4MUMA

Crystal structure of mitochondrial 5'(3')-deoxy ribonucleotidase alternative spliced variant
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
207
structure length
198
Chain Sequence
b'SNRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGTGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial 5' nucleotidase
molecule tags Hydrolase
source organism Homo sapiens
publication title Kinetic and structural characterization of an alternatively spliced variant of human mitochondrial 5'(3')-deoxyribonucleotidase.
pubmed doi rcsb
total genus 66
structure length 198
sequence length 207
ec nomenclature ec 3.1.3.-:
pdb deposition date 2013-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4mumA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4mumA01
2FUCA 4NWIA 3SMVA 4OFZA 3U7EB 3E8MA 1TJ3A 3D6JA 3IRUA 4JB3A 1YJ5A 3N5KA 2W43A 3RF6A 2R8EA 1ZOLA 1WVIA 2JARA 3U19A 3KDPA 4RESA 4AS2A 3W5AA 4NABA 3CZ4A 3F9RA 1RDFA 2YMPA 3OCVA 5AIBA 2WF5A 2AGVA 3NRJA 2PKEA 3NUQA 3J7TA 3N8GA 3U13A 2PR7A 3VAYA 3U7GA 1L8LA 4JDPA 5AM2A 4AP9A 2GFHA 4ZEWA 2Q5EA 4EZEA 3W5CA 5ALGA 2B30A 2FPXA 3SKXA 2G06A 2FDRA 5AESA 3R4CA 5AKZA 2ZBGA 4EELA 5AKYA 2YMMA 1NRWA 1QH9A 4UM5A 4BYGA 2FI1A 1ZRNA 3A1DA 4J2TA 5AI5A 5ALIA 3WK4A 3A1EA 2ZXEA 1Z4OA 4ZEVA 3WKEA 3R9KA 4DW8A 3ZVMA 3ZI4A 1Y8AA 2PQ0A 2ZG6A 2IOHA 2WHEA 3P96A 1QQ6A 3GYGA 1LTQA 4UW9A 4NFLA 4C4SA 1RRCA 4IG4A 5ALRA 3A3YA 4C4TA 4CE6A 2YJ6A 3QUQA 3WK5A 3FPSA 2G07A 3UMBA 2HO4A 3QU5A 2B8EA 2RBKA 1U02A 2CFSA 3AR3A 5AK6A 1Z4LA 5JJBA 4OHFA 1YV9A 3ZX4A 2YFYA 2HCFA 1ZD4A 4YGYA 4CF4A 2WF9A 3AR4A 4ZEXA 3FPBA 2IOFK 3N28A 2NO5A 3I1YA 1RKUA 2YY6A 4HAIA 1QQ7A 4HYTA 4Y2XA 5AW6A 3HLTA 1L7PA 1VFPA 2VKQA 3ZVLA 3E81A 3R09A 2RB5A 3OCXA 3OTQA 1Z4NA 5ALWA 4HGOA 4NAVA 1RQLA 1QQ5A 2WF6A 5ALSA 1O03A 4Y2UA 2IA5A 4EX6A 2HHLA 2G09A 3N1UA 4XE5A 5AM4A 4F72A 4UATA 3NALA 1L7MA 1S2OA 5IT0A 3N07A 5A3RA 1RLMA 2EATA 3SF0A 5AK4A 4CF5A 5AVQA 3ZVNA 4Y2RA 3QXGA 5FP0A 5AI8A 5AK3A 3L8HA 4UM7A 5ALJA 4O8CA 1LVHA 2FEAA 4UMFA 1S8OA 3QX7A 5AW0A 2AMYA 3WK6A 4YIHA 4BX2A 3ZWKA 4KNVA 3EF0A 1JUDA 1RC8A 1CR6A 3W5DA 3KD3A 2HSZA 2I34A 3U26A 1RMYA 2ZBDA 2IYEA 1L6RA 4KX5A 1RMQA 5AHXA 3WKBA 4GIBA 2FPRA 1T9ZA 3PCTA 2OA0A 2C9MA 5IT4A 2EAUA 2B1RA 3QU7A 2P27A 1L7OA 3ED5A 4Y2VA 1N9KA 3A1CA 3KC2A 4YH1A 1TA0A 2FPUA 5ALHA 1VJRA 3DNPA 4UU0A 2RAVA 3ONNA 1Z4QA 1U2TA 4DFDA 3UMGA 3ESQA 3WK8A 4MWOA 1Z4MA 5AM1A 5AW4A 3EPRA 3AR5A 4YCMA 3E58A 1XP5A 2DQSA 2ODAA 4OD0A 3ESRA 4BX0A 2HF7A 3ET4A 3L8FA 2O9JA 4FE3A 4UASA 4G9BA 3L8GA 1Z4JA 5AVYA 2AUTA 1O08A 3WGVA 4FFDA 1RMTA 2HI0A 2I33A 1EK1A 1SU4A 3QNMA 2P9JA 2WF7A 3EWIA 5AVXA 5ALQA 5AW1A 3QU4A 2JAOA 4YCNA 2WFAA 2CFRA 1YNSA 2G1AA 3S6JA 5AW2A 3OPXA 3QU9A 2JAWA 3TLMA 2FPSA 3OCWA 3NANA 5AVRA 3L5KA 5ALMA 2CN1A 2OYCA 2WM8A 5AW9A 2B1QA 3QGMA 4OCZA 4Y2YA 5A3QA 2C8LA 1SWVA 2YMLA 3AR2A 4UAUA 2Q4RA 1Q92A 3MN1A 1T5TA 1VJ5A 4AS3A 3WGUA 1KYTA 1ZJJA 2D2VA 2GO7A 5AKLA 2O2XA 3MC1A 3U7FB 3DAOA 2R8XA 3SD7A 3QUBA 5T41A 3FM9A 2W11A 3OCUA 2I55A 1Z5GA 2YJ4A 5AIAA 1WR8A 3WK9A 5AKGA 2BY4A 2JAUA 2ZBEA 5AKXA 3DDHA 3I76A 2YJ5A 1MH9A 3NASA 2GHTA 2HX1A 4HGQA 1RKVA 1ZD5A 4HGNA 4BEVA 4C4RA 3QUCA 5AI9A 5AM3A 5AM5A 5AKEA 1FEZA 2QYHA 3L0CA 5ALUA 4EENA 3OCYA 3I28A 3IB6A 4PNHA 2QLTA 4NV0A 2NYVA 5AKKA 2FUEA 3W5BA 1IWOA 2I6XA 1AQ6A 5AI0A 3CNHA 5A3SA 5AVSA 1N8NA 2YN4A 1K1EA 2YBDA 4GXTA 2HDOA 4I9GA 4H1WA 4Y2SA 5ALOA 3K1ZA 4KN8A 5AI6A 4L6CA 4J03A 4Y3UA 2CFTA 4UARA 3OCZA 5AK5A 1X42A 1XVIA 4FYPA 3WKDA 2AH5A 3AR8A 3NIWA 4UU1A 1Z5UA 5AW7A 3ZTWA 4B6JA 2WF8A 3SKYA 5AVZA 2HEGA 5ALFA 4QJBA 4IFTA 2I54A 1ZD3A 2G80A 3L1VA 3KOOA 4KYTA 2Q4TA 1Z88A 3FGOA 1T5SA 3FZQA 2C8KA 4Y2TA 4XOUA 2YMQA 2JGAA 5ALTA 5E0OA 3ZTYA 3EF1A 3FVVA 1TE2A 1QYIA 2MU1A 2OBBA 4EEKA 3B8EA 1YMQA 3B9BA 1WZCA 3SLRA 4E88A 4BNDA 4UMVA 1F5SA 3MMZA 3M1YA 2EARA 3RFUA 2I7DA 5ALLA 1NF2A 4DWOA 5ALNA 1WPGA 2W4MA 5AICA 5ALPA 4BBJA 5AVTA 5AVWA 4BX3A 1J8DA 2BDUA 2NO4A 5ALKA 3WKCA 3PGLA 2B8JA 1Z4PX 1ZS9A 3L0BA 2FPWA 1RPZA 2ZOSA 5ALDA 4QQFA 3PDWA 3ZW7A 2P11A 1EK2A 2G08A 1XPJA 4MUMA 1TJ4A 4UMDA 4Y2QA 4EX7A 2X4DA 5AW8A 3L1UA 3AR7A 4L6AA 3QLEA 3MPOA 4Y2PA 4KX3A 1Z4IA 3QUTA 4BEWA 1U7OA 2IOFA 2R8ZA 2BDEA 3ZU6A 3L7YA 3E84A 5AW5A 3IJ5A 3B9RA 5ALVA 1Z4KA 1YS9A 1RLTA 2HOQA 3L0YA 2MSNA 3DV9A 2B82A 2C4NA 1J97A 5ALXA 3NAMA 4HGPA 4L57A 3ZUPA 1L8OA 2GHQA 1U2SA 5ALEA 4XQ0A 4HGRA 3UMCA 3WKAA 5AW3A 2HF2A 3ZX5A 4G63A 4F71A 1ZRMA 3ET5A 3BWVA 3QU2A 2R8YA 3BA6A 2GMWA 4KNWA 3U7HB 2YJ3A 1RLOA 1NNLA 1CQZA 1PW5A 3WK7A 3QYPA 4CNQA 2P69A 3M9LA 3KBBA 3HYCA 1RKQA 5AI4A 2OM6A 4I9FA 4DCCA 3L8EA 4BNDB 5AM0A 4Y2JA 4CF3A 2RARA 3UM9A 1L7NA 3AR6A 4XPZA 2B0CA 2C88A 4UAVA 3SHQA 3PGVA 5AKHA 4BKMA 5ALYA 1ZD2P 4RETA 5AVVA 3AR9A 4UMEA 3I6BA 1Q91A 3ZWDA 1RQNA 2G0AA 1YDFA 4YIKA 3KZXA 1U7PA 5ALZA 2ZBFA 1SWWA 1TJ5A 5AKJA 5AVUA 5IS2A 4YCLA 5AKIA
chains in the Genus database with same CATH superfamily
