4YIHA

Crystal structure of human cytosolic 5'(3')-deoxyribonucleotidase in complex with the inhibitor pb-pvu
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
192
structure length
192
Chain Sequence
SVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of a bisphosphonate 5'(3')-deoxyribonucleotidase inhibitor
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 5'(3')-deoxyribonucleotidase, cytosolic type
total genus 70
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 3.1.3.-:
pdb deposition date 2015-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4yihA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4yihA01
1RLOA 3ZWDA 4B6JA 1LVHA 3F9RA 3NUQA 4DCCA 4UMEA 5AICA 4ZEWA 3ZVNA 1Z4MA 1TE2A 4UAVA 3SKXA 5AIBA 4IG4A 5AI9A 2ZBFA 2G06A 4QQFA 2HSZA 2WM8A 1ZJJA 3QUBA 4XQ0A 2AUTA 3L1UA 3L8EA 3U7HB 4XOUA 3OCZA 2QLTA 4DWOA 5A3RA 4FFDA 4OCZA 3ZVLA 2G80A 3L8GA 1XP5A 2I55A 5A3QA 5ALUA 2ZG6A 3A1EA 1ZOLA 3AR6A 5AW2A 2D2VA 2ZXEA 2PR7A 2OBBA 3KDPA 3A1DA 4UW9A 2YJ5A 4YIHA 4Y2TA 3WKDA 3BA6A 5AVQA 3N07A 1F5SA 2WF5A 3FGOA 2FI1A 3W5DA 2HEGA 4OHFA 2NO5A 1Z4QA 1Y8AA 3B9RA 5AW5A 2B1QA 4UU0A 2P27A 2ZBDA 4Y2PA 3AR8A 5FP0A 1AQ6A 2HHLA 1MH9A 2FDRA 1Z5GA 4NV0A 3E84A 1RMTA 5AI8A 3ZX5A 2AGVA 2B8EA 4ZEXA 1J8DA 3QU5A 4KN8A 3TLMA 5AI5A 5AIAA 3A1CA 2YMPA 4AS3A 3FPSA 4Y2QA 3MPOA 3U13A 1WZCA 3R4CA 3BWVA 1T5SA 1L8OA 5AKGA 3PDWA 5ALLA 3UMGA 3W5BA 2YFYA 3N5KA 3WK9A 4ZEVA 2FUCA 1O08A 2NO4A 2WF6A 3E8MA 4L6AA 1YJ5A 2GHTA 3QU7A 3SF0A 3WKEA 4UASA 2BDUA 2GHQA 3PCTA 1TJ4A 5AM4A 3QXGA 1NRWA 2OYCA 2ZBGA 2B82A 3NALA 1QQ5A 2RB5A 3SD7A 3P96A 1K1EA 5ALWA 2P69A 5ALZA 2C4NA 4HGPA 1NF2A 1WVIA 3KC2A 2FUEA 2CN1A 4Y2YA 1ZRMA 4BKMA 5T41A 1ZD3A 5AKHA 2IOFA 2WF9A 2Q4TA 5AVXA 4I9FA 1ZRNA 2G1AA 2W11A 3DAOA 3KOOA 3N8GA 2MSNA 3B9BA 3RFUA 5AI0A 5ALQA 4UAUA 2RARA 5E0OA 2JAUA 2AH5A 3MN1A 2FPRA 1EK1A 3U19A 5ALRA 5ALXA 2EATA 5AHXA 2IYEA 2IOFK 2EARA 4GXTA 4HAIA 1RKVA 1TJ5A 4BX3A 1QH9A 3FZQA 3NASA 5AM1A 2GMWA 5ALSA 4Y2UA 5ALHA 3MMZA 5ALYA 5AI4A 4YCLA 2HO4A 2YMMA 4PNHA 5AKIA 2DQSA 3W5CA 1KYTA 2R8YA 3OPXA 3NRJA 4EZEA 3VAYA 4GIBA 3NANA 2FPSA 5AM2A 1ZD4A 2CFRA 3KBBA 1RQNA 5JJBA 4NAVA 4CF3A 4AP9A 4BEWA 4J2TA 4UARA 3AR7A 4FYPA 2Q4RA 1RLTA 1SWWA 4CF5A 1SU4A 5AK5A 1RMYA 1L8LA 4EEKA 3L0YA 5AKJA 3QUQA 1U2TA 1RQLA 3OCXA 1L7OA 1J97A 5AKZA 1EK2A 2YY6A 3SLRA 2R8ZA 3R09A 4JB3A 3RF6A 3QYPA 3WK6A 5ALMA 2X4DA 3K1ZA 4UM5A 1T9ZA 3OTQA 3DNPA 1YMQA 2B0CA 4YCMA 4G63A 4I9GA 3B8EA 5AVYA 1U02A 4UM7A 5AVZA 4AS2A 3IB6A 1NNLA 3N1UA 1QYIA 5ALVA 2P9JA 4UATA 5ALNA 3WKAA 2W4MA 1Z4NA 3QU9A 2HCFA 3ESRA 2ZOSA 3L0CA 2IA5A 5AKKA 3HLTA 4E88A 1XPJA 2HF2A 3IRUA 1RKUA 3ED5A 2G08A 3E58A 1CR6A 3ZU6A 5AW0A 3QLEA 3L1VA 2YMQA 3AR5A 4HGRA 3QNMA 5ALGA 3M1YA 2JAOA 5AW3A 1QQ6A 4BEVA 4YCNA 5AVTA 1YS9A 2YBDA 2I34A 4UU1A 2G0AA 3NIWA 2WFAA 3WK8A 3DDHA 3E81A 4FE3A 4YH1A 5ALIA 5AM0A 2JGAA 3U7EB 1XVIA 3I28A 3NAMA 3QUCA 3ZX4A 3MC1A 1Z4IA 3ZTYA 5AKXA 4Y2RA 4Y2VA 5AI6A 3QGMA 4XE5A 3L8HA 3UM9A 4MWOA 1IWOA 1L7MA 1O03A 3UMCA 5AVRA 3J7TA 4NWIA 5AKLA 3ET5A 1Q92A 3SKYA 3IJ5A 3PGVA 2BDEA 3AR9A 4CNQA 2I33A 2RAVA 3FPBA 1S2OA 3ZI4A 4BX2A 3I76A 2BY4A 1CQZA 4MUMA 1U7PA 4EX7A 5AVSA 2WF7A 3AR4A 4HGOA 5AK3A 4BYGA 3AR3A 1Z88A 3SMVA 2YN4A 3KD3A 2JAWA 2QYHA 5IT0A 2ODAA 1RPZA 4BNDB 3PGLA 5AW6A 2R8XA 5AK4A 2PQ0A 3EWIA 4KNWA 1ZD5A 4KX5A 4EELA 1SWVA 1LTQA 1RLMA 2WF8A 4H1WA 2GO7A 5IT4A 4JDPA 2ZBEA 4Y3UA 1L7NA 2O9JA 1WR8A 4OD0A 2YJ6A 5ALDA 3W5AA 3ET4A 1JUDA 2B1RA 2B8JA 2FPUA 3M9LA 4C4SA 1VFPA 4YGYA 1S8OA 2B30A 1RDFA 2FPWA 3ZVMA 2GFHA 3S6JA 2EAUA 4CF4A 1RMQA 3ONNA 2G07A 3QX7A 2C9MA 4F72A 3EPRA 4IFTA 2I7DA 5AW8A 4DW8A 1Z4JA 3D6JA 2P11A 3WKBA 3WGUA 4EX6A 5ALFA 1VJRA 3ZW7A 1WPGA 1U7OA 3WKCA 3L0BA 2FPXA 3WK7A 2CFSA 4KX3A 1YV9A 4G9BA 2Q5EA 4Y2SA 1VJ5A 1T5TA 5ALJA 1L7PA 2G09A 5AM5A 3ESQA 3U26A 3EF0A 2YJ3A 2WHEA 3U7FB 4BNDA 2JARA 2OA0A 3L8FA 5AW9A 5A3SA 4RETA 3UMBA 3FM9A 3OCYA 4YIKA 1X42A 3I1YA 3OCWA 5ALPA 3KZXA 5AW4A 2NYVA 3L5KA 4UMDA 5ALKA 1Z5UA 3L7YA 3OCUA 1YDFA 5AVUA 3OCVA 5AVWA 1TJ3A 1Z4PX 3R9KA 2OM6A 3CNHA 3SHQA 4NFLA 2IOHA 1U2SA 4NABA 5ALEA 4RESA 5AKYA 4KYTA 2W43A 4C4TA 2R8EA 2HOQA 2O2XA 4C4RA 3EF1A 3FVVA 5AVVA 1Z4KA 3DV9A 2C8LA 5AESA 2I54A 1Z4LA 3A3YA 1N9KA 1PW5A 4J03A 2YJ4A 3QUTA 1YNSA 1ZS9A 2HI0A 4BX0A 2C88A 3CZ4A 5ALOA 3WK5A 4UMFA 3WGVA 5AKEA 2HDOA 4EENA 4OFZA 1QQ7A 2YMLA 4HYTA 3QU2A 4KNVA 5AM3A 2HF7A 4BBJA 1FEZA 3ZUPA 4HGQA 4UMVA 5AW1A 1RRCA 5AK6A 1N8NA 2CFTA 3AR2A 4DFDA 3U7GA 4Y2JA 1Z4OA 4QJBA 3ZWKA 4Y2XA 2RBKA 3ZTWA 2MU1A 4L6CA 2I6XA 4XPZA 1ZD2P 5ALTA 2C8KA 2HX1A 1L6RA 3I6BA 4O8CA 2AMYA 2VKQA 4CE6A 4L57A 3HYCA 1RKQA 3N28A 3QU4A 2PKEA 1TA0A 3WK4A 4HGNA 5IS2A 5AW7A 1RC8A 4F71A 2FEAA 3GYGA 1Q91A
chains in the Genus database with same CATH superfamily
