4YIHA

Crystal structure of human cytosolic 5'(3')-deoxyribonucleotidase in complex with the inhibitor pb-pvu
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
192
structure length
192
Chain Sequence
SVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase, cytosolic type
publication title Structure-based design of a bisphosphonate 5'(3')-deoxyribonucleotidase inhibitor
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 70
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 3.1.3.-:
pdb deposition date 2015-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4yihA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4yihA01
5AICA 3QU5A 1T5SA 4BKMA 3UMGA 3NAMA 3N8GA 3A1CA 3UMBA 2W43A 3RFUA 3ESQA 1XPJA 1X42A 2WF5A 5A3SA 1VFPA 2C9MA 3QU9A 4EZEA 1NF2A 3QGMA 4YH1A 1S8OA 1SWVA 2FDRA 4PNHA 2GMWA 4UASA 4XPZA 2PR7A 5ALFA 5IT4A 2IA5A 3I76A 2Q4TA 1NRWA 1YNSA 4CNQA 2EATA 3NALA 1RLOA 5AKJA 4UM7A 3ED5A 5AM0A 5ALUA 4GIBA 5AW5A 1RDFA 1U02A 4L6AA 1WPGA 2B0CA 3M1YA 2ZBGA 4EELA 5AVWA 2WF8A 1Z4QA 2ZBEA 4F72A 1ZD5A 3QU2A 2G06A 2ODAA 2I34A 2FEAA 2G07A 5AHXA 2GO7A 1RKUA 3QXGA 4CF4A 1L6RA 3AR4A 5ALHA 4UARA 4NFLA 3L7YA 3ZUPA 3L1UA 5AK5A 3VAYA 1RMTA 1NNLA 2B1RA 1FEZA 3U7GA 3WKAA 3ZVLA 2YJ3A 4BEWA 1CR6A 4HGNA 4DCCA 5AW7A 4FE3A 2GHQA 2JAOA 2YY6A 3EF1A 3KD3A 4XE5A 3UM9A 1PW5A 2HSZA 3QLEA 2ZOSA 4BX2A 1L8LA 4BEVA 2R8ZA 3NANA 4IG4A 4YCMA 3A1EA 3PGLA 5ALRA 1Q91A 1U7PA 2B8JA 1J97A 4O8CA 2HOQA 3QUTA 1XP5A 2FPWA 4ZEXA 5ALIA 3AR7A 4HGPA 2MSNA 4EEKA 1RKVA 5AKLA 2NYVA 2G09A 2R8EA 3E84A 1L7PA 3SLRA 2B8EA 4NWIA 1Z4JA 3OCZA 4UM5A 1RMYA 2P9JA 5FP0A 2W4MA 3ZX5A 2GHTA 3W5CA 2OM6A 3E58A 3I1YA 2X4DA 1RC8A 3W5AA 3KC2A 4Y2QA 4I9FA 4L6CA 1JUDA 2MU1A 2D2VA 2YMLA 5ALEA 5ALVA 1J8DA 2O9JA 4DW8A 1RLMA 3QU7A 2HF7A 2NO4A 3EF0A 5AW1A 1TA0A 3L0YA 2FUEA 5A3QA 2I54A 1ZD3A 2JAWA 2ZBFA 3AR2A 1MH9A 4RESA 4XOUA 5E0OA 2JAUA 2C8KA 2QLTA 4JDPA 2IOFA 5AW9A 2YN4A 3WK9A 2WM8A 2OBBA 4CF5A 1Z88A 4UAUA 1QQ7A 1WZCA 1ZS9A 3NRJA 4NV0A 1F5SA 4ZEVA 3U19A 1U2SA 1ZRMA 4KNWA 3ZI4A 4F71A 1TE2A 5AM2A 2Q4RA 3E81A 5AW6A 3ZTWA 1TJ3A 5AVTA 3OCUA 4L57A 3RF6A 3ET5A 2FPUA 3U7FB 3IJ5A 4Y2VA 3QUQA 3PGVA 2AUTA 3KBBA 4C4RA 1VJ5A 3B8EA 3ZWDA 4I9GA 2DQSA 5ALOA 3K1ZA 3L1VA 4Y3UA 3L0BA 2RAVA 4Y2JA 2YBDA 2BDUA 5AVSA 3WK7A 3PDWA 2GFHA 4Y2PA 4QJBA 3KZXA 2HCFA 4UAVA 3IRUA 3HYCA 1RKQA 3L8HA 3FZQA 2HHLA 3ET4A 4KYTA 3AR8A 3QUCA 5AI5A 5AKHA 1WVIA 1YMQA 4KX3A 5AIBA 2EARA 3L8FA 2G1AA 5ALYA 3WKEA 4UMFA 2P69A 2I7DA 3UMCA 4BYGA 2CN1A 4BNDA 4B6JA 3SD7A 4MUMA 3QU4A 3FGOA 2B82A 3AR9A 1IWOA 4HGOA 4OFZA 2HO4A 2R8YA 3DDHA 4EENA 2B30A 3P96A 5ALQA 3MC1A 5AK6A 5AKEA 3L8GA 3OCYA 4RETA 2FPRA 1VJRA 5ALGA 3W5BA 3CZ4A 2IYEA 1Z4OA 3BWVA 4G63A 3ZX4A 3KDPA 5ALPA 1ZD2P 2WF9A 1QH9A 4JB3A 1RRCA 2CFTA 5AI6A 2RARA 4QQFA 2CFSA 4EX6A 2ZXEA 1N8NA 4AS2A 1N9KA 1SWWA 5AI4A 5ALTA 3OTQA 5AM3A 5AK3A 2HDOA 3AR5A 4UMDA 1QQ5A 2WF6A 3NASA 4IFTA 4BX0A 3AR6A 3EPRA 1Z5UA 4J2TA 5ALLA 5AW0A 5AVYA 4E88A 1L7NA 3FVVA 2FI1A 1YJ5A 3OCVA 1RMQA 5IT0A 2G0AA 3R9KA 3AR3A 2W11A 3J7TA 5ALDA 1O03A 3FPSA 4HGRA 5AM1A 5AVVA 1Z4LA 1CQZA 1ZOLA 1ZD4A 2I55A 3R4CA 2AH5A 3NUQA 4CF3A 3F9RA 1ZRNA 4UMEA 1EK1A 3WK6A 3WGUA 5AVUA 5ALZA 4NAVA 1TJ4A 1L7MA 4YGYA 5AKYA 1Z4KA 2JGAA 3E8MA 1U2TA 2JARA 3M9LA 3MMZA 4DFDA 2ZBDA 3U13A 4OCZA 3SHQA 3WK4A 5AK4A 2G08A 5AKZA 4Y2YA 2RB5A 3WKBA 3FM9A 4UATA 4YCLA 5AM5A 3GYGA 3KOOA 1Z4PX 4CE6A 2YFYA 3ZVMA 2IOHA 2HEGA 3EWIA 4Y2SA 2G80A 4H1WA 3QNMA 3L5KA 3U26A 4UW9A 3ONNA 3SKXA 2AGVA 1LTQA 2WFAA 2HF2A 4C4SA 3ZU6A 4C4TA 2C8LA 1RLTA 3B9BA 4KX5A 3HLTA 1K1EA 4DWOA 2WHEA 4AP9A 2YMQA 3B9RA 5AVXA 2P11A 1YV9A 2YJ4A 5AKXA 3OCWA 3MN1A 1O08A 1ZJJA 2WF7A 2YJ5A 2IOFK 4YIHA 3ZW7A 5AVZA 5AW2A 2QYHA 2RBKA 5AW8A 1Z4IA 2YMMA 3D6JA 4MWOA 5T41A 1WR8A 1L7OA 3DV9A 4UU1A 5ALNA 3TLMA 2EAUA 2I6XA 5AI0A 3WK5A 3SKYA 5AVRA 1Y8AA 5AKKA 2HX1A 2ZG6A 1Z4MA 2YJ6A 3A1DA 5IS2A 2FUCA 1QQ6A 3ZTYA 3WGVA 2FPSA 1QYIA 5ALWA 3OCXA 4OD0A 4ZEWA 4FYPA 1RQLA 3ESRA 1AQ6A 3W5DA 1L8OA 1LVHA 4GXTA 2AMYA 4AS3A 4HYTA 4Y2TA 2CFRA 1U7OA 1T9ZA 4YIKA 3IB6A 3WK8A 4Y2UA 5AIAA 2I33A 3BA6A 5ALMA 4YCNA 4BBJA 3ZVNA 1RQNA 1SU4A 3WKDA 4G9BA 3PCTA 5AESA 1Q92A 2YMPA 3ZWKA 3SMVA 3N07A 3L8EA 2R8XA 3QUBA 2B1QA 5AVQA 3CNHA 5AKIA 5A3RA 2C88A 3N28A 3OPXA 3I28A 5ALKA 2OYCA 3QYPA 1T5TA 3MPOA 4NABA 1YDFA 1RPZA 1TJ5A 4J03A 3DAOA 3U7EB 3N1UA 1XVIA 4HGQA 4Y2RA 5AW4A 5JJBA 5ALXA 3WKCA 4HAIA 5AKGA 4EX7A 3FPBA 4KNVA 4BNDB 2BDEA 2C4NA 2PKEA 4UMVA 2PQ0A 2FPXA 4KN8A 2VKQA 1S2OA 2P27A 3L0CA 3R09A 3SF0A 4OHFA 1EK2A 2O2XA 3NIWA 4FFDA 5AW3A 2Q5EA 4Y2XA 5AM4A 5AI9A 1Z4NA 3U7HB 4BX3A 3A3YA 3S6JA 1KYTA 2HI0A 5ALSA 3I6BA 3DNPA 2BY4A 2OA0A 3N5KA 1Z5GA 5AI8A 4XQ0A 5ALJA 4UU0A 3QX7A 1YS9A 2NO5A
chains in the Genus database with same CATH superfamily