3W77A 3PEWA 5L8VA 4XWOA 1EX6A 4YRPA 3U7EB 3NTLA 1T4BA 2WKQA 1Z6QA 1KHHA 3TMYA 1XXHB 1SELA 3K9NA 4WXMA 1M5RA 2ZWIA 3N8IA 1WNFA 4MUXA 3KR9A 4AYWA 3K8ZA 1OIWA 2R8EA 1KEZA 1SD5A 2IIVA 4WL0A 3G5MA 1UPTA 3W5UA 3CF0A 5FTNA 1OV4A 3HZOA 4ZO8A 4WECA 1NVXQ 3NHFA 2PZGA 3F9RA 2QPLA 2YMPA 3KKLA 4KHZA 3FHTA 1DB3A 4H16A 5HKKD 2IYVA 4S05A 2BTQA 2AMFA 5CFLA 4B81A 2AL7A 4CMJA 2XUJA 2G67A 3AXTA 1K8XB 3ONEA 4BMPB 4DA8A 3LHIA 5G2OA 2PT5A 1K2VN 2GXAA 1IZ8A 2O54A 4IF6A 4KDFA 3EIXA 2CNWA 3P9CA 1M1XB 4DMHA 3R3YA 3LGAA 3TDMA 4R0VA 5AHRA 1KGDA 1P2UA 5A0TA 3ANSA 2VBIA 2V59A 3EZXA 5H02A 1G8FA 2JL1A 3A6LA 3H75A 5AESA 3VKGA 4AWXA 1G9XA 5DW0A 3SAJA 4W99A 1PKEA 5DHQA 1BEZA 3DMGA 1NYLA 4E7PA 2C2GA 5CAEA 2EKDA 3T5BA 2V7QA 6REQA 4OAQA 1PFVA 4WKCA 1GPBA 5LBIA 4PX3A 2WHYA 1EUYA 1ZP6A 3HN7A 4HX9A 1M3SA 1MEOA 1V6AA 3D3WB 4LQCA 4EGCB 2HEIA 1Z4OA 2C5GA 1E8NA 2OY0A 3I32A 4EVIA 4BMZA 2GPAA 1AKYA 3SDBA 4MPPA 4RL4A 4J75A 3K8OE 3AETA 1DAIA 1QF7A 2H85A 3CPSA 3K0KA 3P19A 4O02B 2VTVA 3DWFA 4HOYA 4Y2HA 3SE0A 5CDGA 1QP0A 4PGMA 2J3KA 4IH4A 1C1DB 3JQEA 4WGGA 3ZE1B 4TXNA 4KPUB 3WL8A 1B43A 4CEJB 4HB2A 1W5TA 2OCDA 1ODKA 3VR3A 3SOZA 1SVNA 5DCYA 5H3HA 2SICE 4AJEA 1Q12A 3CLKA 3DCIA 4J0CA 2GRJA 4BFXA 1V3VA 1YJCA 2C8VA 5L7WA 3UKOA 4GYWA 2DBZA 1X1DA 3EZ6A 4LK2A 2JCVA 3E1GA 4A8PA 3MCTA 4IHQA 4EO7A 1IULA 1L8QA 1ULTA 2E4ZA 2XNHA 1YBVA 4KH1A 4ETWA 3U3RA 2XE8A 2A35A 1IPHA 4BFTA 1XCMA 1PHRA 3ZHSA 4BAUA 3AR4A 1VIVA 3JWHA 3R0QA 4ZQBA 1OA0A 2IOFK 5F1PA 4QAQA 3HPQA 4TS9A 4BZZA 2FB9A 3C70A 2FW9A 1L7PA 2RH5A 3H3XA 4RY9A 1O58A 2A1IA 4LBYA 4DLBA 1G9SA 2C2KA 5CVEA 3B89A 3LCCA 4OSOA 2RJ3A 3B6JA 1E62A 4WADA 1A9XA 4TWBA 1YCGA 5EKUA 4R8MA 2V7UA 2C00A 3C3JA 4WT7A 4UBMA 4RZ2A 4MGZR 2R6JA 3T41A 4JLJA 5DV9A 1IONA 3NDJA 3I83A 2C2XA 2CKMA 5BYJA 2Q27A 1ZCJA 2IZ7A 1MD9A 1U7DA 1W52X 3W8NA 1JIQA 3M4XA 3OPQA 4DM7A 1COWA 1NQAO 5BV8A 3A1TA 4ALLA 1UBOS 4F72A 4BPRA 4P84A 1P0IA 3RRMA 2C98A 3VSAA 4D25A 4NBNA 3PE3A 1R8QA 2VBCA 4XDZA 5KKNB 3LBHA 4UXJA 4KVZA 1NX9A 1NBAA 1NWHA 1QFXA 5FAKA 1GRVA 1CHNA 1L5GB 4EA9A 2E7ZA 4R5HA 1VYUA 5ECWA 2ERYA 3ZVNA 2CV2A 2ENWA 4C7VA 3BXXA 1XN4A 5EZSA 521PA 1YOVA 4GI2A 5JD5A 5JSZB 1TIPA 2ZYGA 3FUUA 5EEHA 1P18A 1C8KA 4NYJQ 5BV0A 3DDSA 2ZR9A 2Q1WA 4M0LA 2H0AA 2OBXA 1L4GA 4FR5A 1LF0A 2FEAA 5IXYA 1FNCA 2HUPA 3PTLA 3K16A 1A8QA 3WIOA 1C1YA 2AD1A 3U3XA 1Z73A 2XB2A 2FW6A 3RSSA 4YIHA 3B7GA 1VI2A 2W2KB 3G1UA 3P0EA 4ZVVA 1DARA 3A1VA 5I9TA 4TL8A 2I78A 1JUDA 4HXGA 1LJLA 3F3YA 1G8PA 2Q9AA 3VDXA 5JDCC 3L0OA 5B53A 1RCUA 1G1AA 1UMCA 4GI7A 4MYRA 4DE5A 1HNXB 3CLRC 1H1LA 2A5YB 1C4OA 3CRW1 1AXEA 1FS6A 4FZ5A 4KX5A 5F73A 5TPZA 3W2HA 1XTVA 2GLTA 4A2QA 3JATB 4YP1A 3VU9B 3P9ZA 3AZQA 3PT9A 2WIFA 3EPPA 4Q7LA 4AJNA 1XFAA 3OLWA 5C3MA 1YFJA 4NNOA 4OYYA 5BV2P 2B1RA 1QAQA 1TLLA 3OIUA 4HWKA 3C8HA 1FW6A 5F12A 4CM5A 4E07A 1M7HA 1QCCA 5TQVA 2J9GA 2W2VA 1N9KA 4INPA 2ADOA 4IRXA 5T64A 3CSSA 1JQDA 1ZX1A 2XBUA 1C9DB 2IUFA 4KKXB 1P7PA 3TVTA 3ROGA 1HDZA 1PLLA 1NXQA 3BFVA 2GR9A 4YO7A 3PEUA 1YJ8A 1GGMA 3E9DA 4EYGA 5JWOA 3TFOA 2QX6A 5C8ZA 1JU3A 1GUFA 3WGNA 2BH9A 4ZJYA 1AUOA 2CNNA 1KJQA 1U0SY 5JE8A 2YUTA 3WYEA 4F4FA 4O5OA 1IOLA 1K3UB 3ESQA 3I23A 4PPGA 1ZL2A 1JDTA 1GG2A 3WK8A 1SUCA 4B6RA 4C9BA 4MB2A 4X62B 1T6XA 1OLOA 3AI1A 1WMEA 3AFMA 4FCTA 2NUPA 3H04A 3ZD9A 1VBNA 2WIKA 2GESA 3KJEA 2ODAA 4HUTA 4ZI5A 5JJCA 4X7RA 2FR8A 1ZMTA 4NG5A 3UPDA 1XD2A 3A9RA 2G36A 3A6EA 4NMXB 5AQEA 5KOHA 3HWX1 2F3SA 1SBHA 2PIDA 4Q21A 3R7DA 3PQ5A 5HGXA 2I71A 1JR6A 3HMQA 4MRPA 1TJPB 5I7AA 2V6GA 1I7NA 2JD2A 4L7QA 1BCRA 4Q4DA 3TOCA 1T4GA 2PANA 3EC2A 3T1QA 2H1FA 4EL0A 1K5GA 2FWAA 4ZCQA 4PIPA 2WF7A 2EP7A 2A2ZA 3EWIA 1OAKA 1V4NA 2D06A 2P6UA 3CB2A 3PNLA 5IKOA 3V2GA 1JKIA 3X3HA 4OKIA 4E5NA 1GGKA 1DG9A 4OGWA 2YOHA 3I4FA 3MFYA 3LUDA 3ER8A 2FLWA 3S6JA 5HHTA 4DG8A 3K5IA 1H85A 3A4IA 4QYTA 1KFJB 1ND5A 5HBGA 1O8BA 2AF3C 2BMWA 2W2KA 2HM7A 2Y71A 3MCZA 5EYPB 2HU7A 1XSEA 2NO7A 5I9SA 1ZG3A 3NANA 3QXXA 4UE6A 4JXKA 1KBOA 4YDQA 2G0NA 2I5PO 3C45A 3FOWA 4GSKA 2CNLA 4W63A 3RYFA 1DAGA 2C1EA 4ME6A 1MVNA 3KPUA 2Q5QA 2BZGA 2I6SA 2VUIB 2C8LA 3C3KA 3BE4A 4RK0A 4AY3A 3W78A 3HZHA 1YR3A 2OV1A 2FETA 3PC8C 4GF5A 1V11B 1U9CA 5JSUA 1NW3A 1SXJC 2QAIA 3SBXA 4DR1B 2LW7A 2P9FA 4CQJA 4PFJA 1CJMA 2ZIXB 1E2MA 2AFIE 2YXLA 3O9MA 4X92A 3S40A 5CPBA 4RENA 2Z8XA 1YUMA 2PFKA 4IWXA 5DJ5A 4UPVA 3L0IB 4RPLA 4ZZIA 3PU6A 4JCCA 3UJAA 1KQ3A 1SCJA 1E2EA 2ZYHA 5SY4A 2C4MA 2IU0A 2A67A 3M6WA 3OY2A 4KO4S 5A1TA 5JR3A 1NI4A 2DFDA 2E1RA 3KQQA 5AKXA 2GWHA 1TTPB 1YDEA 2O3JA 3BB1A 4YCAA 1ZJYA 1GP2A 1L5MA 1N9GB 1T8TA 5GZ3A 4QPNA 1DKPA 1VI5A 2HLNA 4HGQA 4OQZA 4XM2A 4XOIA 1XNQB 2M6RA 1S2LA 3TPCA 2IOQA 3TAUA 4YCSA 5JY1A 2Q3CA 1KYVA 3ESZA 5D3MB 5C9ZA 5BNTA 4UHHA 4UM9B 2HLPA 3VKWA 4AJ2A 4AMYA 4YAGA 2ANCA 4TYPA 3FTFA 1DKLA 2QLFA 3EPHA 4DIBA 1NY5A 1E2HA 3MCAA 1EFPA 1C7ZA 1X9HA 2VJQA 4I9UA 5KHAA 3ROXA 1UBTS 3WO0A 1JPUA 4KFUA 1YE3A 3GAZA 1OYYA 2V3WA 3M34A 1SVIA 3L9XA 4DMRA 4BO2A 4S2EA 1J8MF 4W7SA 1C1DA 1NA5A 1Z47A 4BP1A 1BCRB 4P2BA 3RNLA 1TQHA 4QLAA 5AQ1A 2QZSA 4OXQA 5TVKA 4HEA6 2KHZA 3LHKA 2CUKA 2H2GA 1D1SA 3DEIA 1XRNA 1H0SA 1IN7A 1KTIA 3LT5A 821PA 4YJHB 4EF6A 5AK5A 2DHCA 1ESMA 1OWPA 2BGUA 2FF5A 4FYPA 4EARA 4IMRA 3EISA 1MJNA 4QPCA 3PQ2A 4EECA 1E9RA 3FHLA 2WF8A 2XX3A 3CEAA 4C4XA 1QJ4A 1XKXA 1MHTA 5LCXA 4PFSA 2KI5A 3QM1A 1LI4A 2QNIA 5FBKA 2ZSUA 3I2GA 4X91A 4M98A 4X84A 5BVHB 5I48A 5IDWA 4Z7JA 