4YIHA

Crystal structure of human cytosolic 5'(3')-deoxyribonucleotidase in complex with the inhibitor pb-pvu
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
192
structure length
192
Chain Sequence
SVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of a bisphosphonate 5'(3')-deoxyribonucleotidase inhibitor
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 5'(3')-deoxyribonucleotidase, cytosolic type
total genus 70
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 3.1.3.-:
pdb deposition date 2015-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4yihA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4yihA01
4Y3UA 2YMMA 4UMFA 3N1UA 2NYVA 3EPRA 3QU7A 4UARA 3N8GA 2PR7A 2OM6A 1JUDA 3A1DA 2ODAA 1Z4NA 3IRUA 4UMDA 2FPSA 5AVVA 3WKCA 4CF4A 4NAVA 5AW9A 4C4SA 4F72A 3WKAA 2HHLA 2CFSA 4CE6A 4YIHA 1VJ5A 1TJ5A 1ZD5A 3W5DA 3EF0A 3E84A 2JGAA 3W5CA 4I9GA 1RKQA 5AVSA 2MU1A 2MSNA 4HGPA 2HOQA 2G0AA 3AR2A 2ZXEA 4YCNA 1WZCA 3FM9A 1L8LA 3QUCA 4UM7A 1PW5A 5JJBA 3U19A 1ZJJA 2P11A 4DCCA 2EARA 3ZI4A 5AKLA 3RF6A 5AM2A 5AW7A 3ZX4A 2C88A 4JDPA 2ZOSA 1SWWA 2BDEA 4AS3A 4OHFA 2CFTA 5AW0A 3WK5A 4DFDA 3QLEA 4PNHA 4L6AA 1U2SA 5ALLA 3SD7A 4ZEVA 1U02A 1NRWA 2WF7A 2OBBA 2EAUA 4BX2A 1SWVA 4HYTA 2Q4TA 3EF1A 1K1EA 1RPZA 4BNDB 2FUCA 2ZG6A 3L8HA 3OCVA 1TA0A 3ZVMA 5ALVA 3QGMA 3MN1A 3TLMA 4UMEA 3WK7A 3M9LA 3WK9A 5AM5A 4C4RA 3SKYA 2CN1A 4Y2RA 2O9JA 1L6RA 3QYPA 2FPWA 2YJ4A 4XOUA 3L5KA 1RDFA 1ZD2P 1Z4IA 3L0CA 1Q91A 3FVVA 3OCWA 3WKBA 2HDOA 2FUEA 3ZWKA 3RFUA 4F71A 5ALKA 4UU0A 2P27A 5AVYA 4B6JA 1Z4KA 2G07A 2FPUA 3L8GA 3A3YA 4HGOA 1CQZA 5AKXA 3L7YA 3W5AA 4L57A 1S2OA 2B0CA 3DAOA 3AR5A 2RB5A 3KZXA 2B1QA 1O03A 3I1YA 1Z4LA 5AVRA 1F5SA 5AI4A 4EX6A 4MWOA 1NNLA 4NWIA 3KC2A 3QUBA 3DNPA 2PKEA 4KN8A 3U7GA 4FYPA 1L7PA 3AR7A 5ALMA 2G80A 4UAVA 2FEAA 4GIBA 4HGNA 3ZX5A 5AVXA 4RESA 1FEZA 2GHTA 3QU9A 5AW3A 3U7EB 4I9FA 2D2VA 5AICA 1QYIA 4XPZA 1N9KA 2I7DA 2YN4A 3HLTA 4OCZA 1RMQA 1WVIA 2EATA 1L7NA 2NO5A 2RAVA 3N5KA 4YCLA 2GFHA 5AW5A 3BWVA 3OCUA 3CZ4A 3SMVA 4UATA 1ZRNA 3PCTA 3KD3A 2HF7A 2I34A 1XP5A 1QQ7A 3QUTA 1RQNA 2AH5A 3IB6A 1RRCA 1RMYA 1QH9A 2HCFA 3KBBA 4UU1A 1VJRA 4CNQA 5ALZA 2WF9A 5AK6A 4HGQA 1U7PA 3ET4A 3PGVA 4Y2XA 3OTQA 3L0YA 3QNMA 3AR9A 4YH1A 5FP0A 2G06A 1Y8AA 2G08A 1RQLA 2OA0A 2IOHA 3WGUA 3S6JA 4KNWA 5AI9A 2WF8A 3FGOA 5ALHA 4AS2A 1ZS9A 2PQ0A 3E8MA 1AQ6A 5AKYA 5AI0A 1QQ6A 2QYHA 3QUQA 1IWOA 2R8XA 2B1RA 5AKZA 4HGRA 4E88A 3OCXA 3ZTYA 4UASA 3U7FB 3ZWDA 5ALEA 3WK8A 1U7OA 2RARA 5ALRA 3ZTWA 4UM5A 3KOOA 1N8NA 3R4CA 2FPXA 3BA6A 5ALPA 1L7OA 3AR3A 1ZD4A 4Y2SA 3E58A 3L0BA 4UW9A 4DWOA 1RLMA 2I54A 2IA5A 1EK1A 4BNDA 4BKMA 3ZU6A 1LTQA 2G09A 1J8DA 4UAUA 2FI1A 3NASA 5AKJA 5IS2A 1NF2A 4ZEXA 3PGLA 2G1AA 2Q4RA 1CR6A 5AVWA 3QU2A 2HEGA 2HO4A 2JAOA 5IT0A 3W5BA 4O8CA 4BX3A 3ED5A 3OPXA 4MUMA 3M1YA 5A3SA 5AKEA 3GYGA 3U26A 2ZBGA 5AKHA 4EEKA 3P96A 4EX7A 2YMQA 2NO4A 2R8YA 2YY6A 4Y2PA 3L8EA 2HX1A 1EK2A 3KDPA 1YMQA 2WFAA 4G63A 2YJ5A 2RBKA 3ONNA 1ZD3A 4NFLA 5AKIA 4BEWA 4Y2QA 4FFDA 3FZQA 1O08A 4KNVA 2WF5A 3L8FA 3ET5A 5A3QA 2B8JA 5ALJA 1Z4OA 5AK5A 3SLRA 2I33A 5T41A 5AVUA 3DDHA 1QQ5A 5A3RA 4YCMA 1Z88A 5AVZA 3SHQA 1YNSA 3ZVNA 4C4TA 2I55A 2AMYA 4Y2VA 4IFTA 2BY4A 2AGVA 4ZEWA 4QJBA 1Z4MA 2C8LA 5AK4A 3SKXA 4HAIA 3U7HB 4KYTA 1WR8A 1YS9A 2OYCA 4G9BA 3UM9A 3B9RA 2B30A 1Z4JA 1LVHA 3NUQA 1Z5GA 2WF6A 4XQ0A 2P9JA 3I28A 5AI6A 1RLTA 3NIWA 2WM8A 1S8OA 4Y2YA 5ALOA 3IJ5A 5AM1A 5ALYA 3E81A 1U2TA 1L7MA 5AIBA 4EENA 2X4DA 3WKDA 2Q5EA 1ZRMA 1TJ3A 3MC1A 3QXGA 2IOFA 1MH9A 5ALFA 1TJ4A 5ALUA 5ALGA 2QLTA 3UMGA 3OCYA 1X42A 4NV0A 4H1WA 5AM3A 3AR6A 5E0OA 4Y2TA 2ZBEA 5AI8A 4OFZA 4XE5A 1XPJA 1YV9A 3NAMA 2YMLA 4CF5A 2GHQA 3AR8A 3OCZA 3AR4A 1TE2A 3B9BA 2C4NA 1Z4QA 4JB3A 1Q92A 2W43A 5ALTA 4YIKA 1YJ5A 5ALSA 4CF3A 5AW2A 1T9ZA 2O2XA 3ESQA 3L1VA 2B82A 2DQSA 2BDUA 5AK3A 5ALQA 4OD0A 1ZOLA 3WKEA 3ZW7A 1RKUA 1Z5UA 3FPSA 5AW4A 2YFYA 1VFPA 4Y2JA 5ALIA 1T5SA 3DV9A 3CNHA 1RC8A 4RETA 3SF0A 2W4MA 1L8OA 5AM4A 2WHEA 2GO7A 2JAUA 3MPOA 5AESA 3N28A 5ALNA 3K1ZA 3R9KA 4NABA 2ZBFA 2HF2A 2R8EA 4L6CA 3NALA 3NANA 1WPGA 5AVTA 2I6XA 5AI5A 5AIAA 4KX3A 4GXTA 4IG4A 4J03A 3VAYA 3WK6A 4FE3A 4EZEA 3R09A 3WGVA 3ZVLA 5IT4A 1SU4A 5AKKA 3FPBA 2ZBDA 3L1UA 3QX7A 4QQFA 2FPRA 3B8EA 4AP9A 5AKGA 3NRJA 2C8KA 4J2TA 3F9RA 5AM0A 4Y2UA 3UMCA 2C9MA 1Z4PX 3A1EA 3N07A 2YMPA 2JAWA 5ALWA 1XVIA 4BBJA 5ALXA 2VKQA 3QU5A 5AHXA 4YGYA 1RKVA 2IOFK 3ZUPA 2FDRA 2R8ZA 2YJ6A 5AW8A 4UMVA 2AUTA 3D6JA 5AW1A 1RLOA 3ESRA 4DW8A 3I6BA 5AVQA 3U13A 1KYTA 2P69A 1J97A 4BEVA 2HI0A 2HSZA 4KX5A 3QU4A 5ALDA 3I76A 2YBDA 2JARA 2YJ3A 3HYCA 1RMTA 2GMWA 2IYEA 3MMZA 5AW6A 1T5TA 2CFRA 3EWIA 2B8EA 3A1CA 4BYGA 3PDWA 4BX0A 3J7TA 2W11A 3WK4A 4EELA 3UMBA 1YDFA
chains in the Genus database with same CATH superfamily