2EQBA 1BQ4A 1YZLA 2QN8A 4TVBA 1FDWA 3FVQA 1O94D 2ZS8A 1I36A 4CKEB 2VAWA 2VFAA 2Z5LA 3KQVA 4CM4B 4D98A 3KTOA 4M1SA 3INGA 2DTXA 3TLZA 1A3CA 4EJ6A 3TZHA 1R50A 3M4ZA 5JNWA 2GPTA 2QD5A 3WP0A 4BASA 2LE0A 4JJ7A 3PPIA 3QFTA 5DHPA 3I5YA 3RVKA 1ZDMA 4O4HF 4AM8A 1C8KA 2WRZA 4CCYA 4Y0NA 4ZZIA 3D5TA 5JPIA 4RLSA 3AEZA 4U7TB 2LCIA 2GJSA 3ZXYA 4FNMA 3R75A 5BN5B 3MTGA 4C43A 2D54A 2XNSA 2Y0EA 4HF7A 3I3SR 1QIHA 5E3IA 4R71A 1V6SA 5JQWA 1Z73A 4JVMA 5JSHA 4IOLA 2PZMA 1JIKA 1YZTA 1JDUA 1Y7LA 3PA6A 4FD2A 3SY8A 1EHYA 2W37A 4B4VA 1NY6A 2IOYA 3LW8A 2AJCA 4RD6A 1MX3A 4REQA 4EB3A 4YXFA 1JYEA 1F5SA 2NU7B 5J4HA 2HQRA 4BZWA 4UDXX 5K3EA 1MAHA 2FG6C 2JZCA 9MHTA 2FI1A 3B12A 1X7ZB 2D8AA 3BXOA 4F5WA 2V4UA 1WU8A 3RBVA 1XWIA 4H0NA 1O7JA 5ERXA 3SNKA 2QRVA 1UKYA 2EFGA 3E2MA 1VBKA 3FR7A 2PYDA 5IT9A 2ZBDA 5FLXA 3KQQA 1SCUA 4FC7A 4R6XA 4J8PA 1T24A 3PX2A 2DUWA 3DE0X 2QQFA 1KZ6A 4KE8A 1VL1A 2KI5A 4N0EA 4TMWA 5L6MB 2IYVA 3AQ4A 5BWNA 1HNWB 1W4AA 3QSGA 3ZPXA 4NTZA 2ZYTX 3QE4A 4TTTS 1PX0A 2HL6A 2OGZA 4MVWA 2VT6A 2JFHA 3AETB 2O3QA 1U5BB 3W79A 4FILA 4H31A 1KTVA 4YBRA 5BNWA 5CDGA 3HDVA 5DXJA 2E6KA 1RFGE 1JHQA 2LIVA 4MYSA 1SZDA 3MM4A 2ET6A 2WFZA 1RYEA 2HNBA 2P8SA 3FPSA 3ORFA 4J07A 2OV8A 4OHMA 4R8LA 4V02A 2IUFA 3KQLA 4WH0A 3ZK8A 3W5BA 4IQ8A 4ND8A 1KAQA 4P93A 3WK9A 1OWLA 1XE3A 2XRZA 1XROA 1H2FA 4BQPA 4ISCA 4PGMA 5K6TA 1C3UA 1AGPA 1I3KA 1NBAA 4HDNB 1SCNE 1RYMA 1XTRA 3GFBA 2HQSA 4KOAA 2O14A 4OKSA 2WLTA 4TZTA 4W7HA 1SNYA 2FOIA 1UM8A 1DAHA 4KLZA 4K26A 2YS6A 3L01A 1J0AA 4MYDA 1UOOA 3R2JA 2OY0A 2BTEA 1U9YA 1XLTA 1Y5RA 2WU4A 2ZTUA 3KXLA 1RI3A 3CLSC 3QMVA 1U0EA 3E5HA 3HCDA 4DM7A 4UBMA 1ULAA 3IT1A 4MGZR 5T64A 4C3VA 4P22A 1HL3A 1WXGA 2B82A 1X8LA 2QE6A 5GJVC 2CB9A 13PKA 2KQUA 2QAJA 4IKPA 4YRPA 2A35A 1ISJA 3DMGA 1G7TA 4PLGA 2FLKA 5JANA 1DBQA 4BMYA 2XY4A 1DCTA 1PG5A 2NSJA 4IGAA 4QFBA 5FF9A 3O8QA 5D85A 2K2WA 1UODA 1T9GS 4JOBA 2GTIA 4M4SA 2RBEA 3HFRA 4R1PA 4UC0A 5IJXA 1T91A 3H3FA 1X1EA 2AN4A 2Z3WA 1K86A 4DEYA 1ZRMA 2NUAA 4F92B 2WF9A 2HT1A 3MCVA 3TFWA 2Q41A 2J4FA 1A5ZA 4FINA 5K3FB 3L7KA 3OPVA 1YBFA 3ZDQA 3O1LA 3BIJA 1GPH1 2QQEA 3JW8A 4IFEA 4DGSA 5EG5A 1K6JA 3KJHA 4Q3CA 3WYBA 4AL4A 1CBUA 3COZA 5HK8A 3WB0A 1ISFA 3QPVA 1T8SA 1OFGA 1AO0A 2UXBB 4RTSA 1DX6A 1E1MA 3L0OA 1YS1X 4N5LA 2NUAB 1MJHA 2I6UA 2G5TA 4MAFA 1EG2A 5KAMA 1T5OA 3V7FA 4COKA 2XE7A 4UBJA 5JS6A 1R8QA 2VYCA 4GXTA 3LXRA 4PGAA 1RM5A 6ADHA 3Q8KA 1PWEA 3LYHA 1ZNXA 2BJWA 1B0AA 3IVXA 2GZSA 4F3KA 1P6XA 3CZRA 4Y9TA 4MKIA 4NBRA 1RRPA 4GNKA 1HTWA 3N9IA 2YICA 5LCXA 5ALYA 4R2KA 1MH1A 3FOBA 1K98A 5K3AA 2ISSD 2O23A 2XQFA 4GVXA 3P0HA 4WLUA 4XYGA 5FNVA 4BNXA 4CU5A 3QBTA 2P9YA 3W5CA 3V55A 2V97A 3M6MD 2BFBB 4EZEA 2NXEA 1BE0A 4OBXA 4FEAA 5FULA 3Q5DA 3KLBA 3H8VA 4RHEA 1BW9B 1NP3A 4XWOA 3QPUA 2COUA 3GLRA 1MV8A 1TW2A 4MMZB 5EYPA 5KVSA 2XYRA 2QI9F 1BWRA 1HFJA 1PWYE 2EZ9A 1E2NA 3CLSD 4RZUA 5EKTA 3N0VA 4NZMA 2AX3A 5T5QA 3CVVA 4J2TA 4BO9A 1QM5A 3D59A 1USKA 3DL7A 5AXAA 5ISMA 2BWJA 3CLUC 2ZRJA 4TROA 5JCJD 4CM9A 4KZPA 3NGMA 5K8VA 5MN6A 3EXG2 3CNEA 1UBMS 2EBWA 4BJ6A 1G5PA 5T4HA 1Y34E 3SC2A 4H3HB 1DOFA 3C14C 4AC9A 3BWBA 2BGGA 4PANA 1JFRA 3OKAA 5G2OA 4LE2A 2NZJA 3QYFA 3QUQA 5HQ3A 1RQLA 4JR2A 4XPIB 1J97A 2F3SA 1W5BA 3KQOA 2YZNA 3R09A 2VA9A 5T4BA 4X8MA 3QYPA 3L02A 2GJAA 4N4AA 4AUEA 4HWGA 4BMPB 5J4LA 2NPOA 2ZCVA 1HORA 4IOMA 3SVLA 2NZVG 2Q0SA 3K1ZA 3VR6A 2ZIAA 3FDXA 2YXBA 1WETA 2F00A 1KEVA 1WW3A 4WT7A 2AHOA 4MW1A 1AXEA 2NVWA 2HRCA 3M9WA 4Q1DA 4QUJA 5FHQA 5IF3A 1QP4A 2QGNA 1JIJA 4DCMA 3EEIA 4ADSG 1TQDA 4FYHA 4LGMA 2PT9A 4CMKA 2GEUA 5CMLA 1CZHA 3GLKA 1G4UR 2AG0A 3UXHA 1ZN2A 3U4IA 5FPYA 4XRGA 4CQLA 1NC3A 2M6KA 2PX0A 4ZVSA 5C35A 2VWGA 5CT4A 1JWBB 2O2HA 2BMDA 3ETNA 2XB6A 4UFOA 3VYSB 1R15A 3O4HA 4RH0A 1R4NB 4E7PA 1JA9A 2XB2A 1VGQA 2PSDA 2Y1OA 3FWZA 4XVRA 1LI5A 5DNUA 3H65A 4IKEA 4AJIA 1KI3A 1O94A 2Q5QA 4GM0A 1J24A 4QL3A 5AKKA 1JHOA 5IMBA 3I1IA 2ZB4A 2D1YA 3D4OA 5I5EA 2FZWA 3DF9A 1LFAA 3PGA1 2G08A 4FFMA 4HC4A 3NHJA 2H57A 3I42A 4LNAA 5CA0B 3GFSA 1JSZA 4IIVA 4RY0A 5AW0A 1OAOA 4OA5A 5KUTA 4WVLA 5E38A 4RDHA 2B2NA 3UUGA 1NNEA 5H68A 4RA6A 4GF5A 1H2EA 4MV0A 4GEKA 4P5PA 3FIJA 3O4JA 2F90A 4H08A 5D8DA 4M1WA 3IBTA 1REQB 5KNBH 2O7NA 4A7PA 1Z2OX 3D8UA 2YOFA 4J2OA 1ORTA 3CO0S 4M60A 3TRDA 4C21A 3PE4A 3C2QA 3LUCA 4GD3Q 3NLLA 4HWRA 1G7SA 9ATCA 3IO5A 2B78A 1UBGA 4WCDA 5IH7A 4RVSA 2ONZA 2W8ZA 3GRCA 1LRKA 2I34A 3NIWA 2WFAA 2P2CA 3N74A 3Q3JB 5KSWB 2R7NA 3EBOA 3BF8A 4EUFA 3EPJA 4BN4A 3BOSA 1VMDA 1KK1A 1AJEA 5EJ6A 1EFAA 1VZ3A 2IYQA 4GX1A 4BZXA 4QHSA 4C4YA 4B43A 4QVGA 5DTEA 5SZHB 5KQLA 1VOTA 3W04A 3I9MA 2LCFA 4A2PA 3E82A 4MCHA 4YMVA 1NR7A 4GICA 4Y30A 1L3CA 5K3FA 4XTCS 3WE7A 3GH1A 4CLDA 1IWOA 3ZI7A 3ME5A 3FLAA 3KTAA 1S8NA 1H6CA 4GMGA 1VJTA 3KCNA 4C0WA 1SZJG 2G17A 4NL4H 1UINA 5AKLA 3BM5A 2JIZA 4WKBA 1E6KA 4HAYA 2A9PA 2DCUA 3DD5A 4BVJA 2BDEA 1XVVA 1HE8B 1V3VA 2H51A 4HYYA 5TMEA 4CHTA 4EFLA 2XCUA 1QYWA 3F96A 4G09A 3G2PA 3QHQA 5EQJB 4ZRNA 4P4SB 3O4RA 1PKEA 1P9OA 3UGKA 3CCCA 3EXG1 4BFXA 5LZ7A 5CA0F 5ADHA 4G0XA 4D4IA 1CS0A 3FBWA 2OILA 2P2SA 4RCVA 1NIJA 3EOZA 4CQMD 1UT5A 3H9GA 5E3JA 5D86A 3CSDA 4KE6A 5DBGA 5HBRA 3VV2A 2YR0A 2I03A 2ZZKA 3BJRA 3N59A 4NS4A 5GJWC 4XSGA 2PUEA 1VG9B 4FMPA 1GTJ1 4PFQA 4DV6B 2JAWA 1ND5A 1CDOA 3AVYA 2COEA 3BSSA 2W6PA 3DKRA 4KFUA 4WAUA 4TQGA 3H1TA 2PQ0A 1RXWA 1S8FA 1P44A 3CPHA 1LF0A 2VBIA 4EYEA 5LQCA 1XTZA 1AY0A 2JHCA 5LQJA 5DM70 4D8YA 3KLOA 1F3LA 2PMBA 3BZBA 1VE5A 1WRBA 2W6QA 2ZBEA 3NQ41 2DXIA 4FQ7A 5FAXA 4EI8A 4GI1A 1YR3A 