZA 3WG9A 1EX1A 1I0ZA 4Y9DA 1L5LA 1ZNZA 1GG8A 5K3BA 2KS6A 1MC4A 4KN6A 1PGOA 5DGXA 1CJTC 5CHEA 5FTMA 4OOFA 2CJPA 4O25A 2C7VA 2OHJA 4QWWA 3H0EA 4A23A 4DGSA 1CW2B 3NBFA 4IZHA 4PEVA 1KFEB 5HQ3A 2EEPA 2G83A 4FOLA 4KRFA 4L8GA 4HZGA 5B4TA 3GUYA 5I7VA 4JT9A 2RHGB 3V4RA 4KQWA 3CNEA 4HGQA 2OKGA 3EG9A 5TIIA 4LJ8A 4JDUA 4DLNA 2Q29A 1Q3TA 4HAIA 3WP0A 4AJJA 5LJLA 4UEOA 4ZTZB 4OYRA 1FP7A 2UDPA 4ZT2A 4UHEA 3DE7X 3TTTA 1NVWQ 3IODA 3DB1A 1U3WA 1ZEJA 1D7OA 1YJQA 4HDSB 1SNYA 3I34X 3DZGA 4LSGA 3RSFA 4D4HA 5F7JA 2SCUA 1K5HA 2YMQA 4EUHA 4CEIA 4FW8A 2JFGA 4EPTA 5JAPA 2XB6A 3P0IA 3PQ7A 5CYOA 1XPRA 2FDRA 2XWSA 3KYIB 1E62A 1UBHS 2XKJE 4AKIA 4JIMA 3THYA 1GZSA 1JDBC 1NFQA 3FF1A 3GQBB 5F2KA 5A02A 3LOUA 5B6IA 2I91A 1T5IA 3ZNPA 2VAWA 3C7KA 4D9NA 3N8KA 1AQYA 1Q22A 4UBKA 1GYRA 3Q7SA 5EJ2A 4NCKA 3LDFA 2HZ7A 4IJWA 4ZO8A 2XY4A 4KIGA 4XPIB 4TZ6A 3JS5A 4HB0A 2XMSA 3MJCA 4JX8A 4N49A 1DBRA 2BV3A 2W6ZA 4HG2A 1RQNA 2AC4A 1QE3A 1EA5A 2VP5A 4I8XA 3N8DA 1WXHA 2G7ZA 2P0AA 4YAJA 2JRCA 3F2IA 1N6RA 2GETA 4LPSA 5JARA 5K4AA 3RT9A 4C0KA 1E8DA 2HA7A 3M5CA 5D3MA 3RWOA 2HV9A 3ZDFA 3AR5A 3ZVKA 1O58A 3WGKA 2CNBA 4FE4A 2NO9A 5FI5A 4A0SA 1KOGA 2BKXA 1E60A 1Y42X 3RAPR 3A9VA 3LYAA 3EJWA 4EMSA 1KS2A 4Z7QB 2ERYA 3RUFA 5DNCA 1SBHA 2Y0BA 4FE7A 3ZN2A 2R5NA 2VH1A 5JQGF 5LP6A 1IEXA 5EIWA 3ZH9B 4QJ4A 1QIEA 4RQBA 3VFDA 1UAAA 3THXB 2IOFA 5ITWA 2P9HA 4NFLA 4CLHA 4LF6B 1UPTA 2WM2A 3C8UA 4BKPA 4IL5A 5ED0A 3ZI4A 4IINA 3UB2A 1ORTA 1V4BA 1BGXT 5AVSA 1SUSA 3PNKA 1DSSG 2IXAA 3G0GA 3QW4B 4JNKA 2VVTA 1BX1A 1VE3A 3NTXA 3TE7A 1MOPA 1N9ZA 3HUUA 3PUHA 4E46A 4XVHA 3ID6C 4JVMA 1YVRA 2GEBA 2J7KA 4WKPA 4L8VA 2XJ9A 3RFTA 5KYXB 4KREA 4KGVA 1E5QA 1A5BB 3O47A 1NUTA 3KAKA 2BMAA 1QC5A 2XXBA 