4MUMA

Crystal structure of mitochondrial 5'(3')-deoxy ribonucleotidase alternative spliced variant
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
207
structure length
198
Chain Sequence
SNRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGTGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial 5' nucleotidase
publication title Kinetic and structural characterization of an alternatively spliced variant of human mitochondrial 5'(3')-deoxyribonucleotidase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 66
structure length 198
sequence length 207
ec nomenclature ec 3.1.3.-:
pdb deposition date 2013-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4mumA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4mumA01
5AM4A 3SHQA 4Y3UA 5AKEA 4QQFA 4CF3A 5ALQA 1ZD4A 3L1VA 3ESRA 2C8LA 2O2XA 1RRCA 2YJ5A 3WK8A 3ZVNA 1F5SA 1L8LA 1N8NA 3WK9A 1Z5UA 5AK4A 3I76A 3QUBA 3WKBA 4KNWA 5AW2A 2GFHA 3L8EA 1RKVA 2ZBFA 3UMCA 4ZEVA 3MPOA 3R9KA 3HLTA 1NF2A 5AVWA 2R8YA 1ZD2P 1YJ5A 3L0YA 3MMZA 5AW7A 4O8CA 2ZG6A 2FPRA 4YIHA 2EATA 2B0CA 1WZCA 4NAVA 4MUMA 3U7GA 5IT4A 3L0BA 3QYPA 1Z4PX 5AKGA 4DFDA 1L7PA 2R8XA 5AVXA 3ZTWA 2I6XA 3QLEA 3UMGA 3UMBA 5AESA 5AW3A 2OM6A 1SU4A 1YMQA 3OTQA 4HGPA 1NNLA 1TE2A 4UAVA 4RESA 2P27A 4Y2XA 1VFPA 1ZD5A 2AUTA 5AKLA 4BNDB 1Z4NA 3QU4A 5ALXA 4BYGA 3I6BA 2YJ3A 2ZXEA 1JUDA 3GYGA 1L7MA 1RDFA 3WKEA 2WM8A 4EZEA 2ZBEA 4HGQA 4OCZA 1RLOA 3L7YA 3MN1A 3J7TA 3W5AA 2P11A 2AH5A 2VKQA 1T9ZA 4OHFA 5AVSA 1QQ5A 4UATA 1N9KA 3KBBA 4Y2JA 3I1YA 2IYEA 2HCFA 4Y2UA 1NRWA 2CFTA 5AVTA 1RKUA 5AW4A 2CN1A 3DV9A 5A3SA 3SMVA 5ALYA 2FPSA 3VAYA 4EENA 2PR7A 1MH9A 3NANA 3FVVA 1EK2A 1RPZA 4GIBA 1XP5A 2EAUA 1XVIA 3N8GA 5AIBA 2B30A 3QXGA 3NALA 2I34A 4GXTA 1Z4QA 2BDEA 5ALEA 1RMQA 3ET4A 5ALLA 3OCXA 1U02A 2GHTA 4G63A 2BDUA 4MWOA 2R8ZA 2WF6A 4BKMA 4EX6A 4OD0A 3QU9A 1RLMA 3QNMA 5ALNA 3U7EB 4DCCA 4YH1A 5AVYA 4Y2PA 5ALZA 1TJ3A 1QQ6A 5T41A 2HEGA 4Y2QA 