4EYGA 2JFPA 4FWBA 1P4HA 2QGAB 1CQPA 1GXSA 1SEVA 2VPXA 4G5QA 5A9TA 1AU9A 4QWMA 3BWBA 1OGYA 3LY5A 2GZSA 2CHFA 4FN5A 3H4VA 5G1OA 3MBKA 4LJ9A 5HKLA 2HNBA 3ZV6A 2FWPA 2O8NA 4F3KA 3NHBA 4JLUA 4UZFA 1DBIA 2H1IA 4NATA 4NOJA 4B8WA 1IB0A 2C2OA 3TWOA 5A5EA 1Y33E 1ZCZA 3NBXX 4EYEA 3CUWA 1TF7A 2P5TB 2WAOA 5BOSB 4FW8A 1HNNA 1QVWA 2UVPB 2G4VA 4GSYA 1PFQA 5DB4A 2FW0A 1SWVA 1KNXA 1P3Y1 4C01A 4ETMA 2PTHA 4K26A 4NBKA 4PNHA 4GFDA 4JLVA 3NNDA 1HDXA 2PR7A 4LRSB 5EXTA 1L4NA 1DOAA 3C6KA 3WJ1A 5IT4A 1E3QA 5EP1A 1YE5A 4MWTA 2BBOA 1L4HA 3ZY4A 5EHQA 1K68A 2DKOA 3PFNA 1V48A 2A5GA 2F1HA 5J5CA 2EEPA 4I1RA 1W88B 2EATA 5EZYF 4UXIA 1KKUA 4IDAA 3QFCA 2HJHA 2HYIC 2IXGA 2EKPA 3T3GA 4B0PA 1ADFA 2PD6A 1Y7LA 3EDRA 3D4BA 1O5TA 3H1BA 4AW9A 3KTFA 5AW5A 1RDFA 4EKYA 1Y98A 3TVYA 4HX5A 2IITA 1NBMD 2DBVO 5AJYA 2VHCA 1F6WA 3VHRA 3P9XA 1VKHA 3PQ6A 2CJFA 4QDOA 1GTMA 4KOEC 3GJ6A 1GNRA 1V95A 4I8IA 1SKQA 3T06B 3QUSA 2UKDA 1G5RA 1N5LA 3ISJA 4C76A 4EDHA 4EB3A 2JCYA 3GT3A 5A5FA 3DPSA 2YYSA 2RBEA 3DE5X 3OZXA 1IN8A 1CRLA 3AXTA 3DFFA 1II0A 1ZK1A 4M1ZA 2QN6A 1X39A 4NHOA 2DU8A 4UBMA 1OYYA 3N8NA 5T4BA 3T95A 2F8TA 1Q7GA 4JP3A 2Q6OA 5L7WA 1KORA 1KXZA 1YQDA 1PYGA 1T1JA 4HB0A 4FFWA 2XKBA 4PYLA 3R3YA 5DU2A 5EE0A 1KDVA 3T6KA 3VMMA 3VTZA 3VYVA 3EOZA 2HLDA 2J7PD 3PEEA 2DE0X 4JP1A 3CZ9A 4TTIA 2P65A 1WXEA 2BGKA 2BJHA 2X58A 2XMCA 1PDOA 4TN5A 1Y1RA 1FEZA 1BX0A 5DW0A 1T3TA 3IILA 4GP7A 4O33A 5K3BA 2QB5A 5TQ0B 3N2LA 3OQHA 1CZHA 3TLGB 3FVWA 4DN6A 3CXUA 2VOEA 5KJ1A 4YO8A 2JJ1A 2X4IA 3ZHRA 1C1HA 4K6HA 4QYIA 4H7KA 3IUEA 4D0LB 1SMKA 1TM7E 4P0TA 2HRQA 2YXNA 4QULA 3BMCB 3QVMA 3ROQA 1AQNA 4UUBA 4Q1VA 3NJ4A 1T5DX 2CBXA 1SHKA 5ENZA 3DCJA 3ILYA 2HT1A 4X1YA 3IXMA 4KI0A 3A6JA 1QZUA 5CBKA 1AGXA 5EMHA 2ZIXA 4D98A 2ZDGA 3BCRA 2YKGA 4XM0A 3PBKA 3BCUA 3L0SA 3N53A 3R5SA 1VGVA 1MVLA 3LW7A 1TF5A 1Z5PA 2NU8B 4OU5A 3SM9A 4XWKA 1IQUA 3L4SO 4CMEC 1JDSA 1U9IA 4HDNA 1EWRA 5LZ2A 1HLDA 5ALIA 5HDBB 2VHVA 5JNTA 1CD5A 2VAWA 1FRVA 4JP2A 4NCHA 1E6CA 3TZEA 1IC6A 1A50B 2WM2A 5AKLA 3OE7A 3DTVD 2NAPA 2JFGA 4FN4A 3W3ZB 2FN9A 1VMDA 4P7GA 5K09A 1XTSA 1YA8A 5GP1A 2P6OA 3EPHA 2ZAYA 2Q3JA 4UM5A 1JEOA 2P9JA 2TECE 1F0PA 1QS0B 5A7FA 3DVAB 1TNDA 2Z4SA 3HV2A 5LP1A 2PFMA 4PVCA 3R8CA 4G86A 3QEAZ 1LNZA 3MCZA 5COQA 2C61A 1SKMA 4FYKA 1EUDA 5ADWA 5HTKA 4UKDA 2W48A 4X44A 1HKHA 4ZQEA 4Q03A 3ASZA 1TO6A 4P83A 1QFJA 2D2VA 4R84A 2FSFA 1IN5A 3R24A 4WA8A 2QU8A 4DCMA 1HL7A 1MX1A 4X1KA 5I9BA 2P6MA 1O9HA 1RE5A 2IIBA 4QFBA 3GI1A 3EXAA 4HNQA 3T9BA 4FMCF 4CETA 1W4RA 1U8UA 5FNVF 1IVNA 5EMMA 1A0OA 1CZRA 1JDBC 2H52A 2VPTA 4BFCA 2XRYA 5JDCA 5K0ZA 3OQOA 3G7NA 4RVUA 1GILA 4GI7A 4JI6B 2WOJA 1GPYA 4ZHQB 3WWEA 1N8SA 4C05A 4DADA 3AYXB 1RYZA 2JLCA 2C8KA 2TSYB 1UMBB 1KQNA 4DGSA 5K3FA 3FPGA 4AM8A 5I51A 2O8FA 4X71A 1P2VA 2KW5A 3D02A 3CVOA 4X3PA 4LYGA 4BX9A 1U2DC 5FBKA 4DDHA 2CDNA 4CBVA 3K09C 1TA9A 1KBOA 4Q12A 1LQUA 1FUPA 4UXHA 2A0UA 3HYTA 4MARA 4PLVA 1DTEA 2EWWA 3AL2A 1UXGA 5FWXB 4MV5A 3M6UA 2VPIA 1YDMA 2IF2A 3F4LA 1TT5A 1XLTA 4MJ7A 1GCGA 1YR6A 3FA2A 3OX1A 5FTJA 4IL5A 2J87A 1DDIA 3OY2A 4Q3NA 1PG0A 3OOSA 1RJ9B 4BXOB 1QQBA 3N74A 1PKEA 3V1TC 4I8DA 1TZJA 3V4SA 1Y6FA 2W71A 2GPBA 3FTQA 4NU8X 2RH4A 3U5TA 4TSFA 2FWMX 2GK3A 1YZLA 1OB5A 1CHDA 1MMFB 1VJ5A 2HADA 3FMOB 3ZWDA 4D97A 4EHBA 4O4IB 1OH7A 3EGVA 1BCSB 4BMDA 1T26A 4RD4A 3S2UA 2PLNA 2Y1CA 1K4MA 2ZATA 2BDUA 4FJ2A 3J81A 3ON5A 1KO1A 4XB1A 5DBIA 3PDIA 3TSCA 5EJEA 4Q4HB 4RABA 4UAVA 3HCEA 3LWZA 3AETA 3QKIA 3VDNB 3H9JA 4C08A 5EZYA 3HYCA 4BEBA 5CFPA 3FZQA 5HDQA 4D8TA 3HO1A 3QUCA 4P4SA 3CYFA 4ZQCB 1BE6A 2Z2IA 2EFGA 1MB9A 4BDSA 4MUKA 2RC5A 1Z0KA 4B3FX 1VG9B 1M34B 3H0CA 5FLXA 2MJLA 1C9DB 4JYPA 2O0JA 1PJZA 4RU1A 4CU2A 2WLSA 4D6XA 3GVIA 2R47A 1V35A 3QEMB 3WLQA 3VH1A 4B75A 4BFTA 4EATA 3GJYA 2VZLA 4DR2B 3Q3JB 1OLUA 3HR7A 1O5IA 3I37X 3W6PA 1NIJA 4HATA 2X42A 2H4FA 1AC5A 1Z6GA 3LBHA 3TTUA 1M1XB 3UXMA 5F5NA 4BYGA 5B2FA 3GYBA 4JSYA 3R5TA 3PF8A 4LHZA 4CU5A 1UZNA 5CPBA 2CL0X 1I4OA 2PGIA 1W4LA 1JT9A 1EYZA 1TPZA 4G0QA 5FPSA 3FMVA 1T25A 5EJ2A 2W2PA 2CY0A 4JB8A 4UUQA 2RHMA 1NSFA 4KQHA 3V8BA 4FNMA 4RIGA 1XDWA 4ZO8A 1JIIA 5DVZA 2HJGA 3B1ZA 2WYVA 4N7MA 1GU0A 1S2DA 3G0GA 3RT9A 2X76A 2FEMA 2QRZA 1BRTA 4FYXA 4Q3LA 2WD7A 5DI3A 3VI3B 3G1UA 1VMIA 4GXQA 1OT5A 1GTVA 4IXDA 4Z9BA 1BMTA 5AQEA 3HP7A 1UXJA 2OZKA 2XR1A 3OESA 3OZBA 3DL7A 1KIFA 3EIWA 3UTDA 1RQXA 3Q9SA 1O95D 3OAAA 4M7WA 3K0FB 5IVPA 2MWMA 1V2HE 1QYWA 3EAFA 4GF5A 5IPFA 3WX0A 1WCIA 3WNVA 1XDDA 4B4VA 4UMDA 1QQ5A 4WOJA 3E53A 2VIIA 4HDKB 1NF9A 2PSFA 1KEPA 1VCIA 2QUBA 3EZ7A 3JAKA 4R9RA 4BX0A 5THXA 4YP1A 3WQSB 2DG2A 1WVMA 4OQMA 2JD0A 4WLOA 4BP8A 3LNCA 1MF7A 2WC1A 1USUA 4OJQA 4FQ7A 1CVLA 1Q74A 3JU3A 1RSZA 3COWA 2A9KA 1MT0A 1E1KA 1M7HA 5EMKA 2PEZA 3CF6R 1WDMA 3D4PA 3NR2A 1FNNA 4EYQA 3MHTA 1O57A 1GTJ1 3CISA 1HYQA 4F5EA 3UMYA 5BYBA 4MINA 3GN2A 4PGFA 5GOTA 2J6IA 1FJHA 1Z38A 3LQ1A 2AH5A 1FNCA 4UD6A 2F3TA 1Q0LA 1WF3A 1G8GA 3FYUB 3ASVA 2CGEA 2DT5A 2RHDA 5E8RA 1T4MA 2MYTA 5AKYA 3KZKA 3E8MA 3IKMB 5A04A 3Q8LA 2NUTA 4EBFA 3RYCB 3OWOA 1QV6A 3EIEA 3ZH2A 5HW0A 1P33A 1P81A 2VH1A 5JCOA 5CVCA 2QX4A 2O2DA 5AYVA 2UZ0A 4JN6B 5H4GA 1QCCA 3ZBTA 3WLSA 3PUVA 3ZDZB 4RTPA 2NTVA 1ZOPA 1YZFA 4CEIB 1NP6A 4IS3A 1ZRSA 4OI4A 2RK6A 4ZPXA 2EJVA 3TOXA 1KYQA 4C2TA 3KOOA 3OECA 3EFBA 3HS3A 2CL6X 4RUKA 1POWA 2OHFA 1T8PA 2O7SA 3HZOA 4IV8A 1XX6A 2YBEA 3G8YA 1EDBA 1I4EB 1YB2A 2XRFA 1QIDA 4JT9A 4KDFA 3SG0A 1CDOA 2LCFA 4KLAA 5C7OO 2OV2A 5HJEA 4G0NA 1BEZA 5LA6B 1UPTA 3NWBA 4GI5A 3VH2A 3MTGA 2Q9BA 