3VDNB 8MHTA 5IJ0B 1NGSA 2VBFA 3FOAA 3HVUA 3NBYC 1UKBA 2YW2A 3IDQA 5EJ5A 1X8XA 1XYVA 1TDJA 4IGFA 1ABFA 1G8FA 1WZNA 1F8GA 1HKHA 2R4UA 2ZPAA 3S6JA 2DF8A 1E32A 3ONNA 5ESDA 4EF6A 5IBPA 3A9VA 1YJQA 3E1KA 1Q3KA 4Y1FA 2B6NA 1NVVQ 5BV0A 3K9NA 4TTPA 1XXLA 3NYIA 5IAAA 5C81A 3GLQA 4OAPA 1CY2A 1UMDB 1GT91 1PE0A 2CBGA 3M6UA 4DW8A 1Y8RA 1Y9AA 5M29A 5TMPA 3D6JA 3IUJA 1TU3A 3G0IA 5JZOA 5JSUA 1DEOA 2GKGA 1FFGA 3FGZA 3K5HA 2A88A 5TIIA 1ZM4A 1C80A 2IF0A 2QNIA 1KORA 3M89A 5FBQB 2QMEA 1JVBA 2R68A 3DFZA 3LBYA 4EDFA 4W5TA 1P5ZB 4FOLA 4J0DA 2E89A 4QECA 3H86A 2UYHA 4PE5B 1ZP6A 1KI8A 3K0AA 3I2KA 1MXFA 4I2NA 4ZP1A 1QH1B 2WKSA 3Q8WA 5H8WA 1ZIXA 2DBQA 3NM6B 2PBRA 4QPZA 4CLEA 3RWOA 4EKIA 2BCGY 3K73O 1ZNQO 3IUPA 4N7JA 1CUFA 1L4BA 4A0RA 1G2QA 3T3DA 2HDNB 2H54A 2IPNA 3UCEA 5JYBA 1HQYE 2HPVA 1N9GB 2WD7B 4E3WA 1DT3A 5E6UB 1U90A 4XGKA 5GZ6A 3GU3A 3ZIDA 4BVEA 1CY7A 1ADFA 3CUWA 2ECQA 1PWHA 4HFRA 2QENA 4BU0A 3OEEA 2BFEB 3K15A 3NC0C 2WG1A 4HUQA 1IC6A 2FZLA 4IIUA 1ZWKA 5FT9A 4DJAA 2IGTA 2QZZA 3RYHA 5HOEA 2HSJA 1DTSA 1E8NA 1XL0A 4ZVNA 1Z5UA 1HY3A 3BMQA 5DEOA 3RVSA 3IP8A 4BVBA 4IDAA 4EFDA 3PFKA 2FNAA 5T3YA 3SHQA 1H6DA 4N7BA 4PWZA 1FTQA 2UYYA 4XJVA 3BJIC 2OAGA 2VXCA 2PYIA 5DXFA 1P1BA 2QN3A 1UR5A 4EA9A 2CF6A 1T43A 2IPAB 3TSWA 4C0SA 2SKCA 3K31A 1GEEA 4Z9FA 5I3ZA 1AUVA 3B60A 5BQFA 4IUCS 3SEAA 3FFWA 2F67A 2Q99A 1OKKA 3VISA 1GL9B 2A0YA 1AUPA 3OCFA 1YOVB 5BSWA 3PTLA 4GOXA 1YE5A 4JMPA 2IWHA 1X1DA 3NNNA 3PKIA 4EB8A 1H9BA 3I04M 4URUR 1IDOA 1W52X 5ALOA 3RIHA 4EYSA 2PJUA 4HTAA 3D3KA 3KLPX 1IG3A 1RJDA 1FYVA 1B1CA 1QK5A 3G6KA 2PT7A 1XWWA 2ETXA 1F8YA 1D2HA 2TMYA 3K09A 3SIWA 5AM3A 4D4HA 4KQHA 5K8TA 2GN8A 3NDPA 4UDOA 4QUIA 4UBNA 4INPA 3M2PA 1WUYA 2CFIA 3DUFB 4CKBA 3GDFA 2PT5A 3LOQA 4KPUA 1FFAA 1UL1X 3JYQA 5E1BA 4MVCA 3RVQA 1W76A 2OCKA 2HA4A 3LKZA 4O0MA 3DVAA 4YN3A 1XA4A 4ZAWA 1M34E 3WLJA 3PFCA 1CUCA 3RQIA 2HX1A 3P2KA 1R3UA 4B71A 3U60B 1M1XB 1DIRA 1YZQA 3G5LA 3AUKA 4GSYA 2WKWA 4PU0A 5G1PA 2QEQA 4KAJA 4L5CA 1EE2A 2JAQA 2VH1A 3AF2A 3N7UA 1OBHA 4OJMX 1ZUIA 3IUSA 5FUQA 3T95A 5THQA 4JLPA 1E3TA 4GC5A 4EP1A 3EY4A 3OIYA 5KU7A 3F6BX 4NH4A 4D9GA 3DMYA 1RAGA 2P2GA 1P0CA 5ERGB 1EVEA 1O97D 2CSUA 2OWEA 3E1SA 5CLIA 4YQEA 4MV4A 4C0BA 3E3MA 5IEJA 4YMGA 1ZR2A 4HH0A 1PUIA 3ZWDA 1OAAA 4ECEA 2A6PA 2WIAA 5FTLA 1II8A 3EQZA 2II6A 4PO3X 5DM2A 4Y98A 4BN0A 4C7JA 3PHHA 2PSEA 1QO0D 2VHQA 1AKVA 1JFFA 1R9JA 2BE9A 2PGJA 1KKMA 4ZEWA 2YBEA 1D6JA 3CTMA 1CERA 4HAUA 2ENUA 3IAM6 2J5KA 2AQKA 1YZHA 4P4TA 4IO0A 4JB8A 5LBUA 2CLMB 5CJ2A 2G1KA 3LLUA 5EKUA 1Q7GA 4CCAA 1RYZA 2F3UA 3BDIA 2IITA 4ZCPA 5KOJB 3U7HB 3OJOA 1Z13A 4XOUA 3A14A 3OCZA 3OX3A 3ACBA 1R5JA 4G26A 3NNSA 4IO1A 2M6SA 2AFIE 3OEED 1F2TB 3JQ9C 1XP5A 3LBAA 1GDTA 2YZ7A 2JLRA 4IH4A 4I6JA 3MINB 1ZOLA 1GIAA 3JR3A 1TPYA 1CP2A 3IBCA 2PZLA 3AF3A 3G1UA 1SXIA 4HD8A 2GCGA 4Z4IA 4EAAA 2B0JA 3WKDA 3BA6A 4B4UA 3Q8MA 1PYOA 5C3MA 4P2BA 3L6RA 3U48A 3TAHA 2QRHA 3QEJA 4D8UA 4QTUB 4M86A 4DB2A 1EH5A 1Q44A 3WAGA 4KU4A 4ETWA 4DR1B 3DTTA 1GZVA 1K08A 1GYPA 3OBBA 2FMUA 1M6NA 3L07A 4ETNA 1KSJA 5CLQA 3DT8A 4UUMA 1NVBA 4MCIA 1QP7A 3LY5A 1CUGA 2LD4A 3A4MA 1KC3A 1ZBQA 3OURA 3LUFA 4L4XA 1T0HB 4E5MA 2FW9A 4RVUA 1MC5A 2E9SA 5DSXA 1KDVA 1T9GR 2Z5GA 4LNHA 1B0PA 3I23A 4ICIA 5KJFA 1SUDA 1LGYA 5CLGA 4WXHA 1C1HA 1O8CA 4PF1A 4M8SA 4LDQA 1HQCA 2AEEA 2N46A 2HHHB 5A3VA 4JI5B 3RABA 3PDUA 1CY8A 3D81A 1C30A 1T2UA 3A4VA 1X8JA 2HQ1A 3HKDB 3A04A 3ZCTA 1FMFA 4MR7A 2PMEA 1FUUA 2BFWA 3KZOA 4BXOB 4Y2QA 3DDZX 3RIXA 3R5SA 2A84A 1C29B 3OX2A 2ILTA 4ND4A 1Z9BA 3B5EA 3EZLA 3ZEIA 2GCOA 4KXMA 3EC2A 5GMOA 4ZI3A 1I3LA 1A72A 3NT4A 2YZGA 4JH0A 4KACA 2ID7A 5FX2A 4NNOA 2PXCA 4F3NA 4Z53A 2B1IA 3IR6A 4ZYYA 3T1TA 3UHPA 2X8AA 4LDNA 1PFWA 4G2TA 2BDUA 2AYYA 4S35A 4ARVA 3M49A 4LC1A 3THWA 4CMIB 1E1KA 1FNDA 2LR0A 4MPRA 4RSHA 2WSLA 3C3JA 3LY7A 3DLTA 1L5WA 4OHCA 4XVCA 1KAGA 2CWDA 2WD9A 2HNKA 3PVCA 3MWEB 3TW4A 3EFHA 1ZL0A 4XVUA 2JGDB 3M82A 1LBSA 1WB5A 5B1DA 2ZROA 4G37A 3LX5A 3ZXXA 4X7BA 4EJSB 2P68A 2XT0A 2VSFA 3IKVA 3N6XA 4MROA 2PGAA 1ZMXA 2CJWA 2PQMA 1TO1E 1Z5PA 2MYTA 3EXIA 3H2KA 1E9SA 4HGPA 3WLTA 2QLJA 3OM9A 1BKDR 5FBVB 2JGJA 4QDOA 4I9FA 3BWXA 4D5GA 4KPUB 1M7GA 2X23A 1W5SA 4A8PA 1KHTA 2OCDA 2GSWA 4PRLA 4A36A 1NXSA 3DE5X 4F0JA 4B3FX 5KOIA 3Q3HA 2QUJA 4KWCA 4ER5A 4HDQB 2WZQA 3GLFA 1DRVA 4PO8A 3RAFC 1A2OA 4R9UC 1ZG3A 4U0KA 3O6VA 4F8JA 1CYEA 1ZUWA 2QAIA 3VMFA 2ZT8A 1D4AA 2P5YA 2RFLA 5REQA 1BOOA 4GI2A 5KYWA 3HB5X 4FJ1A 3T3PB 4I1IA 2GZRA 1SVOA 2AT1A 2B94A 2IU0A 1BD3A 3KQTA 4A26A 3GA7A 4UHKA 2R7AA 4YP0A 3GJSA 3PDIB 4QT4A 5CDFA 4Y2UA 1VP9A 1RQPA 3LK7A 4B73A 3OQHA 3QFSA 4EB0A 1PZHA 1ZZEA 3WGMA 7GPBA 1COZA 1KMMA 2GN1A 1FVOA 3IQGX 3A6JA 3FYHA 4FR5A 2PRYA 5DRTA 2XWJI 1X7ZA 4JI1B 4MGIR 4AJPA 1NMYA 2FPSA 2OMKA 1ZD4A 1P33A 3V1LA 2QVCA 2VOEA 2BDTA 5C8VA 1EEXB 3UOGA 3OWOA 2V7UA 4NAVA 4QULA 1G1AA 4B2YA 2FN7A 2H1SA 5LKAA 1KZ1A 4IDGA 1Q1EA 2F4VB 1P4HA 2PRKA 3L43A 2BUAA 2CNLA 4JXXA 1DV2A 4CDGA 1LD3A 1OLUA 1RRMA 2AFHA 3BT7A 3QVLA 1OWMA 5FH9A 2QYTA 3K70C 1ISIA 2ZPUA 3EODA 1VCNA 1SWWA 4LQDA 4MPTA 1DBIA 1NBMA 3AF4A 2XUAA 3RVDA 3AHEA 2EWWA 3NX4A 4XYLA 1CUSA 2XJ9A 2XUDA 2NZUG 3PUJA 