1JAIA 4IPTA 2WMYA 1PJBA 4YPOA 5K8UA 1U04A 3SX0A 2WUDA 2NSYA 4P33A 4HTAA 4D8WA 2FMHA 1Z0JA 4L74A 4JJKA 5CYPA 3D64A 4GX5A 4YPVA 1B8PA 3NHWA 4K6KA 1Z7WA 3CZPA 2CXNA 4FK8A 1KAGA 1JH9A 1AO3A 1GUAA 3ZCUA 5I7WA 2A9OA 3L1VA 2HO4A 5HKLA 2PY6A 1RHMA 4GPBA 1S1CA 5FUYA 4KE6A 2P77A 4PHTA 4EPXA 3EXHC 2B2CA 4C4OA 4TLLB 4BGVA 3L0CA 4U6SA 2XB2A 4CMBA 2ZBQA 1XF9A 2FSIA 3NYWA 1SXJA 4V02A 1GHTA 4YALA 3SR4A 1GA4A 1OJLA 3PUWA 2O1EA 4BJ5A 4QPDA 2BFCB 3HPRA 4UKDA 3EGWA 4F5DA 1MHPA 2A94A 3AVQA 2BF7A 3RW9A 1YS6A 4EJMA 2W2PA 4KUEA 4YRSA 3G0HA 1BGVA 4UAUA 2VKQA 2PZEA 1L8AA 2CDNA 3EVFA 2PM8A 4GIBA 4L0CA 5H83A 4BB9A 4Z7OB 1Y5RA 1NMQA 2X40A 2XMBA 3LPLA 4JUDX 3GFGA 4CL3A 1Z8FA 2I1QA 4OJKA 4AECA 5EVCA 2YHUA 1YE8A 2C7PA 5CK4A 2LP4Y 2QN1A 4BGDA 4NXMB 3JYPA 1DBWA 3RVPA 3AKZA 5ICGA 2SKEA 1J9EA 3OLVA 2VUHB 2N1BA 4F04A 2DQSA 5IBRA 2HXSA 5COBA 1YJAA 4IYRA 3OPYB 3L8FA 4ENSA 4K3UA 5G40A 3OUZA 3D4LA 4P3YA 3PD0A 3AK4A 3CEPB 3QWBA 4V0RA 1XELA 1BVRA 5J43A 3GCDA 1F48A 2MWMA 4G56A 1NMEA 4WXHA 3B1YA 5FWYA 5BNTA 1V47A 5ALTA 3WO1A 3CC8A 1QGUB 1SUDA 3ZE7A 2Z98A 2F3PA 3BS4A 3RC7A 4BMCA 4BNKA 2WOOA 2Y0EA 1KA9H 1MF7A 2PKWA 1N2ZA 4Q6BA 5CA1A 1XMIA 4GPD1 4HUQA 1S1MA 1IONA 2DX7A 3WL6A 3MFYA 5EJFA 4C2TA 2E4WA 2ZSHA 5MFPA 3ZQUA 1PLJA 1QAQA 3M4NA 2H00A 2C97A 2JDID 5FWDA 1UP7A 4ER0A 4ZJYA 3NHLA 2O8EA 2VSYA 4G5FA 2BLLA 1M10A 1UJCA 3ZY2A 4CM4A 1JKXA 4XWKA 3QVXA 4YV7A 3A9CA 3GFPA 1IY1A 1ESZA 1H4VB 2OBXA 3RYIA 3H05A 4BFCA 2C8JA 3ZGZA 4AMZA 2OYCA 5I51A 4RBNA 3JQBA 1JQKA 3MT9A 2MIIA 2YZ2A 2X42A 2ZWIA 3K0EA 3U13A 2ZYAA 3I4LA 5E6SA 4P36A 5BWMA 3LHFA 2V58A 2OK7A 1GKYA 4ZPXA 3RRMA 1ZUWA 3TZCA 3L6RA 1Q20A 3IHTA 4IOJA 4WFJA 2OQVA 5HXAA 2PRSA 5JZVA 3EUEA 3QYFA 1X86B 