2IE8A 3A28A 3DBRB 3DPUA 4XM0A 5TPZD 4B7XA 1X77A 1SHTX 1MB4A 2AKYA 1LXCA 4D9NA 1SD5A 1F48A 2WP0A 3O7MA 3N3AC 4YALA 5BSFA 1ID8A 2RKBA 4G4SO 2ZBRA 4BZPA 3BGOS 3GMTA 3KSDO 2AE1A 3BAZA 2G1UA 3LP6A 3EEQA 4NAVA 3SE7A 1NVDA 2VL7A 3WNCA 4A26A 3OM1A 2QG9A 4K9SA 1FXWF 1D2MA 2OR3A 4INAA 2C4WA 3PQ8A 1XT6A 4CM7A 3K0CC 1CWUA 4R71A 3W04A 4QOEA 1CUYA 3O8RA 3I1IA 4MKFA 4X8MA 4F97A 3HJGA 4DCUA 4HNSA 4ZZ1A 5A2QA 1R6TA 2MU1A 5CM2Z 3CURA 1VECA 1XMPA 4YRPA 2QW1A 4BNUA 4JOCA 3IS3A 1GEGA 1THMA 3AWIA 4Y9TA 4NYIR 1GGKA 3BS4A 4LRXA 2ZJ0A 1EB9A 3SPXA 1WZCA 3I09A 3U3OA 2AC7A 3QTTA 4Y0AA 5B2FA 3RSLA 5JPDA 2ZWPA 3R0ZA 1QIJA 4P4LA 5T64A 1B3BA 2Z6QA 1KC3A 3UTDA 2X0EA 3EPLA 2HREA 2EBUA 5J4YA 3ZI4A 5IANA 3GXBA 1V26A 4HCJA 2UYOA 5LDGA 4MI3A 3WXBA 5AW7A 4BB9A 3LWDA 3NWOA 1IE3A 4CTOA 2GEVA 2V0NA 3EGCA 1B4DA 3GB9A 1TYZA 3U81A 4ZI3A 3TW4A 2E4YA 2E49A 1ITZA 3BSFA 4KO1S 3LY8A 3T9DA 4E2FA 1D3AA 1XDDA 1ISPA 2PX0A 1HY1A 3A9RA 3MCUA 3Q8XB 5FUXA 3SYLA 4YP1A 4B8YA 1U2DA 3MFYA 3QOFA 4ZT5A 5CHEA 1WDKA 4YREA 2WTBA 1EM8A 4URZR 1Z16A 2H7CA 1M67A 1KAHA 3HZOA 3FPGA 4FMPA 1R88A 3ABSB 3TECE 1E5XA 1RYYA 2P5YA 1T9BA 3S2UA 4UUPA 5CH3A 1JEEA 4W9MC 5KU1A 3RYCA 1B8UA 1TO6A 1Z73A 2GH1A 5ER9A 5IJXA 4QTXA 4MW4A 3PA6A 2R5WA 1GO2A 4DA7A 5KSZA 1MXHA 4MGEA 1ZK1A 2XAAA 1QG4A 4U3JB 3SZMA 1M6WA 3DF7A 3QVVA 2EEZA 1NU8A 3H42B 3P7MA 1DCTA 2O9JA 2RIRA 3AILA 4MQEB 5GGYA 4M2LA 3UAZA 1YRYE 3NOQA 2HWUA 3TQQA 4DSNA 1ZRSA 1NN0A 2YFKA 3KB8A 2YV4A 3H5VA 2NZUG 5EHZA 1LW6E 3OIGA 5ALKA 3SFVA 3OQHA 4F3CA 3QZUA 2C1EA 5C7YA 1FFXB 3EZLA 5J63A 4AO7A 5ABPA 3KKQA 4YYEA 5JQGA 4EI8A 5BUQA 4TROA 1V5FA 4AUEA 3ZCTA 3WMXA 5EXXA 4IXDA 3AW9A 1N3BA 2YVKA 2QS9A 3FUTA 4Q1BA 3OQVA 5BWOA 1EA5A 2AR9A 3PUVA 2H8GA 4MO2A 4XCQA 3HVIA 3OMXA 3A11A 1I3OA 1LWOA 3HXQA 3KT6A 1T1EA 1C1HA 1OYOA 5U1PA 1L7VC 3KQKA 3X0DA 4GRIA 4ZZ0A 3MLAA 4NDNE 4DG8A 1SXJA 1NI3A 1ZGJA 5BNWA 1VJ1A 1N36B 5EXPA 1QB8A 1MX1A 4R54A 4DILA 2UVPB 3RH0A 1WUHS 3K9WA 4P93A 4KR2A 3PEEA 3FGZA 4JR2A 4XDYA 5H3LA 1JHOA 4MO9A 3VPBA 2D7JA 4FBMA 3ZI0A 1DIRA 5I4BA 2QAIA 2OMEA 3HCFA 4GT1A 1U3GA 2HYDA 3A2NA 2QN2A 3DB2A 3NC0C 4Z4QA 4CMBA 2ONKA 2DM6A 1L4HA 3OT1B 3QFFA 3GW8A 4ZT2A 4A23A 4ND2A 5FRDA 1P6QA 4D9GA 1LVUA 3SMVA 3PLAE 2PMDA 1GL9B 1N57A 1BJKA 1KH2A 2WWWA 4RZIA 2I6QA 1Q3TA 3KD3A 5DX8A 3S1LA 1OD6A 3PQ3A 2N9UA 5DOVA 1RQNA 5LPNA 5AOCA 4LWZA 4WBNB 5I5GA 1H93A 3U44A 4F8YA 1KRXA 3T3GA 2PK3A 2HT6A 1EDBA 2AUNA 3KVVA 4GSYA 2QSZA 4KDFA 4K6GA 1KFKB 1TC2A 3AFMA 1A7JA 3M9XA 5AK6A 4CNQA 2HLDA 1E0JA 2JFHA 5KYVA 4AX8A 5L6LB 1WB4A 3EVTA 3H2KA 4F1JA 4OB8A 3MGBA 1RJWA 2E0IA 4KI7A 4R2IA 3PGVA 3B82A 1CCWA 3IHTA 2AVDA 2AQIA 5HCUA 4JYPA 3OQMA 2QN6A 3R0JA 5LSAA 5B53A 5CU7A 4TYQA 4HP8A 4O4JB 4F5EA 1RYDA 4HMQA 4R8MA 3N58A 1N32B 1QIIA 2AI3A 2IOHA 1J1UA 1EIWA 1KKMA 3C6ZA 3IPYA 3S6JA 3ABQB 3GUHA 121PA 1R3UA 2BHSA 2VQ6A 2OY0A 3KL2A 1QAQA 3AOEC 5DP1A 5EJFA 3U3MA 4RY9A 3TQSA 2JJ1A 1QDUA 1MEJA 1AF7A 4ZCSA 4C7OB 1R9MA 3LX6A 4WLOA 2G63A 4NAHA 5CIWA 1DTEA 3TCKA 3CKMA 4UVEA 3K6RA 3OCXA 4OHXA 3B2QA 5ALEA 2IZ6A 4RKEA 1X14A 1QYCA 2JLRA 3LHFA 4OSPA 1A2BA 3K09A 1H2YA 1U90A 1WU8A 2ODQA 3TLJA 2W2KB 2XMRA 5CJJA 3F6YA 4FOLA 1ZSVA 4Y2SA 3OM8A 4Y1EA 3VPCA 1IBLB 4P32A 3KQVA 4UW9A 1RLMA 2V59A 2JI4A 2I54A 1U0RA 4G5QA 4Z7NB 1EIZA 3WAGA 1N3LA 5FULA 5JCZA 2B9VA 1VPDA 1QH1A 1VIVA 1M3SA 5EYPA 3WMWA 2F4VB 1CJBA 3CWQA 1Q74A 1M2HA 3AF4A 3FR8A 4P36A 5AVWA 1P61B 1UK6A 1TO1E 2W6IA 3GJRA 1ZMOA 2X5NA 3QKSA 2ZIFA 4MIKA 3SBXA 5JARA 2DSTA 2ZE7A 3PIIA 1FVOA 1W35A 1PK8A 2HHHB 1OI2A 3ZW8A 4NE7A 2PTGA 1TJYA 3A6GA 5BT8A 4RCZA 1TEXA 1JW9B 4G5GA 4QUDA 5DBIA 2ZBGA 4LXXA 5HCIA 1VL8A 3EISA 4AMZA 3ZTTA 2R8YA 2PQ6A 5EWMA 3M3DA 2X3FA 5CDTA 5KWIA 3LUKA 5A04A 2ERXA 3I8OA 4TL7A 4YP9A 4Z3DA 1KU0A 3COPA 4MYHA 2AI1A 1AIPA 2WHXA 3DVAB 4HNGA 5JG7A 3RK0A 3BDIA 3VNSA 1U0SY 2AX3A 3KOMA 4NBVA 1LI5A 1Y9AA 1VSQA 2I6UA 4MQFB 1O5IA 4C78A 3TZEA 3IE1A 1HR0B 1R6VA 3W9BA 2IXFA 1CUUA 1P0CA 1XN1A 2VYFA 1IMOA 5FL3A 1PNRA 3I9V6 4Q9DA 2FN3A 1W29A 3H1AA 3P2KA 4Q3DA 3IQZA 3C1UA 2V4ZA 2QI9C 3D3NA 3KV3O 1Z15A 4ID3A 2YFHA 4M0DA 5I7HA 2AOTB 2B7CA 1F6DA 2Q5JA 3KYBA 3NJ8A 3RYFB 3A1WA 2PVPA 2FPMA 4RV9A 1NPTO 1KO1A 3Q2OA 3SQLA 3V4FA 3GNLA 4PHGA 3LUGA 4BASA 1YS2X 2OB2A 3L6OO 2D0OB 4INJA 1DP4A 1CR0A 1Z6YA 3PTZA 1NNUA 1M8PA 5J2UB 3SJAA 4IFTA 5KYKA 1NOJA 1M6VB 2EF0A 3FW1A 3MTAA 5T3UA 2G7ZA 1W2WB 3FVRA 2H63A 4CKCB 1Q5PA 1SOWA 1RYHA 3NI2A 2JDID 2P4QA 4MW9A 4W7IA 1JQLB 4D45A 2C2ZA 4EHJA 2YY5A 3IT0A 1E8DA 1FXWA 2P4UA 2QZ4A 1GNLA 4GYWA 2QZ9A 2VXYA 4M9XA 1BS1A 2CBZA 4HFRA 4PYNA 4QIHA 3R7WB 3HXLA 4DV1B 4GS5A 3SZLA 4YC7A 1MT0A 1CJVC 4L8YA 5CRIA 5EQJB 4RH0A 2PCJA 3ASVA 1Z5GA 3OPMA 3MTBA 2GFIA 4RLQA 4YCJA 5DTIA 3QPVA 5HDBB 5BWLA 4WW0A 3OQPA 1NVEA 1WQ3A 4YV1A 2G7MC 2NUAA 1G3RA 2Z2IA 4GE3A 4NEGA 3L8CA 5AI6A 1G8JA 5EIWA 4BL5A 4UTPA 4KXNA 2YWFA 3HB7A 4R69A 1N5MA 4GQIA 2WJJA 4CEJB 1QYXA 2FKNA 2ZIEA 5HWSA 2GM3A 3ZJTA 5IC6A 4FDLA 5HM6A 1KBOA 2PZGA 1Z0IA 1H2XA 1AY0A 1XQVA 2K2WA 2VWQA 1H2BA 2Y92A 3MC1A 4AMVA 5GVRA 1CDDA 3BMOB 3DOJA 4K9LA 3UUWA 2CNOA 1QAMA 4WOBA 4AT1A 3K3PA 2QJOA 3CPEA 4LXHA 3A27A 2J0EA 5EP2A 3A2KA 4IXMA 5EYPB 3PUZA 3HZHA 3DHEA 9GPBA 3WLIA 5HKKD 1C3LA 3NFRA 2O19A 4DTCA 3LKVA 4M0KA 4MW7A 4F11A 4Y6LA 2BONA 1M54A 1R6AA 2B8NA 1QVZA 2OP0A 1ZH6A 4IMJB 1IJKA 4R9RA 1NAHA 1E79A 2WKPA 1V43A 2PGLA 3ZJ4A 4MHTA 2PD6A 3ORHA 3WWOA 3RJTA 2RJOA 1GNRA 3PNVA 2WSMA 4KWCA 3U9TA 4QXQA 1SG9A 2HLHA 4RDCA 2CXPA 1ZBDA 5B6IA 1YB7A 2J7PA 4P4SA 1MEEA 5CNJA 4MEBA 