1V71A 3VR6A 1ZCFA 3OSUA 1E9SA 4PCUA 5EI5A 2O07A 2NZUG 1S2IA 4TN1A 3ZY5A 1H9BA 3NJ8A 4OHUA 2AOUB 1ISIA 2EU8A 1FBTA 3BHJA 1ZKMA 4PM4A 1BDMA 3L7CA 3RUFA 1ND6A 1TCCA 4G5HA 4KX5A 3PENA 2QX9A 4KVFA 2CT8A 4EPWA 1A8PA 4M89A 4WL0A 2JI4A 1FP7A 4JENA 4JZKA 2OFXA 1K9VF 1LDYA 1FFXB 2P5SA 3K94A 4PY2A 1AHHA 4MQUA 3T7CA 5G1NA 2XTJA 3KU1A 3OMLA 3I5UA 1GPH1 3T35A 4CLOB 3PDUA 3CR3C 4XWTA 5ITSA 3K0EA 4B3GA 3ZDRA 2K6GA 4WLEA 1R5NA 2A5FA 3M4YA 4XX0B 2XB9A 1Z0AA 3NAQA 4TLCA 3ZHXA 3CA8A 3LDFA 2JLSA 3CRMA 1JZTA 4RDHA 1IXSB 3MQFA 3O8RA 4LYHA 4IWNA 3DYIA 3QMPA 3LUKA 1GGMA 1VG0B 2VC2B 1DKOA 1Z2NX 4MUBA 2WK1A 2REOA 3IKJA 4B1FA 2Z56A 3O4RA 2ZTSA 1IRXA 1BXRB 3MCWA 4C6HA 4WJZA 4H7IA 2QE6A 4Q9JA 3C5CA 2I4MA 3IAS1 5EMLA 4DR3B 5LNK1 1MN6A 5CJJA 3WJ7A 2PXAA 4IICA 1L4KA 3L7DA 1M67A 4Q02A 3QFHA 4LWZA 3K2IA 4YRTA 5EINA 3SBXA 2X23A 2HNAA 3ONEA 2CMDA 3L92A 4D9MA 1BA2A 5G4KB 4EBBA 4G24A 3QNUA 4D82A 1YOVB 4AJ9A 3IEXA 4BGDA 5JPDA 1OJLA 4PNZA 2XDAA 4F56A 5AUPB 2WSMA 5H68A 3S44A 4QBKA 1JYSA 2F59A 1XNHA 3VO8A 2AG1A 3NETA 3PA6A 2E4XA 1H93A 5CJPA 1SRRA 2FFRA 2EKBA 1DRWA 1R88A 5IW8A 1E9FA 1XQXA 1GAQA 1LB1B 2BFOA 2VHJA 1MG0A 4TMFA 5CNJA 1RKBA 2COEA 2DGDA 2UUPA 3HJHA 3L8EA 3VQTA 2V9ZA 4AJNA 3HU1A 4XARA 4FR2A 1GZSA 2KS6A 3N75A 2GCOA 4W9MC 1FIUA 2W98A 4MB2A 1JR4A 3T5CA 5L3QB 4ZTUB 4J43A 2ZU0C 1C14A 1E3WB 2A2ZA 3D8SA 3WXMA 2RJ3A 1FS4A 2Q0SA 2XGJA 1CUZA 1W48A 2VBFA 2GUWA 3ZHVA 2B1JA 4UU8A 3NPMA 3V4RA 1II8B 2LTAA 2FWIA 5AVJA 4EJSB 3KKQA 4QARA 5FOXA 3QZUA 4PCAA 4C14A 1XVIA 1Z8DA 5ADUS 1YFEA 1TW2A 3INYA 1NTRA 2O2JA 3Q7TA 3ADPA 2PWYA 4XTCS 5GM1A 3LVQE 3MIIA 4ZYTA 3RS3A 3FX2A 3UOAB 2GAIA 1NHWA 4EX7A 5KYGA 1GG9A 1FW6A 2Q9CA 1V4VA 3EXG1 3B2NA 3BBLA 4EI2A 2FPXA 1HMPA 3G88A 4GO1A 4G1MB 1DV2A 4ND3A 3HDYA 1PR4A 1GNPA 5A2GA 1JSWA 5IULC 3LP5A 1CP2A 2YV5A 2H1RA 1O9GA 4Q1FA 2UVDA 2ZUWA 1DTWA 4K9KA 4RZIA 4YPFA 4KXXA 5AM4A 3A9TA 4LC9A 4GICA 3E3NA 2Q6VA 4ROSA 4BX3A 3KYDA 1QPGA 3PXAA 3LPDA 2V5AA 3AY6A 3GMIA 1DAGA 5FFFA 5CNKA 4BRZA 2ZBUA 4EG3A 2HU5A 3GC6A 4I4TA 2AI1A 1SULA 3BSYA 2OCKA 3D6FA 3GFVA 3TUZC 3EWSA 5LYJF 3ASYA 1L0BA 2X9QA 3QKSA 1L4BA 5AI8A 3PHLA 2BKAA 3P52A 2D13A 4P7BA 1K3UB 1J21A 5FHRA 2ADOA 1L5WA 3IVXA 2X8LA 3E3OA 4X6YA 3W9BA 4LZOA 2DWQA 5K0JA 1DAHA 4G5FA 5JWHA 3NFRA 4FWTA 1HFKA 2XUOA 2B4YA 3GD7A 2AF4C 2EFEB 4PINA 4WIAA 2Y99A 2H06A 2XUQA 3CJRA 4W5QA 4ZDWA 1TU0A 3NTUA 4NH0A 1ZMBA 2WJHA 2C98A 5INTA 3J7AC 1NQXA 3QI2A 1M8FA 2NZ2A 5A6SB 4HXGA 1DDGA 3AFGA 1ESMA 3M4JA 1NBME 3DDWA 3HWWA 4HQNA 2ZUDA 4P4TA 2AWOA 3VUFA 1BS1A 4DA8A 4DJJA 2FDRA 3EG9A 3OX2A 1E1CB 3HYNA 4AY3A 1A7UA 2AN1A 3QPDA 4BBZA 2HFKA 1XMIA 4WFIA 4OHXA 1KJJA 3TLJA 5CCXA 2VDWA 1T2CA 1QTQA 3GRAA 3I76A 4MVWA 4OBBA 5JFOA 3LCRA 2QAGC 4ZAFA 3TDKA 1AH2A 1TGVA 2DR0A 4Z0PA 5JFTA 4HEHA 2XXAA 2HHCA 3S99A 1M54A 1XEWY 3A8TA 2Q0HA 3PFFA 2IUFA 1B15A 1BXGB 1SEPA 3FWZA 4LJ4A 4D8VA 5GAJA 3BH6A 1QIEA 1WPGA 5K01A 4EAAA 1RPNA 2NYRA 3FLEA 2FG5A 1IN7A 1UDRA 2TMYA 3I12A 4WLVA 2H4XA 5GV7A 3FI0A 1NXSA 2GNPA 3AONB 4D9KA 2RKBA 3MIZA 3V1LA 3WL8A 2OGWA 1J0BA 4MGIR 1GOTA 3OPYA 3ZK7A 3AESB 3QU2A 2AFHA 4XM2A 4F3YA 1A4XA 3GROA 1UWVA 4MHOA 1IHXA 5AIBA 2FEAA 4P33A 4L02A 1BGWA 1CR4A 3H2SA 3O4HA 1YUNA 1A9ZA 3P26A 1L5LA 3S8YA 3VKVA 1SU8A 1N75A 1ZH8A 1ENPA 1LBHA 2I7VA 3F4BA 5CCBA 2ZAOA 4Q3BA 3RTEA 3O92A 1PT7A 4NYMQ 1Y80A 3B78A 4I3GA 4LWPA 4NFLA 3AL3A 3OVMA 1C2TA 2ZTUA 3KUDA 1N0UA 3U4HA 3E03A 2QTFA 1AGNA 3SSOA 4TWRA 1A5ZA 1NR7A 3HDJA 1MP0A 4IP0A 3C3KA 1J1ZA 2HPZA 2PUWA 1QC5B 1JKXA 1EKXA 2KMLA 4KE7A 3TW4A 4C0AC 1E2MA 3DLBA 3FGPA 5FQOA 4IFIA 2R6ZA 2O5VA 3EGDB 3PC2A 4U5XA 4CFZA 2W2MA 4L7QA 1WO8A 3TAHA 3D81A 4NI5A 3E9MA 1QONA 2PX4A 1JSRA 4UHHA 2IBSA 2BSAA 3I4LA 1CKEA 1UOOA 2ZOSA 4L4SA 1C3EA 1FDRA 1YK1A 3D6UA 3L8CA 2I87A 4KV7A 1R4NA 4IIDA 4BKPA 4Z7OB 2DQYA 2QL7A 3GAMA 4WASA 1J5XA 2BUBA 1ADJA 3CNOA 3UJPA 5JD4A 3JR7A 3OJFA 2B8JA 1U7PA 3H5WA 2WV7A 1OAKA 4IMRA 1MU0A 3ICCA 3HCRA 1F20A 2NUBA 3RASA 3IKTA 3VKHA 1GQQA 1D04A 1T0PA 2BRUC 1M2JA 2A35A 2NO6A 4BMCA 1J8QA 4WJLA 3NM6B 1XYVA 2Q21A 3GEEA 2CEAA 3VR6H 1HEUA 3UGQA 2PX5A 1AQLA 3EODA 4BNVA 5KU7A 2IPXA 4U9HS 3T9FA 1ADCA 5KWSA 2BC9A 4NENB 3K8ZA 3LQRA 5IAOA 3C3EA 1TK2A 2WG1A 3DM9B 5JADA 2E18A 1OCEA 2XYRA 2OB2A 3LXRA 2D1QA 4TKZA 3MT7A 4R01A 4E5KA 5CFZA 4OHVA 4H08A 3EVEA 4H6WA 2GHTA 4L76A 3SQDA 4YAEA 3S8EA 2VXBA 4JWKA 3COYA 1DC3A 3H6HA 1DIHA 2GB4A 4LE0A 1QR2A 4IIBA 4XW2A 3KCNA 4ASUD 1A5SB 5EYPA 5BN3B 3TBHA 1M0SA 4KO1S 4ER7A 2YFKA 1I3LA 2C7GA 2ICAA 2H4JA 1RLMA 3EFEA 3ZEAA 3QU7A 3RC2A 2XUAA 4EPRA 1U8CB 2VP6A 5GJCA 1YRYE 3E7FA 3PTLA 4AZ3B 3ZGYA 2AVNA 4JCOA 2AN9A 2Q3EA 4KW7A 3ANTA 5REQB 3UYLA 1XMQB 1Z5ZA 4LJSA 1DJNA 1NUSA 2JHFA 1L9KA 2IDJA 2GS9A 3AR2A 3SZUA 1XTKA 2Z09A 5KKNB 1JDVA 4JJEA 4M1KA 1K8RA 1FTSA 1RKXA 4ENPA 4B4WA 2AEJA 2AOVA 4FBLA 4F12A 4Z4HA 4AN4A 3HPQA 2G0TA 3N7UA 2IUEA 1EE2A 4NDAA 1C3CA 1WHTB 5HMLA 1ACMA 5LYJA 3DONA 5IF9A 2JLBA 4YQEA 1AMNA 2FG6C 3PV0A 3V8QA 4YO7A 2HQRA 2CNOA 3C6XA 1Q1GA 2WU4A 3G2HA 1F06A 3MJSA 2WM3A 4WGFA 3RGGA 3DC7A 4F60A 1PS9A 3GELA 1D9XA 4I66A 5HNKA 4PIPA 3K2BA 4QSMA 5B1HA 5K0GA 2GCNA 3RVOA 4B79A 1KVTA 3JWPA 4KNWA 1RYEA 4DQUA 