3HB1A 4PZYA 2IHVA 3INGA 1ENPA 2QLBA 4LOIA 1W35A 3S40A 2Y1EA 3O92A 3SF8A 5JWRA 4P0PB 4M0DA 4AZVA 1UFVA 3BXGA 1ZITA 4GPTA 4IIDA 4KXVA 4I6JA 2AMJA 2V5UA 5A4AA 4CG2A 1U3DA 2C77A 4E5YA 2C7RA 2ZGVA 3UMYA 4M9ZA 1E6UA 1TUIA 3WRYC 1N2XA 4JJAA 2FPIB 1GGVA 3RYFA 1ZY2A 1T1SA 1G8YA 521PA 1EK6A 3M6XA 1L5RA 2JLBA 3BXXA 3JQ9C 3AM4A 3G0DA 5A9TA 1CE8A 3J81k 3GQBA 5IDWA 2WSMA 4MQFA 1EM8A 2W2LA 2XAAA 3FFBA 3COWA 1ST2A 3FWZA 5DI9A 4BDTA 2Q5HA 3T1YB 3IA2A 1AKMA 3HPQA 5I7OA 3UPTA 1B93A 1O87A 2A3NA 3I62A 1CUBA 3ER6A 3A4NA 3KZCA 2QUAA 3A14A 3CR3C 4O4IB 4MWEA 1OF1A 5GP1A 1EP1B 3KRTA 2P6MA 5D86A 1M7BA 2YUIA 4OI1A 4CR8A 5F9HA 1Q0PA 3S5UA 2WZDA 4O29A 4D45A 2A78A 3PCTA 3PGLA 3C6MA 1KO5A 2J3DA 4GBMA 4HEA1 2ZI6A 3ITKA 4WI1A 1QB8A 3TS1A 3WDMA 3ZWMA 5LXTB 1UM8A 1P5JA 3PNOA 4EO7A 2D0OB 2IV7A 3D8BA 1GM5A 3AHIA 1GGMA 4XJTA 5AJHA 3GA7A 2OENG 2W8BA 3CTMA 4BP8A 5JHHB 1KGDA 4C87A 3AW9A 1RM0A 4TV8A 4NYMR 4A0HA 4R9SA 1HG0A 3BGSA 1E3QA 4RCZA 3F47A 2IPLA 2QPOA 1GU1A 1OXUA 3TQCA 4JGGA 3GD7A 3OFVA 3LQ4A 4TT3A 2WYOA 4KQ1A 4KO4S 4KN8A 2MINB 1FFWA 4S24A 1QCDA 2GBLA 2W2XA 4YDRA 3ZQ4A 1W4RA 2JH3A 2ZIEA 2WKQA 3L0BA 1FRNA 1PR5A 2JA2A 4DDMA 2GFIA 1U7HA 1EK0A 5KWJA 1SWWA 4B6GA 3IHWA 4EG8A 3NDBB 1EGMB 3DD5A 3IP1A 3SKXA 1BS1A 4RWEA 4LJ5A 1COWD 1RVDA 2I4NA 5E7MA 4OK5A 4JI4B 4CUZA 1CY1A 2Y0DA 4LUCA 4N7RA 2IHBA 1MEJA 1TF2A 1Y6RA 2P2YA 4JNCA 1DIAA 1QRTA 1N6HA 3OBIA 5AI8A 2LBPA 4FEGA 1FFDA 4DV0B 1NURA 4Z0PA 1SXPA 1UH5A 2A14A 1QOQB 2IYUA 2FPGB 4U02A 1Y1PA 1W9HA 1WZNA 1JQJC 2BFAA 2VQDA 4JODA 4C7XA 1V43A 4D98A 4DLAA 1C1XB 2LTAA 3O3CA 4W1RA 1J4AA 2ECQA 4J76A 4XTRA 2V6FA 2ZZNA 2OFPA 3MB5A 3UUEA 4G9BA 4G85A 4U9UA 3TKYA 1ZK2A 4P93A 4ZMBA 3AW8A 3CLSC 2Y1CA 1Y8CA 2YH2A 