4BX2A 1Q92A 3KDPA 2HI0A 1S2OA 3MC1A 3SKYA 3EF1A 3P96A 2WF9A 2B82A 3WK6A 1Q91A 2YMQA 3ZUPA 1U2TA 1Z4IA 2IA5A 1Z88A 5AW0A 3E84A 3I28A 4UW9A 2BY4A 2Q5EA 1Z4LA 3K1ZA 1IWOA 4DWOA 2YMPA 4ZEXA 3AR6A 5A3QA 5AVVA 3NASA 3QUCA 3E8MA 2OYCA 4UMDA 2WF5A 5AKJA 1ZD3A 5ALDA 1WR8A 4F72A 1T5TA 3QU7A 3OCZA 3NUQA 2B1RA 1AQ6A 3A1EA 3EF0A 4HGOA 2GO7A 4I9FA 3WGUA 4EEKA 2CFSA 3RFUA 4UARA 2W11A 4UMVA 3CNHA 3R09A 4UMEA 2YN4A 2NO4A 2FPWA 4BX0A 2I7DA 3ZTYA 1LVHA 2GMWA 4JB3A 5AKHA 3ZVMA 1U7OA 4UU1A 1XPJA 5ALHA 4FYPA 4Y2RA 2FPXA 3A3YA 5AKIA 2QYHA 4KX3A 3UM9A 3W5BA 4IG4A 3ZU6A 4AS3A 2AGVA 2I33A 3AR2A 5ALGA 3D6JA 4JDPA 1QH9A 2Q4TA 3AR7A 3WKDA 4CNQA 3NAMA 4NV0A 1Z4OA 3AR5A 3ET5A 1Z5GA 2JGAA 4HGRA 3NRJA 4J2TA 3QX7A 1QYIA 2YMMA 4C4SA 3HYCA 3WK7A 1KYTA 2IOFA 2HF2A 2HHLA 5FP0A 5AKZA 3SD7A 5ALOA 1T5SA 5AW1A 3W5DA 1YV9A 3FGOA 2RAVA 2MU1A 5JJBA 2NO5A 4DW8A 3FM9A 2G09A 3U7FB 1Z4KA 2ZOSA 3FPSA 2G1AA 1LTQA 2HSZA 5AKKA 4AP9A 1VJ5A 4KN8A 2W4MA 3L0CA 3KD3A 5ALTA 4ZEWA 2B8JA 3A1DA 4HGNA 2JAUA 3WK5A 3EPRA 2OA0A 4KX5A 3AR4A 5ALPA 3W5CA 4L57A 1EK1A 3S6JA 2JAWA 3PCTA 4L6CA 3SKXA 3SLRA 2X4DA 4NFLA 5AK5A 4BEWA 2RB5A 3L8HA 4QJBA 5ALJA 1Z4JA 1O03A 5IS2A 3FPBA 2P69A 1RMTA 5AW8A 5AI4A 3OCVA 4KYTA 4BBJA 3QUQA 3ZVLA 5E0OA 4YCLA 3A1CA 2JARA 5AW9A 1YNSA 5AKYA 1CR6A 3AR9A 5AM3A 2WHEA 3L8FA 3U7HB 1L8OA 3OPXA 2ZBDA 3NIWA 2FDRA 1Z4MA 2GHQA 5AI6A 2HF7A 4OFZA 1WPGA 4UASA 4B6JA 2I55A 1RLTA 3ZW7A 5A3RA 5AM1A 3WKCA 5AVQA 5AW5A 1YS9A 4PNHA 1L7OA 1ZS9A 2AMYA 2W43A 5ALKA 5AK3A 3DNPA 4FE3A 5ALWA 3PGVA 2ODAA 3N07A 1PW5A 2ZBGA 3CZ4A 4F71A 1CQZA 5AKXA 5ALMA 3N1UA 2CFRA 4YGYA 3QGMA 3IB6A 3ED5A 2FUCA 2Q4RA 1L7NA 5AVUA 1RMYA 2RBKA 5AHXA 3KC2A 5AI9A 2C9MA 4Y2TA 1SWWA 2OBBA 3BWVA 2PQ0A 3BA6A 3IRUA 3EWIA 1L6RA 2C4NA 3ZWKA 2HOQA 1Y8AA 2YY6A 4XQ0A 1ZRMA 3ZX5A 1FEZA 1ZOLA 4I9GA 3KOOA 4C4RA 3TLMA 4Y2SA 5IT0A 3E58A 5AI0A 5AM5A 2HO4A 3OCWA 3AR3A 1J97A 3B9RA 4XOUA 4E88A 5ALUA 2WF8A 2B8EA 2IOFK 2NYVA 3QUTA 3F9RA 