1A5BB 2I76A 1ZHOA 1YRWA 2G17A 1XQ1A 2Z2KA 3NWOA 1TI7A 3CLSD 4ISCA 4XYBA 1E9BA 2O3QA 3GP8A 3AUSA 1IZYA 3QJGA 4FR5A 3PC4A 2RCNA 2YWRA 2PAAA 2H6EA 3OP1A 3PVSA 3V4VB 4O4LB 4DV6B 3E7DA 2O54A 4K03A 5DX1A 4HUTA 3GLQA 4LHXA 2PHZA 5I7FA 1TPYA 1EUCB 3H5NA 5A1TA 3DDSA 3Q2IA 2ZKLA 5DE3A 3R3JA 4Y7DA 4KFUA 1AKRA 5CFQA 3VHXB 3GUVA 5BV2P 1Z34A 2B69A 3T9DA 1ENOA 1W75A 1U6JA 1I0ZA 3D9QX 3DB1A 4LYDA 1AXEA 5CT6A 5EWLA 3O7MA 4PQYA 3HV0A 3PPYA 1E1RA 3I05A 3OM9A 2ZFUA 1GXSB 2UZAA 4ENWA 4QT0A 4B6FA 2OQRA 4AG3A 5AI5A 1XL1A 3UOWA 3LAWA 3OPQA 2WJYA 4URHA 1QAMA 4U0KA 3SFVA 4Y8VA 4GWKA 2PZLA 4ZCLA 4F96A 3U9TA 4F9FA 3QVJA 3VAZA 2FXVA 1TYEB 2G1AA 3DL0A 3K9BA 4XSGA 1JLRA 3UKOA 1CJSA 4N6NA 3N7AA 3LPMA 4KJZA 1RJDA 3P71T 5PGMA 2Y0DA 5E2IA 5C7IO 5ICEA 5I5EA 4A8HA 3IERA 1AB5A 2Q6IA 2CN1A 1IRIA 3U37A 1E8NA 5CK5A 2HSJA 5CXQA 1KEEA 3I32A 1JSCA 2CXHA 2X0DA 1X8XA 3CVYA 1P3JA 2J08A 5KAPA 4OFZA 1U0BB 4CNBA 5JXHA 4RX1A 1MOZA 3IVMA 3DBLA 3R7AA 3UG6A 2WLTA 5JAQA 1THGA 4FDMA 2ISQA 4JFAA 4LDPA 4CKYA 4DLLA 1E2HA 5CB6A 1NNEA 5DWVA 2VCEA 1KK0A 4LBVA 3DAPA 3UV3A 1YF3A 4FSHA 3B1YA 3OZCA 1QHSA 4CGYA 1YI0A 2HTEA 3PHCA 2OCXA 2OXCA 5LUBA 1T6YA 1GPMA 1LEHA 1QWOA 3A0UA 1V6CA 5JCJD 4BVJA 1HORA 2GLXA 4NPCA 5JWOA 3H0EA 2CV1A 2C84A 3NDJA 4II2A 2GLUA 1ADGA 4EX6A 2VJYA 3TEMA 1MBZA 1KSFX 4D79A 3X1YA 2BZGA 4DCOA 5B4VA 4MQFB 5AHOA 2EZ8A 2HUPA 3MSCA 2ZYHA 1NLZA 4YRQA 1EXMA 3FWYA 4ENTA 2QVBA 3HXQA 3LX6A 1DB3A 1KWKA 2JLWA 1KF0A 4UJ5A 3ETNA 2HF8A 2W83A 4JLKA 5FOWA 4CQJA 4XIIA 3T5PA 2VYVD 2V0CA 1E2FA 1WD7A 4RFSA 4UOQA 4OYHA 5LP6A 4HYYA 3GEMA 4B2YA 2TMKA 1UC4B 1XCMA 4G8JA 5GIOE 3ZWAA 3OE5A 4AUNA 1TJVA 1EPUA 1Q7RA 1NFQA 3TIGA 4U6SA 4PAWA 4FLMA 1LX6A 3LDAA 4EHLA 3UAZA 2G9VA 2VDNB 2WDPA 1SKYB 2G77B 4NR0A 2Q9UA 4FD3A 3R8FA 4QKQA 3DOIA 5C9ZA 2PUHA 2RIRA 2C9BA 5AM1A 1ETHA 1HTTA 2B6HA 4QYIB 4EEZA 1ZOLA 4B84A 1NSYA 3I09A 3SC3A 1W36C 2O8CA 1Y7IA 5JJIA 3SX0A 4PEVA 1YRBA 5ULLA 3BYZA 4J0JA 1E1QD 4B6GA 1UXOA 3HJAA 1FXWF 3LLUA 4L85A 4A6XA 1FDVA 2JIOA 3CCCA 4O25A 5JD5A 4X1YB 3SHOA 5K3CA 4D4MA 5CA1F 2HWUA 2ZJ6A 1SHLA 2O20A 3OUTA 4EUHA 4YGYA 4YUZA 1Z4KA 4CIAA 4D43A 4LGCA 3EPJA 3MMZA 3EY9A 2H2FA 4EFCA 2WZBA 3ZU2A 1JX6A 1NNI1 2GA9A 4MV3A 3IRVA 4HAYA 5DMXA 2WQ6A 4LF9B 1DJOA 4HDNB 2AZMA 2LV8A 2OV3A 1N6NA 1G5QA 1P1RA 4FHEA 4PSCA 5CIQA 3U80A 5A0VA 2RB5A 2D1SA 2NV6A 3G6KA 3KX2A 4CF6A 1KI3A 3V33A 1F8FA 3I9V6 1P2FA 1AT1A 1N5DA 3NB0A 1JV2B 2AVDA 4JLPA 2Q1TA 5H8WA 3DP7A 3F4TA 1A4RA 3I8XA 4MOWA 4LFBB 5C18A 5BV0A 3O2SB 5ARCA 3KQLA 2QL6A 4OMUA 4F2WA 3EA4A 1UQRA 3VGJA 3DCYA 3GRRA 4WKNA 5ADHA 4GQBA 2JLVA 2EJWA 4K9RA 2ZVPX 3ZCUA 3OJXA 3I58A 5JEEA 5JEDA 3MTJA 1EUDB 2GKOA 2V7VA 1FYFA 2EV9A 4B4KA 4HVAA 2C8LA 3A32A 2ZP1A 4DLWA 3CW8X 3FHJA 3M83A 3WV5A 3DTTA 3CLRD 5TQVA 3Q1LA 3RFVA 2WHEA 1U4OA 1XPOA 4TV8A 1WX1A 1XNJA 4C0XA 5AVXA 3PVZA 1YV9A 3DZ8A 4J0DA 5KYKA 1SUBA 2QZJA 2QMEA 1ZJ5A 5JALA 3TXXA 3VX3A 3JAWA 4FX5A 3ZW7A 2P9TA 5IM4A 4DDTA 1A2BA 5TMDA 2RC6A 1U1CA 3A6LA 1JPUA 4F97A 1CK4A 2P0EA 2A7QA 1H6DA 3SI7A 4WXEA 3BILA 4EHFA 2I66A 1G2IA 1MQ8B 2O8FB 4DCPA 1PVVA 3VNSA 1ML4A 4P9NA 1ZZGA 4ZO9A 2GESA 1WVGA 4IOLA 4Z4FA 2ZVJA 3E22A 5BQPA 2VT6A 4GGMX 1LS1A 3HVJA 2TS1A 4YECA 1YL7A 4N9WA 5I6DA 2GZ3A 3PHGA 3M70A 5HBRA 2Y71A 1ZISA 3CCFA 4RJJA 3WOHA 3BL6A 2QAGB 4PZLA 5JZSA 1TT5B 1M0TA 4MVCA 5LBTA 5KNDA 1M6VA 1SCJA 1VE5A 3BBPA 3ESBA 4HS4A 4OD0A 3GNLA 4RORA 3V3TA 1C7JA 2BFFA 2FJ0A 3TFOA 4MW7A 1RTTA 2ZCUA 4J0FA 1TX4B 5LDGA 5LQNA 2GERA 3UW1A 5T57A 4EWLA 5JZBA 1J1UA 5JAUA 3OTGA 4RCVA 1SCAA 2OVBA 2Z2XA 5FD8A 3BXHA 4C43A 3QF4A 2OOSA 3NO9A 3BA6A 4ADLA 4PRKA 1WDTA 3M49A 5I7SA 3EXHC 1Q0ZA 4HPWA 1F8XA 4DR1B 1RQNA 1N77A 4I6EA 2E9SA 3V4LA 2A9VA 2V1XA 4K3UA 4BKOA 3R6DA 2VQ3A 2RGBA 4IGEA 3DBRB 3M3PA 5G1PA 3GHYA 2HPVA 3SMVA 3CV3A 2WIGA 3PDIB 2X8JA 4GGPA 1MO3A 4AMBA 4GGOA 4DCTA 5ENDA 3AETB 3KWLA 2VBIA 3LCUA 5TB5A 4P4SB 1EZ4A 2F1KA 2J31A 3WAKA 3TPZA 1P4SA 1QFXA 4RZUA 2R96A 3BRCA 4MRMA 1OFIA 3V8NA 4E12A 1I13A 3FZYA 1ZHFA 4BB5A 3MGGA 3OZVA 1Z17A 4S1OA 4ZI7B 1ZZEA 2HYDA 3ZHYA 2QQ0A 1JEAA 1P7VA 2VJDA 1FDTA 3N1UA 2JC3A 1EK5A 2WWIA 3EVZA 3ELBA 1UBUS 1OLUB 4JV5B 4KLCA 3EXEA 1KZ6A 1E69A 1JJ7A 4NYJQ 3HGTA 3FDZA 2WTNA 5EGSA 1OFUX 2PQ0A 2UYYA 1LSOA 1VC2A 4FNAA 1OW3B 3PHJA 3HKCA 2IPAB 4GPEA 1C1DA 3O84A 2Y05A 1RVV1 2ZI5A 3QE9Y 4MW4A 2IW1A 4HV4A 1EXWA 4PLCA 1IL0A 3I5AA 4GW3A 1LDNA 2AOWA 4FFDA 1SA0A 1T10A 4XSHA 4E7OA 4KXVA 1NJ6A 1L5GB 3FMPB 3LKDA 3LZ6A 1OBFO 4U9IS 2PSSA 4EVSA 4BP1A 2IPNA 3OFNA 1I0LA 1MB3A 5JNSA 4Q93A 2HI0A 5UKDA 3H42B 2YIJA 1J8VA 3LS2A 4H4EA 2O7RA 4EJMA 3GGCA 4PZYA 1ZOOA 3FNQA 3RGWS 4R9NA 3VSEA 5HCNA 4XIJA 3MINB 5FBQB 1LVGA 1SG6A 3L1KA 1IAVA 2GILA 1OZHA 1SBZA 2BM0A 4IFEA 2WD7B 4TTJA 4ZARA 4MUFA 2X2PA 4MRRA 2JK0A 4RHTA 3WRYC 1CNMA 5IXYA 2YFHA 3ULKA 1ZK4A 4A9AA 3HA5A 4NYIQ 5GJWC 3A0RB 1TTPB 3AQIA 4K0RA 1XTPA 2CJXA 1WCIB 2P6PA 3CS3A 3O74A 4ITUA 4I3HA 2C7QA 1R6BX 3WAGA 1JR3D 4MEBA 3UMBA 2AK2A 3JAKB 4MPTA 1EQ2A 4XKJA 4H4CA 4QGSA 2B2NA 5HJ7A 3U6BA 1SB9A 3C6ZA 4FU0A 3HKEA 4B83A 4YB8A 3HXMA 4LZNA 3CUKA 1KGDA 5FHQA 2GZ1A 4X8LA 2OXTA 4UASA 1CB7A 2DJIA 1FMJA 4OK5A 3RVQA 5EP2A 2QDKA 4ACAA 