2J3LA 1T13A 1WZNA 2N47A 2ZRQA 1N36B 5F9MA 2YN0A 1WXIA 3M1IA 2HWWA 1NRIA 2CGEA 3EDMA 4OB7A 1HSOA 1WW8A 1W88B 1L5WA 2J32A 3LD9A 1T36B 1XVAA 2HHJA 1AKVA 3E6AA 2AFIA 3NYQA 4BB0A 4DLKA 4OK6A 1BFUA 4L74A 3G2IA 2ZEJA 2GAIA 4RY8A 4CKXA 5JG7A 3MTJA 3RIGA 1H9AA 1XMXA 2WBLC 4NOMA 3WMEA 3PWSA 1N2JA 2GFQA 2OPHA 1OXMA 3S2YA 5CA1A 4I1PA 3ROMA 5B12A 1DDOA 4F3CA 1FRZA 2X1MA 1CJUC 1KZGB 1L4YA 5DHSA 3K9QO 2GBIA 3G5UA 2ZSHA 1AVTA 1TYBE 3OI7A 1WUTA 2NZXA 3MMZA 1TCVA 1AZLA 3JQPA 1HDXA 2EOAA 1VPVA 4YJKA 4P5PA 2ODNA 4K2HA 3AW8A 4PS0A 3AF0A 3BJZA 3EFEA 1F4LA 4PYMA 3ZIAD 1FFDA 1IHPA 5TPZD 5K0CA 3S70A 1O87A 3ZY6A 4ZVRA 3R7WB 4GC9A 3DT9A 1JJAA 3PE4A 3RFCA 4URZR 3AEZA 2FY8A 4QXMA 1RRGA 3OY7A 4MUNA 1TLFA 1RR6A 4P3PA 4UE2A 3UHFA 3ZWAA 4GGPA 1ZS9A 2O20A 4MQUA 2FPWA 3LIIA 1BW9A 3DTYA 4GEKA 3KYBA 2DHRA 2Z4SA 3AHIA 2IUUA 5BURA 3ZW7A 3O8RA 1CYEA 3O74A 1GG9A 2UZ0A 4FFPA 4XEHA 3UPTA 2P2CA 3CTMA 3OTIA 4EHNA 4IUDS 1RHMA 1R74A 1N4AA 2J0VA 3ZDXB 3QQ5A 2FOIA 1JHYA 1ZVQA 1FFEA 2XUQA 4IVNA 5SZJA 1V4VA 3D5QA 2AC4A 1V7PC 4WHMA 1GXSA 4O33A 2E0IA 3D1LA 3GAMA 3VUFA 1ZNXA 1U98A 3CLTC 4QLOA 1TT5A 4YMHA 4OUDB 4EI7A 4DLPA 1X14A 1KY3A 1MRSA 4H1HA 3NM4A 1Z68A 2WNHA 3JATA 5JZ9A 3TZEA 1P72A 1SY7A 4MV7A 5HWSA 1BVYF 3RHSA 4MHSA 1NIJA 1NBWB 4JQOA 1RLTA 2R8RA 4G1BA 2QQGA 4QECA 3SIPA 1U04A 2EV9A 3F8TA 1M73E 2BKVA 4FMCF 1II9A 4JC4A 3SE7A 1MOPA 1X1BA 4A3SA 1RADA 5AO9A 4MKRA 1RPJA 2D00A 2OAEA 3BF7A 1DC5A 3I01M 3MRXA 2N1BA 3WKAA 3CGWA 5K0EA 4EL5A 2O2EA 1ZRMA 4MP8A 3BWVA 1Z0JA 4I2NA 5JCZA 4K88A 1K6XA 1SUSA 3DEZA 4PPYA 3OLCX 3ONFA 5EJAA 2R2GA 1AMOA 2PU5A 5D01A 3IESA 5LP6A 3RLFA 4PONA 2ZUCA 1PUJA 2YJZA 1SXJD 4BY9E 4LXTA 4X20A 1JAXA 3BCSA 3BYZA 3EXHA 1EM6A 1MGOA 1HDEA 2AK2A 2MINB 2YZMA 3A9WA 4JY7A 2PXHA 4MQFB 2I80A 3URMA 4BJ5A 4FVTA 4RKYA 5AM0A 3DL7A 3OQBA 1DKRA 1NY6A 1MQ8B 3OECA 4KBFA 4AN4A 3BD9A 1Y5RA 2B0CA 2C88A 2VNJA 3D5TA 5CM2Z 4FYXA 3PGVA 3BS4A 1XR3A 2VDMB 4BKMA 5ALYA 1ZD2P 3AKZA 1GILA 4O2BA 1A9TA 1IJEA 1GAEO 1VL5A 4FDUA 1PZGA 3BIJA 5D1HA 2KSQA 3JWJA 3K4HA 5EIWA 2P4UA 3LXRA 1XX6A 5FORA 3IKVA 2VNHA 1AU9A 4D96A 2RBEA 5B7GA 1AKQA 1A76A 1QWSA 4ZQCB 1V6CA 2QN6A 3BB3A 5D3QA 4ZVOA 4YV2A 5ICSA 3EGXB 2Q8QA 4LDZA 3B6ZA 1IZYA 3SXPA 3R2JA 4OLJA 5FDFA 1YJ5A 5EYPA 4FP9A 2ANBA 2O2IA 3LUHA 5K0BA 1T6ZA 3HYTA 3R8FA 1KC3A 1K5PA 1RW4A 5E4FA 4RD1A 4RHUA 5BT9A 3FSRA 3VJRA 4L0MA 2D59A 3KQHA 3L05A 4L5JA 3DEHA 4FFSA 2BFFB 1E98A 3MTBA 1L7DA 3KIPA 4LRUA 3CNNA 4POOA 3ILSA 1O6GA 2NSDA 3GRKA 3LUCA 4P8RA 4MKZA 1W87A 4BDSA 4NBWA 2O1XA 3N8GA 2PR7A 3WWEA 4D9KA 3OOSA 1I5OA 1CZLA 1T24A 1T8YA 3C5EA 3CLUD 1P2GA 3LU1A 4HAZA 4X7BA 4QATA 3WMGA 1D0SA 2FNAA 4TN1A 3JCZA 4ZICA 2PGOA 1XRLA 3F8SA 2VHEA 4E5PA 1L3BA 4Q9LA 3T8YA 3TE7A 1NHGA 3JZFA 3K70B 1ECLA 1MQAA 4J16C 1FFBA 1YK0A 5JFOA 2FMUA 2QZZA 3IT1A 4PW0A 4F93B 2PUAA 3QX8A 3OVMA 4WKBA 4XWAA 3T9AA 4DT1A 4ZCIA 4Q1VA 1VB3A 1JNXX 3L4EA 4N5LA 4C5AA 1EZ1A 1FMJA 3N8DA 5JYBA 1CNEA 2F00A 2GD6A 3NAZA 4UTVA 3KOZA 4CIYA 5FPPA 1NSFA 1F20A 1X7GA 2RGBA 2ZJ1A 3B1FA 3FGPA 3PXAA 4MV8A 3QHAA 4ZODA 5G4KA 1ZD1A 2ZM6B 4F4HA 3GY0A 5LXTB 2VDWB 3CLSC 3V4VB 5CVTA 1ZHOA 4BFZA 5KQSA 2OHFA 5GADl 1T5DX 2QRHA 1OXTA 3P2JA 4HI0E 3H9GA 4LJ7A 4CLOB 3MIIA 3ZVMA 1Z0SA 1A5BB 1J1IA 4QC2A 5JXJA 4MS1A 2YNMC 4GZ3A 5L45A 4UBNA 2IEIA 3THRA 5L95A 1IBCA 1Z06A 1MABB 2GPWA 4W5NA 3PKZA 4LJ6A 2GCEA 2H7CA 3GYGA 5MGNA 5AOVA 2E55A 1RE0A 3GCDA 2IEZA 2XTZA 5DI3B 2ZIZA 3CF6R 3ZI7A 1A9RA 3RAFC 2YY5A 3BKXA 2BM1A 1S7CA 4RF5A 1Z22A 1IBSA 3AI7A 1QIHA 2XA9A 4DR3B 5LDGA 5A0VA 3SJCA 3F4BA 2D54A 2F9MA 1UDBA 4AW9A 5EJ6A 3AM3A 3HVIA 3QJGA 1NF3A 1MB4A 1DC3A 1Z6YA 3NAQA 3O4IA 4RXTA 5FBRB 2BGJA 3EIWA 4F12A 3N86A 1XZNA 5JCOA 4F04A 1IB6A 2AI3A 2VF5X 1ZFNA 1L6IA 2J7PA 3ESYA 3DCYA 4XEUA 3WGIA 3TCNA 1WKBA 4N48A 4DTIA 1E0KA 1KVQA 3DXYA 3G0HA 3CF4A 3L6EA 4ZEXA 5AJWA 4BKPA 3K32A 3C1UA 5CXSA 3CZMA 5KC9A 2R6R1 1AGRA 2HXGA 2XUPA 2YY6A 3D5EA 3R6WA 3ZIUA 2FMTA 3OO1A 1AQLA 1AQUA 3PRHA 2AE2A 4ANFA 2ZE5A 5FLKA 3K70D 4FDTA 2HRRA 3GLHB 1JDNA 3MCVA 1JHPA 2GS9A 5K3FB 4TV9F 3DOOA 2FHSA 1WB4A 4WK0B 3JXEA 4XIIA 3HVRA 3UFXA 1TQ4A 1U1FA 3NS7A 1G8SA 1GQRA 4RM3A 1LBQA 4URFA 1V5FA 3UJBA 2DB3A 1TAUA 2IUYA 3DTNA 4Q9HA 2FUG1 5GONF 2W6NA 2WOJA 4R1SA 2WE7A 1SKYE 3VNBA 1QLWA 1FIUA 1T9DA 4LI0A 4FYVA 5IT0A 3CZAA 4GL4A 4ZMSA 3GLHA 1FP4B 4DUPA 4IEFB 4F8JA 2I0FA 1UPAA 4FJ2A 4R2JA 3Q5DA 1FRNA 5KYWB 2GVDC 5IXJA 4KK4A 1M2VA 5D6BA 5DNVA 1J56A 1FXSA 4Q3CA 1ORWA 5TARA 1UF9A 2VYCA 1KRXA 3DJYA 1SHTX 5AK3A 1M6NA 4A5SA 2CLHB 3MRSA 4AJLA 1S2MA 2NADA 4UM7A 1PR5A 3GJTA 3KQSA 3PENA 1H2FA 1U2RA 2CHUA 4NEHB 1PS8A 3KXKA 3PUWA 1J42A 1Q7RA 3DLCA 3GXBA 4PVCA 4AM8A 1TKCA 3COVA 1KRWA 5DIFA 1ZBQA 3BTSA 3M3HA 2GOYA 4N3AA 2I7CA 5JAHA 5KJCA 2QM0A 4C43A 3LVFO 1CJKC 1XTZA 1CIVA 1EJ2A 2O05A 1GVHA 2JEYA 3L9WA 3ZE0B 3DHNA 4JI1B 3HSYA 5BPFA 1CJVC 1XHFA 1HE5A 3E1KA 3OQNA 3CCFA 1R18A 2O06A 1T9ZA 7MDHA 4ZAYA 1TA9A 1DQZA 2DKOA 1P2DA 1X8KA 1QYRA 1QAMA 2BHNA 3CT6A 1G0OA 1VIAA 1Y6JA 2C61A 3GPDG 2VHQA 3N6VA 4JLBA 3MWDB 1VXRA 2P27A 1ULZA 1WZEA 3ED1A 4EZBA 2NZ2A 3A3OA 2IIQA 3IP9A 4YP6A 3FRHA 3MILA 3LY9A 2ZRNA 1BKSB 3BN3A 3N8KA 2X0FA 4WI1A 5J59A 3UA4A 3H3FA 