2CJFA 1IUPA 1O57A 5EJ5A 1BVRA 5I3CA 3MJFA 3BWDD 2ZRLA 3OMWA 4XIJA 2JEYA 5EJ2A 3PKZA 4XARA 2JBWA 4ZJZA 5E8RA 3WJ2A 2B82A 1HZZC 1ZP6A 2VHTA 3Q3JB 3TINA 2VLIA 5I48A 2DQSA 4NSNA 1AK2A 1N2SA 2QTVB 1DZ3A 3G6WA 4Z86A 1TT5B 2H5LA 3I52A 5ALQA 1J9EA 4HDMB 5DH9A 1YCFA 5DHUA 4YXWD 3BREA 2FWBA 3LZ6A 1SBZA 3BD8A 2GZHA 2ZQYA 3THXA 1GJRA 4O5AA 4PRYA 2B6HA 4B5LA 1TQ6A 1CYEA 1E3WB 2WNIA 1LLUA 3ORFA 1F6BA 1TIKA 3E82A 4RETA 3SZGA 1PG0A 1SHKA 3AJ9A 2ZRKA 3FOEC 2P30A 3FXAA 4GHWA 3PIDA 2PJZA 5KNBA 2Z2XA 1UT5A 1RWMA 2W2LA 3O9MA 3UCFA 4WOPA 1T13A 4QASA 421PA 4WBNA 4JOQA 4IHKA 4EA9A 1AMOA 4BNWA 2AD1A 3ZE8A 1GTL1 3IQFA 3BRSA 1G8FA 4G5YA 2XNDA 3G59A 2V9PA 3E9RA 2XB8A 4L9WA 4N5IX 4NCJA 4NMLA 4L08A 5KEIA 3GROA 2DRIA 2ORYA 4N7BA 1QUFA 5COQA 3N6XA 2XGOA 2GEBA 3GQBB 1S02A 4CQMA 4MVJG 3MNFA 4OQ4A 1ZK0A 3EZFA 4RBNA 4KN6A 4YJ2A 3BL6A 1VHDA 2L18A 1XZFA 3O2NA 1NP3A 1ABBA 3PNMA 5KB3A 1W1WA 1U2GC 1EFKA 5JCJA 1IONA 2RI0A 4FKBA 2ZBDA 3IMCA 1KS2A 4FLFA 4D99A 4FSXA 3NONA 4TX1A 4EW6A 3JQRA 4JLKA 3EQ8A 4OHCA 5AKGA 2FCAA 2O3RA 3PC2A 3DD1A 4ENRA 1EFDN 3NT4A 1DE0A 3T12A 4KYIB 2X0JA 1HK7A 2VDQB 3KJFA 3UYKA 4DCVA 3O4FA 3A1EA 1V2HE 1E1NA 1Z6QA 4QC2A 5TMBA 2RKWA 4C05A 3BRQA 5IFLA 2GZ3A 5IH7A 4P0QB 2CLHB 2FFBA 3GVIA 2F8TA 4L27A 4TTIA 4XSGA 1DB3A 3COJA 3VR3A 1Z2NX 4O2LA 5ALXA 4G8BA 4O2BF 5JNRA 2CV2A 7GPBA 3AHFA 3CO0S 2ZFUA 3PWKA 4HRYA 3R9WA 4HLQB 2XMDA 1G3MA 5B4TA 4WEOA 3E15A 4YUVA 5REQB 3KJXA 2GD2A 4UTOA 4F2GA 4YRQA 3W2EA 1B6TA 1GCUA 5JCOA 4B4KA 4FZRA 1OGIA 3DL4A 2C42A 1BC5A 4UTZA 3SSNA 5L7WA 3M3HA 1UT6A 3TQTA 5KDOA 1YB1A 5JANA 3UB4A 2C57A 4OOEA 2JK1A 1KYTA 2A5LA 2JLBA 2ZRDA 2Z57A 3AZPA 4JUFA 1E2PA 4P3OA 1NJFA 4H08A 1TKCA 2Y2VA 2ZZKA 4FQ5A 4MVJE 4CG2A 5I7SA 1UBJS 2GF9A 2WVHA 3TB6A 1ODJA 2BFOA 5BYAA 3HK2A 4WLNA 5K0JA 4DXAA 5FJJA 4EHNA 2VTBA 3THOA 3EDRA 1CF4A 4S0XA 4ZOEA 1ICEA 4TQ9A 2I5PO 2D3WA 4RTRA 4LZZA 1Q84A 1Y8RA 1CEYA 3GL9A 1JR6A 3SEAA 2FP3A 5EWMB 4JELA 2GASA 3L1IA 3A1CA 5EJ6A 2WEKA 5KQRA 2DPYA 1C0IA 3ZZUA 3BFPA 2ZUTA 1OLXB 2BGRA 1ONOA 4BVFA 2X2PA 1MV5A 1WL8A 1GZ4A 4S1WA 4KP7A 1YR2A 1N0VC 4B6OA 1I0ZA 5C8VA 5DHFA 1M33A 5K8UA 1JS1X 1BZYA 1J5PA 1YHYA 3F78A 1RQ7A 2GR9A 2VA8A 3BFVA 3OEED 1N1MA 1GXSB 1W4BA 3H99A 3P2OA 4ZQEA 1Q1EA 5KJ6A 3NAZA 2RBGA 1M7GA 4HFNA 3T5DA 3E1KA 4LOIA 2HL6A 3C6QA 2JGLA 3NW9A 2ZBVA 4L72A 1JBQA 3EF0A 5D7NA 5EE3A 1SMKA 1XZMA 1FYEA 1NW3A 1O94D 1FYXA 2Z56A 3I72A 4CL8A 3JQPA 2HADA 4Q4JA 3N0TA 3TV2A 1H8ED 1Y5RA 4C6HA 3AUSA 1RJDA 4YX9A 3N2YA 4Q1CA 2O54A 5FFNA 2A7XA 4HGPA 5EIAA 4UKDA 4TLAA 1YRWA 3FFXA 2YJTD 3UENA 1J7JA 1SVOA 3GT7A 1U8YA 1L8LA 1E2QA 2ACWA 1FJHA 4DJEC 4CUZA 1OXMA 3CRMA 3O8DA 3OQJA 2VNKA 4JVSB 1HLGA 2COKA 2XYHA 1GTZA 4FKMA 4JLMA 1GG9A 1XR3A 4JS0A 4CJXA 1MG5A 3C8HA 3LK7A 4PZCA 3KTOA 4IMIB 4ND8A 4Y0VA 1X7XB 4ARVA 4RH3A 4MQBA 3GWGA 1JHZA 1PW7A 5CH8A 4TKZA 4ZVKA 3F74A 4JX8A 2QTZA 1GGEA 4I1PA 1Z37A 4PX5A 4I0WB 1QWOA 4KE6A 3TAXA 5AW0A 2A59A 3GLHA 3Q3HA 2HMAA 3UH0A 4AJLA 4XUCA 2C04A 1DT5A 4EO4A 2Q29A 4LRUA 1HYBA 4RD1A 3WBBA 5GVSA 4LZOA 4BVBA 2X22A 2OBBA 4CLDA 3I73A 4BMXA 4IJ5A 3OHPA 2D54A 2G40A 1EVQA 1UJ2A 4H7IA 3OZWA 1X7WA 3X43A 4XPIB 5JAHA 4D42A 4G0OA 5HTOA 4HAUA 3HJBA 1XMOB 2PO5A 3ELBA 3LQFA 4I50B 1HURA 1ILEA 4DV5B 4JKYA 2FUCA 3B7PA 4QE3A 2IUEA 2CNLA 4JEMA 2QGNA 4KR3A 4ZDWA 4CQNA 2HF9A 3GFRA 3OCVA 3H2ZA 4PHHA 4AP6A 2Y1LA 1FSFA 2XD9A 2F59A 2VTEA 3AV3A 3RABA 1TZMA 3OLWA 3RREA 4L8FA 1Y9ZA 4RMGA 1SUBA 3TL6A 1BCSA 4COOA 1HG0A 2IHVA 1L6IA 2Q3EA 1QFXA 1R6XA 1UBMS 2NNWB 4P08A 4PX9A 4PVDA 4XJSA 1MAHA 3ER8A 2OZEA 1Y5NA 1U7HA 4GOKA 1VI2A 4S1TA 1JJ7A 4MR8B 1GPAA 1YB5A 1RAIA 2JJYA 5D86A 3GJ5A 5J3JA 3NHMA 2ALJA 1NQTA 2X13A 3QVGA 2NSDA 4Q9JA 1QYRA 1JSZA 4FS3A 3WKBA 1EX7A 2JFYA 1NU6A 5CB6A 4MX2A 3AVVA 5LMZA 4IVQA 3M1LA 1OC2A 5T8KA 3D7SA 3RYIB 5KMGA 4J90A 2HVGA 1CZUA 3TXAA 4QXPA 3EYWA 3W6OA 4LKRA 2WM3A 3F1KA 4MPJA 2ZXFA 3BN3A 3MINA 3PFNA 5T6BA 3FUXA 4FFMA 4WIAA 2VUTA 1QM5A 4ASUD 2XJ9A 2JBHA 4LF9B 4R1NA 4RQUA 3EG9B 2QTTA 2I4NA 3UKJA 3I3SR 1YFZA 2YNMA 2YOGA 4S2UA 1T5OA 2ODTX 4IDAA 3PSAA 7YASA 4CMEC 5JXGA 1E4EB 4M89A 1H8HA 3TO5A 1NNLA 2C3MA 4C0WA 2ZIXB 3FHTA 2CUZA 5KKAA 1U0HC 3ZWOA 2IEBA 1ICIA 4TQUS 3EHEA 2PKQO 1JA1A 4PNEA 1KEPA 3M6LA 1F2TB 4FCWA 4BO8A 1ZHOA 2ZEJA 5K05A 1GTSA 3BJRA 3EBOA 3N2LA 2L0XA 2WJZB 1JFSA 2DGDA 2OXFA 2BEVB 3P9YA 4BLPA 3Q0EA 4YY3B 4QFCA 1X3LA 2RC6A 4GKJB 4I50A 4PQRA 2AG0A 4QRDA 3U7EB 1T10A 3WGZA 4EQ6B 2LBPA 4UEQA 1YB4A 2WPDD 1N9KA 2I7DA 3C41J 4NICA 3BJIC 6LDHA 3L0SA 2V74B 3PQDA 3R7LA 3QPCA 1QTNA 4J3JA 1SK9A 1C1XB 1H9BA 1JZQA 3FKJA 5DEOA 3W8FA 1Y4ZA 4UATA 2X77A 5FUMA 3Q85A 4G5RA 2I62A 5BV8A 3OQ6A 1W5TA 3UMSA 1WF3A 1HXHA 1TD1A 1ODCA 1QGUA 2AXEA 2Z8XA 1LY1A 1RMYA 3F4RA 3KBBA 3F4BA 2H2FA 1I4TD 1X7ZB 1TVKB 2Q6LA 4H4EA 4MHSA 1J0AA 3RAPR 2R0QC 4ND8B 2W2PA 4BECA 4J0KA 3S2FA 4XLZA 2XUPA 2VZ8A 4TXMA 2ID9A 4W5JA 4BQIA 2QMHA 5KYNA 1YB2A 1YRQA 4WNAA 1ZGCA 4TSKA 5A0TA 2WLSA 1SKYB 4B76A 2WOOA 3VC1A 2J9RA 4Y2XA 1EEHA 1SC1A 2X58A 1AZSC 5J4VA 3I05A 4J6EA 5LYJB 2JCBA 1DC8A 2G08A 3D4IA 2VZ0A 1H5UA 2N75A 4J43A 4M6WA 4LSWA 4NKRA 1Z26A 4W5WA 4XVRA 4RAOA 3TCNA 3GZHA 3V4SA 2PTRA 3WLJA 