1KSGA 2O23A 3KQKA 3CPSA 1CW2B 2FJUA 4ZVMA 3M2TA 4KQCA 2G0NA 3CRZA 4NJEA 4YUWA 2J3KA 4Y9SA 1MNAA 3DEAA 1SCDA 4W5NA 2QLLA 2WPDA 2XNSA 1Z6PA 5FTWA 1N34B 5E1BA 1T9CA 1R00A 2H2IA 4KGZA 2BHNA 1HFWA 5BYJA 1R9GA 1NTOA 3FDXA 4XVQA 5EKUA 3A4NA 2OG2A 3RS4A 4LJRA 4FYVA 4WZAB 2NUTB 3C3JA 5C8YF 3OWHA 4DMKA 1F2VA 3NW9A 4EELA 1RQPA 1PFUA 1H66A 1IW7D 1SXJD 2CUNA 2NSDA 4FC7A 3RSZA 5I8PA 4EK9A 1ZM2A 2B7CA 4G65A 1UCFA 3PIRA 3PT5A 4LIPD 4P84A 4QGAA 1JFLA 2JGNA 2GPAA 4M7RA 4XCXA 1RHJA 5ITZA 3PQ3A 5IK2D 1RYHA 3RS8A 3VU0A 3LMKA 1UM9A 2BHSA 4GMDA 4X61A 3U3ZA 1Y1LA 3AR4A 4R6XA 4X3CA 1UWLA 3OEED 1DKQA 1DSSG 1ESCA 3K4QA 4UARA 5DEOA 5BQ5A 1UC8A 1YZGA 5H3CA 1P91A 1VTKA 3MVEA 2Z6QA 4UTPA 5JMWA 2YYYA 4LKRA 2LDBA 2VYCA 3SQWA 4GLOA 1Z39A 3VAYA 2G5GX 3T7TA 1FLNA 2DWCA 4Y1GA 1YKFA 3QVTA 3VR5D 1CF9A 1OFVA 1IMJA 1ZOIA 2XTMA 3IT3A 2DSNA 2JDIA 1Q22A 3G68A 3ZVLA 4EY5A 2RGRA 4HGNA 3UG7A 1U5BA 3MAJA 4RPHA 1W5FA 4FLEA 5D01A 4UPDA 1N2OA 4FE3A 4PZEA 3CURA 2IFTA 4YK7A 3DS8A 4DOMA 5T7BA 4XAQA 4MMYB 1JH8A 3KD3A 4KIJA 3BRQA 4IYJA 1W5SA 3EDCA 1FMFA 1X7DA 1G8MA 1L8LA 4BZQA 3ZVRA 4ERNA 1A71A 1OE0A 4Y7CA 3RKUA 3LT2A 3TFQA 4B3MB 3A1EA 1QKKA 4UCQA 4YJGB 1ODTC 3D8NA 4RJTA 1QQTA 3FIJA 1WPXA 1DBSA 3KLPX 4O8CA 4RZQA 2YICA 4MO9A 3KWMA 2W7TA 1IOLA 4RW0A 2ZWIA 1UBOS 3CT6A 5LU9A 2PQ2A 4QSHA 4GDFA 2ZAGA 4IJVA 5IDYA 3ROFA 3TJMA 1LDEA 2YV2A 3OY7A 5ECWA 3OA2A 1G7SA 1I3MA 2PO7A 3TTSA 1Y3FE 1IDOA 2YNMD 2E5FA 2G09A 1L7PA 3SLRA 4D3YA 4ATNA 5EQJB 1EGQA 5EIBD 4RKEA 1PS8A 1WXWA 5IBPA 4MPJA 4XLLA 1N3YA 5FX2A 5TS2A 2I3GA 2WAMA 4QRDA 3H87A 3WTBA 4G9GA 1BXZA 1EX9A 1KOLA 4KCGA 4RCZA 1FUUA 2YXBA 3G5TA 1LSUA 4HY3A 1MDFA 5D3QA 3HH8A 1ZK3A 5KHAA 2W00A 2HCBA 4I9FA 5T5QA 4DMFA 2VH5R 2MU1A 2IXFA 2QTTA 3F2VA 3HSSA 2O9JA 3VBCA 1TK9A 4Z2YA 1KE2A 2O1XA 4BQSA 4PANA 2F1OA 2R65A 3K09A 5EPOA 4HGZA 4Z3OA 5E6UB 4J0HA 2DHCA 3STUA 3RFXA 5AW1A 1BXKA 2GCOB 3GXBA 3I72A 4YJ2F 4JI3B 3ZK8A 1Y82A 4KIFA 1XZLA 2DQKA 2FUEA 2VSOA 4HTFB 1Q19A 4PLHA 5EESA 5E9AA 5A3QA 5FWYA 4HNUA 2Z6AA 4UM9B 3V1YA 4G2NA 5E6RA 3SS7X 4DYDA 2IP1A 5EUCA 1OXSC 3ZIAA 5KZMB 3DG9A 2JAUA 4OX9Y 3ZGXA 1V7CA 2NU9A 4F5DA 2OAQ1 3HJCA 3MBOA 1VXOA 3K31A 3PQ2A 3R41A 1OXXK 3HL0A 4N5DA 5AW9A 5KNDH 3UHPA 1X77A 4D3FA 2EZ9A 3VI4B 2C3PA 4JLDA 2QJFA 3L7KA 4A91A 1U8AA 5LIRA 3VYSB 2J5XA 4RSRA 3JQ9C 3TN7A 4NV0A 3OD1A 5E1OA 4YJ3F 2R68A 4FGKA 4P4UA 3MNFA 2N3ZA 1ZRMA 4EKIA 4UDNA 1W36B 3H16A 2ZVDA 4F4FA 3FB4A 3BFKA 1D2RA 3OWXA 1VB5A 1RFLA 2ZI7A 4HBGA 1QOZA 1Z5WA 1BIFA 2OCDA 3HVUA 5KS2A 1DTWB 2CVPA 4PAMA 1LLUA 2HMSA 2JJ2A 3PFWO 2E4AA 2GWRA 4AROA 4B7XA 1Q84A 2QWXA 3HUEA 4D0GA 4BTEA 1R6DA 3KYDB 4RGQA 1U3FA 2A4KA 4RNCA 3UV7A 1C9MA 3DHVA 5L3ZA 3SE7A 3VUEA 2XYPA 3ZKWB 4AL4A 3WSWA 3KHSA 5D7NA 2IYYA 3NYIA 3QUQA 1OD6A 4K9MA 2ZUUA 3MMXA 2P90A 4I4TB 4NRDA 5I4BA 5JD6A 1IZ8A 4L3OA 4KR2A 2OENG 3VPDA 1D2NA 5CYPA 2FUSA 3UAVA 5HP4A 3B2QA 3QKSB 4TM7A 2RAVA 5TMEA 4MUEA 4ZOCA 2FX2A 4GUAA 4AF6A 1TA4A 3GTDA 4YDHB 3GJ5A 1CF4A 2X19A 5U4XA 2AXPA 2OHHA 1E3EA 3LT0A 4D9BA 1URPA 3OU7A 2HHLA 3ET4A 1R6XA 3CZ5A 2VHYA 4MJXA 3OKAA 2QSJA 2C0QA 4BE4A 3LJKA 4RK6A 2P8JA 1TB4A 3PC3A 4H1HA 4MB0A 1LV8A 5COBA 3LA8A 4CN9A 2E4ZA 2O1WA 3H86A 5C8YA 3AEQA 1JKMA 5L7YA 3SJAA 3SSMA 4RTNA 3KQUA 2BGJA 2QP4A 4H3HB 1V8PA 3EMDA 2HHHB 3KEGA 3NNNA 3PUXA 1ONOA 2QRQA 3PQ4A 1U31A 3GLFA 2C3OA 3D43A 3EG9B 3OFJA 4EG8A 2XUZA 2IDMA 3HN2A 5IX8A 5KQGA 1HDEA 1NN1A 3B20A 3PXBA 2PT5A 3EIXA 2V6IA 3BZWA 1IN6A 4E3ZA 3C3YA 2VDWB 1IB6A 2B82A 1B8PA 3FY4A 3IOCA 2XCOA 3EVBA 3ZZ1A 1QRTA 1K63A 1XJCA 1VGQA 4JVNA 4FKBA 1FTQA 4LOJA 3RYTC 4CCYA 3TCKA 3HCNA 4RQTA 4EG6A 2XXAB 1GG8A 1H8HA 3H1PA 3P96A 4C7MA 4YUXA 3KHKA 5AK6A 3TLZA 1WTCA 2ZU6A 4LXIA 3TQFA 4ZVKA 3LWBA 3WB2A 5DHPA 3WGIA 2B34A 3RTAA 2VTKA 4QDZA 4ZIRA 1Q1AA 4MDHA 2ECPA 4EKNB 3K5HA 1U2EA 1ZU5A 2A9QA 2IY9A 2AC4A 3CKMA 3PZRA 2BL4A 4C0SA 3ACDA 3LLCA 3B5IA 3OPYB 3MLEA 3QPBA 4S3MA 2E5LB 1SNYA 2Q5HA 2AFHB 3R20A 1J7KA 4X5OA 2WSIA 3V6LA 4D9JA 1TIPA 1CUGA 3IAUA 3NH6A 4EMBA 5EQFA 2EP8A 1HDZA 1FOEB 1N5IA 1SVLA 2ATIA 2IY8A 4M55A 2DERA 2NT4A 4I99A 2D2XA 4HVTA 3ROGA 1Y4SA 3U5ZB 4JJZA 1M2NA 4C4XA 4GZ6A 3MTEA 1WQ3A 3R0JA 4FFBA 2G76A 5SZIA 4NDZA 4J2TA 1G4HA 4QM7A 1W0CA 2Y1DA 2BMAA 3NHKA 3M3HA 1SXHA 2FI1A 3NBQA 4FEEA 3R6QA 5CT4A 4B2PA 2ZW9A 1RMQA 2YH2A 1UXHA 3HVRA 3WHPA 1PQPA 2Q3HA 2JAPA 3DQPA 5HOEA 4B40A 4LZLA 4D0NA 1AZSC 3RUDA 3WB1A 4MUIA 4YEDA 3E2IA 1R16A 3PT9A 1NPTO 4FPXA 3IVCA 1E58A 5GJVC 5HR5A 2YWHA 1C9EA 1QCZA 2B78A 3ZJYA 1US8A 3W2EA 1ZD4A 3ZJTA 2C4VA 1X6VA 1HI9A 2GJ9A 2XB6A 3GGGA 3WICA 2PJRA 1J6UA 1FUOA 1O94D 4WNYA 1ZRNA 4KE9A 3KYIB 4RL6A 4JODA 2ID7A 1UOQA 1FSZA 1TKCA 3QXCA 2KQUA 3FB1A 2WTXA 4OIFA 3BHIA 3DR3A 5E7MA 5CPFA 2DPYA 2OUKA 2BR5A 3MS7A 5HM8A 5KWEA 4UNQA 2PT7A 4WOKA 5F92A 4GC5A 2M1ZA 3PPVA 1YZVA 2E4WA 1KK3A 3T4XA 1RHQA 2H1LA 3F8WA 4R0MA 1WZEA 2NXEA 3ROPA 1L4MA 1KJQA 3NO4A 4DG9A 3AH8A 4ZHSA 2FAXA 1YJQA 2H2GA 1OFHA 2H8KA 1D1SA 2DHQA 5TPZA 4BASA 4ZMBA 3TQRA 1UOEA 2V6BA 4CE6A 4AQYB 2H1FA 1XCGB 2HJVA 5CGZA 2FFQA 1EX6A 2YFYA 2BTEA 2M6KA 1P7PA 5DTIA 1L1FA 5LXTA 3PXDA 3IAXA 4LY0A 3U26A 3ONNA 1D2AA 1PLKA 1U7DA 5E3IA 4C4SA 1JJAA 1YR1A 