3ADOA 1GPH1 4MQ6A 1PFUA 4XLZA 4BGDA 3AFIA 2AF4C 3PHGA 4FKZA 3VR2A 2GZHA 3WDLA 4DQDA 9ABPA 1F3LA 5BVGA 2ZCJA 1HYBA 1PR0A 3Q8XB 1NUSA 4UCQA 3F6SA 3GQVA 2QZ4A 3KSMA 4I6GA 4N65A 3IPYA 1UQRA 2I7TA 5DYWA 5HZGA 2HHAA 2LTAA 4M6WA 4TXJA 4LY6A 4RLQA 5LMNB 5K0LA 2A7QA 3TLXA 1ZIPA 5C7LO 4RUKA 3TLAA 3E58A 1T1SA 3AIKA 3FOCA 2E2WA 3CBQA 1UDWA 1ZM7A 4NTZA 3ZHUA 3DQPA 3IIMA 4DN6A 4WJKB 2VDPB 2FDCA 5EMNA 1DO0A 4L2IA 4KRYA 3QKRB 4RNDB 1HFWA 4L76A 1FSPA 1PT9A 2XT0A 4IKEA 3LL7A 4UVGA 4B43A 2QY6A 4GNKA 3MJTA 1P2SA 5C1DA 1EWQA 2NTVA 5KX5B 5AVYA 3E35A 3KYJB 4HH3C 4ON9A 4FFDA 1G6OA 4YP5A 4UEJA 3V1YA 1NXTA 2HIAA 1KAHA 1N6KA 4OKNA 4KN5A 4QOEA 5DLPA 2DH6A 2GAJA 2O2JA 2QJFA 2QM7A 2XAAA 1HBJA 3A7EA 3GJRA 3U5TA 1EXWA 2OZEA 1O54A 2Z3ZA 1R64A 1WD7A 1NUPA 2R48A 4BVAA 3WGJA 3TTSA 4WLEA 2EX4A 2XUOA 3WO1A 5BR7A 3D4IA 3OPXA 3T5TA 5IFKA 5IUJC 2WHXA 3E7FA 1KMCA 4TMFA 5DRYA 2IRWA 1ZM2A 3GB9A 3B6EA 4P4LA 2FPSA 3V4LA 3ODGA 5B3JC 4YR9A 5I9IA 1HURA 5G1PA 4B3SB 2GZMA 5L53A 1V1RA 4B5KA 1F6WA 2G9ZA 5KCMA 2AJ8A 3AL2A 4BFVA 4QJIA 2XXJA 5ADHA 3V4ZA 4F7DA 4P35A 3S44A 2AK3A 1NF8A 1X7HA 3QELA 4RIFA 3IFSA 3RSCA 5BN4A 3OTWA 2OXTA 4JT8A 2R87A 1WKVA 1UAGA 1PK8A 4B3JA 1NLUA 5FTJA 2AA3A 3AERA 1M5UA 1U2GA 2OQ2A 2Q0HA 4JXJA 3VSBA 3ZXUB 3O95A 3ZTTA 4KAXA 4Z9AA 1H6DA 1CF2O 2DGDA 2FPIA 1UT8A 3B7PA 1MAUA 3CE6A 4HRAA 5DH9A 1E9AA 1DWQA 3FFTA 2CLFB 2E21A 1VE7A 5F98A 2IODA 1QO0D 1N57A 2O8FA 1NHWA 1G5TA 1OXUA 3P71T 1V5WA 1TQ2A 1PO7A 1G7TA 1ZD5A 1R0YA 1DWOA 1E6EA 3PS9A 3GFPA 1U3VA 1U9JA 2A5FA 3Q88A 4WBXC 3PF9A 3SFTA 1TQDA 2IYOA 5IZCA 5G0VA 4QHTA 4NBVA 4PNZA 4ZFNA 3NHUA 3VSCA 1DWPA 5L51A 3VKUA 3S81A 3BRWD 4D1YA 1NXPA 1PQPA 2Q99A 4MR8A 2J6BA 4EENA 3QIVA 2B5WA 2HWYA 2PGIA 1M8KA 4B9EA 3IB6A 3LGSA 2P2LA 3JY6A 3UW3A 4MCJA 3D0KA 4MP3A 1XD2B 2FUEA 5AKKA 5KSOA 3OTOB 1X86B 2BMJA 3SBDA 1IRXA 1U8UA 3EVAA 3NC4A 2C3PA 1PG5A 1HT3A 1DRWA 4QOFA 4JJ4A 4HC4A 3BTOA 4QICA 3JQGB 2Y99A 4KUEA 2IGBA 2Z6AA 1XXHE 1ZCBA 3HKCA 4N5HX 5EWJB 4RV9A 1WXQA 3DULA 3SQXA 2GRAA 2I91A 4Q24A 4L6CA 2NM0A 2VF8A 3KHTA 2FGJA 1CY7A 4WOBA 5ESDA 4ASUA 2VNKA 4MPJA 2CUNA 4DWJA 2OK8A 4DCUA 1J5XA 2AFVA 4B33A 1OWNA 1R4AA 4UU1A 3HABA 4YAEA 5GVRA 4YACA 3SKVA 3T0IA 3TCKA 1E2NA 4L4SA 3K6RA 1V6SA 1E2IA 2QRQA 1XCJA 5ER6A 3JRNA 4TVBA 1HL3A 1LBIA 4OQYA 1SOAA 3EUWA 1JMYA 2QG9A 1RWPA 1SGWA 3D6VA 2DJ5A 4PSDA 4L28A 4TTQA 3R9XB 4RC9A 3GFBA 3ADBA 4NCKA 3WTBA 3ENNA 3FJYA 3GMSA 3DM9B 4XRRA 4Y2TA 2OCPA 4RWZA 5EJGA 2V5UA 1T0HB 3RM3A 4CKZA 3LUGA 4PZPA 5ALTA 3UBTA 2ZRAA 1V8OA 1OZGA 1GU1A 1TM5E 3HQ4O 4PAQA 5JZBA 1F1JA 1I3MA 2CL5A 3QNUA 4CDNA 4W5OA 3IA2A 4U7HA 1KDVA 3HN2A 3CSUA 4MWSA 5K8JB 4RY0A 1OC2A 1TGVA 3LHFA 3SF8A 1YQUA 4NX2A 5KYYA 3NNSA 2GILA 5A7HA 1OZFA 4JSYA 2EARA 1W7AA 3DLHA 3PR3A 5CUQA 4E51A 2AW3A 5HILA 1GY8A 4X8LA 1S9HA 3LYAA 4DWOA 2AQHA 5TC4A 3KFLA 4GKAA 3EDOA 1H1DA 1N9ZA 4JELA 5CA1B 3OZWA 2RJNA 1GARA 1Q16A 3RUFA 1XLTC 4EQ6A 2ZQZA 1K7SN 3V55A 2EF1A 5LZ4A 1K98A 1PR1A 3WKCA 3PPXA 3W1EA 1R0KA 3A6JA 3H2JA 3KXLA 2ONJA 5LYYA 5K6TA 3RYIA 1E58A 3RREA 2X7JA 2PKYX 3TJZA 2G1JA 4LG1A 1RPZA 1XJQA 5HIAA 1IUOA 2O1SA 1NN1A 3P0IA 2G4VA 1U4OA 3CR8A 5K3BA 1EK2A 3L7DA 2C9CA 3RRXA 5CCXA 1G66A 1CG6A 1P19A 3KKKA 3N59A 3T06B 3F4RA 5KX5F 1TJ4A 3WAJA 2NSYA 4LCEA 3F4SA 1YAJA 1XU9A 2X4DA 1GRRA 1S4QA 3ADPA 2IDZA 5TNXA 1RAAA 1VP3A 4G8DA 3Q9SA 2D2FA 3QLEA 4JLKA 1M6EX 5C37A 4ARSA 2ZSDA 1LWNA 1W9HA 2GDJA 2XIQA 3BGVA 2PWYA 1X92A 2ZIVB 1MLDA 4YP7A 5FADA 3P9SA 3ABIA 1RYYA 3CB4A 2YWEA 2GN6A 3S2GA 1A2OA 3EEYA 5K8IA 6ABPA 4IDNA 3IHKA 5D8DA 5KDLA 2Q9BA 3IEIA 1QC5B 3GJ7A 1WCYA 4G0YA 1R10A 4TLAA 1E89A 4XIYA 1KXZA 1YS9A 2C9YA 2HOQA 2QSZA 5HM6A 1NJ8A 4R1TA 5C5IA 4DR5B 2NU7A 2Y9MB 3A9SA 3RFVA 2XRMA 3R76A 2YV5A 3E1SA 2CB0A 2OLJA 3V97A 1PQYA 3B9PA 4V24A 1ZI6A 3H6KA 1EZ4A 1WEHA 4PQGA 4DAOA 5ALEA 3MRTA 3LHDA 1TT5B 4XQ0A 4IW3B 3DSRA 4HP8A 2ESRA 4KQ6A 1XZKA 3Q3JB 3RC7A 4BMXA 1MW8X 1YZ3A 2WWRA 3KLOA 3LQFA 1PNQA 3RJTA 1YMVA 2WWTA 2HMSA 2ZT7A 2OYSA 3M4JA 1C9JA 1QC5A 3QU2A 2YV2A 2HHCA 4EITA 1KDRA 3DMHA 4ZRMA 1DV1A 1TDJA 2OCXA 2ZYTX 1SOWA 3PD0A 2WFMA 3A6DA 4NYJR 3DQZA 3TIGA 2LE0A 5DVZA 1E1NA 1PZEA 1SK9A 1XWWA 1YNOA 5ER9A 3JQRA 3UUEA 3UC9A 5IXSA 3QEKA 1Y42X 3USZA 5U1PA 4FYKA 3IQWA 5CX4A 5ECGC 3TIIA 2I4OA 3U49A 4R0MA 1P1KA 2WD7B 1WVMA 3PQCA 1H94A 1KMQA 2HLHA 4ETIA 1PJBA 3SF8B 4D6XA 4NE2A 4F92B 4G89A 3SGLA 3K9CA 1Z29A 3ADKA 5NLLA 2C4TA 4CCAA 1YFEA 1KO5A 1SC4A 4DCPA 2AR0A 1FYXA 6GPBA 1C3XA 4BNNA 2H4YA 3WIBA 1KSFX 3RUHA 2VT2A 3R7WA 3BMXA 1PT6A 3DOCA 2C7BA 5EERA 1TIKA 3A2MA 4NIMA 3PLRA 2C1ZA 2QTVA 1GKIA 2Z95A 1M2JA 4I2VA 4WFJA 5EZ6B 4ZCTA 1KARA 1KYIA 3MTQA 2E6UX 4TV9A 1C4XA 4GGMX 3PHBE 1W5BA 3W3AD 4ZDKA 3BFXA 4DUZB 1NJ5A 1EIZA 1U9YA 2H5IA 3PDIA 4DDMA 4YXWA 5KQPA 1UMKA 2FG5A 1ISIA 4B84A 1X39A 2O1EA 3WB9A 1IHYA 1ZH0A 2EP8A 1BS1A 1MRNA 2O6LA 3A9CA 3BIWA 4NMHA 4OFZA 1CY8A 4Q39A 2P4HX 1Y98A 1F14A 3AIIA 1EGHA 4MLDA 4I8IA 4Y9SA 5DASA 4B7UA 3OEHD 4NV1A 4RD3A 5JS6A 4Q9JA 3QVJA 5D7NA 1WHSB 2QRZA 3KHKA 1FDIA 2YWCA 4II7A 2GWRA 5F92A 4LZOA 1TGYA 3SNHA 4UEOA 5EJFA 4B7ZA 1PGJA 2P9EA 2CXPA 4QFCA 5EMKA 3WMXA 3AUXA 4CMEC 4LYFA 2AJLI 3E3OA 1DKNA 1CUSA 2BHLA 1E9DA 