2PDAA 1BO6A 2X0NA 4GWGA 3EK2A 3SZ3A 4P34A 4CIAA 1B00A 2BE7A 5JV5A 2PZEA 4MEJA 3AO0B 2IPMA 3OZUA 2IW3A 1KPHA 4OIFA 3Q7PA 5A9SA 3IDZA 1VLHA 1YJAA 2NZXA 4MAMA 3R74A 3CEHA 1BDJA 1U8TA 4CTJA 1IPHA 4JJ4A 2HIGA 1SUIA 2AA3A 3C3JA 4IIYA 1W1IA 1NMXA 3H1EA 1OBCA 1WHSB 1S1CA 5H80A 4GXQA 2OHGA 1H6AA 2Q62A 4H6WA 4MR7B 4HQ6A 1I4WA 3CG4A 4N65A 1XWWA 3S1AB 4MW0A 5HKBA 1Q0ZA 4ZODA 5FLKA 4DWOA 1Z63A 1DO0A 1D6SA 1P1KA 1X1CA 2OECA 4PZAA 1AHPA 2O1XA 3FH0A 3HNOA 4O4LA 2Q8QA 2A9QA 1TKRA 3KPYA 1JB9A 1H6CA 4GR5A 2PBFA 4DC1A 2P6NA 3LLSA 4IQ4A 1USVA 2VUIB 2OWEA 4DMMA 4V39A 2VP4A 4M76B 1BCRA 1ZK3A 3A9VA 3LBHA 2HO4A 5I9BA 4H3KB 4EF6A 2QD2A 3CKYA 3UV7A 3BBPA 4RQBA 4U9IS 2CL5A 1PZXA 1Z6TA 2J0UB 3O4HA 1J0CA 5E2IA 2W93A 3TTUA 4O3MA 2IY8A 2XB9A 1SCBA 3MBOA 2XWJI 2GD1O 4E94A 3CLRC 3IVCA 4LYAA 5TIIA 4LC0A 3BL8A 3T7SA 4K81B 4GDFA 4GI1A 4OIMA 2ONCA 2VUSA 4PYRA 4CXMA 2QTHA 1JFTA 4LRTB 3LGAA 3TIVA 1ORHA 1ULTA 2XUOA 5FOUA 3EGDB 2H5JA 4LOAA 3JQ9C 3TLYA 4J4TA 2O0HA 3ISVA 3PJGA 3IA7A 3R23A 4F9TA 1DC7A 4PO8A 2WI8A 4UULA 4TTRA 1FMFA 1IJEA 1PV2A 3UANA 1QU2A 3NV9A 1T29A 3WRWA 4PSUA 5FWAA 3WTBA 3QKIA 1EP9A 4IOKA 1AGNA 3L8FA 1DFIA 4NMHA 1NM5C 3MCAA 2VDRB 2QRMA 1GFSA 3G17A 5CB4A 5AVUA 2I91A 5J5CA 5EE0A 4I19A 5CFMA 1X94A 3MMXA 2JLXA 3QA9A 3H2HA 3ND9A 4HT3B 3C45A 2X2EA 1TFRA 1JTVA 2Y6UA 3GGPA 3AMVA 2AGVA 3H7AA 2NU8A 3RS7A 4BX8A 1J23A 3RWBA 3B6ZA 3E9MA 4FYMA 1DHTA 3OCEA 5C2JB 4YCBA 1J7KA 4Y6RA 2IEGA 4G1FA 5EMMA 1SBTA 4KVZA 3FPEA 3H4VA 4MIOA 3VMMA 4CQMB 2XWPA 3SQDA 1YDMA 4Z8XA 3DBIA 3P9ZA 4HR7A 3G0GA 5JZ9A 4IY1A 3ITEA 2AJTA 4W9NC 1N34B 4BC1A 2FMXA 4J9VA 3I30X 3SLGA 2GZAA 1WTAA 4O08A 1ZUNA 5ARCA 1OAOA 3O8LA 1GKKA 4F84A 5FX2A 2H1FA 3ZDDA 1C7QA 1IY1A 1S8OA 5LA6F 4RHXA 4DJDC 4EYQA 2WTUA 1CR2A 1OYVA 1NVMB 4FYVA 4C6TB 2JLAA 4WKPA 1Q0HA 1T4CB 2N42A 3IPLA 3KELA 1QCZA 5IKMA 4EENA 3BM5A 3I2KA 1N6NA 5IUNC 3C6YA 5ALFA 1DBPA 1CY0A 4JLBA 5FBWB 1WMEA 1YJBA 4TL8A 3LQQA 4G25A 2QZJA 2VP2A 2HT1A 1XX6A 2C29D 3BWYA 4K0KB 1DCFA 1CUAA 2XVYA 1XB2A 3ZDQA 1GNQA 2C7PA 3HB5X 2QX9A 1CLEA 1EU1A 1MU0A 2C5LA 4FMCB 4OMDA 1DT3A 1VRCA 3ONDA 3QG5A 4O02B 4OGWA 4QD3A 2WWXA 2C5SA 4KMMA 1XPJA 5EKSA 2PXAA 2I2XB 4ZVTA 4XDZA 1XKLA 1V1JA 3GG9A 3NWPA 4L8WB 4F9GA 2C00A 3CS3A 1TAGA 5GONB 1E0AA 3O74A 4V0OA 4V0RA 1R9JA 1YS4A 3X1KA 2A8YA 2E1PA 4JENA 1R0YA 5G4KB 4H0NA 3HUUA 3D8RA 2FJUA 2HBYA 3VR4A 3WWYA 1RQRA 3JQDA 1UBGA 1IBRA 2I66A 3NJRA 1NNSA 3H8SA 5DHQA 3MWYW 1FFCA 5JI3E 3KQLA 3IBYA 1EFPA 5E3IA 3O94A 4FFSA 1KETA 1EM6A 3UO8B 4RPHA 4C87A 4OD0A 3OIUA 3LNCA 5JH7B 4C5CA 1UPAA 1QHXA 2GCNA 5DNDA 1WABA 1HY3A 1MP0A 2PQMA 3VZBA 5K3OA 4U2GA 3KB6A 6REQB 2F1JA 1PN3A 4W4TA 2MSKA 4NU6A 3H3XA 3I4LA 3BWMA 3I9FA 3OPVA 3ABIA 2W4MA 1XWFA 2QPAA 3IPRA 4JL8A 2QQEA 5AM4A 4B71A 2AN1A 1ZMRA 4RA9A 2JAUA 4Y6QA 4XGNA 4YJDA 4PAOA 4UVIA 2I6SA 2LPMA 4BNHA 2X2OA 1HLPA 1E9EA 1BS9A 3AM1A 1ULHA 4O59O 2WBLC 3KZKA 4RC9A 2E5WA 2C03A 3NS7A 2EFCB 1NSTA 2FEPA 2P3LA 4LZNA 2AT1A 1F51E 1Y1TA 2WJVA 1XZ8A 2NU7A 1PYDA 1XXHB 2JBAB 2OV1A 3DWGA 3CPHA 4JJAA 3C3XA 1O6BA 4PYLA 5FBRB 2O7NA 4J0IA 4EBBA 1A7AA 1TGVA 1P44A 2VNHA 2XUHA 5AVTA 1ZIDA 4XYMA 4BV3A 4YLEA 1TZBA 3CH5A 4GXTA 4AO8A 3S2GA 3S8EA 2GXQA 1WPRA 2C92A 4K8RB 5IASA 3TGPA 4LOLA 3T7JA 1W48A 2CEKA 2YWEA 4FE3A 2QP9X 1U5AA 2HNKA 5IT4A 5BR8B 3STHA 3IIIA 5DM0A 3ZE6A 1LLDA 3O1HB 3DTTA 5DN9A 3DFMA 1BN6A 4J4BA 4DNQA 1WV0A 2ZSHA 2VH5R 2VF8A 3COWA 1EPUA 1YK0A 1H4SA 1GFIA 1A3CA 3B8EA 3I58A 1QC5B 1ZEMA 1RM5A 1Y1SA 3QWIA 2FRDC 4AP9A 4ZTZB 3C16C 3NVDA 1HBJA 4GICA 5ICCA 2X14A 3KEFA 4HLCA 4EHIA 1N2EA 1Q7RA 5CDGA 2O50A 4X1KB 2FOIA 1R50A 3E48A 2H5IA 4HZUB 4PAWA 4YRCA 4FGSA 4WZ6A 2RK3A 3A8TA 2J6BA 4J4HA 1PQWA 2Q1SA 2VF4X 4YMHA 1Y6FA 3B9QA 1K89A 4A27A 5GJCA 3DGFC 2W2MA 1X8KA 4LE0A 5DYWA 4JL6A 4YGYA 2OV6A 4GZLA 2NP7A 2BPOA 4Z49A 1FVHA 1IY8A 4PZYA 1DRKA 1Q6YA 2R8ZA 3WRVA 2D06A 4QDTA 1WNTA 3NWBA 4GGOA 1E66A 4KR9A 4Q1DA 2A0UA 2J4CA 3EXG2 3BKXA 3KTDA 2D5LA 4I3HA 3V1KA 3LGSA 3BC1A 2F3SA 1XHFA 1U8EA 1VQ1A 2WWGA 1OW3B 2RH9B 2YV1A 3KSRA 3L8MA 3S8YA 3B6EA 4KQKA 2P69A 2XRYA 5HGXA 3KLPX 2IBSA 3DCNA 5TMEA 3U9SA 2GK4A 3IP6A 3IR6A 1SELA 1RJGA 2FWJA 2QTRA 4MRRA 5A4IS 3DHWC 5JDCC 3CVOA 2CFIA 3I76A 3WB2A 4NXNB 1V6SA 2BEWA 3O5AA 3HYCA 3PGKA 2CUNA 1ZGBA 2YJZA 3GRRA 1KHTA 4IMPA 5G02A 4RK4A 2NU6A 1G55A 2WP8J 1OXSC 4JDUA 3UN1A 3BMNB 4DEXA 4DSOA 1Z5OA 4YP7A 4LJYA 5BWBA 1MJGA 3RCBA 1BHQ1 2ASEA 5A4FS 3EBLA 3Q3GE 1P5FA 5I7FA 1ZH2A 3OZTA 1N7JA 4QOSA 3IE2A 3URKA 3UV3A 2V9ZA 2W11A 2BEWB 3IV7A 1Z56C 3E0XA 2ZDHA 4AMGA 3TW6A 3H1TA 2R7NA 1GKIA 3E53A 3N8GA 1CHDA 3OEHD 1PJLA 2IYYA 4HUQB 5FWYB 1NFFA 1WBDA 1P31A 3GA7A 2BZSA 3LI2A 4ALIA 3GP8A 1PFVA 1A1VA 2Q2VA 4I66A 1TDJA 1NW6A 4AL4A 4ZGWA 5LDDC 3AM4A 3Q0TA 2J7PD 3C3AA 4MYUA 1XJWA 1J4AA 5JQGF 1GU0A 4G4SP 3RIYA 5LIRA 3ML1A 5BRNA 1CUBA 4MUEA 1EDEA 3KLMX 3DB1A 3VQTA 3ZH2A 4MULA 3X3HA 5C51B 2OM2A 2HYIC 3DZCA 1S8FA 2YUTA 4KG7A 4HUTA 2WYWA 4UOQA 1JSWA 3EC7A 2JI9A 1OHHA 3OTOB 2GEKA 2ZTSA 2FOXA 4RK5A 2C54A 2O8DA 4UDNA 2QW0X 1CUHA 1ZKDA 2BKEA 4I2NA 3OIFA 4P0TA 1JIIA 4OBWA 4C4ZA 1HOTA 3FWKA 3MD0A 4IDGA 5AHRA 1M8JA 2XHZA 2B37A 3MJDA 3PVCA 5E1DA 5JMPA 5BV2P 