2JGLA 2VSYA 3W3AA 3ZCPA 4BJ1A 2V7WA 3JARA 3RVJA 2GJ4A 5K0BA 2WHYA 1COWA 4PC3A 5EYPB 4YLGA 3OZAA 2PTSA 2GAJA 3QLTA 4J0QA 4PR0A 4PZCA 2LDXA 1AQJA 4YJ3A 1YCDA 5KSPA 1NJGA 1T6BY 2DWPA 4ALNA 4GE3A 3TRFA 1DAEA 4ZVQA 3TB6A 3H84A 3WIDA 4C0BA 4CDNA 1ULHA 3UWOA 3DOEA 2IOFK 2Z0MA 5AVZA 3NVDA 2GA8A 4Z49A 3K70D 5AW8A 3KQSA 1DV1A 2PG3A 3E0QA 4YPVA 3OIYA 1CP3A 4BJ3A 1IMOA 2DUNA 1Q7TA 2AW5A 3ZWYA 2OK7A 4KAFA 5A6VA 1MX9A 1G7CA 2A78A 2OZVA 1G7TA 1L5ZA 4MUJA 4DUPA 1V25A 2RJOA 1B0UA 3QW2A 1E6EA 5KQLA 4XWWA 4DMMA 3KD2A 3QOXA 4BU1A 1YFMA 1IZ7A 1R64A 1ISFA 2AI2A 2IXDA 3L6BA 3G7UA 2MSEB 3NVMB 3COJA 3OZUA 5DLPA 3E9QA 1X8LA 5B3KA 1O87A 3L79A 3T7JA 4BO5A 4CI0B 5M2QA 3OETA 1KP2A 1YC5A 4AI6A 1FJGB 1P39A 3DCNA 4KHPB 2X1HA 1B8OA 2QMOA 4HNAA 1TC1A 4I50F 2Q6KA 2IZ6A 5KKAA 1XF9A 1JHQA 2QAJA 4BPBA 3WRWA 1J2RA 1RQLA 2AMJA 3WV4A 1H6AA 3FFBA 4K9LA 3BJEA 4QFDA 2CZCA 1MJHA 1NKVA 3L84A 2R00C 5HFAA 5C31A 1YB1A 3UAXA 4EGFA 1BTOA 1X92A 1L4EA 4KAAA 2FMFA 3AJRA 1RABA 1U9CA 1XZ8A 2F90A 2SBTA 2XB2A 3MCTA 4MCIA 2GPNA 3DE4X 1JTVA 4U2GA 3IHLA 1NBMA 1GGFA 1IATA 2J46A 1T8TA 3LGAA 2LCQA 3QWBA 3OX4A 1G3QA 1Q7EA 4HLQB 1SB8A 4L7VA 5EWLB 3C85A 3UH1A 4BATA 3AUAA 3P2EA 5FJIA 3P19A 2EJTA 1HG0A 2J3MA 4QTXA 1WB9A 1H3FA 3G8BA 5AVQA 1SBIA 2P4SA 4KHZA 4OJKA 1ZC3A 3WSTA 1FVXA 3KOYA 5CDGA 2FCRA 1GO2A 3RFFA 3F9CA 5IJWA 5ALKA 2WYHA 1FNDA 3GT7A 4M9ZA 1MTZA 1JLMA 3ZDQA 1G8SA 3SLKA 4JYAB 3PWKA 5A03A 4X90A 1TJ5A 1U7ZA 3H05A 2VAVA 4D6YA 3K3PA 2GTHA 5A7GA 1SVKA 2NV2B 4CV1A 4LRUA 3M9XA 1YIOA 1V4BA 3C7DB 1KZYC 4R40A 1ZO8A 1TQ6A 2PZBA 3GJ3A 1REQA 4MTLA 3RDPA 5BYKA 2XNDA 1KVQA 3B1FA 4JBWA 5CM9C 2J7PA 3BJZA 3HBJA 1D2CA 1I5EA 3FVRA 5CB8A 2IHUA 3H1EA 4ENUA 2P67A 3D7SA 3PRHA 5B58C 4ARVA 1L7VC 4L0DA 2BFEA 2P27A 2QR5A 3BD8A 3HMQA 3PNOA 5KTRA 3JAMA 5LQJA 3AUYA 3DBLB 2F1IA 1CUUA 2ERYA 4E1VA 3RRXA 1USGA 1ZM4A 3RODA 1GV1A 3GL9A 3RKRA 1JR3E 3ZS8A 1H2WA 5HM6A 3OIVA 4H31A 1ZNYA 2HCTA 1LI5A 1TJPB 3O90A 2QQGA 3HYLA 2OGUA 2TRSB 2A84A 4FUQA 4ND6A 4G09A 3RROA 4PN7A 2F7SA 3CG0A 3G2PA 2BDTA 1E2GA 2EP5A 4W8GA 4ER3A 1WAMA 1IPEA 5L4NA 4QUEA 1E4EA 1OR8A 4EW2A 3N5KA 4KSBA 2PKWA 2LZ0A 3DMRA 2O48X 1VCNA 2QLFA 3QFRA 4KQKA 4WQMA 3RF7A 3UTCA 2ENUA 4LYJA 1YS9A 1JHVA 1T5SA 3MBIA 4HG2A 1T2DA 4BKMA 3O21A 4URFA 1L5QA 3I0MA 3JTEA 4AU1A 3Q8WA 5CEJA 3KAKA 2XMRA 5AD1A 4FFLA 4G6ZA 1ZIPA 1KKMA 4G36A 1PNVA 1SVIA 4A6PA 3PIDA 3UFBA 2R5FA 2Q3MA 3AIOA 3C70A 3ETEA 4G5RA 4PAGA 4RGVA 1PFKA 3HQ4O 4FP9A 3CJQA 1P8AA 4RFSB 5LP6B 2PNFA 2OAEA 1XTVA 3KSBC 1U3VA 2IYNA 3R9XA 3A4YA 3HGMA 1XCPA 2H5IA 2CLKB 2Q2VA 2WMDA 4E5PA 2QT0A 1SXJE 2QM8A 1RE0A 1PE0A 3A1WA 2OE2A 1ODKA 4E4RA 3OQMA 2C3YA 2F3SA 2WVJA 4E5MA 2W6NA 1X87A 4PFKA 5DWDA 1TRHA 3VNAA 4EVIA 1S01A 2VJOA 4E46A 4B33A 1DOFA 4E2WA 1ZKDA 4PRLA 3UQZA 4JLNA 5LDDC 4PZDA 3RFCA 2QP3A 5K3DA 1IHPA 2YC2C 3DFKA 3OEWA 2O8CB 1LCIA 2KPOA 1ZD1A 4BZWA 5KTMA 4ND4A 2PA0A 1L7XA 4JLBA 2Q07A 3OCEA 5DXFA 4QNRA 3LXXA 1P9OA 2WWWA 2IUYA 1H0RA 1YRAA 3FJYA 3JV7A 4AX4A 2WYIA 3MWGA 4CDGA 5C8XA 5CNMA 2V0GA 2GNOA 1XKLA 2B0CA 2PS0A 4U02A 4I1YA 4WK6A 1M66A 1KAQA 1HMYA 3CTMA 4JUBA 3O5AA 4EFLA 4GAEA 3VDXA 1FFYA 2CL7X 1IH8A 2EZTA 1FE8A 5B6IA 3C8ZA 5K8VA 2D1FA 4FYIA 4BWGA 3G9QA 1J0CA 2WA2A 2RE8A 2QQFA 3JQGA 4L8WB 4OBXA 3T1TA 1NT4A 2BTOA 4H7FA 1GARA 5HRUA 2O8EA 1DT3A 3TZHA 3A28A 3BERA 2I1QA 3I2YX 1V8ZA 1UZUA 3FNIA 5ES3A 1EEHA 2VHEA 4YI5A 1KOGA 1W94A 4N6GA 4IH9A 1S96A 3WLPA 4G8DA 1KPGA 1K7EB 2A5YB 2WSSD 4BVHA 1FF9A 5CLFA 1FXSA 5K2OA 3KEOA 5J9FA 1N7IA 3VR4A 4F6CA 3O8NA 3AZQA 4EY4A 2HJ9A 2HM7A 3ITEA 1HQDA 4IHQA 2W6MA 5CX4A 4NZPA 1LJUA 3L6RA 2I65A 2K5UA 5H80A 5E1MA 3WE7A 3TQTA 4BQIA 2IS2A 4QUHA 3CPJB 4I50A 1W9HA 1I7LA 4TV8B 4WECA 5AMXA 5CDSA 3ICEA 1RYFA 3OZIA 3WGGA 4BNJA 1E0KA 2B2CA 4J4BA 3W90A 1CJVC 2GASA 5BQOA 4OJYA 2YVQA 3KPUA 3DZJA 2C0PA 4HLUC 5JMTA 2ZR0A 3IHTA 4Y18A 5LKAA 1HYBA 2R8ZA 4QE3A 2YCLA 3R7WA 4DRZA 4M9XA 3LNTA 1D6SA 3S27A 4HHEA 4L9AA 3FZNA 4CKXA 4CKZA 1J97A 3BJMA 1RD4A 1GRQA 2JIZD 1ZK0A 4YT8A 3VR4D 2AJDA 3RAFC 5J1SB 3EVAA 4YONB 3AERA 1QQAA 2HRBA 2QD2A 2WIAA 4XJSA 5TLSA 2O2EA 3SYLA 3UJ7A 1JAIA 3S1SA 1GPWB 2F9FA 3PI6A 4G0WA 2DETA 1U1IA 2B1IA 5F12A 3MJCA 3KV3O 4EL5A 1QBGA 2AKEA 4FZVA 1HSZA 4NWIA 2V1UA 4DAEA 1M6VB 1C9JA 5IU6A 5KX5A 5BNZA 3IV6A 2GBFA 5FP0A 3P2JA 4ZZ3A 1F0KA 4LQDA 5TQ2A 3C7TA 4Z7NB 1WA5A 4NS1A 3X2SA 3IMEA 2GZRA 3UZUA 1A2QA 2PD3A 1K3TA 4RTQA 5CD1A 3SM3A 5L40A 1QP0A 3QF4B 2X4DA 2IBMA 2IZ0A 5D86A 2GJ8A 4AZVA 5FCDA 5CFNA 1WU8A 3Q6MA 2GEKA 4YROA 3ZE7A 1PJ4A 2YWCA 4CV0A 2YMLA 4GR9A 4W6ZA 2VDMB 1NUQA 5ALEA 4D5EA 4E4TA 3C14C 3NT4A 2AA3A 2GH1A 3H2ZA 2O2IA 3TUIC 4A5SA 4OGGA 1IXZA 5EUMA 3R76A 2HMAA 2I1VB 2IZOA 2NO4A 4O63O 2WQZA 1BO6A 1E18A 1Q0PA 5IDQA 1EESA 3FPAA 2CNBA 2QYTA 1E2IA 4EMSA 3FETA 1BU8A 3O9ZA 4Z53A 1B1CA 1ZGAA 2B4RO 3ID6C 4GM0A 4PO1A 1GFSA 1AIPA 4MRMB 3SZ3A 3T4UA 4BLSA 3LWNA 4F3TA 4JCCA 3GA7A 2BI4A 4M3NA 3VNBA 4CR7A 2FUG1 2ODWA 3AF2A 2QAIA 3SJBA 3O8OA 4UUMA 2Z2ZA 4P5PA 3VPFA 1U0SY 5LQAA 3RC7A 1OXKB 3RVKA 3L01A 4II7A 4RVSA 4EECA 1KDOA 4MITA 2WFLA 1XVTA 3HA7A 3EXEB 2FETA 2OXFA 1WZCA 3TFWA 3W79A 3FDZB 1JEYA 3KLMX 3U1TA 2C5AA 4P35A 2B2XA 