1RDFA 1SVWA 1L4UA 1T8PA 4GP6A 3LUKA 5DOVA 3E15A 4E3WA 3B3AA 3MMXA 2B34A 1CTQA 3NTRA 5COQA 4B71A 2P9GA 3RBZA 3R6DA 4IDBA 3AF4A 3ZY3A 4C1BA 2A92A 4OIMA 4UHFA 1XPUA 5EIFA 3C5VA 1Q6YA 3VZQA 1SUIA 1XP8A 2JPDA 2Q5EA 1PRYA 1IBRA 3H87A 4X00A 1HF3A 4G56A 1UXOA 4DNXA 1VIYA 2XMRA 2FSUA 3G1TA 3QMMA 2Q3JA 2G06A 3WI7A 3R4CA 1Y6GA 5AKZA 3CVOA 2VYQA 4H08A 4B2IA 4UJ5A 1PDVA 2IYFA 2UV8A 1O8CA 4UM5A 1RC1A 1MRZA 2X6QA 4GC5A 2G4LA 2F59A 4ZANA 5FBLB 3SLGA 1GTSA 1F06A 4G8JA 4NCBA 4J2TA 2R1TA 4ILEA 4IUCS 1SXHA 5AI5A 5E6UA 1D7OA 3KVVA 4BO5A 1Z6PA 1YRBA 2CNBA 3M2TA 3HJRA 4NDZA 1Q1EA 3HJFA 3OP1A 5I7SA 5ESWA 3RK1A 3S2FA 5EESA 4ZYVA 1GSOA 1I0LA 1FF9A 4H7IA 2H5JA 4UDOA 3HRHA 3VR5A 2E3JA 3H6GA 1MC4A 4UHJA 1NKSA 2Y67A 3I6YA 2FX5A 3MVEA 3N76A 4TQAA 1NBIA 3LWZA 1NUUA 2ZBQA 2YJ6A 3TGWA 2XRZA 1UKVY 1VM6A 3DEAA 2FUKA 3RKUA 4HLDA 4ASUD 3FYDA 3O4FA 2WSSA 2VUTA 4YUYA 4AS1A 3AWDA 4MV1A 1ZESA 1TFUA 2HO4A 2O50A 2XVZA 2Q49A 1GZ3A 2QP4A 1U02A 1MC8A 4M1WA 4PHCA 5BXYA 3AESA 1ADYA 3A7DA 2Z8YM 3G23A 4BGIA 4C22A 1SU7A 2FMIA 2C5EA 3QOXA 4MCHA 4FYYA 1ZO8A 3H0KA 1E7QA 4HNRA 5JDIA 5I7RA 4AQ7A 1IATA 3L1HA 4M37A 3M81A 4G0ZA 5DKFA 4C29A 4EVSA 5KQRA 1YGPA 5JD6A 1TJVA 4V1CA 5A0FA 2CDRA 2VRCD 1J09A 2X5XA 2GN8A 1EXNA 3F5FA 4I50B 1Y5LA 4IOMA 3J81A 1O94D 2ZE8A 2HADA 2VKQA 1FJ2A 3ZVLA 2OWDA 4FNOA 3S8MA 4G23A 5H82A 1THMA 4D74A 1S9DA 1FMLA 3B3QA 3QH4A 5CTJA 4YR7A 5EOVA 5T7BA 1SG9A 4RGVA 3LYUA 1XWIA 3WL7A 4YS6A 5ALWA 5GVSA 4RA9B 3BAZA 3T3EA 2OXFA 3IKJA 2IEGA 1ID8A 1SOUA 2IA5A 1YOBA 2VYVA 3SY8A 1RZUA 2ILVA 4E31A 3M7IA 1BJKA 3K5HA 4S35A 2A88A 1ZIXA 4Z0NA 3RUCA 1Z0KA 2VLIA 2Y6UA 3T4UA 1J07A 1E77A 4YMVA 4HWTA 3JYHA 2Z5LA 1TI7A 3UW1A 5K0SA 5C2JB 2N46A 2JGDA 2WWWA 3DVRX 3IILA 1DXHA 1Y8ZA 1KI2A 5AXDA 2AI2A 4CF5A 4PLGA 3W9YA 3ZDZB 3MBIA 4W9NC 4ZQFA 3BE5A 3OE7A 2QN8A 3TM5A 2WSIA 3ND6A 4H7FA 5EP4A 4JKYA 5AI8A 2K87A 2JH8A 4YT5A 2C7RA 4K6GA 4U9UA 3Q2KA 3SYLA 2JLUA 4PSKA 3GXOA 2GD1O 2Q07A 2HQBA 2EIHA 3SQOA 2P8JA 1Z7GA 4QJ4A 1G59A 3QX7A 2XQGA 2EHJA 3AB3A 1LK7A 1XTKA 5ILGA 2QV0A 3O2NA 3HFRA 3M4YA 3EF0A 1MABA 4D41A 1LRJA 4AZ0A 1Z6AA 2XMQA 1IDN1 1RAEA 2YV1A 3Q9NA 3FZEA 3VGJA 4DVJA 5I01A 1T25A 1QHIA 2QPOA 2UVPA 5G0SA 1DCNA 1FTWA 4WXEA 5DTIA 2CFCA 3D7MA 4YRKA 2VJNA 4REQA 7ABPA 3AVYA 1RBQA 2GK4A 2VP2A 2ZIFA 3OX2A 4H7JA 1Z5PA 5REQB 3I04M 2FPGA 4HFJA 5LM3A 2IXEA 2QTBA 4JLNA 4ZDWA 3TH5A 2FPRA 2ENUA 2H1OA 1R4MB 4R1QA 1VP9A 4NJMB 5ICEA 3UMRA 2G71A 3UAOA 2AYXA 1L2TA 1VE1A 2CVQA 2DBVO 3K8QA 2R7KA 3LRTA 1Q1GA 4RTRA 3D6HA 3HYNA 1AKTA 2FMHA 3R5TA 3UFBA 3ITDA 3OD5A 3E03A 1XEWY 3NZEA 4HGZA 3I6IA 1Z63A 4US0R 3NHZA 3OQPA 4RPJA 4ZI7A 5ALHA 4PX9A 3NHKA 3V32A 4DY6A 1XE3A 2CHEA 1L4EA 3ZDFA 4BLUA 3EVEA 2ZBVA 3OC0A 3QUSA 3TL3A 1E4EB 1ADGA 4MKGA 5ICFA 2DTEA 1AX9A 2J07A 3M49A 3NWJA 1P5RA 4EGAA 5B6JA 1A4RA 4CGZA 4Q3DA 3ETGA 3LVBA 3O8DA 2FZVA 5K3FA 4UHKA 3PUZA 4MWOA 4JUBA 5CP8A 3RUDA 1SRRA 3GEGA 4A0FA 3NGXA 4EG3A 1DLIA 4B3CA 2MR5A 2OVFA 1HDRA 1D03A 1HQKA 3EPRA 1H93A 2B69A 2ZYSA 3OESA 3NBXX 4V0NA 3RARA 2CMFA 3IBGA 4TTIA 1INLA 4L95C 3TLBA 5I47A 2AN9A 4LXIA 5GONA 3NTUA 4HLUA 3U1TA 1IQUA 4H17A 4H4CA 4LEIA 4BX0A 3UMSA 3ESDA 5HOQA 4BV9A 2OZLB 4NPAA 2MSLA 3F4TA 5TIIA 1Z2PX 3KFVA 2IDKA 4F1KA 1RRVA 4WMLA 3KEOA 1Z4JA 1SXIA 3FDXA 4TT3D 3PEFA 5CITA 1CXZA 3RDPA 3AG6A 4A26A 1XLWA 4YPFA 2YQZA 2M6LA 2I33A 3UK2A 3FKQA 3ZD8A 1YE8A 3QBDA 1SH7A 5IK2A 5ISMA 3IAFA 4CLXA 5KU7A 1KQGA 3KUUA 1XRJA 4MTLA 3LAWA 3PQ7A 3I9KA 5FUQA 5LBUA 1YMUA 1YXMA 4EI2A 3LC2O 1O5IA 1USIA 3PIIA 4YUZA 4IJMA 4O2AF 4Q15A 3GEEA 4D79A 2E82A 3TQSA 4KQMA 3CT4A 3T3IA 1T5IA 3WYAA 4OIFA 1TF2A 1I6WA 1RI2A 4Y0NA 3VOTA 3G13A 1IAQA 2H1SA 3R75A 3ZQKA 2O0MA 5CYGA 1YWGO 1BDJA 3CH4B 2DUNA 1BMFA 3C39A 2GM9A 3DDZX 3C6MA 3ZNQA 2ZTMA 2CJXA 3SBOA 3WLMA 5I4BA 5JJIA 2ZSFA 2UVPB 4MGIR 1UMDB 1VCOA 4G5FA 4Y2YA 5DB4A 1TK9A 4HQNA 3TRJA 2C5FA 5B3LA 5KOIA 4AS3A 3R3JA 1Q92A 5FWYA 3FPFA 3WB2A 4NPCA 2D2VA 2R6DA 4IEIA 5LZ7A 4OHRA 1YBFA 2ONKA 4LPKA 4XQGA 5KEIA 3Q8KA 1XZLA 4TV8B 1X2BA 3THXA 1NX6A 4LJAA 3DD5A 2IUSA 2W11A 4C30A 3ZCRA 4A92A 3OQHA 1QE3A 2EX1A 4E7OA 1NE2A 4BQPA 2NG1A 3NHMA 3H8JA 5KZMB 5G1OA 4WACA 3E7DA 4HDMB 4I46A 4ZARA 3FPEA 1GV1A 4UU8A 4KLCA 4EFNA 2XHZA 3FAKA 3E2IA 3WQBA 5JYDA 4DC1A 1OHHD 1T5BA 1X8XA 1NYRA 3ZE6A 3VYVA 3R7NA 2J08A 3TTTA 3M6IA 2JCYA 2K4MA 1SBCA 4UNIA 1GNVA 3ZY4A 4DARA 4HGNA 1NUHA 4C5CA 1WUJS 4MVCA 1Z5WA 3KX2A 4LCBA 1GTMA 5BSMA 5DTQA 1BX0A 1OT3A 5DHTA 4M7WA 1FQKA 1Y1PA 1Y7LA 5F2EA 1E2FA 5FI0B 1Y4DE 3FFXA 1GEEA 1JB1A 2MYPA 2V5AA 3WJ7A 1YQTA 3VHQA 1P9RA 1CS0B 1NC1A 5CXQA 4L1KA 4R7GA 5T67A 5HJEA 3W4KA 3GPLA 1OLSB 4CTKA 1P60A 2XMBA 5DW3A 4RULA 3S2UA 2D8MA 4Z2AA 1M34B 3KJQA 4JC5A 1FVHA 1N8NA 4O59O 3FCAA 3RGGA 3AY3A 2HVGA 4X6YA 1Q7TA 2LWIA 4W7HA 1MX5A 1PBTA 2XA1A 4I9GA 4YDSA 2IFTA 1MO6A 1P7CA 3QKIA 2XE6A 3FKSA 3GFSA 3H2HA 4HAYA 4JU9A 1NC3A 2R25B 3ICOA 4G5OA 4TT3A 1ZUHA 2R4UA 5FAXA 4JLAA 1N7IA 3JWEA 5EAIA 1N6NA 2HPHA 4UTPA 2HR1A 2WQZA 3BG5A 3C7TA 4QSMA 3ZWMA 1KGSA 1UJBA 4ZDJA 2ZJ8A 4RKQA 1OASA 1X42A 3VC3A 2C8JA 4QPJC 1A2KC 4EMUA 4ENPA 2QPTA 3AESB 3SJAA 4WNAB 4B34A 2BONA 2Z2XA 5F3DA 4B44A 2RK4A 1BXRB 1TEVA 1LA2A 4LKRA 4MROA 2R62A 