1AMUA 4LI0A 2PVSA 5SICE 5SZIA 3VISA 4X65B 3IXMA 4P58A 5JJBA 3K0BA 3JS5A 2O4CA 4Z99A 2IS4A 1X7YB 4OK3A 4LDQA 4NJMB 1T3HA 3DOCA 5HJ2A 1NJ6A 1JIUA 2IKQA 4J2OA 3F6BX 4PG5A 5IJ9A 3I2YX 4AF6A 1AGPA 3DUWA 3QIVA 5H8WA 4MQMA 3SU8A 1JFFA 2JKZA 3ZX4A 2WICA 3O3NB 3PT9A 2C4TA 4B3MB 3OD1A 5EE9A 1E3TA 1GEEA 2ECQA 3WK5A 4GAEA 3T06B 2RH4A 1OASA 4RPLA 1XZIA 2ZJ2A 3U0BA 2WSSD 3QLJA 4ED9A 4EUFA 4UBNA 5ARBA 5IFKA 1GADO 5L9AA 2GS9A 4KUHA 2FMUA 4X64B 4A0SA 4E5PA 1Y1LA 4GOMD 3RUPA 3GLKA 4QX6A 1DXOA 1QHSA 1QKJA 2Q7XA 5DO9A 2PH5A 4TT3D 5TEVA 3GJSA 4JJ6A 3EF1A 1Z33A 2GPNA 2PLNA 3EQ6A 4EHFA 1G21A 5I01A 3BRCA 1UMBB 4OQMA 2IYLD 1RI4A 3T0GA 4DCTA 2XVAA 2EBHX 4ZKEA 1X1EA 3C8TA 2JEOA 2QEQA 4O5OA 5U4XA 1A8HA 2JGKA 1YRLA 4B7UA 4LHEA 3LDFA 1TZKA 2BFPA 5DNYB 2MOKA 1SXJB 3QGMA 1JR3D 3CUYA 1M83A 1ISJA 3K0KA 1NVGA 3QK7A 1WHSA 4TTTS 3DHNA 2CN1A 2ZI5A 5IM5A 2IDMA 2CXRA 1JEJA 4NZYA 1KEWA 3HXKA 3E9YA 3PCXA 1E1LA 1QHNA 1AM4D 2B20A 2B92A 4WOKA 4Y67A 4AB1A 2EERA 3CG0A 4OYYA 3ZWKA 4AZWA 2ZTHA 4FE4A 1HZJA 5M29A 3ELDA 3DLAA 1JLHA 3I0NA 1VA4A 2VCHA 3C3WA 1XDWA 3NIGB 2IU0A 2J31A 3VNBA 3T9AA 2YV3A 4W5OA 3ERCA 5BQ3A 3U49A 1CQZA 2ID8A 2GCPA 4Q3EA 4YMIA 2AOXA 2VAXA 4RL6A 1OJLA 2P35A 4NCXA 1Z0DA 5JMOA 1QZZA 1YQGA 3ENQA 2HPZA 3ZIAA 3K70C 3GK3A 2OYSA 4MUYA 2P6PA 4B6GA 4ZVRA 1U1GA 1ZNXA 4W1SA 4WCFB 4AXXA 2P0AA 4IDBA 3HUEA 3FUCA 4G0VA 2AJBA 4J0JA 3L41A 1NKSA 2PRKA 3B1JA 1QGUB 5DDIP 1NKTA 1PJCA 1G42A 5EZYA 1CY6A 5A6SB 4MIYA 1HE8B 5EIEA 3FLEA 2H1IA 4RTQA 5AW3A 3ECAA 3ME5A 3IAFA 2WQZA 2XXAB 1O58A 1O94A 1PR3A 4IILA 5EY5B 2DKFA 3JZMA 4I1YA 3TKAA 1WVIA 7AT1A 4I4LA 2NXJA 4GFDA 1COWD 4RTOA 2RAVA 1XQXA 4YCLA 4KLNA 4S1NA 2WSSA 3BWVA 5A0FA 1V7PC 3OCUA 5LQNA 3U09A 1L9XA 3K2QA 4R9SA 2JGJA 4CWAA 1YDWA 2HLPA 2X19A 4QFBA 2WPNA 2BR4A 4R7GA 4ME6A 4POOA 3PX7A 1XF1A 5C3MA 3JRXA 3TJRA 1QH9A 3DEIA 1HQCA 1ENPA 1JPVA 2UVQA 2XVXA 3F3MA 3JY6A 1JEYB 5H02A 5K2OA 4BKPA 1E61A 1FUEA 1Z5VA 4KI0A 3TW0A 2PGDA 4CRWB 2VK8A 4ZI2A 2R6JA 3OJWA 1GVNB 1U7PA 1UEJA 1J21A 1NX9A 2GK7A 1BX0A 4CBVA 3QBJA 2H08A 3AJDA 1PL7A 1JKIA 3H2IA 4AMBA 3A37A 2H00A 4ZI7A 2NLOA 4E2ZA 2EGUA 1ATIA 2H9YA 4DTIA 4PZ9A 4LQDA 4DNOA 2ZZMA 1NP6A 2GBLA 5LP1A 5ESXA 5IP5A 1AKTA 1K5HA 2GBLC 3IC5A 1UFRA 4L5JA 3CTMA 4B6RA 1XYVA 2PCLA 2WWTA 1ECLA 3D3EA 2M6SA 2NVUB 3T1YB 3C87A 3M6WA 1JDUA 4U1RA 3I6IA 3M4JA 1ZCAA 4FGLA 3JYNA 2ZAMA 3E3NA 1JG4A 1EJ6A 2QL7A 3QYAA 3T61A 1SUPA 2EWVA 1B14A 3ICPA 4GP9A 2YOFA 3WLPA 2AX4A 4TMXA 2YVAA 2Y2UA 4N40A 3OQBA 3ROMA 2VA9A 1XK6A 3ZWDA 3IESA 3WK8A 2LDBA 1TLFA 2DFKB 1EG2A 1H0RA 1UPFA 2FW9A 1BH6A 2R11A 3ZTWA 4DMRA 2Q9BA 3MOGA 2CJXA 1NVAA 5DT2A 1ZAKA 4TKVB 3MAAC 4ZP1A 1RAGA 1BW9A 1ISHA 2HJHA 3H2YA 2I0FA 3OU2A 2OFWA 4JXKA 2CLEB 3RLFA 5D01A 2JIZA 2ZVQX 2BI7A 4I8DA 4RO0A 1LBHA 3O95A 3ROTA 1T15A 1YQ9A 2LE0A 4RL4A 1JAZA 1Y0BA 3NASA 3DLPX 4O4IB 1GCOA 2XNCA 3D3QA 3SOPA 2ZRMA 4R1SA 2ZJZA 4L8VA 5KNBH 4EAAA 1DZIA 1SU7A 3O3CA 4JI3B 2PX6A 1YGYA 2P5UA 3GP3A 2HZ7A 3SF8A 4BMSA 3PJEA 2HFJA 2ZYTX 4O8CA 4X84A 4EI2A 3KQTA 4BX3A 2EDCA 3M1AA 1XCJA 3L4BC 2CB0A 3OMLA 4UCXA 3PG5A 3QFCA 4MINA 1W5EA 1MVOA 2ZAYA 4FB5A 1FPMA 4TLEA 1UDWA 1U11A 1N6OA 2ZM5A 1C0PA 1CZHA 2FWAA 4US1R 4B79A 1WTCA 2YY6A 2Y66A 4HDNA 1I4DD 2PXXA 1G7SA 3W2TA 2B3TA 2EW1A 1BD3A 3B78A 4GRAA 5HE8A 1LS1A 4YJGB 4JP8A 4BNXA 3M5CA 1KZGB 1I4OA 1ZVMA 3VZCA 1DDGA 3F5FA 4QPJC 3FNGA 5CXSA 2GF2A 4BEWA 6GPBA 3PJRA 4LOHA 3R3UA 2GVNA 5JSYA 1YD7A 1O08A 4HH1A 1QQBA 1VJTA 4OI4A 3WL6A 1YOVA 2MT9A 2BTEA 2OO7A 2K2QB 2GXSA 5HRAA 2A9PA 3TPFA 4D02A 1JEOA 2H2AA 5JIBA 4HTFB 1OKKA 1CQWA 3AKEA 2QE7A 1CIJA 3VH4A 1RYMA 3VBCA 1GV0A 4D8YA 3QJGA 3D9QX 4Z9BA 4V1CI 3JD3A 3OE7D 4DRYA 4Y2VA 1WULS 4WNAB 1L5QA 5ITSA 3SE0A 2BW0A 1Z4MA 1E1YA 4TV8B 1FRQA 4MWTA 1AA6A 5J23A 4L8GA 4NYJQ 4X1IB 4YPVA 1NLZA 4RVHA 3JQBC 4EABA 1XAGA 1KZHA 3VPDA 3M4ZA 4RWZA 1DADA 3NDJA 2E5FA 2AJCA 4QOHA 4ETWA 3B52X 4BLRA 4QYIA 4MLDA 2V6FA 1AT1A 3GC6A 2RHHA 2B8WA 1U8FO 3NTQA 4IHJB 4RY8A 1N1GA 5HK9A 4DABA 2LIPA 2BELA 2OCGA 4MMZB 5LP6C 3FCEA 2H06A 2X9QA 2O3JA 1XYYA 3DL2A 3FBGA 4RXUA 3UCXA 4ZYVA 1ISFA 4MYSA 1A9ZA 4QYMA 4RKQA 5I47A 4BXOA 1DDOA 1KY3A 2V98A 3QWFA 3DEZA 3ENNA 4DA6A 1RXIA 2JI8A 2ZSIA 3HL4A 5JXIA 1BRMA 3I8XA 4WEQA 1U2TA 4O4IA 1BXGB 4S12A 3WLAA 1U3TA 1GAQA 1TJ3A 3O21A 4FDUA 4S3MA 4N0MA 3WL4A 1TCAA 1ZJ4A 5H59A 1ZN2A 1UQTA 1O96B 3KZCA 1TQ4A 3MW8A 5LD2B 2XKBA 3AFOA 4NV0A 1B16A 2JCXA 4Y2TA 3HJCA 2CSXA 2CZGA 1G5HA 1CDZA 2ZWMA 3CLHA 3R3VA 5AI8A 5TR9A 4EECA 2R1VA 1BVYF 2HQOA 2NW6A 3ENKA 3RJZA 3TEJA 1G0NA 2GBFA 2GHQA 3MOIA 4O4HA 4CF5A 3KQNA 3EXG1 1OJ7A 3A6DA 1UFQA 4NOMA 5REQA 1FNBA 4N3AA 4FDTA 1GZ7A 3FRHA 3H0CA 4PZDA 3HO1A 2HSGA 1S9HA 4OQQA 3I0MA 3MS2A 3RC2A 3TZHA 5TY0A 1KSHA 1TMKA 1AQJA 1U9IA 2O8DB 4GOND 3AJ8A 2UXCB 2O3TA 2A9KA 2X1MA 1UBRS 5DTJA 1QPZA 4QXRA 3I9KA 4RKFA 3PXAA 4GM0A 4P98A 5ALSA 2OSBA 2LD4A 5HDQA 3WNQA 4RCYA 1ZD9A 4DV6B 1AK1A 2IL1A 3LDUA 4LV5B 4JQOA 3WZMA 3LPNA 1DTWB 3ZY5A 2GPTA 2WJPA 2Y1CA 4YV2A 1OIWA 1P0IA 2DPLA 4OAPA 4Z5XA 2GXUA 4E21A 5D3MB 4RULA 2GPJA 3THRA 4LEIA 3PGJA 2DJ5A 2D28C 1R0SA 2VHZA 4HYQA 2E89A 4U6SA 4DLLA 4EBFA 1DX9A 1RW4A 2GYYA 4PTLA 1GV1A 