4XPZA 5AVRA 1TA0A 2PKEA 2EARA 3PDWA 4UU0A 4FFDA 2RARA 2WFAA 1O08A 1RQNA 1K1EA 3DAOA 4BX3A 4EELA 3AR8A 3R4CA 4KNVA 5AVZA 2G08A 1WVIA 3WGVA 2HX1A 2B1QA 4UM5A 2P9JA 4CF4A 5AW6A 3OCUA 4XE5A 3SF0A 1TJ4A 4CF5A 5AM0A 4AS2A 1RQLA 4YCMA 3L8GA 3ONNA 5AK6A 1J8DA 2FPUA 2JAOA 1RKQA 2G06A 1ZRNA 5AIAA 4UAUA 4L6AA 5ALIA 3DDHA 4UM7A 3U19A 3B9BA 2YMLA 3WK4A 2MSNA 3L5KA 1TJ5A 4Y2YA 2C88A 3QU5A 5ALRA 2FI1A 3U26A 4NABA 4H1WA 2C8KA 2G07A 3L1UA 4Y2VA 2O9JA 4YIKA 1X42A 3RF6A 3WKAA 4J03A 4HAIA 1YDFA 1SWVA 2YJ6A 1VJRA 4NWIA 3QU2A 4YCNA 2QLTA 3ZWDA 1ZJJA 4BNDA 4C4TA 2R8EA 3PGLA 2D2VA 1QQ7A 3KZXA 1U2SA 5AI8A 1S8OA 2YFYA 3N28A 4RETA 4G9BA 2YJ4A 3U13A 3N5KA 3IJ5A 4BEVA 2I54A 5AICA 5ALVA 3B8EA 5AM2A 2WF7A 3E81A 2G80A 3ZI4A 2FEAA 4UMFA 5ALFA 3M9LA 4CE6A 4IFTA 1RC8A 2HDOA 5ALSA 2G0AA 3FZQA 2YBDA 3M1YA 3OCYA 3ZX4A 3ESQA 2IOHA 2DQSA 2FUEA 5AI5A 4EX7A 1U7PA 4HYTA
chains in the Genus database with same CATH superfamily
3UJBA 3EZGA 5K0TA 4F3TA 5BOVA 4RFSB 5EKTA 4PO9A 3MINA 4R7ZA 5AKEA 1YI0A 4JR1A 1HYQA 3BJZA 1QS0B 1SN7A 4D7AA 1CY7A 4GPD1 2WB4A 1ZM3A 4H1UA 5TGDA 2BKVA 4PQEA 1G20B 5DPMA 2C54A 2IYAA 4GBJA 5LLSA 1CD5A 2VHXA 4U7GA 2PVSA 4F5DA 5LYJF 4LF4B 3IEKA 1Q0TA 3M2PA 4Y7DA 2AC7A 1OBOA 4E2WA 2W4IA 3CMCO 4LBZA 1JEDA 1A1SA 1BJRE 1E5QA 4LMRA 3ZXYA 2B69A 3L8EA 1R4ZA 4DVJA 5K6AC 4X65B 2PJUA 3EJ6A 3P0IA 4JBIA 4EVQA 1QF9A 3MGBA 3HLTA 1OZFA 2PRJA 4HVAA 4LYJA 2QORA 1GQRA 2D0OB 4BATA 2YYSA 1T3TA 1U2RA 2ZYVX 3R3JA 3H75A 1D4AA 1XG5A 3MJTA 4GPAA 1A9QA 1V96A 3TW6A 1K27A 4IXMA 4UUMA 1PUXA 1E7YA 4JODA 4AWBA 3VM6A 1K7EB 5CX4A 2FQXA 4V24A 4Z7OB 3PWSA 4BNHA 4HEA6 3PC8C 2BH9A 3EC2A 2IUSA 3RB8A 4ARSA 1FUUA 4L3WA 4Y1RB 3LUKA 4EUHA 2JCXA 4MUMA 1BEZA 1KDTA 2P9QA 4Z2AA 2HWXA 2I7TA 1UFKA 1JHVA 5FOSA 4PZPA 2ZI3A 5KI6A 3KEGA 1XAHA 4NBLA 2OZLB 3F73A 1PQPA 2EU8A 4LWOA 2I6XA 5KHLB 3IUPA 1C7IA 1B26A 2ZRFA 5DBHX 2CNDA 2D2FA 4UTZA 1PJ8A 4TMWA 5CB6A 4WY8A 2I7VA 3GFQA 5IXYA 2NSLA 4XYBA 4YO8A 5FFMA 