2PUCA 1O89A 3AR8A 1C50A 1CY8A 5GOTA 4XFKA 4X91A 3FZYA 4CJXA 1I2ZA 3JWIA 1L7AA 2GKGA 4QXOA 5L7YA 1G8HA 3KD2A 1GAXA 5K3FB 3JWJA 3C4QA 3RVKA 4DA6A 3RVBA 3R6QA 3VDXA 1HSOA 2QOEA 2W6OA 4JYMA 4YAUA 2VHYA 2ODQA 2POCA 3G2IA 3IO3A 1R10A 3RIGA 3O4FA 3PE4A 4PCVA 3E48A 3HBFA 1E77A 2QVBA 3VC2A 3VKVA 3WLLA 1TO1E 4YHHB 1I6LA 5MFZA 1RS0A 4R7ZA 3O31A 3COSA 2CLFB 2UYQA 5JD6A 1Y4ZA 4QT4A 2X9QA 2QSUA 4EG1A 2ZOSA 3CRZA 4YK7A 1MTZA 2AF3C 3PFFA 4MVYA 3TIFA 4GVXA 3W78A 3W8EA 1OLUB 4E3WA 4LHXA 2R0QC 3OLXA 3SZRA 3VR1A 2H11A 3PGA1 3QEMB 5AVQA 4MWSA 1KJYA 2Q28A 3H5RA 2GAAA 4A8TA 1QTRA 5JE8A 2UXDB 5K3EA 1H8EA 5AKGA 4PSVA 4ER3A 4Y6LA 1P5RA 2ANBA 2COEA 1ZD8A 4GX2A 2XF2A 2LXNA 2J5XA 2ZUVA 1MB3A 1XD8A 2D2FA 4RMIA 3EZ9A 4INPA 4N5DA 5FOTA 4C07A 2VWQA 3LOPA 1L9KA 3Q3CA 1FVOA 1VG9B 2GK4A 3B3QA 4I14A 3L8YA 3SU8A 4J03A 4BNTA 4C76A 1T4BA 4PSUA 4DKXA 4OTZA 4E12A 5ICCA 5IT9A 4HS4A 1VJRA 4DPMA 4QSHA 3CB4A 2WHPA 2QD1A 3PNPA 3ADDA 4AKGA 1E4EB 3R5JA 5HFJA 5KNDD 1EHCA 2VP9A 2FUG1 4AFNA 3CX8A 3DBIA 3I5XA 2DWUA 5HR5A 1XEFA 5AHWA 1VTKA 3CLSD 2Z6VA 2AN1A 3KQHA 1PHRA 5EERA 5HKAA 4QGFA 3B85A 2PT9A 3BOSA 2A0XA 5FI3A 3WSWA 1K2WA 4BEVA 3KOWA 2R6JA 2QYOA 1LV7A 2FLKA 2NQ8A 3CH5A 2OO3A 5DBFA 2J33A 5IK2A 1MJFA 3Q11A 2Q27A 2Z09A 3A8TA 4LV8B 3GR6A 4BBJA 5A4FS 3ANYB 4TSFD 4HRAA 1W4BA 1OU4A 4FFLA 2LWIA 4F3NA 3BWBA 2I0FA 4EI7A 3H8WA 3OG9A 5B3JC 4N7MA 4GPEA 5LLDA 5DHFA 1EYZA 1KC3A 1ZA2A 5KAPA 1ZCBA 4TZ0A 5FUXA 1PVDA 2IOHA 1S89A 2D2EA 3F74A 3FVRA 3IILA 3LL4A 3ZD9A 4XSVA 5THKA 2OGTA 3FOWA 2OK8A 3BFPA 4MW2A 5KWSA 1XNQB 4M1KA 2CJFA 2GPWA 3IVGA 3X2SA 2ZIFA 1MHTA 1YUBA 4RHCA 1Z47A 1EE2A 4DV7B 4K9LA 1QO0D 2FPIA 2RGBA 2V7PA 3VJMA 1QE5A 4FP9A 2A1TS 2IEZA 4S1WA 1JECA 