1I5EA 4WN9B 3WXMA 5D2CA 5ALFA 2QRKA 4FD3A 1KF0A 4AULA 3TXXA 2Q5FA 4BQIA 2H59A 4F2GA 1AE1A 5AJZA 2V3CC 1JFLA 5DYTA 1UZAA 3TE6A 1EP1B 3HB1A 3FGOA 2GBGA 4L73A 4MB6A 4PYQA 1Q3TA 3T9CA 1GAXA 2VAXA 3CI0K 5CNMA 1W4BA 2YMQA 2G8LA 4CTNA 2OHGA 1B0UA 1THGA 2Q28A 3COWA 3ZTYA 3A4NA 2V9ZA 4L02A 3FVVA 4Q5IA 3K0FA 3CV3A 4TYMA 5DLEA 1MKYA 4FTWA 3PNVA 1E20A 1L5RA 1BE0A 2VHTA 2WKSA 4E03A 1YQWA 4QDKA 4ZTBA 4IGKA 3U7IA 4C3UA 4CQMB 5JDIC 3FKSD 3H7AA 4RKWA 5D1NA 2PSFA 2C96A 2LZ0A 3W5JA 4QGGA 2HTEA 1YE5A 3PX2A 3QPAA 2QX8A 2GBFA 3RE1A 3OPYA 4XB1A 4EYEA 1ZK1A 2D6FA 3D02A 1SAYA 3HO1A 1V8FA 3HYSA 2X9NA 4G1EB 1RYZA 8GPBA 4M1OA 2J3EA 5AJUA 1ZVVA 2I87A 3Q87B 5HKBA 1WPGA 4FIZA 4H1VA 7GPBA 3CW9A 1WY5A 2YN2A 1UFRA 2ZT5A 3B12A 2FZCA 3GQBA 3PQDA 1M10A 5KAMA 4BNKA 5IABA 1I3KA 1PEDA 2H92A 3EFHA 3R5JA 4H15A 4IZHA 4TN5A 4U39A 5LQJA 2BMEA 1C50A 1SHLA 2W7TA 1HA3A 3LKVA 1CF9A 3CZRA 2ZOSA 4E33A 4RF2A 4TVSA 4KDEA 2XRYA 5EXXA 1N32B 1FMFA 3DXZA 2G08A 2PS0A 4FHCA 4C0QC 4QWMA 3HR4A 1OR8A 1Y4ZA 3DFZA 3S1AA 1M8JA 3WWZA 3DR5A 1CVIA 1G16A 1Q2UA 4UMDA 721PA 2ORVA 2FJPA 3ZLVA 3FNBA 2NUTA 3L1UA 3W6ZA 1XTIA 3FI0A 1XAIA 4JJ7A 1CEQA 3EQ2A 4OXIA 2WICA 4C3ZA 5ABPA 1K6EA 1DCTA 2OMKA 4OY3A 5HIJA 4W9NA 1E1MA 1K8YB 1I80A 4Z7OB 4RPGA 4ZI2A 2HA6A 2JAQA 4OHVA 3VPBA 1V26A 2R8ZA 2VG8A 4DV4B 3KYIB 1WDKA 3DUWA 4URUR 3WTCA 3SEAA 3IP7A 1SQFA 2B1IA 4R3WA 4HF7A 3SZUA 5LP1A 1PJCA 5G40A 2QQ5A 3NTQA 1DLJA 2PSDA 2CMGA 4GX2A 1U16A 3GJSA 3QEMB 5JV5A 3VR3D 3PF8A 4LYAA 4I99A 3SQDA 1G5HA 2C5LA 1Q5NA 2XECA 3OZBA 4B47A 3W04A 1R3UA 1E4YA 1TPYA 2X76A 4JGIA 4M1TA 2Y1EA 5DYGA 4B9AA 4X63A 2VPZA 2ZUVA 2GAAA 2HV8A 6AT1A 1SXJA 5I6DA 1ZGZA 2FW7A 2GMWA 2ZAOA 5LXTF 3O8BA 3D6FA 1U2QA 3N3AC 4NYIR 4M1MA 4YQYA 5PNTA 2WB2A 3DB2A 3HE3A 1E1QA 1RLOA 2I1LA 2NUPB 3CONA 1HMYA 1OZ0A 1NVEA 2DBYA 3W0LB 1JRLA 1ICEA 1U6JA 3M9LA 1UUFA 2J31A 3IQFA 1F38A 2JLAA 3BH7A 3ME5A 3PFGA 3Q8WA 4JJZA 4OHOA 4ZP1A 1E7WA 4DCTA 1OB5A 4BWGA 5JJLA 4DCCA 3L8EA 5LQRA 1UBFA 3RK4A 2QT0A 5BSTA 2ZREA 2J9YB 2XVAA 4PIMA 1QK3A 3IAM6 3BX1A 3U37A 1BNCA 4PZEA 1LPSA 2PGJA 3DLPX 1KO8A 1H3NA 3HKDA 2AXNA 1M34E 1EP2B 1NRJB 1H6BA 3T4XA 1RRFA 2A5GA 1NV9A 1SG6A 4KO1S 3K0HA 4R8LA 1N0IA 1TVEA 1NMEA 4QGSA 5K03A 3SYTA 3I6BA 2CNDA 5IJAA 1EXDA 3M6UA 2MTBA 4R98A 2F3RA 4BLWA 4CQNA 3GD5A 2YC4C 2QRMA 3CG4A 3EYAA 3F7NA 2W2OA 2W6PA 1Z18A 3I2HA 1H3EA 1VL1A 1Z75A 3NR2A 1P77A 1XZDA 2Q3DA 5AVUA 1VJCA 3NHWA 4NK4A 3F3MA 4W8GA 3UMFA 5JQGF 3A25A 3Q6IA 4LRSB 3SMVA 3P1JA 4OAOA 2EKZA 2R7AA 3GUHA 1PBNA 1JALA 3D6JA 3IRUA 4HNVA 3D3EA 3JQDA 2NU8B 4X6UA 1T0BA 2A86A 4NOLA 1G6Q1 4JJIA 4AXBA 5EIXA 1QBKC 4KPYA 2W43A 4PV7A 3BIOA 3D0RA 4HDKA 4O4LF 1V7QA 2FU5C 3I12A 1XRQA 3LWNA 1ZJWA 4HRVA 4R1PA 4RCYA 3RF7A 2AI1A 3STHA 3MJEA 3ICVA 1UAAA 3AL0C 3LS2A 1FXWF 3RSQA 5BNIA 1QRUA 5JAMA 4PBTA 2EGUA 3KZVA 1EZZA 3F71A 3RS8A 4GLLA 3TAXA 1E3SA 5CNJA 5AIBA 3LA8A 4I19A 1W6UA 5BQFA 4I5DA 1DX6A 3C5HA 4N12A 4XX1A 4B0PA 3U13A 3CVWA 1EB9A 3HO8A 4FC6A 1VLQA 2VJOA 2JIRA 3GDFA 3OUUA 1D8TA 4LXYA 2V45A 2BFDA 3R41A 1NI4B 1N1MA 4IIHA 1UC4B 2FG6C 4OREX 4WXRA 2V6JA 2NUAA 1S0UA 1E7YA 1T5HX 2P9HA 5JAOA 3SSNA 2JLWA 3P32A 5JASA 3BE6A 1Y4AE 2SNIE 5JSYA 2J30A 1T15A 3ORFA 2Y93A 3CH5A 2LD4A 2RIPA 4PO1A 2JC3A 4JP8A 4NAUA 3SHTA 1J6UA 1NSYA 1YOVB 4PG6A 4EELA 5B55A 1SBYA 3GH3A 5CVUA 4QTTB 4CFZA 3M1AA 4JSRA 1VG9B 3TR0A 3IT3A 4JYAB 2C2BA 1GLGA 3NBKA 3I37X 4EUFA 2PVCA 3ERCA 5AUOB 4I6EA 4UUQA 4CKCA 1FDWA 1LS1A 3O5AA 4FR2A 4CTJA 4QVKA 4R1MA 5C31A 4EG8A 2Z9DA 5HTKA 3O21A 2PQ0A 3T95A 3UAXA 3WJAA 5HQ3A 5IT9A 4AF7A 5KO2A 2D0OB 5CB8A 4ALJA 4CN9A 2VYNA 2PYDA 2WHEA 3T7JA 4P5DA 4BFCA 5HZMA 1JIXA 1CEYA 5AUPB 5P8WA 1RRCA 3H0EA 3FTDA 1U2DA 2JKVA 5DHRA 2C9BA 1IMJA 1QG2A 2JJ2D 3B2EA 3QKUA 4X24A 4FC7A 4C4TA 3MFQA 5SY6A 5B2FA 3UXYA 5K1ZA 3L49A 4PXYA 5BN1A 2CE7A 2G07A 3RUPA 4G2NA 3R1IA 4D3FA 4EJ0A 2QMUA 2F67A 3L4JA 3UC5A 1G8YA 2QE7D 1Z7WA 2YZGA 3MPUA 2PD6A 5DYIA 3WV4A 1CY2A 3JVEA 5BSKA 5JJBA 3DA8A 2QRVB 3W6PA 1UK9A 1WZIA 3IA7A 3PLAE 5KTRA 3KJHA 4H2DA 1GUZA 2P6OA 3NC1C 4JBNA 2QLMA 3Q7IA 3H42B 2A3NA 3DMTA 4II2A 2NU9B 3ZY5A 2OV8A 4XYLA 2FX3A 3DL0A 3IO3A 1IZZA 3BWXA 1RKUA 3FRIA 3MOIA 2R1VB 3UANA 4COKA 1R6VA 4B6QA 4ER6A 1TT7A 2VPPA 5FYDA 4OAPA 4E1AA 4EQZA 2Y1FA 2BZSA 4GPTA 4PVDA 3TQOA 5GINE 3AKCA 2WT4A 1U0TA 4CL8A 4FMDF 4L16A 3H9CA 2RB5A 2RJOA 3QLVA 5TQ2B 3A9VA 1WF6A 1P1HA 5HIMA 4FYMA 1IM2A 1I24A 2X19A 1JSWA 4DABA 2CHFA 3EHEA 3AEUB 1RQLA 1FDSA 2C42A 2HZ7A 5F3RA 2HPVA 4ABTA 3VYTB 1WCV1 4TVKA 1KK2A 4EO4A 2Y8EA 4K28A 5AJTA 1XA3A 3FROA 4LE1A 3IE0A 1HGXA 5AM4A 3R5FA 1BKYA 3VO8A 2JFPA 1DBQA 2H16A 3HJTA 5JQGA 3K4PA 3OMWA 1S2OA 4KI0A 3NTXA 2BKEA 5CG1A 2X2EA 4YJ3B 3W8DA 3HA5A 3PNOA 1UJMA 2VSQA 3B51X 3KZMA 4A0HA 2BFCB 1RC0A 3TFQA 3ENZA 3T9FA 2FSVC 2G9UA 2OL4A 2OR3A 4LSWA 1F2UB 2YWDA 4JK3A 1V1MA 4Y18A 4ND3A 1FURA 2GA8A 5C1IA 4H77A 4QL3A 2HMUA 5EKTA 3GGGA 4WXHA 3DAFA 3IERA 4Y9TA 4BL5A 4BO6A 3DTTA 5BMVB 3AV0B 4GH5A 4NMMA 5A4IS 5K09A 4MUBA 3BQ9A 1ZH4A 2IYTA 5FA6A 5A4KA 5LYJB 4MGHA 5EJ7A 3BC1A 3NFYA 3OIDA 3NYWA 4FOPA 3UAWA 1I4WA 2NYUA 4BX2A 1UC5B 1AJEA 1YJAA 4ZU6X 2J3DA 4I3GA 1U2ZA 3HB0A 2A0UA 4PC3A 3HZRA 1TKAA 2JIOA 