1LA2A 4BKQA 2QZ4A 3IO3A 3KSMA 1WXIA 3KQPA 5B4UA 3WJAA 1HDGO 2IVZA 2ESRA 5AKJA 4B7ZA 1X1SA 4N0MA 1HYGA 3QXCA 2IDMA 3ZV3A 5L95A 1E9RA 1RW4A 3K8QA 2R8ZA 1E18A 2E9FA 4UNIA 3O9ZA 3R9WA 3ZW9A 1H2ZA 1UXHA 4G9GA 3ZKAA 3PC8A 4WKCA 4XH9B 4PLZA 3ITDA 1YQXA 1Z7GA 4MYCA 1C4XA 3NHLA 3RT7A 4UE6A 1U80A 4EHLA 1VSTA 1E0DA 3CXRA 4IVPA 3ZBQA 3JYOA 2WABA 1NNI1 5HE8A 3TQIA 5IUNC 1FU8A 4LDAA 2PD3A 1XD2A 4FDAA 4B3XA 4LJLA 2G0NA 2B7LA 3QKRA 1S4QA 1LXCA 3CB2A 1HT0A 2JATA 3VNSA 4B34A 1C5KA 3IB6A 2YXDA 4AS2A 1DL5A 1XEXB 2BW0A 4DR3B 1OFHA 2P9JA 3FJYA 1ILWA 1PAUA 1Z37A 5ALNA 3T3NA 5C46F 1PUXA 1YB4A 1DDOA 2TMKA 2O3UA 2WJGA 4HEQA 4YT2A 1Z7WA 1U8YA 5KINB 4P0QB 3R7WA 5J58A 1NE2A 3TSOA 1UDWA 2JLAA 5HX7A 2I4IA 1MPXA 2HMUA 1J70A 4CR8A 4DF3A 2DPHA 1IRXA 3MQ2A 3BYZA 3N0XA 5E9AA 4AUKA 1UFQA 1BO6A 3E61A 3R0IA 2ZSIA 1QGOA 3DZHA 3I1JA 2CMDA 2GCOB 4D56A 1D4OA 3F8WA 4YV0A 1L7AA 1ZC4A 4ARZA 5FV7A 4MVJE 4KO4S 4PGGA 1G5IA 1AZLA 1IHOA 5DE3A 1UH5A 3SQOA 2C2HA 2J7PD 1A9TA 4GS5A 1S2NA 5J43A 4GBGA 4M9XA 5TLSA 2Q27A 2PO5A 3CPSA 4KP7A 3PWKA 4A5OA 1T3SA 4OYYA 4DIDA 1NI4B 4IGEA 1L5MA 1TC1A 3A9WA 3JTEA 4GWLA 4LXYA 4NC9A 1Z3CA 2UZ1B 1IOWA 4GI5A 5KQMA 4R16A 3FZGA 4CMJA 5HDBB 1X74A 4JEIA 3UH0A 1KNXA 2J3HA 5HILA 1H6BA 1EX6A 2IYWA 3TI9A 1QV7A 4IQ4A 5B36A 2GBLC 2PWAA 5MF6A 1FVFA 2G0AA 4MW7A 4YYEA 4A15A 2Z57A 4FD3A 4B8WA 4HX5A 2EDAA 2H2IA 1JHAA 1P2BA 2HU2A 4TS1A 2BFBA 3WWZA 1KRHA 3FRHA 1CEEA 1J9GA 2X4GA 4X9XA 3T5GA 1O9HA 1RYYA 1G21E 1Y7TA 3JVVA 1KU6A 4MAAA 1K63A 4P3YA 3WIBA 4DILA 5DNAA 3V2HA 4R0VA 3GOHA 4Y2RA 3TS1A 3M4JA 4CG1A 1EUDA 4WXEA 3AU8A 1ESDA 2AMFA 4BV9A 3CX3A 2NIPA 4RWZA 2IYPA 1FJXA 3O74A 1NW9B 2F4NA 4MGEA 3HWX1 1QR6A 1RBZA 4NCJA 2ZYUX 3FNIA 2GKSA 3ULKA 4WASA 4ZQBA 3T1YB 4G85A 1E63A 2DU8A 2EHJA 4EPWA 4DREA 5CDUA 3DZGA 1MHTA 3JQAB 4TYNA 4B3RB 1XMQB 1GL3A 3GD7A 4O08A 5C51B 1CJTC 4G5GA 3Q8LA 1EXWA 2XVYA 1XDWA 2OP1A 3G8AA 4MNTA 5JNVA 5KYWB 1E3MA 1AX9A 5H83A 5SY6A 1JBKA 1NVXQ 3DE6X 1EXVA 5GVRA 4MUMA 4JQCA 1G3MA 4ZMBA 1WXFA 1AV6A 2H52A 5FKJA 4EG5A 4RPJA 2JI9A 4E03A 2ZI6A 1JR4A 1A9YA 1HPLA 3P0IA 4EKEA 1EWKA 2HMYB 2E1PA 4PZZA 1H5UA 2I4TA 5EI5A 5ITVA 2VSNA 4CXMA 4D8WA 3HZOA 5AW6A 5DM0A 1F2UA 2FJPA 3ND5A 3J7AC 2DTEA 2FOXA 3OICA 5B2FA 1QRUA 3LAWA 3IKMB 4NK5A 1CQPA 5CIWA 1V96A 3H13A 4F7WA 5B7PA 3U0BA 2F55A 2RGYA 3RS0A 2JK0A 4XB6B 2G0TA 4JDUA 4MK4A 3SDBA 3STUA 3VR4A 5A03A 5ALDA 3ET4A 1P17A 2XF8A 4QAJA 3BE8A 3W6OA 4FBGA 1R6TA 1Z12A 2B25A 1QX3A 3FI0A 3NTOA 2ZUDA 3OFJA 4JP1A 2PSSA 3CRVA 5L40A 1GUFA 2O3JA 1U1DA 3D3QA 1K3UB 2Z58A 3PE6A 2QPLA 2QG4A 4WNIA 2ZIGA 2PKXA 1ZK0A 3L2OB 3AHCA 4IFTA 4KQWA 4RHYA 2P9GA 4RX1A 3SDZA 2CZQA 4GM4A 3GJTA 3ST7A 3V1MA 2E7ZA 1U1EA 3K9CA 4U7WA 3DC7A 4YLEA 1VJ0A 3LCCA 1RWBA 3BHNA 3MUNA 3EW9A 1QYRA 1J33A 1H2HA 1PT8A 3TEJA 4Q16A 4KR2A 2E5WA 4ISBA 4WHMA 3N39C 4TX1A 3HA5A 5EL0A 3LUAA 3C6YA 5JOQA 2Q6KA 4EHAA 4YRAA 4HLDA 3MSXA 4LZLA 4E30A 1OI3A 1F5NA 2ASEA 3CZQA 1Y80A 3K72B 1BDMA 3WZ2A 1QRAA 5LMUB 5SZIA 4AZSA 4FGZA 4A2WA 4DANA 1YVUA 5BW5A 1DSSG 3L9XA 1CJVC 2QMQA 2EKQA 4N6NA 5EZ6B 2JGKA 2PMFA 3DT6A 3HB4X 4RF2A 1QMPA 4AYTA 3GJ4A 4UHFA 5KC9A 1RYFA 2OCPA 4ZXFA 2WYIA 4LE0A 4X1KB 2WHQA 5ALPA 1TM3E 4RUKA 3V1UA 4C0JA 1DZIA 3C6XA 1NUSA 5G0SA 3ZEAA 3RS3A 3EXHA 4XAQA 3MVEA 1PBTA 1FS6A 4HPXB 1RAEA 3AX6A 4MV7A 3HY4A 3TN7A 1TUIA 3LT1A 2HIAA 3O83A 1NG9A 3B48A 2WTBA 2YIVX 1IM5A 1G55A 1DO8A 4KMOA 5CK4A 2V9PA 1S9DA 2QWXA 3AEQB 3R9KA 4B2PA 4HDMA 4D2IA 3DKIA 5J3JA 4KXUA 1G16A 2QVYX 2HREA 4FMDF 3FTQA 3EY9A 4BEBA 4B31A 3NTUA 1QH8B 3JQEA 3TLGB 1JHMA 4BL5A 3H17A 2O0MA 4O1IA 1PCXA 4DARA 5J2TB 1RJ9B 3EF1A 4V0OA 2PKQP 3NAGA 3KQKA 2JGRA 3R7AA 1O5OA 2OO5C 3EULA 4MKGA 4RAQA 1L5HB 2YWXA 5LQDA 1K7FB 5IYZF 3ZNOA 5LP6F 1Q84A 1TAQA 1N9KA 4UE3S 2H4XA 3BG5A 1G0NA 5DYWA 3WNQA 3DS8A 4Z2YA 4YV2A 4P84A 1Z47A 2HI0A 4RTRA 1POXA 4U6NA 1X80A 2ZWPA 3CF0A 1QRTA 4B3HA 2EFCB 3GGSA 3ONVA 3KV3O 2AG5A 4HYTA 3QU2A 3QFCA 2PUDA 2NU6A 3Q6MA 4JUIA 4XIFA 2ZRFA 1BDJA 3AXSA 3DEFA 1NM5A 5AR1A 3MQ4A 1MO5A 5GAJA 3W2FA 1F1BA 2RHBA 1K8RA 4XKJA 4BE9A 2CHQA 4G8DA 4KLRA 3DTNA 3WIVA 1NLUA 3H4VA 3I0NA 1GR1A 4QLBA 2B37A 5KOYA 2KLBA 3BH7A 4Q1VA 3Q1KA 4QPNA 3IV6A 4KSCA 4D44A 2J45A 2MU1A 2FE1A 2CFCA 3GRFA 4QBHA 4CTKA 5CD9A 4OXKA 3LF1A 3UJCA 1ZD2P 1G66A 4JL5A 5ALTA 3SC4A 2OYSA 2QPOA 2FK8A 2PKCA 2ZJ4A 2HN9A 1GNSA 4BVHA 4NZOA 1P7YA 1P39A 3L84A 4BV8A 4LHZA 1RI5A 2OEPA 3GT7A 5ULLA 4W5OA 1UJNA 4XFJA 3I8OA 1G8GA 1WMAA 1ZJ5A 5IS2A 2JVKA 1HNNA 1PX2A 3AF0A 3Q72A 3E0XA 3RV3A 4H16A 2W9XA 5HA5A 3VNVA 5C8XA 4HGYA 3MCAA 4XGRA 2VBCA 2GJKA 3PR1A 1BHJA 3EXEB 3KALA 2REBA 4NLLA 4KITB 4O2AA 2DQYA 2JIPA 1GQ2A 2W93A 2O8BB 2MYUA 1U04A 1JLHA 1J5XA 1LVHA 2MINB 4WADA 1F2UB 5C2JB 5ES4B 4MI1A 5C37A 1OH7A 2AYZA 2NP7A 2BFDB 1A9RA 5KHAA 4QZVA 3HU5A 1C4OA 3RJ9A 4HATA 1AKTA 1SD1A 4D9BA 2Q2WA 1GPLA 1QVWA 4IV8A 4E5NA 4F86A 2APJA 3MTIA 2EFJA 1ZJJA 4HRVA 4NENA 1GDHA 1DI0A 5EHIA 5B7QA 5JW6A 1SG6A 3GVHA 3ZWOA 1B8VA 2FEKA 3L1UA 1VRWA 1RAAA 4N01A 4ACBA 4JSYA 3FYUC 1FY2A 1K92A 1WBBA 2OZLA 1OW3B 4UD2A 3ZHVA 2H3HA 2H63A 1G59A 1VYUA 4N82A 4PIMA 5A3RA 3NIBA 3ZZUA 5HKBA 4OCZA 3B5JA 2X77A 4JSRA 1HOTA 4RPGA 5D84A 