1VOTA 4JGIA 1FXWF 4KO1S 4KR0A 1VCOA 1IN5A 4TWAA 5TPWB 4N40A 1HDGO 4JUBA 1BHJA 1M75A 4OBXA 5G0UA 5TARA 4PYKA 1S4QA 2YXPX 2WFAA 2C2KA 3NP7A 1NQTA 1Y81A 1PFVA 4FZRA 4HEHA 5FWAA 1E9EA 3AJRA 4GLOA 1TVEA 2CLDX 2Q1TA 3N28A 4GQAA 1T3TA 1P19A 5GY7A 1C0LA 3ZWVA 5E1BA 3HWSA 3ZLTA 1S2DA 4F56A 2J3HA 3RUEA 4FYXA 2V7UA 2PMDA 2OHFA 3IURA 2WPDD 4TV9B 3GEBA 2W70A 4XGRA 2FFAA 4WAUA 4B2YA 4NYJQ 3PQ6A 1SEVA 4EA7A 1R74A 2FB9A 4N76A 1E3EA 1GG9A 1X80B 2OL4A 2XJ4A 3OQVA 4S2EA 5ISMA 2O59A 2QTNA 1M2KA 1H85A 3B6JA 4RY9A 2P41A 3JPYA 2J07A 2ZANA 2I99A 3FFXA 1FJ2A 1II9A 1XN1A 1TA4A 1ZIPA 4I5GA 1QZ3A 3NS7A 3P2EA 1JRLA 3F4KA 1RU3A 2VJMA 5EZYB 2B21A 5FNVA 4PF1A 3R7SA 4GUAA 2ZQZA 2GBFA 4IDHA 2CVZA 3B7WA 3RASA 1CC1S 1Z5OA 4EFKA 5KYUB 2O07A 4UM8B 2ISQA 1LWOA 3UB3A 2PVSA 4IDNA 3U61B 1GGJA 1T6ZA 2W9XA 1VCIA 3T0GA 5DNDA 4MYHA 1I2AA 5K45A 4KP7A 1YJBA 5K6AC 5G2OA 3VR4D 3KVVA 1C3LA 4HH3C 2A9FA 2NG1A 2NSDA 1OT5A 5LOVA 1YRHA 2X4IA 4ADLA 4UUMA 4BMPB 3GV0A 2JFBA 3L5OA 4PZPA 3R3HA 2KJQA 1BROA 3TD6A 1RWNA 2Y67A 3V1YA 2C2BA 3L0OA 1JG4A 2FPGA 3H4IA 3IUJA 4H0FA 4WK6A 1IHYA 2QTVB 3N3BC 2JHGA 4RQUA 4LDQA 1YRYE 2OVFA 3R6LA 4AQ7A 2NU6B 3N6VA 3M3DA 4GDFA 1MB4A 1PL0A 2RDMA 3MOIA 4W6ZA 3TGWA 4W9RA 1KJZA 2AQHA 4GBJA 5AJVB 1C30B 2CYBA 2QRVB 3C1UA 3ANNA 5AVYA 4H35A 4QOIA 1WDLA 1FMJA 3NYIA 4D4GA 3OC0A 4IRXA 4WJZA 3WTCA 4AULA 1V3UA 4IXNA 4QFBA 1I5OA 4DWVA 3O8RA 1Z63A 1JIIA 4YV2A 3HJAA 3BT7A 1LVHA 5CDYA 5DM2A 3DV0B 1T6XA 1T35A 5ARDA 4ZVOA 3DQZA 1MT0A 1Z5GA 1OZHA 1DT5A 1VLLA 2P3LA 1D6JA 2ZRMA 2Q6KA 3QE0A 5ER9A 5F51A 4NJMB 1N5KA 2XZDA 1WSDA 2ZJ1A 5T8KC 2DH5A 4ARSA 1Z4KA 4AKEA 3PX3A 4L57A 2OZEA 4E51A 3COPA 2L42A 2Q3DA 3HE3A 5JMTA 2ZB2A 3OE1A 3Q3HA 4MQLA 3EW7A 1L3BA 