1E2QA 5SYMA 3KT0A 3W5DA 1ZNWA 4XRGA 3HEBA 2XVXA 1PSWA 2JF0A 2XPCA 4C4YA 4F4IA 5F4BA 2YIVX 5F7ZA 2CD7A 4ARVA 3ZZTA 2PKWA 4KWTA 1ZIDA 2W48A 4RYDA 4ZAGA 3R5HA 4B4DA 1EQ2A 1W0KA 1RLJA 1NOKA 3PDUA 1OLXB 3UKJA 4ZOAA 1GHTA 2GZ1A 2PL1A 1UT6A 2C58A 2QV7A 4JVSB 1X2EA 4UJ3A 2QRVA 4XWYA 5F35A 2CLLB 2ORED 3G85A 2VQEB 5UKDA 4R9UC 4Z4IA 3KOMA 1WPRA 1WG8A 4MIYA 1FQWA 4F4UA 4CL3A 1N2HA 1LGYA 1XCBA 2YRXA 4KMOA 4YH1A 2BKLA 3AEKB 1TADA 3URKA 4EB6B 2ZCUA 1GGJA 1YUBA 3HCPA 3R6VA 3FUVA 1JQBA 3STXA 4EJSB 2GF2A 1E1QD 4C4ZA 4A4DA 4JJ8A 1VHLA 1WCWA 1FFXA 2RHBA 3IQZA 4MRNA 4P53A 4UU0A 4ER0A 4PHTA 5B3JA 2XW6A 3TEMA 1U2TA 3ELDA 4MHOA 5HX7A 2VNIA 1PWXA 5KDDA 1RPNA 3N9IA 5KTKA 2IS6A 3W90A 1DRJA 2VTDA 3K9LA 4GGOA 2Z56A 3SDSA 3G17A 1QS0A 2IEYA 1MIOB 2KLBA 2XZDA 2OP1A 4FQ7A 2V65A 2V0NA 3NATA 4J90A 4R2LA 1CQJA 3TEJA 2EJBA 3D2AA 4UAJA 5DCLA 1WXGA 4LS3A 3H0CA 1XNRB 5K3SA 4KEAA 3OZEA 4X5OA 3ILVA 4U7TB 3VOAA 5ERXA 2JEZA 4TWRA 2LP4Y 2FSGA 2OB1A 1AKNA 1JDSA 2X5NA 1NAHA 3G8YA 1P2VA 2A9RA 2OGUA 4GVLA 4N7BA 4S1TA 5BQ3A 1E6WA 4EAAA 3C48A 4JC8A 4TMYA 1R0RE 4URXR 4Q05A 1B4DA 3QNMA 2F1OA 3OZXA 3LUFA 4PHHA 5FUMA 5JNWA 3RYFB 5DGXA 2P9ZA 4PSAA 1DKMA 4BKUA 1EJ0A 1XO1A 3VO2A 3IALA 2R85A 5DHFA 4YCNA 4OHYA 5JI2E 3MAJA 2HBRA 2CFRA 2G1AA 2JFGA 4O6VA 1H6AA 4GOJA 4NMWA 4L4RA 4PRKA 4DMUB 1SVMA 1OX4B 2OMEA 2QW0X 4CM6A 2UZ3A 1T1IA 2F17A 3C3BA 4QHSA 3OCWA 5AVRA 4D2IA 4RA6A 4WK2B 3AHFA 2XUDA 4G0VA 2EKQA 4XX0B 2ZJAA 2EFCB 1LRLA 3H4MA 2PAAA 4JUAA 2ZVDA 4MGYR 4NESA 5AW9A 4DSAA 4DDVA 2ZXFA 2VPQA 3G7UA 3KWLA 4OYHA 4DIUA 1F0YA 1NVFA 2YMLA 1NMZA 4UAUA 4HDKB 1VJ5A 4OP3A 2X86A 1MUUA 3D8BA 2YHIA 4P7GA 3DZDA 4O2AA 4KOEC 3JWPA 3E4DA 4N7RA 2FJ0A 2NW6A 2F48A 1IAVA 2PUVA 3G5TA 4DQVA 1UBKS 2B1GA 2WUWE 1KP9A 3PIDA 3T35A 1NLFA 2DRIA 3EASA 3GFOA 2JJQA 3CVYA 2FCRA 3B5EA 5DSTA 1U3UA 1WE2A 1ISHA 2FGKA 2AVNA 3LCMA 3UGJA 4I08A 4NHOA 3N5CA 1ODSA 2BBTA 3DE0X 3DEFA 1XALA 3K9BA 1E61A 1XWFA 3WB0A 2JAUA 3LLCA 3DDHA 3QVMA 4FS3A 4EJSA 4BJ3A 3IEPA 3IP6A 2AV6A 4U6QA 3LRPA 1OLUA 5FXMA 3TW8A 1J0BA 4FFMA 3SJZA 1XDZA 4LTNA 1RVDA 2PKQP 4XJSA 3GA5A 5F77A 3U1BA 3ANYB 5AM3A 3BSWA 4RK4A 1O95A 5AKEA 2QYHA 5CFMA 1UKAA 4KXFB 3O90A 4WIAA 3NT4A 3OZRA 4IIEA 2BRUC 4MVJP 4B7CA 4BFLA 3JR7A 2BMDA 3OLXA 4M60A 1N8SA 1YZUA 1Z7EA 3OHSX 5D3KA 1WDWB 5F7OA 1AF7A 2IOYA 4PQRA 1HT1E 4BBAA 2GKSA 3TKYA 3JQ7B 3L01A 2CE2X 4OP2A 4G0MA 2I4IA 5H81A 3DOHA 5E6RB 4N76A 2Q3MA 5J5VA 5FOSA 1TO2E 2Q4BA 3BQNB 3CNHA 1R37A 5DI3A 4GE3A 4EHKA 4MPTA 4ZT2A 1JIJA 5LP6B 4LZPA 4J0FA 4KZPA 2DAPA 5CLFA 1M6VB 1M6WA 1YB4A 2GK6A 4E5SA 3QIAA 4ZVQA 5TMBA 4JA0A 5HA5A 1ZW1A 2CFTA 5M7EA 1Y1SA 1E4EA 3EK2A 3UJHA 1GV0A 5EXTA 3OCZA 3WC4A 5IN4A 4XUDA 3KQKA 4TM7A 2R7MA 3DHWC 1E94E 2AH5A 4BMNA 1WTCA 4KK3A 3NIWA 2IDJA 4YCDA 2QIOA 4V39A 1J0XO 2PUTA 3T9DA 2BEWA 1HETA 2BRUA 3VKFA 3MJDA 1DOFA 3L84A 4B4KA 3G8AA 3KT8A 4MO9A 4AWAA 1DJLA 4WOKA 1DJNA 4B09A 1NPDA 1LBTA 3LUPA 1U28A 3UH1A 1PZXA 2RH4A 1FOEB 1GNTA 4C7JA 2HDWA 5EJ8A 1AIPA 4FWIB 1N3LA 3IXMA 1CQPA 1ESZA 2D5BA 4M86A 3IQDB 2GM5A 4UM8B 1Z6ZA 5J4LA 1M2OA 4ZEMA 1JE0A 2Q9CA 3GCWA 3KQYA 5JNTA 4KR7A 3IH5A 4AYXA 2XJ9A 1YCHA 1PS0A 1G6KA 4J1TA 2PLWA 4RK7A 3H2GA 3ESCA 1UP4A 4MVJF 2OBBA 2LDBA 3SC3A 2QVCA 3HU2A 5GZ6A 4RDHA 3ZVRA 1WY7A 1EHYA 3RUAA 4C0AC 2EFGA 4AU1A 2FKNA 3A2NA 4MLCA 3I61A 2B25A 1PEAA 3NORA 3DGFC 3V80A 1TLTA 1OXXK 3HU1A 2PR2A 3AJEA 1BVUA 2AFRA 3ELBA 3PC7A 4AKTA 4E5UA 2H3HA 2HCBA 1R8JA 1O6ZA 1MDFA 4ND8A 2Z4TA 1HTTA 1NSTA 1Y3AA 4XM0A 2R00A 4IXNA 3NUGA 1WA5A 1AK1A 3KEQA 3PL5A 5JU6A 4P6VF 5KNCH 3K9WA 3P4XA 3COJA 4BX3A 5ANRB 4F3TA 3IR7A 1ZJ4A 2ZJ3A 4JQCA 1CERA 2E9SA 3F7MA 4JX8A 5A4FS 3DW3X 1A1SA 5LOVF 3T7RA 2WHRA 3NAGA 2JDIA 5DBIA 3ZBPA 2P11A 4TZ0A 4GZ6A 2V6IA 5IH7A 2EFDB 4Q7EA 2QTHA 1XPJA 3RR2A 2PS1A 4MUMA 4P38A 3EVCA 4JGBA 2GZ2A 2JI4A 3O3NB 1WKCA 2AG5A 3B52X 2QB5A 3R0IA 3AUKA 4CUKA 2GB4A 3AF3A 5B4UA 1RVV1 4C01A 3AJDA 1WULS 3THWB 3MHPA 1MAHA 1OXBB 2PSJA 1ES9A 1VLJA 2PL3A 3V4OA 3VVMA 2DLCX 3Q8MA 3IQGX 1M0SA 3A10A 3G7SA 2PXCA 1XXLA 3LC1O 3O84A 4ALMA 2O8EB 3ETNA 5MHTA 4RNCA 2Z9BA 3ROQA 5AW5A 3E84A 1YI0A 3HUTA 1ZNQO 2WVJA 1WF3A 1FFHA 1ZHFA 1ZBDA 3RS5A 4MA0A 4FK8A 3WSWA 2EBUA 4XFDA 5F5LA 1SXPA 3HPRA 1N0HA 1N0UA 4CMAA 5DM4A 1E1DA 1ORTA 3SC2A 1F7VA 3EODA 4MIOA 1NUTA 4RIEA 1DT5A 4DMKA 4C7OA 5DP1A 4QASA 2QD2A 1Z33A 2PWPA 4X93A 1JEOA 1XVTA 4ICIA 2CVHA 1P75A 3REFA 2M98A 4RW0A 5CDTA 3S2IA 1UOOA 3T61A 4YRLA 4KV9A 4PPQA 3WZLA 4ZCRA 5K20A 1ACLA 1NVKA 1RIFA 3ZEIA 1CIJA 4YQZA 4HBZA 4ZCMA 1J2YA 2I4LA 3PICA 4MWTA 1IVYA 2GJSA 4D3SA 1A7AA 4S0ZA 5FNVB 5BQPA 5EHZA 5KQLA 3QVLA 5JBQA 1YDMA 2V97A 2ZE7A 4YB8A 2GEJA 4KLRA 1ARZA 1RKQA 3EUAA 3KQLA 5BNWA 2MYNA 2GKOA 4JJGA 4BNDB 1PEKE 4EBBA 2P6NA 1ISMA 2PX3A 3P97A 3CNOA 3L77A 1U2EA 3AR6A 1H5NA 3DW1X 3VJLA 1AHHA 4LVOA 3QVWA 1NW4A 4UAVA 4Q6BA 3EZ9A 3G2MA 2IU4A 1RWMA 2I7VA 4TZKA 3ENWA 3RBVA 2HW8A 4ITVA 5DBHX 2NUBA 3TLYA 3WZ2A 1DEOA 3R40A 3UJ3X 5I4IA 1YS6A 1DBPA 4IZIA 4IDOA 4UNNA 4RHCA 3W5IA 4R7ZA 1XZPA 3AK4A 3F9IA 5KPJA 1K4YA 1O89A 3ABZA 3QEBZ 2VJCA 1XC7A 2WSMA 2XIJA 1H0HA 1MJGA 3N2GB 4O4HB 1J99A 2VIIA 3TK1A 1YR7A 4D0GA 4CTMA 1LFDB 2BFFA 2WW8A 2HQRA 3OCJA 