4HD8A 4KUEA 1IUOA 4L9RA 3RAFC 4UOZA 1FDUA 1SC6A 2IXBA 4P81A 2WHEA 4XIFA 4BP9A 4XGRA 3BMCA 2IHKA 4ARBA 2QD3A 4ZT4A 2P0YA 3G79A 4OHVA 2B5VA 3BIJA 5TT0A 2BTQB 4PYOA 3ABRB 4M7OA 4EG3A 2GJAA 2QY9A 4G0NA 4FYKA 4DQXA 4TWJA 4KQ1A 3JPWA 1ZD8A 3E22B 1TIBA 4FGWA 3CUTA 1IPEA 3D1JA 1QP7A 4G5FA 2FV8A 5EKUA 1RIFA 1VSTA 1FFBA 3BJEA 5L45A 2RD2A 2PA0A 4RF2A 1E6CA 2JGDB 2QRKA 1E89A 3B1YA 3I9V1 1ISIA 4HFJA 4Q4HB 1EVJA 4FX2A 5DGXA 2IV7A 4TL9A 3DKVA 1UDAA 4XX1A 1C41A 5B37A 4G9GA 4ERNA 4UOEA 4XRGA 4NK4A 4UAGA 3NHFA 3BCHA 2XUZA 1GKUB 3V7NA 1FX1A 4BV8A 1FP2A 2OZLB 5EZYF 4WXPA 4B82A 1IK6A 1ZXXA 3SQNA 1KO7A 5LCXA 4V2UA 4EFLA 3TG2A 3OUTA 3V1MA 3PDIB 1ZJ5A 4ZMRA 5AM0A 1YAHA 3D7RA 1W0JA 1MABB 2W6CX 4XR9A 4QJ4A 2RB4A 4UBKA 5D84A 1JKJB 1P91A 4IOMA 4QBHA 5I9IA 1T2VA 2Y1XA 1V11A 3K5WA 1KJZA 3GEGA 3IVRA 5G0UA 3AHCA 4BWFB 4BOYA 2D1RA 4NY1A 3JQ9A 1LSOA 4X1KA 2Z30A 4HDCA 4YP0A 4Z9XA 3PUHA 4HNUA 1SHLA 2NV0A 3EC2A 1ZA1A 2NOAA 3GVPA 1GPJA 4F2HA 5JVDF 1RM3A 3IBCA 4WNYA 1H2AS 3ZUPA 2CFCA 1E5DA 1CVRA 2CD7A 1PNOA 3RJ9A 4XM2A 3RNLA 3W4JA 1DQSA 2BUCA 3LE8A 4ODIA 4CFSA 3N2KA 3UMYA 1N0IA 2CHGA 4E0BA 1MBZA 1DL5A 2CVQA 3TIFA 2O1SA 2ZSUA 1D2NA 1Z2DA 1VE3A 2ZRCA 4ZOLB 5ARDA 2Y0PA 5C37A 1J9GA 5FUVA 4FHCA 3U6KA 2ZU0C 1I3LA 4JIMA 1H2EA 4HX5A 1RBQA 1R27A 2Y9MB 3CPSA 1UC9A 3VR2A 2DAPA 3PPWA 1C81A 3IKTA 1M5RA 3U4GA 3PC3A 5EI5A 4ESEA 1X1DA 4NG5A 1UPBA 3VV3A 4ZC8A 2XECA 5KX5F 3WYNA 2X5KO 3ESXA 1UBLS 4U7PB 4B3IA 1NNI1 4FB4A 1WXXA 4BO7A 4ADMA 2VXOA 1UMBA 1TUBB 1YR1A 2H4YA 1DEXA 2J45A 3MMZA 3LOQA 1G59A 1PG5A 2I8LA 1XKTA 3PXCX 5GZ6A 1A4UA 2PKCA 5E9AA 1ZL0A 3FNQA 3SBOA 1BXKA 1R00A 3WWPA 2W2QA 3KHUA 1N0UA 2OP1A 2O2ZA 1XE3A 3GNSA 1C50A 2HK7A 4RA9B 3JQAB 4G01B 4UM8B 4ZAWA 4AI6A 1L8XA 1WMFA 1K7SN 3A3KA 4MJLA 3LK6A 4JJ7A 4QA9A 3LP8A 5AH0A 2GN8A 1JJFA 3MWEB 4N76A 2PKRA 3MIZA 1FQKA 2MWMA 3LXUX 1IJBA 1LV7A 1UFKA 1W93A 1CY2A 4HL6A 5JECA 1R18A 2P3QA 2VQDA 3L02A 4WDRA 2Q9AA 4N5NA 4MP6A 2G1PA 1ZW6A 4RK1A 5LIPA 1WU7A 4H1VA 4XGKA 3JYLA 5BQ5A 3W5DA 5KYYA 2FCRA 2IYSA 1E6EA 3FUUA 4BY9E 3F4SA 2AG6A 4NAUA 4CEIA 4GZ6A 4XVQA 3OFSA 3ZEAA 1ABEA 1YI1A 3W79A 1YI8A 3HU5A 1J2JA 4XAQA 1CK4A 1MHPA 2H8KA 2NG1A 5SZKB 2QD1A 3TVTA 2G0AA 4N0EA 4TLDA 1EK6A 1AX9A 4E5NA 4EMUA 2RGGA 3IEUA 4MAFA 4OQDA 2IJGX 4C7MA 2XUAA 2PX4A 1PQYA 3WDLA 5DW3A 3QUCA 4R01A 1PW5A 1QFMA 1QKKA 1PUJA 2P11A 4KTVE 3G7NA 4TN1A 4X71A 1FPQA 4XLTA 5LOVF 2PD4A 3NVMB 4LHSA 5IX8A 1Z2PX 4BNZA 1S0UA 1XEFA 1YZUA 1CF2O 5DEIA 2FUNB 5BY2A 2R6HA 3THSA 3DOFA 1YZVA 2QXYA 3EA0A 2IYAA 1FUQA 3O8BA 2FWNA 1W4AA 4KV9A 4PC1A 3MCZA 1QXSA 2AW5A 2FW6A 3OWOA 5CT6A 1C14A 4U7TB 5FA6A 3OIYA 4G8JA 2Q6IA 1UQRA 2QRGA 4QOGA 4RKWA 3V7WA 1NXSA 1T4CA 1QLJA 2WVAA 3R9XA 2NMVA 2Z5LA 3P0RA 4BAZA 3PHGA 4BAUA 1KK1A 2CDNA 1NE7A 4U00A 5T67A 3VU3A 3WGGA 521PA 1NRWA 2WF7A 4O25A 1T8RA 1G21E 4YP6A 1DKMA 3TLXA 3D6MA 2REBA 2IUYA 2OE2A 2PU5A 4X94A 3RU9A 3SBDA 5IZCC 4BMCA 3R8CA 2OLEA 1ZEJA 2Z3WA 4ZO7A 4QBTA 2DECA 4KKVA 1NHGA 2OESA 1GDHA 1S2LA 3PXUA 5E7QA 4QQRA 1SKMA 1GDTA 5LNK1 4CHGA 3JRNA 1I3KA 2NACA 3L7OA 2J9FB 3G8BA 3QVXA 4QUJA 5FIUA 2VWGA 2C61A 4MNTA 2WJGA 3QVSA 2WHRA 1UDBA 4JOSA 3SR0A 4HO1X 3VSBA 2VJPA 3GRUA 4FNMA 4FM9A 3KQMA 3AV0B 3UJHA 5IDVA 2EZTA 4WFJA 3S99A 4AYTA 3K92A 1KI8A 2YJ4A 4D0RA 3S29A 2QPLA 1ZD2P 2H9AA 4QREA 2QW8A 1QGYA 1Y6ZA 3HFJA 3FVVA 2ZETA 4IUYA 4I1UA 4RIHA 1NUQA 4URFA 4YRSA 1Q44A 2KBEA 2R4TA 1CIPA 1CLUA 1KMMA 4NBTA 4BYMA 5JISA 2WT8A 1GA4A 1BGWA 3SQMA 1YS7A 2L2QA 2PIAA 2D7DA 2FPUA 3ELYA 2YH2A 2ID4A 4BV2A 1MOZA 3T94A 4PC7A 3HCWA 3ZUGA 1M0SA 2GRUA 2I71A 3IDSA 4EHLA 3C5HA 1ZJ6A 3SEQA 1I3NA 3OCFA 3ZWXA 4JXJA 4DB2A 3I1YA 1LBQA 1QR6A 1OF1A 3IMEA 4QEDA 4D44A 2FW0A 3U4AA 1NLFA 1EBBA 4RKRA 2W90A 4PYIA 1JMVA 1R9NA 3KC2A 4WA7A 1ZCBA 3ZE1B 5ICEA 3U7GA 2R85A 3HCPA 1ORWA 3R7NA 4P5EA 3QBPA 4WXYB 1HETA 4GIBA 3AC0A 4OU5A 4X6LA 4KSCA 3V8MA 3FMOB 3FI9A 3QQPA 2GHTA 4IO0A 4PC3A 1W44A 2IK8A 2JGDA 3PC8C 3REGA 1JDBB 4CQMD 1C1XA 3R76A 2YQ5A 1R5NA 2G17A 2FA9A 3QX8A 4QYTA 5FOSA 3VSCA 4CEJA 3FTPA 3UCEA 2OHXA 4AN0A 3NEYA 1FMCA 1WCV1 1YKGA 4MROA 4OQPA 4W5QA 3IA2A 4YRDA 4DPKA 3TOVA 1XFAA 3ZDZB 2BP7B 4OH1A 3BULA 4E32A 5DM4A 4HEA6 3E7FA 3K0FB 2AWOA 3NB0A 3NQ41 4MR7A 3S1AA 3SC4A 1J8MF 3H19A 4OFBA 4V0ME 2DUMA 1QQ7A 3WGQA 1NVWQ 2QL9A 1L4BA 1N3IA 3H5TA 3JQQA 3OAAA 2ZRHA 1PT9A 1KQFA 1ZM9A 4BTEA 3AHGA 4C0HA 3HDGA 3OZBA 5CD9A 3P19A 4HG2A 1MIHA 1DEKA 1YQEA 2GLUA 2QG4A 3VO2A 3D43A 3EVCA 3P4UA 2OKGA 3S2YA 4HGQA 4LKOA 3TD6A 5BNTA 3T3PB 3STWA 1CUEA 3LF2A 4TTVA 1PF7E 2FG6C 1AHIA 1AVTA 2BZGA 3EQZA 2HJSA 5K2MA 1IZ0A 5HR5A 1X6VA 2JFXA 2HTEA 2IHYA 2QAGA 4KE8A 4WVFA 3MUOA 3OTHA 3K2IA 5AOBA 4YACA 2PG3A 4ARUA 1Y8AA 5FXMA 5KQSA 2I6TA 4LQLA 2HJ9A 1Y6RA 3JSAA 1K66A 1O87A 4FBGA 4COKA 1KJ8A 4UBIA 3H13A 3ZV7A 1JMYA 2GZDA 4IFBA 1YC5A 1JSCA 3M82A 2C4KA 2H92A 2Y0CA 2G9NA 2XDQB 2R1VB 3DMTC 4L0CA 2JCYA 4MQFA 1FZQA 1LX6A 3PX2A 4LBYA 1T4DA 4PRLA 3KFXA 4JCOA 4BDSA 5LQJA 1EXDA 1B0PA 2QYSA 2ZRGA 4KAAA 2RARA 4BNMA 3ZQ6A 4ZCRA 4D25A 2MTBA 3LUBA 1NN5A 1IB6A 1UPCA 1CUWA 4DRXA 2EJWA 2E85A 3I9LA 1MW8X 4U5XA 1K3UB 5PGMA 3EXAA 1XDGA 3IODA 3QLUC 4E1BA 1JQEA 4TRNA 3VGPA 3DOUA 