3LYHA 4BRZA 4IMJB 1LPSA 5G1NA 3OIGA 1E0JA 1DG3A 3O95A 3PFWO 1QX4A 2DCUA 4UCQA 4UTOA 1D2CA 4A8JB 5JLJA 1EPUA 1T2AA 3L6DA 3P2YA 2OLKA 4I99A 5CB8A 2WQZA 1UMCB 2OILA 3LNTA 2JAOA 2NAFA 4EG4A 5JTUA 4HLNA 1ECCA 4FOSA 1J8DA 5BPFA 1ESNA 1EMDA 2H1VA 2NT4A 4IQGA 3S8MA 3BJRA 4NE2A 5KHLB 1QYIA 1H2RS 4BQIA 1JMYA 4RD3A 1IBKB 3H2ZA 1R5OA 2G70A 2IXGA 1CETA 4ALLA 4DA0A 2EP7A 3LWDA 2FW6A 3GPCA 4ZYUA 5LJIA 4E08A 1JHQA 3SZOA 1TJWA 2OV4A 2IY8A 4J16A 1ABFA 4ZCIA 3L9XA 2XKAA 2Q5EA 2BHRA 3AIOA 3QFSA 4MV4A 4F0JA 4BQSA 1ZW6A 4M0EA 2XHZA 1J0AA 1N4DA 2XYPA 1M76A 4URUR 3L0SA 5ALIA 5HCIA 3L6OO 1ULBA 5EY5B 3ZWAA 2D7CA 1G5QA 2GYUA 3HRIA 3TZ6A 2IELA 1WX1A 4W1QA 1Y37A 1XZKA 4CHTA 1DFGA 1IOLA 3BX1A 2DE0X 2IX9A 5JI3E 2OHVA 2DECA 4IXWA 3A6FA 4KQGA 1Q1NA 3K1YA 3DONA 2H7CA 3DT8A 4FGZA 4LNUA 4U2CA 2C00A 3UV3A 4UNPA 3PDIA 4ZQGA 4HXEB 5GMOA 3KQOA 3L4BC 3LTNC 4D92A 4B3FX 4EG6A 3L8HA 1PJQA 4JB2A 4AURA 4F91B 2G0AA 4QRIA 1JXAA 1L4NA 2VDWB 3JU3A 3NOOA 4J0IA 3TIXB 2JANA 4B48A 1KZYC 1SVUA 4M4SA 1PG2A 4EPVA 5IT5A 4O4HF 3UYKA 5AVVA 2XKBA 3G2NA 1VDZA 2PX8A 4UPVA 1UOQA 3GRYA 3ZOKA 1AQNA 3DLIA 1U5BB 4WOCA 2DHQA 3GJZA 2RK6A 5EE5B 1KYIA 2ZSDA 5I8ZA 5LQDA 5A6VA 3KEMA 1XHFA 1U1DA 2JIQA 1HO3A 1UBNA 3G88A 3LHSA 4NLLA 1NN0A 2A57A 4C7BA 4C08A 3T5AA 1Q17A 4Z4HA 4JR0A 4W5WA 3G2QA 3L43A 5ALMA 3KXKA 4Q93A 4UUQA 4EF6A 4K8OA 4BLVA 4B3HA 5KO2A 2RGAA 1U15A 1DVRA 2Q0HA 1RWWA 1YIDA 3OSUA 2JI7A 2HSGA 2OR3A 4JVOA 4XQGA 5FTNA 5TPWA 3WLMA 1SVLA 2GZ2A 1HFKA 2I55A 4F93B 1TX4B 4TZKA 2ZE7A 3GLHB 3VVMA 3CHYA 2H3HA 4KQKA 2OB1A 4PLZA 4AK9A 1W6RA 1J8QA 1SCIA 1NDUA 5CP8A 5FTWA 3F46A 3TDNA 3H11B 1IVNA 1E1KA 1VSTA 5EJEA 4X54A 5BW8A 1FVFA 2GM9A 5KI6A 2ZIWB 4Y6QA 2OESA 1W96A 4TV9A 