1CK4A 2J3JA 5HCUA 2C8VA 5DCWA 3TRIA 1YFMA 1FNCA 2DH6A 3RV4A 1FNMA 4KE9A 4YRJA 3ESDA 1TF7A 1PVVA 2PR7A 4NENB 4CLRA 2EVWX 3ESCA 1ZWLA 1YACA 2I0FA 3GRPA 4QM6A 1YIOA 1UBLS 1I7PA 3EVTA 1L1RA 1W88A 1CUEA 1O96B 2VYVD 3ABRB 1P7ZA 3N8HA 3QQ5A 3TD6A 3X44A 2V7VA 3ZDAA 3F3MA 4HJRA 5H81A 3R41A 1YZVA 5DGTA 2WVJA 2AQIA 2AZTA 3S7ZA 3S8YA 2WBLC 1BHQ1 2YHBA 4Z49A 3PZBA 2Q7XA 3AWIA 2YJNA 4ND1A 3OQ6A 3AR8A 4IDQA 4BTVA 5I4IA 2DQKA 5AVOA 4TT8A 3RROA 1KO8A 4MS3A 3JWIA 2JEYA 2AQHA 1MJGA 1P91A 2QB5A 3FSRA 3IEIA 2BR3A 2H07A 1MB4A 1QQAA 1ETHA 3DHEA 2FDRA 4I9NA 5TVGA 1PZGA 3FX2A 4OSEA 5SICE 3BMOB 3ZX5A 1HA3A 2AGVA 2H48A 1XN4A 5IANA 4KN8A 5FLKA 3OZXA 3Q7TA 3M83A 4UTRA 3KL2A 4I8DA 3UPTA 1TEHA 5TQVA 1P77A 1RM0A 1T6NA 3D3EA 5FADA 3U7JA 5KNLA 2FTKE 3Q3GE 5IUJC 4DVJA 3PUKA 4Q9NA 5CH8A 3UXYA 1NIPA 3KJIA 4ZVOA 3T5CA 5C5DA 3IQDB 5ECYA 4BPBA 3A4TA 4YV7A 1MAAA 4ARAA 1ZR4A 2V7EA 1PP4A 4D6PA 1DAPA 3SSOA 5AJZA 5LD2C 3D2AA 4MRPA 1SQFA 2GHTA 4I6EA 4EYGA 2SKDA 3GQBB 3KB8A 2ROQA 1S2GA 4LOJA 4L5BA 2CJWB 1GOTA 3EXIB 4NPAA 5KNCA 2OQIA 4ZANA 3DZFA 3B85A 2LGJA 4CMCA 1R0SA 2HIGA 1ODSA 5CXQA 2QORA 3NDRA 1I2ZA 1MO3A 1GKIA 1IEVA 1M8FA 4AP5A 1EFVA 1KSGA 4HO1X 4GC9A 4IFBA 2QW0X 4AZ0B 1IRIA 1CLEA 2HUNA 3NETA 2GUGA 3Q7EA 4CM7A 2UVPA 1FFSA 2XVZA 5DX8A 4EJFA 2WQ7A 3SR4A 4EPRA 1GTRA 1P4AA 5L3RA 5A6VA 5CBKA 1Y9EA 5JSFA 3D3NA 3GC6A 4IIHA 2BGWA 2FSIA 2CN1A 2VPQA 1M5TA 3DHNA 2I2XB 4IMJB 2PGLA 4INJA 4MXDA 4PZCA 1FTSA 4OLHA 4B81A 4W5NA 5D7NA 3ZE6A 1VKNA 1A2BA 2PTGA 5IG2A 1U7UA 1WBJB 2DX7A 3EZ7A 4FMCF 3GRRA 4J29A 4KSBA 4R1QA 4X6UA 1YR9A 5ECDA 3B9BA 1JU9A 3O84A 2OSBA 2ZJFA 3JAWB 4KUEA 4FWIB 2X8JB 5K0LA 3N0RA 4DQDA 3IMKA 1Y5IA 3ADPA 2BEVB 4JP2A 3UJBA 3UBTA 2BOVA 2OBNA 1XZFA 3VKUA 1LQTA 3AOEC 1URPA 2H0RA 1F2TA 1YT5A 2RHHA 3D7SA 3P27A 4FI3F 2Q8PA 4IV5A 3TF5A 1XPOA 3MJEA 4UUOA 3S2ZA 1R1DA 2Y27A 3VR4H 2DWCA 1G5FA 1QCCA 3H05A 1RKVA 1BXRB 1MO6A 1VXOA 2XYHA 3BK1A 1YZ3A 3PRYA 1PL7A 1IUPA 1I01A 2G83A 1VIVA 3SDSA 1TAGA 1PZMA 1UC8A 1M3SA 1YQWA 1YAHA 3MWDA 3HVHA 4K9MA 1N6HA 1DINA 3NBUA 3ILVA 3TM5A 3ZHUA 4DLSA 5F2NA 3R4VA 1IY9A 1Y1LA 3SX4A 3TQRA 4UQOA 3U3KA 3IOYA 3L7DA 3LCUA 1R27A 2X9NA 1WV0A 4JT4A 4QQNA 2BFDA 5C34B 5D5HA 4GO1A 2IQ5A 1BN6A 2QUIA 1JLMA 2HLPA 4CMHA 3FNHA 4DSZA 2FSPA 2WAAA 4Y6SA 5KYXB 2C9ZA 3GDHA 5K8LA 4FFSA 1YHZA 2ZSDA 2HHCA 3V1KA 1GNRA 5TJ9A 1N8KA 4BFTA 3GZHA 4MRMA 5JAUA 1XBTA 1Q1AA 1AG9A 1OA0A 2C4UA 4NOKA 3W7BA 2GA8A 4HDSA 4IDDA 4XSVA 4Q9DA 1X2BA 3KPJA 4ZGWA 5C9ZA 4CDNA 3WYDA 4HH1A 2VQ6A 1UJ4A 2VJQA 4L22A 2JH9A 4YJGB 5AK5A 1W5FA 5JSYA 2IK8A 2B35A 3C8TA 3B1FA 3NOVA 4HPWA 2DFKB 3NP9A 4H59A 4Z1MA 1IN1A 1YZNA 1GPYA 2PJRA 2BHSA 1ONBA 1T2NA 8OHMA 5FWDA 4WY2A 1VE3A 2YS7A 4HAXA 4R8SA 2A4MA 4TWZA 4XDGA 4EPTA 1NATA 4AZ3B 4D0SA 1CF4A 5IVHA 2W48A 4L78A 3HBFA 3ZJUA 1GEGA 1ACLA 4XW2A 3PF9A 3G2KA 4G67A 1L7BA 2YYZA 1R9GA 1IDN1 1T4MA 3ELWA 4UM5A 3I2YX 3AT1A 1BJKA 5HIIA 4G0UA 4NOJA 1ST2A 5CB4A 4O6VA 1D6NA 2RGNC 2JIMA 1K7EB 1RWWA 1BMTA 3PB3A 4ZICA 1UJ5A 1V1MB 3PJDA 1M8PA 1O4WA 4XUEA 4BTLA 1E2UA 3GFQA 2P2DA 2XYQA 4AO7A 2I7XA 4F60A 1U02A 3IL2A 2BEWA 3NC4A 5EWLB 4PGFA 3IALA 1FYFA 5SV2A 2A78A 3HP7A 4LC0A 3BMCB 5T57A 5HJ7A 1PG2A 3T6KA 4PPYA 1XRQA 2FUSA 1LNZA 3OFVA 1RRKA 3QWBA 3TJZA 5B4VA 1GD1O 4KR3A 1BKYA 1H22A 3I39X 3DBRB 2W2KB 3H99A 3ML1A 4P31A 5DP2A 2YTZA 3DAGA 3OEYA 4EGAA 2H7XA 1JF8A 2FY8A 3V32A 4EW3A 4TPKA 4BY9E 2XUJA 3EQ7A 3O8BA 4NFSA 5KPDA 2JLVA 2P40A 3N2NA 3O93A 1GYRA 1I4EB 4L85A 4ASUD 3AHHA 2QJTA 1EGMB 1CR6A 1B23P 3DE7X 4MWEA 2UU9B 1GU1A 1M2OA 1P7WA 1RXEA 2DJIA 4YHHB 3MLEA 1DLJA 5CB4F 4B9AA 2HGSA 2ZTSA 3QUAA 1JQEA 5MN4A 3TR6A 5DLQC 3NHAA 1SJ9A 2JZOA 5TR9A 4MUJA 1HDEA 5F12A 1JKJA 4BP1A 1RRVA 1AMUA 1VKOA 3F7MA 4E5UA 2WQZA 1OXKB 1QQ6A 4QO7A 4YDQA 1BN7A 3QF4A 3OQBA 4MV3A 4WINA 2ZRHA 5DT2A 3ZE7A 4JYZA 1CHDA 3DAFA 1E6LA 4EHHA 4IIXA 1XTVA 5DIZA 1ONOA 1ZHFA 2ZI9A 2F6RA 5EJIA 1DV1A 2G1JA 3UT6A 1OYVA 3CIFA 4BNKA 2Z8ZA 2JLXA 1DBSA 3I6MA 1H85A 4NICA 5IVDA 5BUCA 2HYDA 4C07A 3RSLA 3IP5A 3C6KA 1XVLA 4OGLA 4J76A 3IAUA 5FTNA 1EXNA 5ELMA 4MJ7A 3A6LA 3QHPA 4YONB 3ZX4A 4WOCA 4B75A 3A70A 3Q85A 1DIHA 4CLHA 4WBNA 4MVJA 3JQBC 1FS4A 4N5IX 4P92A 3DXYA 4GDMA 4A0HA 3QGMA 3GZNA 4PO1A 2XNKA 5K8JB 3FPFA 5K3DA 4DWJA 1GT6A 2WZBA 3KEQA 3DXZA 3N2LA 4KC0A 5LZ5A 2PD4A 4ZCQA 5TB5A 3R7LA 2IYXA 4CTMA 3A6HA 4H77A 5BSRA 1VIDA 1UK8A 3CSUA 5C18A 5K0JA 2FN4A 2ADFA 2PBFA 3GARA 1W2WB 3N2GB 1BYIA 2NQ8A 2YV1A 2V6IA 3LQQA 3W3AD 4F4HA 2X0NA 2BMWA 1GNTA 4L5JA 3WQQA 3UJPA 4M87A 1SB8A 1C7FA 2OVBA 1BVYF 3FPBA 3VR5A 1S2OA 3AP2A 5LZ4A 2FUKA 4MDFA 2QGAB 1KK2A 3RSHA 3EGCA 2M2IA 3C1OA 3KAQA 3OCJA 1KE2A 1NF9A 5A5VA 4ZVTA 3VSDA 1P31A 3KG2A 5BWCA 2VXOA 1G6OA 4HDKB 2QJOA 1T5LA 3PFFA 3R9IA 3TIGA 1KMCA 1E9DA 4WK2B 3LT5A 4WZBE 4DZTA 3GIWA 3H11B 4HLQB 2FMTA 1U5BA 2J09A 5IT0A 3VC7A 3KVNA 3O3MB 4P3OA 1M7HA 4DQUA 2A58A 5EIOA 5AK4A 1OFUX 1P0MA 2DT5A 1U6JA 3AL3A 2XOKD 1GDDA 5J40A 1AS3A 2BGIA 1ZD5A 3OD1A 1JEYB 3LY9A 5FLYA 5EUCA 3HXLA 2A0KA 1ESEA 5I9NA 1Z2EA 4LYEA 4B1FA 2V4ZA 2XMBA 4TWAA 4DCNA 4EUHA 1ODIA 4ON9A 3PEWA 3U4AA 3AVTA 4V39A 1M2GA 5AFSA 4ITVA 3V4OA 3REFA 1GNVA 4GYYA 4B3DA 1OOEA 