4A1OA 4TXMA 4P34A 4YCAA 3BREA 3HKCB 4DJEC 3SQMA 4EAQA 4EY3A 4B47A 4L4YA 5B36A 2BGTA 1BHQ1 1YC2A 4FMDF 5KOYA 2HK8A 1Q0TA 4X7BA 4D5GA 1MZPA 5LBIA 1NP7A 2JANA 4DMUB 1N0WA 3NEPX 4O4HA 1ZXXA 1FTWA 4L72A 2ZIEA 3JWJA 3KCQA 2CLEB 4ROTA 1R15A 3ZLBA 5BSKA 2O2YA 3ESZA 3ELUA 3UAOA 5EWMA 4Y2VA 5I7HA 2DH5A 1FYXA 1PBTA 2YJNA 5AO9A 4YRPA 3PSAA 1ZCAA 2OG1A 3AV3A 1IM5A 4IQFA 4N8EA 1O4VA 4F2HA 1RT9A 1N2EA 3RAJA 1T2EA 4TLEA 3BZUA 1X9GA 2Q1UA 2FEXA 5BN5B 1ZL0A 2BAGA 1JU4A 1T5BA 2WA1A 4E30A 3JS5A 1JECA 4G56A 2G25A 3LQ2A 4A03A 3B12A 3QWHA 4P53A 3CF4A 4DLXA 1UJCA 4IIUA 3P2YA 2HVGA 5EJIA 2K7FA 1KI2A 4B73A 4I2NA 4C3VA 4DV5B 1F4VA 2OGTA 3LGXA 4KWCA 1RAEA 3HEAA 4LJ6A 5F5XA 5TPWA 2JJYA 5CM2Z 1Y8QB 3NGLA 4KE8A 1P9RA 4U63A 1DOHA 3T0FA 2ID8A 1L5VA 4X7PA 2EARA 2VBCA 3M5WA 1Z2CA 4IG9A 3ZWMA 2QTVA 2X9VA 1DAPA 3QMMA 2QZ9A 2WE7A 3DWFA 3KQMA 5HIMA 1ZSVA 1EA7A 4XDYA 4Q9HA 3UWPA 2JCGA 3F4RA 3JRWA 4MRPA 2ZWVA 1UBHS 4X7RA 1Z16A 3V7UA 2HRDA 3CU5A 4DIOA 1K2WA 3JD3A 1M5UA 3CO5A 3FMGA 4MR9A 5DMHA 1K89A 3WYFA 4JR1A 2P3SA 5CDUA 2I8CA 2W4QA 4QDUA 2ZJ4A 3QVXA 4P22A 1UJ5A 2I8AA 3L7JA 4HGOA 3ANYB 4KO3S 4JEIA 5B1DA 5IH3A 1OAAA 1PYDA 1SFRA 2R8YA 2BGMA 1HA3A 4HLCA 1EG7A 4UTRA 3KTDA 5BV7A 1ABEA 1JB1A 1TUBB 3DNMA 3GLHA 3H9EO 3IBFA 2PLAA 1FX0B 1QNFA 3GUYA 2FPRA 3IVRA 1U7TA 4C0WA 1LW6E 3AM3A 3Q98A 3ZD8A 4G63A 4BZXA 3G6WA 4XDHA 4NS4A 1QV9A 2XW6A 2Q7DA 4W1PA 1MGOA 3W9UA 4IDFA 2GBLC 2PH1A 4EGJA 1MOSA 5A4DA 2CFTA 1RWXA 1DWQA 4O02B 1GT6A 1EA5A 2JFBA 3VJLA 2CFSA 1SU6A 3N3AC 3NHWA 4GSKA 3ZE9A 4EG1A 1EQUA 1G3UA 4WX2B 3JQ8A 5ITZB 3TD6A 4EH1A 3VJRA 4YCJA 1A9RA 3A1FA 5KTPA 1UM9B 4OF4A 2D5CA 4F3NA 3FW1A 3USCS 3IIJA 4Q9KA 4G23A 1YFKA 3MTAA 1MW8X 1E9EA 2G4LA 4IFTA 5JDIC 1OWOA 1VFNA 2B4AA 1ELOA 3DGEC 3GT0A 1SIUA 3OJEA 3QTBA 4JL6A 1QF7A 4M1MA 1ATIA 1UBTS 2B8WA 3LUAA 4OATA 3V4FA 4HDAA 4S24A 3O1HB 2GYVA 3EVDA 1MPXA 1Y0BA 1QHXA 1YB7A 3IS3A 3GIDA 4QTYA 5BNIA 1DT5A 3SNKA 1NUUA 2YW2A 2FLVA 1E2NA 2W2XA 3J7TA 2L17A 3QVGB 4B8ZA 4EEXA 4P3KA 3ZWXA 1K0UA 1E5QA 1H42A 3QRWA 1AKUA 1U5BB 2Y4OA 2HIMA 2IPMA 1E3DA 1OXMA 3ANXA 4MUAA 1N36B 4LRYA 2DULA 3RTGA 2IEZA 3WISA 3RYIB 1NX9A 1ARZA 1ZN2A 3GJ0A 1J8MF 2ASEA 4U3JA 4XUGB 1HLPA 1VMKA 3EBPA 4B3DA 3ITNA 4D3SA 4BX2A 3TIXB 4DS3A 2QYOA 3MJRA 1YK0A 3RV3A 3W77A 1I5OA 4RJKA 4KYVA 4HJRA 4OHRA 3LBIA 1PLLA 1TO1E 2WDZA 3FH0A 4I6GA 3JZAA 1H69A 1OWMA 2FW7A 2X5KO 3JVEA 3LUBA 5CA0F 3K15A 5ADVA 4Y2YA 4GLLA 3DV0A 4WXYB 3GYGA 1C8VB 3IP6A 2TYSB 5ESDA 4DZZA 4IDCA 1ZM3A 1ZUD1 3W05A 3PX2A 3IPYA 2RIPA 2P3QA 5F21A 1JXQA 1HDCA 3LXUX 3L4KA 4NC9A 1QK5A 3UB2A 3ZWQA 1H9AA 2HA3A 2WKRA 1JHDA 4Z0HO 3GBSA 3L5KA 1S8FA 2GEDA 2Q4DA 4PQEA 1DLJA 1KARA 1ZC4A 3PD1A 4QGBA 4RZ2A 4X92A 3RPEA 3UKJA 4ENVA 1T2VA 4CKEB 2EW1A 1I2CA 5THQA 4B6OA 1JLKA 3NP9A 3PLRA 1VLJA 1KEZA 4ICIA 4WNIA 5J59A 2WJIA 4DXAA 3V1KA 1VKRA 3TGLA 1FFDA 3FYCA 3G49A 3U39A 1KI7A 5C32A 3EDYA 4INZA 3HJUA 2ARKA 3MTDA 2DLDA 2OD9A 4PGHA 4JYCA 5F2EA 1QK4A 1KVSA 4AP9A 3F3MA 3ACBA 4MA4A 1QZZA 1RXIA 4MV8A 2V7GA 4EIWA 2YJ4A 3CZPA 4N3BA 1MHTA 3AM1A 1TEZA 4BUZA 2W2QA 4IAOA 1ZPDA 4YIHA 1B43A 2HPHA 1ZAKA 5L7TA 1JHOA 5FWYB 4WEQA 4OUDA 5DNDA 4KGVA 3UQYS 1I3CA 4UJ3A 5E6RB 1TLFA 2WRZA 1QHGA 1YDHA 1WR8A 1ZN9A 4J2OA 4P4LA 5LZ8A 4ACBA 4CIVA 4UVHA 5DBOA 3M8KA 2Z5FA 2NU9B 3ZWNA 4IDDA 1JPJA 4KPUA 3IBCA 3UN1A 1FLAA 3ZD7A 5IC6A 2ZRKA 4Z4IA 5BUZA 3M6VA 4TLMB 1WXHA 2VSFA 1JEQA 4M53A 5DRYA 3WB0A 1AKWA 2ZTVA 3O8QA 4Z99A 1I7QB 5A9SA 4M0UA 4I4CA 5JAIA 3MK31 2XZOA 2M9MA 2I9PA 3FBWA 5D51S 1ATZA 1JG1A 1K62A 2PGDA 3R7BA 4X20B 2X7HA 1OTYA 4ZEWA 1ZESA 4FYPA 4GPIB 3HXOA 1PJ3A 1RLJA 1ULTA 2IVFA 1E61A 5C7YA 2IXEA 3A58B 3U7JA 3WS7A 2M6SA 3P2MA 1G4AE 4PC2A 1XTIA 2DFDA 1ST3A 2I3ZA 1B00A 2QRHA 3B36A 4P4GA 3W06A 1U7OA 2XT0A 4WDRA 3ZBQA 4TZ6A 1SG9A 5AIAA 2JFUA 1UFOA 2D06A 2WB4A 4XIFA 3WGLA 1QK3A 1ZJ4A 3T5MA 1B8VA 2BTQA 3RVSA 1ZMXA 4XUCA 1TU4A 1F1JA 3HHPA 3WNQA 5FL7D 5DCWA 4G1FA 3GFTA 4UEKA 3MD9A 3EVTA 3GO4A 1EFKA 1NZDA 1ADBA 2FZCA 2OAGA 3KVYA 5F7ZA 1YGPA 1K8XB 1F0NA 1Z56C 4M0EA 4PG8A 2O0LA 4NV3A 3DDNA 1II9A 4UULA 4EHDA 1JFTA 3QYPA 3MPOA 4K6OA 5C8YB 1PQYA 1O6ZA 3AEQB 1F38A 3DAOA 3T5BA 1J22A 1NM5C 3AWIA 1DO0A 3I83A 1UEXC 2AEFA 3TAUA 3B7GA 3IOYA 3TGWA 2ECQA 3ICOA 3UJDA 2D2FA 2V7BA 4A7PA 4BVLA 3N39C 5A02A 3ABIA 2IHKA 1SU7A 3QXHA 5HA5A 4YV0A 5IDWA 3GLFB 4IXTA 1FC0A 2CLOB 4KIWA 1K8YB 3I92A 4NP6A 3U3JA 2BF7A 1IHUA 3D6MA 1MO2A 4QUGA 4EPVA 4MKFA 3HN7A 1J99A 2ZPAA 9ABPA 3CM0A 3EW9A 5TGTA 3VAAA 3C3WA 1TC2A 4JOCA 4DC0A 1HFJA 3FDFA 1PTJA 2DR2A 3EIHA 2WILA 3CEAA 2QR3A 3S28A 3MMNA 2WU1A 3F2IA 4PX9A 4BKRA 3S6JA 1OA1A 3BE4A 1H2XA 1HDGO 4WVLA 5E9QA 3SICE 1KYTA 4ZIRB 3O2QB 3SCZA 2PZGA 1EE9A 2X9GA 1SQGA 1J2UA 1VPTA 1FNSA 1LV7A 2VYQA 4CJXA 1SC6A 5BWCA 4JOBA 3TF5A 1N9ZA 4HZIA 3ZN2A 1A3CA 1SVUA 2XY4A 2WYOA 3D6NB 3QBEA 2I2WA 3Q2KA 2YRXA 2PQ6A 3DKRA 4BB0A 4Q82A 1N2HA 2EIXA 2NXJA 5CFRA 4DV3B 2XVYA 3TM4A 4DNXA 4N0MA 4DYHA 1HF3A 4WCFA 5LZ9A 1V16B 1E62A 3KJXA 1CUYA 2O7VA 4MHTA 2IK8A 1UDWA 1Z6YA 1KS9A 2X0NA 1V5WA 4GP6A 4MYDA 5EE3A 1CEQA 1O95C 3BK1A 3F6YA 1J3UA 2DBYA 3JQCA 1EDOA 5KHLB 2VQEB 3LC7O 2IT1A 3L06A 3FSRA 2LKCA 1G18A 1C9NA 