4CCWA 1OX6A 3GP3A 1GNRA 4IF4A 3SVTA 2YNMD 1ABBA 2CLDX 3VGPA 3O1IC 1OTXA 2DH5A 2EEZA 4HB4A 5EMJA 5C5CA 5LR6A 1M33A 2G6TA 1VYVA 4ILKA 4KL8S 1ZOLA 3QBJA 5H3LA 4HEHA 5B3AA 3SVLA 3WWOA 3K72B 4B3HA 5B7PA 1C3CA 2Q46A 2ID4A 4LJRA 1O57A 4HQFA 1ZZEA 1OJLA 3PV0A 4RHTA 1UXGA 3LA6A 3V46A 1O97C 1E3JA 3BAFA 3C3PA 3KPWA 4S24A 3RJMA 4DT1B 1KO7A 4X65B 5MN5A 4BKOA 1W0JD 4X8HA 4XARA 2ZYRA 1L8LA 5FEUA 1Q3HA 3L8YA 1MA3A 3GDHA 3U4AA 3W5CA 1PX2A 3G68A 4Q47A 2ZJ4A 1P9NA 4Q3LA 2V6MA 1P8AA 2Q41A 3KV1A 3ZGYA 1PGNA 3MGBA 2PS3A 2JW5A 3UAZA 1E3MA 4OVKA 3RRPA 2Y76A 2B37A 1PVVA 2XGGA 3ES9A 3A26A 1L4HA 4YMGA 5FV4A 1KP3A 2FPPA 2QTMA 4QU0A 4E6EA 1I33A 1ZOIA 3A04A 1O94C 4BN5A 2ZJ0A 4OI1A 2PL5A 1X80B 5ELXA 4E6PA 3NOXA 1BU8A 2VTBA 2XZPA 2ZRHA 4ONEA 1GPJA 2GTHA 9ATCA 1EHCA 3BERA 1CR1A 1E79A 4RSRA 2JIBA 4LGCA 2J41A 3OUTA 4QBIA 4UHBA 5EJIA 5EPUA 5K45A 4JS0A 1UM9B 2IPXA 1LTQA 1JDJA 3BZWA 4FOLA 2ATCA 4NFLA 1GG8A 4JI6B 4J6EA 3HJHA 4BLRA 3C3EA 2F6RA 4E2ZA 4RELA 1RXEA 2AN3A 2SKCA 2WVAA 4N7JA 3U61B 3UMMA 3II6X 1T0UA 1DWUA 3TLCA 2P9YA 5DK4A 3IMGA 3NB0A 1NLYA 1WMFA 3DBVO 3H16A 1CE8B 1XZFA 3CRMA 3M4NA 3MTIA 4HO1X 1EDZA 4BNTA 2QTLA 3IPCA 1DQYA 2CFSA 3IXLA 4N3NA 5FPHA 4BXOB 1RWXA 3IUPA 5E9AA 3WJ2A 1O5TA 2EERA 5DNUA 3IS3A 5ICGA 3OQIB 5BN3B 5LWHA 1V16A 5J2UB 2BFPA 4TLEA 1YFKA 2NU8A 3NHSA 1Z45A 1WPXA 2EF0A 5TJ9A 4UU7A 1GFIA 5LSAA 4KO8A 3FMIA 4AI6A 1YT5A 4EUNA 3M0EA 3J7AC 3KQWA 1U8TA 3UOAB 3GT3A 2A9QA 3K1JA 1KMHB 5CIYA 1J3UA 4KFSA 1X70A 1U9ZA 2BE9A 4JJAA 1KJZA 5KWJA 3AF6A 3DOIA 4F2WA 2UDPA 4MUYA 4RGBA 5CYOA 3LX6A 5HKOA 2L69A 1XA4A 1XPOA 2JGJA 1HOTA 3QLJA 2QT1A 4HYEA 2BR4A 3CF2A 7AT1A 2PT6A 1WXXA 1EG7A 2GLUA 1PGOA 2HBZA 4RH3A 5B1HA 1LZKA 1ZY2A 4UFPA 3V2UA 4OO3A 5JPDA 2LIVA 3WLQA 3E5HA 3X1YA 3FYUC 3AVVA 5F64A 3ZDDA 1XMVA 2WJIA 2IJGX 3PUYA 4Q9NA 2B61A 4AUNA 4Y2RA 1KH2A 2REBA 3GFTA 3I34X 1GRQA 2V74B 3DMPA 3G2JA 4G37A 1Q1NA 1I2AA 1R0WA 5H80A 5FP0A 1R15A 3AC0A 1AZSC 1VSUA 3QWHA 4M0MA 5JS7A 2E4XA 3KOUA 4BB5A 3BH0A 1IHDA 1QNLA 5HXAA 4Y6QA 4D9GA 1PFWA 1O9BA 4J7UA 1MIHA 5FLXA 1ZUIA 4RL6A 3RO7A 4QFBA 4CGYA 4UBJA 5DM60 2XGMA 1V8PA 3EIFA 3MINB 3QEJA 4NKRA 3F0TA 4EAQA 4ZU1X 3ND9A 2YRWA 4K1XA 4LMBA 3GGOA 4NENB 4PFKA 5JRJA 1EWVA 1GGHA 3LMKA 4FCWA 4E70A 2UUCB 3OETA 3TNDA 1OB2A 4AQDA 2RCYA 3N8NA 2HSZA 4FFRA 4UFNA 4ZA2A 1RMYA 3SHOA 3U2QA 1EUDB 3PWZA 4GMKA 3ZGOA 2Q5JA 5KOYA 5J4VA 2PLAA 1I0ZA 4M9UA 4Q3EA 3NDPA 3MINA 4XLLA 3MUEA 2C9MA 3EXFA 1XPRA 3ZCPA 4ZZ2A 3VU1A 1FVFA 1SRQA 3LV8A 3HBMA 3O92A 4GR9A 5EI5A 2P0EA 5F9FA 5E7MA 3RQSA 4Y2VA 3WZMA 4TKVB 1WZ2A 4BCDA 3DKVA 3O2SB 2WWFA 4H60A 2MCFA 1KFKB 3KKNA 3HKCB 1ZONA 4U2KA 3VZDA 3EOAI 3C3XA 1F2TA 2XNCA 3B1YA 3P94A 3UB2A 4WJLA 3CJTA 1G2IA 1DINA 4TS1A 3JQQA 3NVDA 3QKRA 3O0DA 2KBFA 1B26A 3OOYA 1AA9A 1LZLA 4RS4A 5CYFA 1SVLA 2ZWVA 1ZLYA 2ECKA 1SXJB 4M9ZA 1HG0A 3O7MA 4PBRA 2GPJA 3THYB 3GNTA 1YASA 1YIOA 3OOWA 1N6OA 3LUAA 1FS4A 4FMDB 4KQXA 1R88A 1PNTA 2ARKA 2YS7A 4UFOA 3DAGA 1ECGA 4ZVMA 4D9EA 1ML3A 4DJEC 1A77A 1Q17A 2YZNA 3HCFA 4J29A 4WN9A 4HFRA 1EAMA 2OXRA 3NKFA 4QYWA 4EFLA 2D7DA 2DPHA 2UXCB 3ET4A 1VG0B 3OJOA 4AZTA 1X38A 2QUHA 4HQOA 3E5MA 3IEVA 4W8HA 3MB5A 4G1VA 1NW7A 1XJCA 4Q1CA 3WLOA 1ZJ5A 3D7LA 3NH9A 3RVBA 5IVKA 3GWGA 2HT1A 4L5CA 1U0BB 2G3YA 1NBME 4X1YA 3GDOA 4DWVA 1A5ZA 4ECAA 3HM9A 1GA6A 1MDBA 4HAXA 2PQ2A 4C0JA 3QU4A 4D3DA 2PA3A 3C3AA 5KOHB 3N2NA 3M83A 1BC5A 4EB8A 4JWTA 4LOJA 4RS3A 1XHEA 2GD0A 3Q7EA 1G41A 4PG7A 4H9GA 4ZTZB 1QCDA 4B6OA 2PX5A 1JYFA 1IW7D 1PWEA 3HFGA 4L8FA 2B6HA 4OI4A 5T57A 1BE8A 2B7BA 3WMFA 4A03A 1V43A 4BN0A 3V7FA 2NVWA 5EC8A 2CLIB 3PP8A 4M76B 4D9CA 3G9TA 3CWCA 2VZ8A 3RS4A 5F1KA 2CKDA 2VLBA 4PAOA 1CJBA 5H16A 5FJIA 3OJEA 1YFLA 3R9XA 3RFFA 1SWVA 1LPAB 2YJNA 3AR2A 1NBMD 4J7XA 1UAYA 1T5TA 2XNDD 3C3YA 3DR3A 1QOQB 3OEEA 4JBLA 1QGAA 1ECPA 4MDHA 4PZUA 5C1PA 1SKAA 5F91A 4CKYA 1XMOB 2DMRA 4B3GA 1Q0RA 1W2GA 3ROFA 4IY1A 4OOFA 1A9YA 1MO5A 1JMKC 1QV7A 2ZI9A 1U0HC 2O2ZA 2Z30A 4HCJA 1TQ6A 1XYYA 5J5CA 2J5KA 3TSCA 2EKPA 2P8SA 5C8DA 1RD4A 3D9QX 4B31A 2Y68A 4FN5A 3ZBUA 4DRZA 3MD0A 1SC9A 3EGOA 3MCWA 1FDRA 4QZVA 4HYQA 3GLIE 3L1IA 3UVEA 3LDGA 3FMOB 1ILEA 1GZVA 3D81A 3I76A 2F8MA 2HLDD 3P9IA 4L8VA 4NC9A 1AF4A 1IM5A 4QRHA 3LLVA 4LWPA 1OGIA 1BN7A 5A6VA 4AZ0B 1B3BA 1JXAA 1Z36A 2WJ6A 1GCOA 3QUCA 1ZUNB 1AURA 3JZAA 1PD1A 3IVAA 4CKBB 4ENTA 3KD2A 3D8SA 3JZDA 1AN0A 3SBEA 1W49A 5KB3A 1RYDA 2QDXA 2XITA 1QTIA 1M9NA 2XCUA 3IOMA 3ZJTA 1YZGA 3FZGA 4F3KA 4EY6A 5A3JA 2Q21A 3EC7A 1BDMA 1T35A 1ADFA 1K6IA 2UZAA 2BT4A 4G97A 5TMEA 2DC1A 4Q02A 5DWQA 2HCTA 3YASA 3Q5EA 1J49A 5KWEA 2QLLA 3PGKA 3DE6X 5F4ZA 1DT3A 4HVLA 4BAGA 3CX4A 3P0RA 3TWOA 2ERCA 1CRQA 4FJ1A 4G01B 4RBNA 2R68A 5C4GB 3PGJA 4FEAA 1DG3A 2XYVA 4ENUA 4TQGA 5ULLA 4YMLA 1AA6A 1N0WA 4AG6A 3TYXA 1B2LA 3I42A 2C2YA 4KDRA 8LDHA 3TQQA 3DLTA 2P6RA 4GO1A 3L82B 3ZS8A 5A5FA 1CFZA 1FX0A 4WCFB 3CH7A 4ZGWA 3GCXA 1Z2DA 4KO2S 2X0KA 2YW9A 4JB8A 4E1BA 5JWRA 1XQVA 1Q19A 4FFBB 1DUSA 4QDXA 1FK8A 3AUUA 3ORYA 3TKAA 1RAHA 2VSOA 4XPIA 4ZQIA 1BN6A 2YS6A 2XT6A 4CEHB 4HSGA 3ENKA 5I9LA 2WSBA 5INTA 1KE2A 3UWOA 2J4DA 3U40A 3OJCA 4BO7A 2I3GA 5J2UA 3UMJA 4Y1EA 4QJBA 3MGKA 1RHRA 2MSEB 4EWLA 3NC0C 4YC7A