2Q6OA 2HB6A 4N1AA 4N5MA 3DGFC 3RRJA 1QV6A 3T0IA 1IZ9A 1IEXA 3ZJ5A 3ICCA 4B76A 2G07A 3FE2A 4EY5A 1YOBA 2BMEA 3T4UA 3ZQUA 1F9AA 3GJYA 1ISHA 3CLRC 4MV8A 1OH6A 2PY6A 3HGMA 4PXAA 4HFMA 3O0DA 4RDIA 2I1WA 5FUYA 2REQB 2GEDA 1TNDA 2W6JD 4LHWA 1ZVJA 4JJ4A 3GN1A 3H5IA 2ZSEA 1ZW1A 4L8GA 4MA5A 5JCZA 3NR2A 4RIEA 2ZQZA 4RL4A 3ZXSA 4FOTA 5B30A 2PWYA 5DV9A 3GJ7A 5EHGA 1IJFA 1V7ZA 3FTNA 4PBTA 2ONKA 2XOKA 2Q5EA 2Z1MA 4KRGA 2G4CA 1TM1E 1HDIA 2GN9A 2IIPA 3DUWA 3F6PA 4HRXA 2QL7A 3SX2A 4RZQA 3SE0A 2F64A 5CA1B 1F12A 1KJYA 2WT8A 1JV2B 1X13A 3REGA 1KVTA 3H4IA 2WHEA 5DI9A 3KT6A 4DBZA 6NULA 3MG9A 3HYNA 3RTDA 4TTVA 3V3TA 3R20A 4KXNA 3AXTA 5DO9A 4L5YA 5K0CA 2NO9A 3QF7A 5F1OA 7ABPA 1QHHB 2PN1A 2QT1A 2OAP1 1IEQA 4RMHA 1IBLB 3O8NA 2RGWA 2ZR8A 1NLYA 3ABOB 3EQ9A 1V6AA 2D0DA 1J00A 4RLFA 1C14A 1GUDA 4QQKA 5GWXA 2C99A 5ALKA 2V5AA 2EZUA 3WGKA 5A4KA 1U2EA 3L7YA 1HI9A 1MB9A 1E2LA 1ES9A 4D0LB 1SOVA 1K6EA 1T9CA 1A7KA 3BXPA 2XOXA 3R7SA 3CH6A 2X1LA 1U2SA 2X6TA 3G59A 3KSAC 3DBLA 1P4GA 1D1PA 4DWWA 2QTTA 3HJBA 3KUXA 3HR4A 2OCAA 1KS9A 5L3ZA 4K7JA 5EOVA 2PCLA 3KD2A 1NHGA 3DWEX 1ZOSA 3MGAA 1Y6RA 1TYCA 4GE0A 2P6PA 3WLMA 1WMDA 1G8KA 3JQ6A 3ZDEA 3QF4B 2NOAA 4Q66C 4RXUA 4WFKA 1AGRA 1ESNA 3LX8A 5TPZA 4A8JC 5I7RA 1UJ2A 4RPCA 3KEMA 4KXLA 1JX6A 2C59A 4CIWA 2VCEA 2EKDA 3K7EA 2GPAA 3DOCA 3HJTA 3L0ZA 4F84A 4KQMA 1DIBA 1DQNA 2XCRB 1NAIA 2QIPA 1P2TA 3EW7A 1LWNA 5DN6A 1IG0A 1ZQ9A 1Y6ZA 2VF5X 1GUYA 1Y4ZA 1NBOA 3JQCA 3OTIA 1JPJA 5HOQA 3TQTA 5CA1F 3AG6A 5JNRA 2NG1A 5JCPA 4MGHA 1UMBB 2W71A 4L75A 1J0DA 2ZWVA 3TBKA 2WM3A 5LNK1 3E7WA 1OI4A 4G0QA 1JFTA 4YUZA 1N8NA 5BV8A 2HA0A 4LISA 3H5NA 3PPXA 4I3FA 4OX9Y 2Z4TA 4EHKA 1FQOA 3MJRA 5JS8A 4KV9A 3EFOA 1INLA 1JAIA 1M34B 4B47A 2Q4EA 4CN9A 4BC0A 1P1JA 3JARA 4BNGA 2IXEA 1PGPA 4IIGA 4C4AA 4P3NA 4DLYA 2VAPA 3SYMA 2I9KA 4O4LB 4TT3A 1KEEA 3CA8A 1MDFA 2EZTA 1OUMA 1FZTA 3PI6A 1GFWA 1WVGA 1HDXA 2H0AA 1ZXXA 2YW9A 2VYNA 2Z5VA 4MRAA 5G3ZA 1RC8A 2UUOA 3JX9A 2NT4A 1LDYA 2F1OA 2FJUA 2DH5A 2J67A 3CLUD 3E8XA 1EXDA 4LRYA 5FPPA 4J7CA 5HS6A 2Z8XA 5I9TA 3GVIA 5LJLA 4UDYX 1O94C 2QRZA 2WJYA 2H8GA 3DDNA 5BN1A 4OHYA 5AICA 4F4IA 2DM6A 2QLMA 3E2IA 2YOGA 3U3MA 1JEQB 4Z54A 2I6SA 1H2WA 1Z5WA 3W77A 1HKUA 4Y1EA 3Q3CA 2FW6A 2BKUA 3OZIA 2G88A 2Q5LA 1ONNA 4DLRA 4G4SO 4KXFB 1ZCJA 2FX3A 4UCXA 1H2RS 1Z6GA 1VKHA 1QHXA 1PHPA 2B2XA 3I9OA 2J31A 3OOHA 3PLRA 5B3JC 2AZ4A 1W8IA 3Q9UA 5IAOA 1Y3CE 4TYWA 3ANXA 4UTPA 1U2DA 3C4VA 3OP4A 5JV5A 5K99A 1SPXA 2ZAMA 2QZPA 3HA3A 2IS4A 1W94A 1XJ5A 1Q5PA 5GM1A 3A8TA 1Z6PA 3IAS6 2WYOA 4PXSA 1O1YA 4EI7A 2HRQA 3PU6A 1M33A 5LOVF 1J2EA 3IYLW 1E3WB 1RACA 1M1ZA 1PU2A 4P54A 5IXYA 3B70A 3QELB 3DGEC 4IDOA 3BTSA 4YIHA 1SC1A 1N0WA 4CCSA 1KOGA 4O5AA 4OUKX 5CT5A 4WV3A 2QOEA 1AHPA 4PYKA 1QF7A 4LSWA 2QJRA 4AG3A 4DJEC 4KHPB 2OWDA 4EMTA 3FGOA 3KKZA 4D9KA 3V5NA 1R37A 1EI9A 1XDBA 3CX6A 1XWOA 1ISRA 4C3ZA 5DYNA 1TCVA 2RHRA 2B1QA 1VLLA 4A6XA 2BFPA 3KUUA 5JD4A 2OCGA 5CG2A 1TMGE 4QC2A 1H0SA 1T0UA 2VPWA 4M1QA 4ZJUA 3KT0A 3R6DA 4F2PA 3TRJA 3CVOA 1I33A 2ZUUA 4H18A 1L5SA 4RADA 1V4NA 2C7OA 2ZJBA 3OHMA 3KWMA 1GPAA 2JDID 3REQB 4II2A 3EARA 3LLVA 2VJYA 1ZISA 4MMYB 4H6XA 2VHJA 1NX6A 4TL8A 3RG8A 1KJJA 1SCDA 5I4BA 2EHDA 2P2ZA 4W8HA 4ZO6A 1A0OA 1UT8A 3AFMA 3GCWA 3F4SA 4P4LA 5HSGA 3KCQA 5LM3A 4HH4A 1WZCA 3B2QA 2FV8A 1OAOC 3A06A 2QA5A 5TARA 3REQA 4GQIA 3ADKA 3E8MA 4B6QA 4E2YA 2D7DA 2WIJA 2V5UA 1KJWA 4RABA 4CYMA 4NS1A 1JIVA 1E7MA 2R5WA 3BFKA 4EQ6B 2L42A 3DOIA 1GTL1 1KYVA 3T5MA 3K2IA 3VO1A 2IELA 1NRWA 1XTIA 4WZZA 1ORHA 5MDHA 1NXWA 2ADMA 4G4IA 5JRDS 5BQ5A 3H75A 3KKEA 3OP1A 1YONA 1ZAKA 4PV7A 5IJ0A 1C0PA 3B82A 4IJMA 5HKLA 3EXFB 3QBJA 4EG3A 1T2VA 2R48A 2BLNA 2Q3JA 2WUFA 5G0UA 3KQHA 4AI6A 3ISTA 1TYAE 1T26A 3P5SA 4QSHA 5HW2A 2VC2B 1PJ8A 4EW1A 5CCEA 1P2UA 4HXEB 3WFIA 4DMUB 1G4HA 4DIBA 5HWSA 3KJNA 1WNFA 4CMEA 4KNYA 1R4AA 1UMBA 1F48A 3UAVA 4BE7B 4U7DA 1TZ2A 2BH9A 5CFOA 2RGAA 4G8BA 1UXIA 3T3IA 2QS9A 2ZXFA 3CRZA 4LJ4A 4AJHA 2J85A 4ZV4A 5BXYA 3ZW8A 1N7HA 4OEHA 5ED4A 1DIOB 3QKTA 4B6PA 1UPXA 4LI0A 3AY7A 2OZLB 2PRIA 2O2ZA 3JWGA 3PVSA 3D6MA 2XQJA 1UMCA 5IKEA 4NE2A 1R9NA 2YVAA 1PO7A 2EATA 5WRFA 4DCJA 2DVMA 2WWWA 5HFNA 5L9AA 2IY9A 5GONB 1IATA 3QA3E 2O7SA 3HN6A 1ULUA 5L4LA 3FZQA 4BN5A 4CV0A 3NASA 1MABB 5AM1A 2VRNA 4BO2A 1DWPA 2FKNA 3J81A 2IYNA 4MI6A 5F4ZA 3TTWA 2P9HA 1N9GA 4QPJC 4BFZA 1E2BA 4PNHA 5AKIA 3DQZA 2HA3A 4G0ZA 1T34A 2GK4A 1JDNA 1P4SA 2JGFA 2Z09A 1JE1A 3IHLA 4LXHA 3A6ZA 2AFHE 2TMGA 3ANLA 4MP6A 1KU0A 3NTXA 1G7RA 3FMVA 3VX4A 3PQ7A 5JQGA 2D0PB 3HYRA 1MLDA 1WXDA 1GQQA 5JAMA 3Q9SA 2JIRA 3UB2A 4ZK2A 2C7PA 1QG4A 4M0LA 1GLGA 4MQUA 4RFSB 5EHQA 4Q82A 4H1TA 3QV1A 4M9RA 4B3SB 4HADA 1LF5A 1XO1A 3DV0A 2W6MA 3HV0A 1DS6A 3OZVA 2EWVA 4I2VA 3TMAA 1ZCZA 2VNKA 3K2EA 5FUBA 1UIMA 1P0QA 2JFFA 4KKVA 4RFVA 4B7CA 2KPOA 1E1QD 3AIOA 4BRZA 2XNHA 1SXJE 3G2OA 4XUCA 1UWKA 2QJWA 1NVTA 4RVOA 2P1RA 2BISA 2RG7A 1MF7A 2ERCA 3D4BA 2BD0A 3PKJA 4HXGA 1C3VA 1VRCA 3BEOA 4OXIA 1CR2A 3D2CA 1MC4A 3D7RA 4Q7JB 2VTKA 1Y3BE 1FUPA 2O4UX 2YHUA 3O7WA 1P72A 4K6MA 4EEKA 1XN1A 1KYIA 4JI0B 3KHUA 3GD5A 5BT8A 2OV3A 1SIBE 3R3ZA 3QELA 3ZLTA 3SLRA 1E98A 5CVTA 2ZTHA 4V38A 4V3BA 3RRMA 2UVQA 