4FFBB 4FI3C 2AYYA 3DA8A 1LNSA 1RCFA 1XA0A 2VUTA 1DO8A 4W7IA 4XCQA 4LW8A 4YY3B 4S04A 4ABTA 4PX3A 3MT9A 4M87A 2QENA 3DLAA 5B4UA 1JMYA 4HZUA 5GONB 5K0TA 3BWDD 3SX4A 1CX9B 4WY5A 1PQWA 4ASUA 3L18A 5DNEA 1UADA 3UHFA 1U1GA 3ONFA 5BMOA 1VHJA 1DWOA 3VV3A 2MDTA 1U3GA 2XBUA 3WYGA 4DILA 3HCBA 4Y9UA 1GRVA 1JVSA 1US8B 1E3IA 1PR5A 1YONA 3JTMA 2BELA 4QYWA 4JYZA 5D6NA 1FVOA 1KTVA 1ZW6A 2I7TA 2O6LA 3JR3A 3NALA 2E1PA 5TRTA 4OYYA 2WKPA 2BHLA 5DTQA 4C4AA 2MYNA 1DPFA 3GW8A 5TEVA 1GKIA 1P2GA 3RSCA 4CI9A 4PYRA 2X3UA 3EUFA 1RJGA 4HWGA 3BT7A 2DJ5A 1ZD5A 2JJ1D 2AXQA 3HBFA 3W2TA 4PYIA 2FQ1A 1NBWB 1FUKA 3F3SA 2DHEA 4RTRA 2CDBA 2NVBA 2IZZA 3HFGA 4P92A 2IHYA 1QGZA 3C3PA 1OBHA 4K40A 3OU2A 5CLGA 4ETNA 2VPPA 3R1IA 4NBRA 3O2JA 1ECJA 2CVZA 5E2BA 2QI9C 4NXMB 3DV2A 4DZRA 3TDMA 2PGXA 4HNRA 5MDHA 4LDZA 5KJ6A 1PJBA 3SSNA 5JWRA 3KEMA 3TTXA 1D0VA 1VSQA 3F47A 4RTMA 1XNGA 2YS6A 1VL0A 4J0EA 4KXNA 3RK0A 5BSHA 5C1BA 4TLLB 1I94B 2NSJA 4PZUA 4FDLA 2J9GA 4QPCA 3QEBZ 4YXWD 5FUQA 2Y77A 1J06A 3KR9A 1X74A 2FMKA 4O6VA 1RJEA 1NXVA 2XUHA 3HK2A 1FDWA 2P79A 4LOIA 1HE3A 3WWPA 3V2UA 4HRYA 1Z47A 2MINA 4CLDA 5DM70 2CBZA 1N4AA 2JAOA 2YY6A 3CSUA 3AG6A 2IW3A 1Z8HA 3VVLA 4YMUA 4MDEA 4UOZA 1Z07A 2GPYA 3ZW9A 1XD2A 2FZVA 3DW3X 4PYNA 4WMLA 4BNHA 1TQ2A 3FE2A 4JJAA 1PZHA 3FYHA 3W6NA 1W5AA 4QZVA 1L5NA 2RK3A 1X1EA 1FSPA 4YCMA 1N0VC 1P0QA 1SKUA 1UMDA 4EKDA 4AT1A 1IQRA 4XEUA 3L8MA 2NT3A 1YR2A 4QAJA 3A9SA 2QF7A 1C0KA 4B6EA 5E38A 1CRZA 4PSAA 4ZVTA 2FMXA 4EFDA 3DTNA 3BGDA 3W2GA 4FE4A 3AIKA 3WWDA 1Q77A 2LR0A 2WJVA 2ISSD 2XNJA 1HM5A 3D8TA 3GQBA 4MS1A 1OXVA 4IW3B 1MB4A 3Q8XB 1EGAA 1S2GA 3M1AA 4HNAB 3O4FA 3RC3A 3TMYA 3RUHA 3AHFA 4S1WA 1JQEA 4LRQA 4XFDA 3WRXC 3ZJVA 3E84A 1CXZA 2GETA 2HRZA 1KY4A 3FTPA 1V5IA 2ZUEA 5B57C 4B34A 2PL9A 3OQNA 1USVA 2ZWOA 3AKYA 4NECA 2ZZNA 1TZKA 1L9XA 3K1JA 1ST2A 4PZPA 5ECDA 3TAXA 4B3CA 1UBMS 2MSKA 4M9UA 3EZ9A 3W8DA 3ZHUA 4TROA 5DYYA 2CMFA 5F2NA 3TRJA 1UPAA 1QRUA 1O8BA 3SYMA 5CITA 1VGRA 4N03A 3FMIA 3GG2A 4Y2QA 5BMVF 5JC1A 1WKCA 4O3FA 5AP9A 5C34B 2FSVA 1NX6A 1NDHA 4DW8A 4JVLA 5JCJA 3B5EA 3JYLA 4DSOA 3S7TA 3UV6A 1SBQA 1KMHA 3QFSA 1Q50A 6YASA 3USES 2SKCA 4H7HA 1HNXB 1FSFA 4QVIA 3H5VA 1NJ1A 3SLGA 1VPWA 2E49A 2XF8A 3IEMA 4N7BA 1IN1A 1OI3A 4R0VA 4CODB 2XGOA 2JAWA 3U09A 1WPRA 4KQFA 2AJBA 4TSFD 1RYMA 5LWQA 4R7TA 5LN1A 4P80A 5JMOA 1M1ZA 3ZH9B 3BMNA 3HB0A 1F8GA 4DA9A 1R4ZA 4IPTA 5DBFA 2VYVA 3KPJA 5DNAA 4LA4A 5F7JA 1WXGA 4P8RA 1REQB 4LZAA 4U2FA 4EGQA 1IU9A 1XCOA 2MYPA 4G9EA 4X54A 2RJNA 1CUEA 4GOJA 2C77A 4Q3DA 3SQNA 4KR6A 4L9RA 3TLEA 3U61B 1MKYA 4BTVA 4ZTZB 1NULA 4MI1A 3U9LA 2BFDB 2CXSA 4Z9YA 3ENNA 2BFEB 5J43A 3EGWA 1CR0A 2NWQA 3LHDA 5EP4A 4C3OB 4F71A 1TE2A 4HNVA 5C3MA 3QA3E 3W5IA 5I5GA 3LUJA 4K8RB 1JG2A 1VXRA 1R0LA 2VJLA 2H7CA 3VC7A 4EJSC 1E1QA 3KUUA 4JK3A 3GA0A 3E27A 3CF4G 5K0SA 5IBQA 3RNOA 3RIHA 4CMIA 2YQZA 2V9PA 4GLFA 5C81A 3U7FB 1JU9A 3BWYA 5B64A 5B1IA 5B2EA 2QRJA 1PHRA 2L19A 1I7NA 3LQ4A 5ARDA 5TC4A 3VOAA 3HWX1 5BQXA 2DQSA 4KQ9A 3L1VA 3AJDA 1E4EB 2WUFA 4IMJB 4ALIA 1A2KC 4O4JA 3BK7A 1MQSA 1S4MA 2GFHA 1G8KA 3JALA 5B6JA 1GRCA 4BWFB 5JQWA 1VA5A 3U3DA 3F1KA 1PJTA 3K4HA 2YR0A 3DTVB 4TVBA 5DFAA 4YJHA 1DS6A 5TE9A 1HE5A 2ATEA 5IJ9A 4IDNA 1MRNA 3I42A 1UAAA 2BEWA 4JBYA 5ILOA 2WEKA 3PNYA 3UGJA 2ZDQA 4QYTA 1NF8A 3N76A 2DFTA 1JG6A 1HURA 1SUIA 4LOLA 4M0LA 4DANA 4X95A 3R9XB 3F78A 1ZDMA 2IH4A 3E23A 3GLGE 2P69A 1FFWA 1I30A 3B2EA 4Z2AA 3T7RA 1NAIA 4QPDA 3RNLA 4E07A 5DM2A 5NLLA 2ZM6B 2GQ0A 1XRRA 4AECA 5DSZA 1APBA 1GLNA 5K3AA 2IIPA 2QS9A 5LSAA 1OV4A 2BIFA 1THMA 2PJDA 3MQ4A 3TNLA 2EQ5A 4I0WB 4ZOQI 3GEIA 1P19A 4RJLA 2G8NA 2X8WA 2CVOA 2QKYA 3NFYA 4CM7A 2QJTA 5KSWB 3MC1A 4EW6A 4X66B 3UHOA 3BMQA 1ZVMA 2PT6A 3QPVA 4MW1A 8ADHA 3KNZA 5BSWA 3DCIA 3W5BA 2VHQA 4LHWA 4OTZA 1EJ6A 5A9RA 4BC0A 3VC1A 4BVKA 2PEYA 4OQEA 1UIMA 3KDPA 4CXMA 2WF9A 2FW1A 3KYJB 4PLWA 1E94E 1LPPA 2O0HA 3HZZA 3GDFA 5CVEA 5F1OA 1BDJA 1NVWQ 4RDCA 2Y1GA 3JQGB 3VZPA 2VJCA 3PNVA 3WLJA 1KC3A 3CLUC 4BRSA 1X1BA 4CM9D 2O8EB 3O93A 1O58A 2N0SA 3RB8A 4P3PA 3VZCA 4MV1A 3E9NA 3ZHTA 3TQQA 2B9EA 2XTNA 4YRIA 1GKLA 4DM4A 5TF4A 1T91A 1ZIDA 1XVLA 5ICMA 3G2NA 4TLDA 3U60B 4HVLA 4FEYA 1O2DA 2D0DA 2D2IA 4E88A 3PTZA 1JQ3A 2HJWA 1WBJB 4F4DA 3O4VA 3V2IA 4C29A 1DP4A 4JB0A 3HMKA 4EEIA 3ETHA 3R9KA 5DHFA 3T52A 2R1TA 5MF6A 3OC6A 5KNBD 3RVNA 4W82A 5GM2A 3STHA 2VUUA 4HXEB 1C29B 2SCUA 4QOGA 1H8ED 3P9QA 4CN8A 4AG5A 4CTJA 4DIKA 1BE0A 1G17A 4OLHA 5LJIA 4IRUB 1XDGA 2HBZA 4OXYA 4ALKA 4NBNA 2Y92A 2CMHA 3VJMA 4CKBA 5JXIA 1NYLA 1AVTA 3IIIA 1GPJA 4KRGA 4ZOEA 3RJMA 5FUVA 3F9RA 3AF3A 1NW9B 2C1XA 2GVZC 3CRVA 1VA4A 3H17A 4R7GA 3PITA 1EWVA 1PQUA 3MWKA 3UJHA 3R7WB 1KGSA 2YVKA 3M1LA 3O26A 3PFKA 3QVVA 1V11A 2ZTMA 3UEOA 1H6BA 4AIRA 2GKGA 4OHKA 2JG3A 2JARA 3M9LA 1XRSB 4P08A 2QBYB 1I6MA 2D5IA 3PWTA 3WO1A 4LZWA 2GGSA 3GLUA 3IAM6 4H2DA 4OCZA 5CDYA 2J9XB 4BJ6A 2A67A 2BYTA 2YHIA 1WXFA 2HDWA 3AERB 3M4XA 3Q41A 1KI6B 5AK4A 3HBNA 3T5AA 1VPDA 2ZSUA 3NEYA 5I7RA 3MUEA 3WIOA 2IRWA 2P6UA 1DC8A 1AS3A 1TEXA 2H54A 3LIIA 3IUNA 4XQGA 3WKBA 1Q7BA 1OY1A 2VNAA 1XXLA 2IWRA 4CL8A 5IFKA 1CVRA 5NULA 3F67A 3A4TA 3C3CA 3Q3VA 4WCDA 4OMDA 4FMPA 4MKIA