1VPWA 1QHIA 3OF5A 3CUTA 4D5EA 5BV7A 1L5YA 1GPH1 4ENVA 5ENVA 4BB6A 1MEEA 1P9WA 2HSJA 4QXRA 4QUJA 1ODKA 3EDMA 3AKDA 5AUQA 4F4IA 1FLVA 2DT8A 5E9JA 1C3EA 4NCHA 3GLIB 4YCBA 3C5WP 4RTOA 3AM5A 4E4RA 2J9ZB 4YP1A 3KU4A 4LDZA 4M3NA 4Q4HA 2VAXA 2WD7A 3OY7A 5K2MA 2CE7A 2B8NA 5M3BA 4EZEA 4ZZ0A 4CIDA 5C4IA 3NHBA 3BORA 2PA0A 5KVVA 4H7DA 3KQTA 4E33A 2ODWA 3VKUA 2DCMA 3PCRB 2GS9A 4ND7A 3DQQA 5L3ZA 3OECA 5I8WA 4N5LA 2PLAA 1FPMA 2B92A 1YRQA 2W22A 3N9IA 1E6LA 3IAS6 5KMGA 2FHPA 3R5XA 1P4SA 1CUCA 2NYAA 4ZI7A 2A88A 3ICQB 1JR6A 2YFKA 1EFTA 3P45A 5FLYA 4Q9KA 2M1ZA 3IO5A 5REQB 1JQEA 3EULA 4LBVA 4BBAA 3BH6A 4OXQA 2EW2A 4NBNA 4YQYA 1AHPA 4GMGA 4MUAA 5LR6A 5C4GB 1TYDE 1PVVA 1UJ6A 1W30A 4NNJA 1W52X 4DNPA 4ER6A 1RHKA 3GLGE 4QDZA 2ERCA 1GZVA 5EHXA 1TKAA 2GCNA 4RA6B 1E0KA 3A28A 1ST3A 2BFDB 2YHAA 4Q3NA 4WZAB 4NXNB 3I6MA 4D9JA 4WOJA 3LT0A 4R8KA 2GXSA 1TJ5A 3OP4A 3CVXA 3U5TA 3AONB 5LMZA 1Q0TA 1QNFA 4Z8YA 3T9AA 4Q7QA 4LGYA 2ZIGA 4NATA 5EJ9A 3B52X 4FZ5A 1EFHA 2PANA 4G1FA 5A5VA 3HEBA 5TY0A 2ZB8A 3DOIA 4TTTS 1YB5A 3QIVA 2JVJA 4K86A 2N42A 3DLHA 3H0KA 1KP9A 4POAA 2ES4A 3BDVA 3UMRA 3KQLA 1QIGA 2XQVA 5IKXA 1U1FA 3I9OA 2IV3A 2GEKA 2ZWVA 2A0FA 3Q0TA 3QLVC 1HY1A 3IESA 3D6UA 3DV0A 3OX3A 3FYCA 4KODA 4L7VA 3UA3A 3FOFC 1P0FA 1YHNA 4XEHA 4I7EA 4M22A 1RAEA 1HTTA 1ATIA 3CINA 3IEUA 4HF7A 4H2DA 4ZCLA 3TTWA 1NW3A 1QG2A 3AILA 5ALLA 1WNFA 5DMHA 5A04A 2GASA 2IU6A 5JCJD 3KS9A 3JZFA 3D8UA 2HBZA 4MHOA 4JX9A 3N0WA 1GXSB 1PV2A 4K9MA 1WLSA 3U7IA 3PRHA 5D1NA 5KTYA 1ZINA 5T7BA 1YA6A 4FMPA 3ZX5A 5KOJB 2EJTA 4QDXA 3L18A 4RV9A 2QWXA 4NPHA 1TTPB 3E2PA 3PIDA 5EWLA 5SY6A 3PDUA 3R7NA 3E7WA 2GLUA 3T4XA 4WESA 4B3DA 5EUBA 4FLFA 1WSBA 2NNWB 2PX3A 4MPRA 4CKZA 4HDMB 1Z68A 3COVA