1U3UA 4FE7A 3URMA 4X20A 4YQFA 1GUAA 4QTTB 4FGJA 3GQBA 2CYBA 2PFKA 4Z0TA 2QV7A 2W2KA 3W5IA 3HBNA 4U3JB 5I9IA 5JSZB 2XTNA 1MIOB 1KSHA 3ICVA 3JTMA 1QIMA 4C9BA 3EH1A 2JLWA 2WY2D 2PS9A 2AF4C 4DUYB 1H2BA 2E3JA 4DLBA 4LVOA 4CKBB 1E2DA 2X0IA 5EJFA 5BV1A 4YRZA 4UM7A 2ZSFA 3ROFA 1OY1A 4CM9D 4X66B 2WVAA 2O0LA 1NXXA 2A1UA 3K9LA 2OVFA 1WKCA 3Q87B 3EGXB 4Z51A 4GRIA 1DPFA 2PL1A 4OQ4A 1L7QA 4ALKA 2K6GA 3GRUA 4QYWA 3V46A 4P34A 1JDJA 2YWDA 3K1TA 2C4MA 3D6NB 4S3MA 2VRCA 4K46A 1I9GA 3F90A 2IA5A 3L0CA 4KUGA 4P7JA 4EHJA 1XKXA 3KTDA 4XCXA 4EF5A 3CXUA 1B7GO 3KZKA 4L07A 5KTRA 1E4OA 5IVIA 2PX8A 1N0VC 2CXNA 2LXNA 2CDRA 4RJJA 4JEUA 1UAAA 3FBTA 2RAFA 4NX2A 1GRCA 3M7IA 1B0UA 5E95A 1E0JA 2YQ4A 3CE6A 3E3OA 4LZOA 5DOVA 3U3OA 3QYAA 4B82A 3T0FA 1M6VA 4HGRA 4S1NA 1CUVA 4ZQGA 1U3CA 2AMVA 3VKGA 4GX0A 2RHMA 1Z0ZA 1Z2DA 4NI5A 3WMFA 3B3AA 2O19A 3KR1A 3PR2B 1KWKA 3CZ5A 1YR2A 3QPBA 2P6RA 3TAXA 4X8HA 4FKBA 2I3GA 5FB3A 4H60A 3K0CC 1SQ6A 2OM2A 4NCXA 2Z6VA 2B1JA 1ENOA 1YKFA 4NNPA 4DBLC 4TZ6A 1NNUA 4FW9A 2DHDA 3X1YA 3RDPA 1Z06A 4QEZA 1KRXA 3AILA 5K8CA 2PJDA 1GAQA 1QIGA 4ITUA 4E2FA 2XUKA 4D9IA 1YD7A 3MJFA 2H1OA 2HMWA 3W5JA 3M5CA 4ML3A 1F06A 4C5AA 4EI2A 2ZCJA 1W1WA 4WA7A 6CHYA 3CVWA 3LPCA 3V4RA 1J21A 1N7IA 3UMRA 2A0WA 4L0QA 1W5EA 3MEQA 2AN1A 2VJNA 5JYDA 1B42A 1QTIA 4E2ZA 3QM1A 3V8NA 3D4PA 4H3SA 5AT1A 4RHUA 3GOQA 3H2GA 5F7XA 5BOSA 2RAVA 3ZLJA 2QZJA 5B4TA 1GRQA 3MFYA 1TQ2A 3LTEA 2HTFA 4MW4A 4J4BA 3A26A 2WV7A 1U7PA 2I67A 1OYWA 1HE3A 5M5BA 5BVHB 2JFZA 1TCBA 3NWOA 3PA8A 4RA9A 1GPUA 4RH1A 5LUAA 1DUVG 1DTEA 3ZV7A 3ZQ6A 3CLVA 3AF1A 5FUWA 4JBNA 4OLJA 2D3WA 1C8VB 2JH8A 2X5JO 2VYFA 5FQNA 3K5WA 4OH1A 5KO2A 4CEHB 4HWSA 2VF8A 2R8XA 2J5RA 2FR1A 5YASA 3B53X 3LCRA 3Q98A 1QSGA 5BVHA 1V2GA 3LVBA 4WBSA 4ZV9A 1XPRA 3UN1A 1K6XA 1SB9A 1JG2A 1ODJA 4J7AA 1N5JA 1FLNA 4ZODA 5EWLA 2ZUEA 3AESB 2SECE 4Y2GA 5EPEA 1U4NA 1NBEA 3C7AA 1RDFA 3EMDA 3EDCA 2XB8A 4RQAA 4CMIA 4LZAA 1QGDA 2HHAA 4PHCA 1I1QB 2GFHA 3RADC 3GAMA 1DAKA 4DMCA 1PT6A 2IHTA 3A9UA 2I7CA 3NHZA 1OHHD 4E4RA 3OLQA 4PTLA 1I3CA 3QKWA 1R4MA 4D41A 2C9MA 2BL4A 2XVAA 3CLRD 3S8EA 4MIYA 4MKZA 5D2CA 3RU3A 3QVMA 3ZD9A 1T5IA 2YX1A 2QW1A 3P2OA 1OIVA 5KYTA 3M6FA 1L8QA 1UFVA 3WIEA 4REQB 3RODA 4PIVA 3B1VA 2IUTA 2XBLA 1QORA 4M1KA 1T15A 2HH9A 1AOXA 4LBZA 1Z5NA 2WB2A 1GCOA 2YV4A 1XELA 1OC2A 2OC9A 4NSNA 3VI3B 2G7ZA 1YZFA 4YUAA 3H2SA 1GAXA 1GNQA 5JH7A 2WMDA 1CDEA 3U39A 4LF5B 1GSOA 4EFCA 4DA9A 1P0PA 1IY0A 1WJGA 2D00A 2R65A 2A5FA 2R6HA 2RH5A 1N3IA 4M2LA 4PFSA 4TUYA 3QLTA 2BMFA 1L1QA 3DOUA 4F9EA 4HP8A 1QVRA 1YUNA 3BPSA 2YL2A 4GW3A 2V4MA 3NAQA 4A92A 2ZB7A 4G86A 1U0JA 2GSDA 1DRKA 4XR4A 3U7FB 4JC8A 1R0BA 5AW9A 3WMEA 2JW5A 3WGZA 3KPVA 3UMBA 3OJCA 3Q40A 1I14A 4ENWA 1RABA 1C9NA 1M74A 2Q3HA 5E2BA 3BILA 2GVDC 5HK9A 1I5OA 2FETA 2G28A 1J9ZA 2GAJA 2D59A 2WP8J 3TSAA 2ZWOA 1SFRA 2H11A 2H92A 5J5CA 3LQKA 3NT5A 4TXHA 5IAJA 4MRVA 5DW0A 3S0JA 2M1ZA 1FC0A 3HRIA 3IOBA 4OXXA 4MLCA 5D6OA 4J7UA 1QIFA 2J4DA 3V97A 2QX9A 4XXHA 2KMLA 3F1KA 2RSLA 4LOHA 5L45A 4LKRA 5EHZA 3WQSB 1BMFD 3U5ZB 1Z8DA 521PA 2G3YA 3IGFA 1KZHA 3WRWA 2RONA 3HADA 1XZLA 1Z8FA 4RHCA 4PAGA 1J56A 2O6LA 3WNVA 2BGKA 1R0XA 3AFHA 3DONA 1DOHA 5CVCA 5H1YA 1A82A 5CVJA 2FW1A 4S05A 3R7DA 1WX1A 4NCHA 3GUUA 1YKSA 1CT9A 4YR7A 4YASA 1W5TA 3MD9A 2H5EA 3LECA 4NPHA 3H6KA 1B00A 1TEXA 2Z6UA 1ZOIA 4KAXA 4UMFA 2NX2A 1TC2A 1FFBA 2CXTA 2GA9A 3BWYA 4BO7A 1RJFA 1T3TA 1EP3B 1U9IA 2PMDA 4WCFA 4H6WA 4O4LA 1UWCA 3QP9A 4EAQA 1HR0B 2NADA 1T29A 3L4BC 1XWFA 4JI6B 4BO4A 1I7NA 2R8BA 3ZUPA 3FF4A 5CT8A 4JD5A 3V4ZA 5AW1A 3FRJA 5AK6A 3AR2A 4FNAA 1D0SA 2XE6A 4YUWA 1U7HA 3S4YA 2WJ6A 3K0KA 4BWYA 2O5CA 5ER6A 5KNDD 4ZI7A 3LQ1A 3JQFA 3VPSA 4R2IA 3BGIA 1A88A 1SULA 2A94A 3ON5A 3CG4A 4G1VA 2Y1CA 4FYYA 2QLFA 4Z9YA 3UWOA 2Q0QA 2IHBA 4Z2AA 1DC5A 4QG7A 1XMVA 4J9UE 1IOVA 4MUXA 5E2AA 3UC9A 3ERCA 2H16A 3IIIA 2YRFA 4BE4A 1LDEA 3I6YA 4LOIA 1E0SA 1TA0A 4AY6A 5JASA 3USCS 4PCVA 3CZAA 3RJMA 2P4HX 4GP9A 4XB1A 1DG3A 2AI3A 3TOVA 1GV1A 2JJ2D 3WV5A 1MVLA 1TUEA 5DASA 1EB9A 3DZ8A 5BV2P 3K70D 4NV3A 4FEEA 2H6EA 3HUTA 3OZRA 2PZEA 4ZQIA 2JCBA 1K7XB 2WU1A 5B12A 1SUSA 4LGYA 3S1AA 4TS3A 1E9EA 3VOTA 5BN3A 1TE2A 2GM4A 2H2HA 2PLRA 2DKFA 5L53A 1ELOA 2GXUA 3KYBA 3X1WA 1POWA 4S1VA 1YCFA 4F12A 3C39A 2VBGA 1A1SA 2WM8A 4HGZA 3KSUA 1NYRA 1VIAA 2YRWA 3W6UA 1L5RA 3WWDA 1B4DA 1HZZC 1QFMA 2H4JA 2G9QA 1RHJA 4DR6B 3TLBA 1WCIA 3R7NA 3WS7A 1L4EA 1P60A 2PG3A 5CM9C 4DGQA 2E4VA 4N5NA 4GOND 3DLPX 4N5DA 2P6MA 4I50A 1WXQA 3UATA 5ICMA 1GGFA 2IEIA 3DE2X 4CHGA 4QDJA 5FDFA 1J0CA 3NCTA 3JRNA 3IUNA 3K0HA 1WS6A 2ZR9A 4GP7A 4MUFA 3RVLA 5CAEA 3CKLA 4B3CA 4NYIR 4S04A 5IFKA 2CK3A 3ODPA 2YJ5A 5DP1A 1V11A 4R3WA 3OF2A 1T36B 3S28A 3VRHA 5CHEA 3LWDA 1NJ2A 5TGTA 5BYJA 3RHFA 1NNSA 2O8DB 2ZITA 5DSZA 4J6FA 4BZQA 1WEKA 2JFVA 5M7EA 2BP7A 5KYGA 2ATEA 3DXXA 1WU7A 4Y2PA 3PXXA 2YWCA 4KXVA 3L6OO 4LVCA 3VXKA 4A8JA 4PTYA 4MW0A 4MA0A 1ICEA 3CW9A 3I45A 3N8DA 2W6JA 2PRSA 3QW2A 2Y0DA 3BRCA 2Q2VA 3IMGA 4HB0A 4PSAA 1SGWA 1Y4UA 2X4LA 3FAKA 1WABA 5JPDA 2WIKA 3SJZA 2HLHA 4IVQA 3MJHA 4D46A 2VDOB 4KTVE 1FIUA 3TR5A 1TLTA 1X1QA 1QLJA 2WI8A 3EFEA 4I4TB 3T7SA 5MGBA 3UT5B 3ASZA 