2CC2A 1ODKA 5JJKA 3CF4G 4XTRA 3LRTA 4I4NA 2DSNA 4RU1A 1MQ8B 4G0XA 2DMRA 1O6CA 1YL7A 2BFCB 3KZ1E 1CF9A 2HU8A 4KSBA 2NTJA 3VSDA 4R83A 3ZXSA 3GPCA 1DU4A 2DWQA 4LYEA 2HU2A 2ZE8A 2CNDA 3G02A 1A9XB 3K16A 3EVDA 1HE5A 4G4IA 4GX0A 5TVKA 5JSQA 1R5JA 5F33A 3E35A 2XITA 3HKBA 2AYXA 1JR3A 2MINA 3Q9LA 4KEAA 3GTDA 4GI2A 2CMDA 4L5CA 1SA0B 3EXFA 1G98A 3NNNA 3I2IA 2H3EA 1WY7A 3KIPA 1NUSA 4FHFA 2UDPA 4FFBB 2RGRA 3KR9A 1IQUA 2UAGA 2VSNA 3HBLA 4UEWA 2DPHA 3SKVA 3ETLA 5JZVA 1NPYA 1QQAA 2JPDA 1L7AA 5HKOA 4DDUA 4YVFA 4OGGA 5DKFA 4ES6A 1LPNA 1VHLA 1W8DA 2XY4A 4JP3A 2QAJA 4TT3A 5J43A 1Z82A 2D2FA 3MIIA 3Q2IA 3SQWA 4EG5A 5ITZA 3L7DA 3M7IA 4K9OA 2PLAA 1RP1A 4NFLA 1ULSA 1TFUA 2ZR7A 2M6KA 3C5EA 3T7AA 1QCCA 5TVGA 4ZT6A 4C7OA 4PAGA 1EKXA 1PX0A 3N0VA 3Q5GA 4X45A 3P9QA 5MGBA 5DK4A 2YXNA 4GVPA 1X86B 2P7IA 3JWIA 3T1OA 1N2XA 3NGMA 5LZ9A 2LP4Y 1PCXA 2OORC 2PKXA 4QPZA 2J3DA 1C9YA 1UOPA 2HMUA 2R6R1 4MW1A 1GZ3A 3RRYA 5KOYA 1OUMA 3FWNA 3DDHA 1FZTA 1FFEA 5A3RA 3HQ4O 1Z88A 1PD1A 2Q28A 1R5OA 3CONA 2VHWA 2YYAA 1YNSA 4YJGA 4DBLE 2H29A 1UDRA 2BM8A 1G8YA 3I42A 2GCEA 4C4TA 2LDXA 4D4HA 1L4EA 2Q21A 4MKGA 1C7JA 5F5NA 1FJ2A 3DO5A 3EXHB 1C3VA 3OU7A 3OTIA 5DE3A 2D27A 4F5ZA 2KMLA 3BZWA 3BL5A 1ZNYA 1YS9A 4DADA 2R7MA 5K45A 4FXOA 1W73A 3ODGA 2AFIB 2EBWA 3UBMA 3C74A 1DJMA 3WP1B 4IIJF 2DF8A 3G5AA 4P84A 3T3IA 5GZ3A 2WNHA 2PAAA 2I4MA 1LVHA 3SOZA 3GJXC 4EHKA 2A88A 4BRZA 2WF6A 2WSBA 5CEFA 2HJVA 1SH7A 2O07A 2ECPA 3VJLA 4MRMB 4QPNA 1M34E 5DULA 1VM6A 3FFBA 4CV2A 4DJAA 1N1DA 2EVWX 5DMHA 1TYEB 1E2FA 2B2NA 4A3SA 4BWYA 5LQDA 1LLCA 2QPTA 3IGFA 4WJKB 1GCIA 1IG0A 3KJGA 3EF3A 5BSRA 1XK7A 2PGJA 3UXHA 4BWVA 5HRCA 4I1IA 3RVSA 3T34A 4AJOA 3TLCA 1RRFA 2JG3A 3HKCB 5EKTA 3RIXA 1VA5A 1Z7WA 2QM0A 2X9LA 2UZAA 3KBOA 1G9TA 4FLEA 2IT1A 3D6VA 1XU9A 4IIDA 5F1PA 3NHRA 3UJBA 4TKVA 1T1GA 4KIUA 1GYQA 4EHHA 3SN6A 3LU1A 3WFJA 1T6XA 2AQ8A 3HDHA 3L07A 3FJOA 5ADVA 5ANRB 4K6FA 1JP7A 1LJLA 3CCBA 4I55A 1W1UA 4RVCA 1EXVA 2PUAA 3T6KA 1CBUA 3FY4A 3O1LA 3WX0A 5I8WA 1P3DA 3DBOB 1W30A 4DLPA 4LAFA 4B2PA 1UPXA 2UYCA 4OXNA 2BEUB 1WS6A 5BV1A 4KAXA 4PCLA 4QSMA 2ENUA 2A0WA 5HM8A 1RXSA 2VPPA 5BMVA 1M1UA 3GIDA 1KO8A 1JILA 4UUOA 3R40A 4V03A 2QUAA 5EIBD 1F20A 2RFLA 2ZI3A 3SSAA 4ALLA 2JASA 2W2XA 3ZV4A 4LWPA 5LYJA 4BO9A 2WTAA 4PYMA 3N8KA 4YIKA 4MGIR 5I7RA 1MQSA 3WO0A 4MSUA 3ESQA 3KQPA 2IUTA 1PTJA 3LYHA 4GPIB 3WNVA 1FDTA 4XR4A 3F1LA 4TN5A 2VRWA 4CDRA 5JSZB 1VPTA 3QPBA 1KOFA 2H3HA 4NZOA 3GN2A 1D1QA 3FOFC 3IQIX 5DYGA 2OOKA 1M2EA 5EZSA 2GXAA 4A15A 1J5XA 2FSVC 5ILGA 3C6BA 3KG2A 1ZW1A 2DR3A 4P3PA 3EPJA 3MB8A 1C0KA 5AW4A 3P2MA 5FORA 5JZMA 1WXQA 3DV9A 3N87A 2CYCA 2QUIA 5HIAA 1ZESA 4ENQA 3RS4A 4YJ2B 4OFXA 5I9SA 2DETA 2QTWB 2GO7A 1Q7GA 3AIMA 1JQ3A 1UBSB 4OKIA 1LEHA 2VJNA 3NGLA 4TWBA 2BUAA 2IYPA 2QSYA 5C8YA 2OYRA 2UUCB 2EQ5A 2OCYC 2F43A 4C4YA 1E1CB 3UWKA 4R2WA 2C3OA 2GNOA 3PF8A 2J59A 3EC1A 1SKUA 2H2DA 2Q27A 3IO5A 3TSZA 4WCFA 3VX4A 2J9XB 2ZT5A 4B44A 4BMDA 2R8EA 4OAOA 5F3RA 4LJRA 2GAFA 3IR5A 5TQ2B 3FPCA 2ERYA 1TM4E 2REOA 2WRZA 3I6QA 5G41A 2K4MA 3D5TA 4XB6B 1Q0UA 2EGHA 4DYHA 1IW7D 2VZ9A 3T8YA 4EQ6A 4IO1A 1II0A 4HXFB 1XQ9A 3PC7A 2CY0A 3AXSA 3PP8A 3KRTA 3T9BA 2ZJAA 2H2GA 2VDJA 3FX2A 3U31A 4ER5A 5CXXA 5BXYA 3IUQA 1F2UA 2ECKA 4L7VA 2BHLA 2FKAA 4FOSA 3AHIA 2RK6A 3JALA 4OU4A 3AVUA 3LFHA 3F3YA 5CFRA 3HN6A 2RGBA 1G18A 1HT1E 3L4SO 4TRMA 2HMTA 5IAEA 3ZG6A 1D2HA 3BDAA 4WRRA 1A8QA 4YT4A 2A7QA 4PRKA 3FMFA 1OKKD 3F2IA 3GDHA 2CNWA 1J07A 2C9MA 2EFDB 3C2QA 4RQTA 3X1YA 1U0OC 4MRNA 1GPMA 4FC6A 4O3FA 1G7RA 2J9FA 1OTXA 2F55A 3JW8A 4P3NA 2FEKA 2O3UA 3ELWA 3SS8A 5MFPA 2XT0A 3GPDG 3D2LA 3K2BA 2E55A 2XTZA 3KDSE 3W90A 3U1BA 2FB9A 2BKLA 2FDRA 1X80A 2UYGA 2OXTA 3VDRA 2QIPA 3AKDA 2QLBA 1CB0A 4NP6A 2VT2A 1QONA 3D6JA 4D6YA 4EJFA 5IVKA 4R98A 1UBHS 2V4MA 4HBZA 2WC1A 4PAQA 1GQ2A 1CUFA 2CXTA 4UBOA 3G3EA 4GG1A 3DVLA 4TM7A 3ANMA 4DQVA 4WZBB 1I2DA 4JC5A 1I7SB 2GTIA 5JS8A 4BPBA 3AQ4A 2QVYX 1XQ1A 3NG1A 3KAJA 4IM7A 4BEVA 1EHIA 1SIUA 3AY7A 4KX5A 5EUCA 5DI9A 3HDTA 1M6NA 5D87A 3BMQA 1JU3A 1X7WB 1SKBA 5CT5A 1PJZA 4FSDA 3QHQA 2ZYRA 1X8LA 5DBFA 1D9XA 1T8SA 1WV1A 2O5VA 1C3CA 4N5LA 2VP9A 4N03A 2BJVA 3ZLBA 4NBNA 5IZ4A 2XF8A 3NBMA 3NH6A 3L7IA 2XXAA 1CUVA 2WJAA 1JQKA 2LV8A 1XNGA 1CZNA 3N0WA 2W71A 5SV2A 2ZJ8A 3M89A 4XYLA 3OF5A 3RU3A 4CMKA 3PDCA 5D1HA 2WHPA 4A6EA 4BFUA 3VJMA 1M0EA 3MYRA 1EJ2A 1NDUA 3CNBA 4HMPA 4NZZA 4OHBA 5KTYA 2QVBA 4FE7A 2ADMA 5AJYA 5JCOC 2BT4A 4BLSA 2G76A 3IUPA 3EZNA 1NF8A 4G86A 1W76A 3A4NA 1T3ZA 2WWFA 3UGKA 5KYYB 4LDZA 4AUKA 3AIKA 1IN4A 1GU1A 3UT0A 1IQRA 5KYUA 3T41A 1ABFA 4D9JA 1H3FA 1ZKMA 2X0DA 2BF7A 2V7BA 3BWXA 1TJ5A 3CISA 5IWAB 1TIPA 4O4LF 1ZD5A 2AG1A 1AUWA 5DNEA 1JE1A 2QQFA 5BV7A 1N9ZA 2JFPA 3T5MA 4CU5A 3D02A 2KWIA 1Z7YA 2XA1A 1RCUA 3AONB 3MWEA 4I9GA 1Q12A 4KZPA 4Q4JB 1KMCA 1V5IA 4UU8A 4W5NA 5A9RA 4W5RA 1F8GA 3JQ8B 3RAJA 2VHUA 1BU8A 4H18A 3TSCA 3A4MA 5FWYA 3OC0A 3R5XA 3O8QA 5DGHA 3AVTA 2ISQA 4CODB 4XQGA 1LVGA 4S1OA 5CVVA 3HJAA 3PF9A 5FPKA 5ES3A 2J6HA 3D5EA 1RWPA 5JMWA 4ZCQA 5BSUA 3SJCA 9ABPA 1Z08A 3WJ7A 5AO9A 3TRKA 2ODNA 4JIGA 3CU5A 5H70A 3R5HA 4TMVA 5KNBD 1YZHA 2Y1GA 2WIFA 1II9A 2D4AA 3WJ1A 1JDZA 1I9CA 1NW8A 2ORVA 1QANA 4OHFA 2GNAA 2PR2A 2VQ3A 3KYDA 4QPDA 1U2ZA 1UEXC 2LIVA 6Q21A 4A1OA 2IHUA 1BDIA 4NE2A 4F4DA 5IYZF 1E2HA 2HA3A 2NO6A 2VYCA 4B84A 1A8IA 2IH5A 3HDQA 3RSQA 1PR9A 3NOOA 4PXYA 1UT8A 2XTAA 5CB4F 2UUBB 1C3UA 3P1JA 1JFRA 3WSVA 4OJKA 1AKNA 2AF4C 3SG0A 2IZOA 3E9ZA 1XBTA 3JQ8A 1DDIA 4ZYUA 1MZPA 3OT5A 2ADOA 1L5VA 4M22A 2XDQA 1M73E 3G7UA 3O8QB 4IV5A 4CM8A 4OOFA 3E1SA 1ZI9A 1MR3F 1U6IA 1II8B 4AAYA 4KQFA 2HA7A 4N5HX 3RSSA 3AINA 1U28C 1DG3A 1XAHA 1GILA 2P2LA 3TR5A 4D9CA 2ZYSA 4MW6A 1GSOA 1ADFA 1LRLA 3WL8A 1LSUA 1PR2A 3M4NA 3PI6A 4LJ4A 3SZRA 5KTRA 1VCOA 2GILA 2R65A 1CT9A 3P4XA 5KHOC 2QU8A 5K9ZA 3JAWA 2O8FA 4JI1B 1RRMA 2OZLA 2QX7A 1HT3A 3N2GB 3CT6A 1SEPA 3QFTA 2ZYAA 4IXNA 1UZAA 1TLTA 4OP2A 2HUPA 5DI3B 1BMDA 4BLUA 3DS8A 4MUJA 4IEIA 4HI0E 1W4CA 1NYLA 1SOUA 3BXFA 1ZWLA 1O5TA 3H0EA 3K9LA 1Z4KA 3KSZO 9LDTA 2H1SA 4TL6A 2WAXA 3VI4B 5KC8A 4JZKA 5JD4A 5A06A 2BIFA 3IAAA 3PQCA 3QLVA 5DPMA 5ECDA 1K97A 2B94A 2X9GA 2WHPB 2PU7A 4J7XA 4KO4S 3W5AA 1F8YA 4C01A 2W6QA 1PHPA 2BFWA 2H7XA 3HACA 4IKPA 2EW2A 1GWNA 5DCYA 4I55F 1KNQA 1FYWA 3AF2A 4J7UA 2V7TA 1SD2A 1EINA 4RSRA 3IEXA 2LWIA 1JALA 5CDFA 4OI2A 2QTAA 1HL7A 3VC7A 3WOVA 1L7PA 4B3HA 1P9OA 4WKGA 5JD6A 1SUFA 2OKCA 2MYTA 1AXGA 1P5RA 1QCDA 3HM2A 4TPKA 3DLBA 4WZBA 1PEYA 1K7EB 3PUIA 3V33A 2RJNA 1XZGA 2FN4A 2R00A 4UUNA 5KZMB 4ROTA 1J5EB 2AC2A 3QKSB 3F73A 3EGOA 3D8SA 4G1VA 5EIOA 2D2VA 4YXFA 1EGVB 1RACA 1QYIA 4JLUA 4LJ7A 4BMZA 3DBHA 1NBHA 3NGXA 4TZTA 3KVYA 3MZ0A 5HGJA 3NORA 1W9MA 3N5KA 2VDWB 1XAIA 4ZV9A 2P5TB 7MHTA 3BGIA 1XV5A 4QUKA 4C4PA 4ZDJA 3HCDA 1BNCA 4I5FA 4S1PA 1SZPA 2ZRFA 2P9HA 3FCUB 3G2IA 3EG5A 3DKPA 2J3QA 5JZOA 1NUAA 1KQ3A 1M2KA 1MFZA 4JEHA 3V6LA 5L3QA 1K27A 2GKOA 3L92A 4M86A 4JC8A 3T38A 1HQKA 2NTNA 3HKDB 1UMCA 3IB6A 4QG7A 3ZXYA 1LPSA 4O6VA 1QG2A 2FPGB 1V16A 4J0FA 4DIFA 2HMVA 2YYZA 4KDEA 2HSDA 1C4KA 3S5JA 2IXTA 1IU9A 3HBJA 5EMKA 3SSMA 3W5VA 5EQFA 2DFNA 4EVRA 3V4OA 5I7VA 4E12A 1XEWX 1NF3A 2CXUA 4IVNA 1BHO1 3CBQA 2J5BA 1Y4AE 3AEKA 3NBZC 1SCIA 1O54A 2LW7A 2Q1TA 3AF5A 3EGIA 4DIKA 1Q0QA 4ER3A 2ZTMA 2FPGA 3RRJA 2Q4EA 3IH5A 3UK0A 1WZEA 1II8A 2GPBA 2R8PA 1H4TA 1RQLA 1LPBB 1NQAO 3A6KA 4O4JA 1D6MA 2FRXA 3ETNA 4PZZA 4TXLA 2FDCA 5JU6A 4FHGA 3T4UA 3TEFA 3E8MA 1SD1A 5I4IA 3ZY2A 3ZZ0A 3QE4A 1HC7A 2CK3D 4WLEA 2C4UA 4ZQBA 3ZIAD 1JU4A 5JNUA 4CQLB 4XWGA 2P1DA 3A05A 1N1EA 2HFKA 3M34A 1Y5MA 3OUZA 3VV2A 3AFNA 1KAGA 1FFSA 1P1JA 2VPXA 4JK3A 3JVUA 3PNQA 5I51A 4HADA 2OK8A 3A6HA 4QBGB 5DTRA 1X74A 4PX2A 4OTZA 3AHEA 4B1FA 4H6PA 5DTQA 4AWBA 3KOOA 2NXWA 3N3BC 2FPXA 3N8NA 4X6YA 3EPKA 2ZUDA 2YS6A 4I6JA 3DDOA 1DG9A 1HLFA 1T9CA 4YAFA 4BNGA 4R68A 4ENPA 3BMOA 4RVOA 4F9EA 2VEOA 3K9GA 5IVHA 3CX6A 3E22A 4H7HA 3W3AD 3I37X 1WM1A 1X0XA 1SK8A 3SP1A 4WXRA 3UFBA 2RGAA 5AKJA 4WXHA 4WINA 1J0BA 1EXNA 3O0DA 4II3A 2RHCA 5IDWA 2GN2A 5A02A 3NX4A 3BMCB 1AURA 3BE8A 3GLHE 1Q6ZA 4FVTA 2ZJ1A 2OK7A 1ESMA 5D51S 3HJFA 5JAIA 1D4AA 1F2TA 1DTWA 3K15A 3W5BA 5IT0A 1RXVA 1GTG1 1JSRA 2ZBQA 2QLLA 2BKAA 4MUMA 4Y9UA 1U2QA 1MX5A 4JJ8A 4P2GA 3VYUB 5CXUA 4AG3A 4V38A 3P2EA 3PDHA 1SB8A 4EEKA 3IAS1 4PX3A 1VE1A 4ZJPA 1DCKA 1MC8A 2OCAA 2WILA 4OYLA 3RANA 3ZR4B 2BMEA 2WWHA 3H9CA 2RGNA 2C95A 2ZI6A 5EPEA 4EB6A 2NTVA 3MT9A 4MICA 4CEIB 2VCEA 3A25A 3FTCA 4GSLA 3AOEA 2VJYA 5FLYA 2EEPA 1EFPB 3G2NA 3ODPA 5KHLB 3KL4A 5IKEA 3ND7A 4GU5A 3GJ7A 2HHJA 4B4VA 2YBEA 4K6KA 4DWWA 3IBSA 5L4LA 4KK3A 2QRHA 4LW8A 3WMEA 3LVFO 4DLBA 5JAMA 2ZM6B 1SC3A 2FW1A 3ANTA 3NTUA 4ZXFA 3ZHOA 1PVOA 2ERCA 4N49A 3UA4A 1ZMXA 3MMNA 2W2NA 4QGSA 5FOTA 3KT3A 1H22A 3F5DA 4R8VA 2ZCUA 4X9XA 1HYEA 3RVRA 5I5EA 3WHKA 4AC9A 4ECAA 1ULAA 3CUWA 2ASVA 1Y9JA 3KZVA 5BOVA 2ZSAA 1NLMA 3DAPA 2ZUSA 3JQFC 3L05A 4E5DA 1YQQA 4CIVA 2C8JA 2J7KA 1GYRA 2WYHA 1ZGAA 2XPCA 4MCJA 5LP6B 1ETUA 5D8DA 1E7MA 1JPJA 1A9OA 1WB6A 2ZULA 3NFYA 4QFMA 4RK6A 4EJSB 1WR8A 5D3KA 4KNYA 3T99A 1S96A 4DQUA 5BR4A 1T1IA 2YWXA 3KETA 4KAJA 2D00A 2ZATA 1Z4JA 2WVGA 4GEGA 4YA6A 5A5VA 3CF2A 2NYAA 4GO1A 4L74A 1B8PA 1YVEI 1U0BB 4URUR 2RDMA 3SQXA 3EXHA 1F0YA 3EEFA 1F06A 4XJVA 3IQXA 4E6PA 4FEAA 1BMTA 3WHPA 1ZUNB 3WLHA 1D1TA 3E7DA 2OAQ1 3AL2A 4R9NA 3UKDA 1KBZA 1MC5A 2VN8A 2PZBA 2XIQA 4QYIB 3K70B 1J1IA 4CMEA 2V58A 1BKDR 5AM1A 1JHAA 3GRFA 1JT2A 2F62A 3AKYA 2Q5EA 1MRZA 1I13A 2ANBA 3MUEA 3TXYA 4BO3A 2FSPA 1R12A 3QWHA 2ATIA 3ZZTA 4E5UA 1G38A 1YQXA 4CGZA 4UDYX 2I3DA 3UK1A 4FOTA 1WCYA 1B7GO 3OCYA 3R7DA 2JHAA 3D5QA 1ML4A 1P2UA 4HWOA 4ER0A 1MENA 3FD8A 4ZU6X 4M3NA 3QELA 3WBFA 4B2LA 5HIKA 2E4XA 5D1NA 1GARA 3IB3A 4R5MA 4RFSA 4GYJA 4MB6A 4KGDA 5JZBA 2G70A 3Q5EA 3MLBA 4EPWA 1OR8A 2JVJA 2G67A 1NVVR 2V65A 3F5QA 4RFLA 4GPTA 4RMIA 1CJTC 3MBKA 3WLLA 1ZN7A 1XN4A 2C4NA 3ZN2A 3MBIA 1J0EA 2ZJ5A 4I4CA 4RLFA 1H42A 1I36A 5CFOA 1NG1A 3WVNA 2HSEA 3G88A 1JJVA 2V5VA 1EX9A 1YJ5A 2FN7A 5GOZA 2I3AA 4M1MA 2F6RA 4EFCA 3F4TA 3BB3A 3GJ3A 3KPJA 3RPEA 5FAKA 2VAPA 4JP2A 1BXRB 4QGBA 3G8DA 4ZVNA 3SF8B 1PUIA 4D8XA 3EGDA 4MQ6A 4XTCS 1DX6A 2NUPA 5JFTA 3EJ6A 2YUIA 3STXA 4IH9A 3TNYA 5DYYA 4YEDA 4CNBA 5MGNA 1AQNA 3TNFA 4YRFA 3CN9A 4FZ5A 3K9FC 3FTFA 1V1MB 1BFDA 1LPOA 3HBNA 2ZBPA 2C2KA 3AUXA 3SXUA 3RIMA 4CQLA 3KCNA 3QVWA 5DBEX 1E1CA 2WUF