1KH1A 1R5NA 3KNZA 4M0CA 4OHWA 1SG0A 3GUCA 3EXAA 1CXZA 4RVCA 4BB0A 3NB0A 3LZ6A 4IEEA 4DQXA 4C4ZA 3GJQA 4RMGA 1SR8A 4HQNA 1NJ1A 1Q50A 1WKBA 1N36B 2Z6QA 5CJJA 3B1KA 2FPPA 1XAJA 3EAGA 4MUGA 4RY2A 4AP6A 4C2TA 1AZSC 1CIJA 3WKEA 3EVBA 3PC8C 4DDUA 3OCCA 3GLUA 5ITZB 5JPCA 4G0MA 1N1EA 2HK8A 2KE5A 4G1UC 1PDVA 1VECA 2FZ4A 3BWMA 4J49A 2YH2A 3D2LA 3OY7A 4IHAA 4N12A 3L5OA 2NWQA 4URHA 4D0RA 3SQWA 3IESA 4LHEA 4DG8A 6GPBA 4HBGA 2V45A 3E9MA 1KEEB 3GJ0A 3H4TA 4MV1A 4ONEA 4ER3A 5JMOA 1Q6ZA 3EJ6A 3VR6H 4FXPA 1NVVR 1RIIA 3RC8A 3WB9A 1WY5A 1ZYUA 1DIAA 4IXTA 1OTYA 1YZUA 3DEZA 5KX5F 4HXFB 3SI7A 4TS9A 1R5BA 5DXAA 1MVNA 1C0LA 4QNRA 4QASA 2QRNA 1E9CA 1NYQA 1Y9JA 2O8NA 1SEVA 2GK7A 5HBGA 2QL6A 3C0KA 4R9RA 1HXHA 1VSUA 1Z26A 3B2NA 1ETUA 3FWPA 3H2IA 3HO1A 1NRXA 5E9QA 2O5EA 1XZMA 2J3LA 3M8KA 4MW2A 5A6SB 3C6MA 3IPYA 5I4CA 5DM4A 5LB4A 1Y9DA 1MABA 3QLUA 3WHKA 3I83A 2VXYA 1CUBA 1HG1A 4E1BA 2G04A 3LKBA 4MCAA 2ODQA 2OO5A 1IPHA 5A4AA 3S1SA 1H05A 4GU5A 4TTSA 3PXDA 4DDKA 4TXMA 1YB2A 3S8MA 4EI9A 5JALA 3HCWA 4D9JA 1BXKA 2F8MA 2VF7A 3LMKA 3A2LA 1RT9A 4FMDB 1JU4A 3KUCA 2ZRKA 2GD2A 4PZPA 1E99A 4O2LA 3LBFA 4R1OA 1U3WA 2J0SA 1EIWA 1A77A 1JAYA 2AJ8A 2QXTA 4PAMA 5KX5A 1BG6A 1E4VA 2J7PA 2I78A 3W34A 1Q5NA 4HB3A 3ZU5A 2PTSA 2UVDA 3GL9A 3JZFA 4IY1A 1V5WA 4KGVA 3MMZA 1SQGA 3K94A 4KMRA 4URZR 3TRHA 3TXXA 3TTSA 5DBHX 3RK1A 4B79A 2DQSA 1SD2A 4C6RA 1NLMA 2AFIB 1RYNA 1EDBA 3VGPA 3NRJA 2ATXA 1FTYA 2R6ZA 1M6HA 4NHOA 3I4CA 2IVFA 4MIOA 3PUZA 5IC4A 3KXIA 3B3QA 4MDYA 4QRIA 3UMSA 3MJSA 1GKKA 4X1IB 4AURA 2VQFB 4BVAA 3I2JA 1Q16A 3KB2A 4CF3A 1DEKA 4O1MA 4O4IB 5KC8A 2MDTA 4F1KA 2QX4A 2Y93A 2PKYX 1WPQA 4OHRA 3VM6A 1ZNZA 5AD1A 1WLYA 4ENPA 1Z0DA 3LZCA 4Q1FA 4P0TA 1AB6A 4KH1A 1HDZA 4U7FA 3VBEA 1X77A 1Z29A 2LTAA 2ZSBA 4OQNA 5A9SA 4FT4A 2BEUB 3NPMA 4DC1A 3OA2A 2ATIA 5H3CA 2F1IA 3IDZA 4JP3A 3M5DA 4L8YA 3UMVA 3NO9A 3W5SA 3N0WA 3P71T 4XLTA 4JSTA 1W49A 5B5SA 3R0XA 1LS1A 3IAHA 1Y8RB 2BSXA 2GEJA 5B3JA 4MS1B 1JLKA 4RCZA 4WNAB 2ICAA 3LL4A 4M0FA 3SR0A 4D25A 4CFSA 3E4CA 1HYQA 4OM8A 3TOXA 3OAAD 2GNAA 2IX3A 1A5TA 1G8YA 3KJZA 2M6LA 1GCAA 1G8AA 4C7KA 5JMPA 4Z4GA 5CTJA 2XSZA 1KGDA 2IZ7A 1R9MA 2HA6A 1SN7A 3OZGA 1USIA 2YOHA 3DOFA 4GLOA 3VZRA 2H4HA 4BAUA 1HGXA 1KR5A 2DUMA 2BF7A 3K0AB 1KMQA 2Y4OA 4XA8A 4ZQFA 4HH3C 1SHLA 1DKOA 4JQYA 2QDKA 2AI2A 5H70A 5IM4F 3DO8A 1AK2A 2XUIA 3ZUGA 1G6Q1 4EUEA 2Q0XA 2NUTB 3MGGA 4YECA 5ALVA 3H0CA 2IP1A 4YCBA 4PW0A 4CKCB 1U0NA 3KKLA 4CDRA 2IXTA 3MWGA 3KJGA 3WKAA 4EEXA 2EFEB 3HJCA 1B15A 3SJBA 1RP7A 3CW8X 2V5VA 3JQGB 4XD7D 5DNVA 3QU9A 1SHJA 2OQRA 2P7HA 1E1RA 1L5GB 4YY3B 2I71A 3H1PA 1EPUA 3V8VA 1B6GA 4J1NA 1WQ1R 3E23A 4EKYA 4LXQA 4BLSA 3BTVA 1UDAA 2FSFA 3G13A 4K9LA 3V8EA 5CB6A 4OOEA 4OHXA 4HQ6A 4CKCA 3VDRA 4UD6A 5H4HA 1CU1A 3ZQJA 1M1NA 4HQLA 5TQ0B 1U94A 1W4ZA 2XZOA 1WY7A 1XU9A 1NJ6A 2W2LA 1Q2UA 1VHJA 2RDMA 4AX8A 3LE8A 1Z6QA 2ZIFA 3DMPA 3OE1A 4NJEA 3CN9A 1S0UA 3HFSA 3WHLA 4TLBA 1DWOA 5CW2A 2H59A 3INYA 1NBWB 1X0VA 4BWGA 3R23A 4Z4HA 3AKCA 1DELA 421PA 1I2CA 2E49A 5B58C 5CPBA 3FWYA 4MAMA 2QN1A 4E4YA 1Y8QA 5HGXA 1NW7A 4RD3A 1QHGA 1MRZA 3LIIA 3WK8A 4DR5B 4I36A 4LV8B 2A92A 1ECLA 4QPCA 4ZWNA 1QIIA 1T0BA 4RSRA 4OB6A 2ZGVA 5ALIA 5DBIA 2BFNA 4DR2B 1OKKD 1ZXBA 2R5NA 3MT0A 4AWXA 1NM5C 2GDZA 3BSFA 4NBLA 3HUEA 3DCNA 5G1OA 4EPVA 1KDTA 3Q7QA 4AF7A 1Z4IA 2YINC 1IHUA 1F2VA 4FU0A 1H0RA 3T7DA 1EZ4A 3LO8A 2AZXA 3QEAZ 4OPMA 3P32A 2QRGA 4E5PA 1UFOA 3I9JA 4RJIA 4EB6A 4Z1MD 4Y9UA 1DEXA 2NO0A 4BNZA 1EG7A 4KTTE 1SOUA 4CEHA 4ZALA 1C1XA 2HJRA 3U2QA 3BCRA 2QP3A 4C4OA 1GZ3A 4G9EA 1B16A 1XQ1A 4AJOA 4WN3A 4EARA 4M0KA 4L5AA 2ZI7A 2G72A 2BJHA 1FSGA 5KWIA 3PTAA 3ND8A 3JYHA 3A3PA 3JY6A 3KSDO 2WDPA 3SEZA 4ENVA 5BSGA 1WOMA 4WX2B 1V3TA 1BAPA 5LD2B 3PPWA 1VA5A 1SCJA 1PJQA 1JALA 1RRGA 3PVZA 4Q03A 4EH1A 3RU2A 4IDFA 2YN4A 4XLZA 1NUUA 2XWQA 2JFBA 5KZMB 1DAIA 1UZUA 3SP1A 2MWMA 1IK4A 3EWIA 1Z6AA 1E5QA 2XIQA 2PLFA 4PBRA 1FYWA 2R79A 3PCRB 3OPYB 1U0FA 3WHIA 1NQAO 1VE6A 2WF8A 2OZEA 5KTKA 5HMLA 3BHJA 1AKNA 2QAGC 2AN3A 2NYAA 2H1WA 5IDXA 1PLLA 1VKZA 1J49A 4FMCB 2HU8A 4C4SA 2WPNA 2FRVA 5MHTA 2B30A 1IQPA 2D1RA 4UTZA 3W2IA 3T94A 1I4LD 2AE1A 4AJEA 3HZHA 2J6CA 1WUKS 4CF4A 3PL5A 2P78A 2H2WA 3ETGA 4GX5A 5B7GA 1G20A 3VYRB 5E1MA 1ZUHA 4OYHA 5A4MS 5JAIA 1KMHB 1H93A 3DWIA 4MS1A 4D9MA 3F4TA 3EUAA 4ENRA 3U31A 1SK9A 1XIVA 3D6HA 2B20A 4C76A 4HLUC 4XWTA 1QJCA 1DOAA 3NV9A 4Q93A 3F0TA 4TTRA 4LY0A 3AI2A 2W2XA 5JNSA 2F9FA 4R2WA 3LQ4A 3SXJA 4C1BA 3B89A 4BQFA 1BU8A 5HKAA 3I2GA 5JZMA 4CFZA 4Z86A 2GI4A 3JS5A 4POAA 3DO6A 4GQBA 2DLCX 3CSSA 3WXMA 3TMYA 3RYHB 2BSAA 3IMEA 1AKQA 4EA7A 3V2IA 4I55F 4YPFA 4NU5A 5TY0A 3BAZA 4XGQA 1JR3A 4PVDA 5IZCA 2PVCA 2VQDA 3DTVB 3PC2A 3UMJA 2AZMA 4YGXB 1P8JA 3T7RA 1Q83A 5LB2A 2J07A 1KL7A 4KIGA 4WWHA 3GLFE 3BUSA 1ARZA 4V1CI 1QGUA 5K2OA 3IMCA 5FPSA 4ZRMA 5LLDA 3L5KA 2JB9A 3FTCA 4K6HA 4UMDA 5FA8A 1ZM7A 3QJ5A 4CIBA 4LYFA 5AVJA 1ISGA 2HQOA 2VRCD 3I32A 3QRWA 2PUAA 3FGNA 3LU1A 4QVKA 3SEQA 3BE6A 2X2OA 1YOVA 5HR5A 5IF9A 1NUTA 1PR0A 2QBYA 4PZUA 1TM2A 2A5LA 4Q4LA 2CL6X 4CTNA 4QTYA 4RTJA 1BDIA 5ALEA 3N7AA 2GHRA 4IZOA 3ZDZB 4E6PA 5GZ3A 5HKKA 4N6GA 5CLJA 4GPAA 1FJHA 4J0CA 5IK2