3V8PA 1JS1X 1PW7A 4MGKR 2NX2A 1ZD5A 1RZVA 2YW2A 3ZV4A 3J7AC 3ZWXA 2NSDA 3FUXA 4QELA 4XVCA 3LA8A 1K08A 1WUTA 2R7AA 4KQWA 4P22A 2YFKA 3U2QA 4NQRA 3TPFA 4ZCQA 3L4BA 1UPUA 1SUFA 1R4AA 5LYJB 2A7XA 3A3PA 4U0KA 2QVGA 1ODLA 2QK4A 3K0SA 4QWMA 5JSFA 1A50B 1SBIA 2BFDA 1PJAA 3IIJA 2ZRIA 3RDPA 1SXJD 1HZZC 2JA2A 5LQJA 1ZCFA 2Z95A 3FOZA 4B0OA 3P94A 2PUEA 1IOVA 2AH5A 4LOKA 4BLOA 2I6GA 1YVDA 4AMGA 3KBBA 2QE6A 5TB5A 1HPLA 2DE0X 2HC9A 4BFZA 4E0BA 4Z2YA 2YWRA 3OURA 1KO5A 1RRKA 4E1BA 2RGDA 3PXUA 2ZZNA 3SMVA 1KZ9A 4F8EA 3ADOA 1R9NA 3RFTA 3K6SA 1K5PA 5KSYA 4N49A 5D5PA 2KLBA 4Y6QA 2GF0A 2PGIA 4PO8A 4YQEA 1K6IA 2Q1WA 5JI3E 3WHPA 1OASA 4M7WA 5JNWA 1O0BA 3MJSA 1MV5A 2BTQB 2EKPA 4PXAA 1D1TA 2WT8A 3RGGA 4ALMA 2DYKA 3Q3EA 5AHWA 2IP2A 5GJVC 1NURA 1L5SA 3GLRA 4B48A 5GM1A 3PFGA 1E1NA 1SK8A 2VHYA 3WGOA 3CJTA 2JFGA 3R44A 5CTAA 5EVCA 5GQSA 1M7GA 3RVBA 3SZGA 3HCBA 1JQJC 2DUMA 2O23A 5CXXA 5ALNA 3KB2A 1W581 3CX7A 3PYXA 3ZDFA 4IQ8A 3BYZA 3I9MA 4GMDA 4RAOA 4D6YA 3TMYA 2D28C 3PIIA 3DAGA 4LJ4A 3UO8B 3HFJA 3IDFA 4IMJB 4MUAA 1S2OA 3FCAA 3FPGA 2O8NA 2VXOA 1QHIA 2L19A 1DEHA 3EIQA 1QYXA 4MAAA 3WRWA 3ZI0A 3V4VB 1LZLA 4RHTA 4DMMA 5ILQA 5HJ5A 5IABA 3H9QA 3R4VA 2AK2A 2GXUA 2O0HA 2H31A 1L5KA 1JG7A 1KQPA 3GUCA 2Z2YA 1ZBDA 4X8HA 2GYVA 2ZITA 2O5CA 3BB4A 5EI5A 5F77A 4B3SB 2W8BA 1R6AA 2FW1A 4LMPA 3QE9Y 3DVLA 3AWIA 4KCGA 1VKOA 1KEKA 1NBMD 4N4AA 5AVVA 1Z17A 1ZAYA 1U2DA 1E4YA 4B7UA 1ZD3A 3HRKA 3DOEA 4Q7MB 4ZOCA 3Q6IA 4IPTA 4GYWA 3PLAE 1RQGA 2QENA 3C3PA 1O96A 2X14A 2HWKA 3NO4A 3P71T 2W2QA 5F51A 1FX0A 1ZCJA 4JYZA 1Q12A 2UXBB 3I5MA 4V1CB 2VTBA 4N7BA 3O31A 2QD1A 1HLDA 2X7JA 4L4UA 2AFHB 3DS8A 3HPQA 4IS2A 4QGAA 4WK4B 3HJAA 2NW6A 2WE7A 1SEPA 4LE2A 4WNAA 2J46A 3H1BA 4O1IA 1DARA 1Y1QA 4JEUA 4RHXA 3S55A 5D6NA 1DELA 4E1VA 2C77A 3WGIA 4HFMA 3ZVMA 2E4VA 4NU0A 4P4SB 3ZQUA 3ONVA 2QTMA 1D9ZA 3H7IA 1UK9A 1V9CA 1QLJA 2B2CA 2V98A 1UMDA 3L02A 4ND8A 5CYFA 3NTOA 1X1TA 2WZBA 3FSJX 4C7KA 3IC5A 5CVJA 5JMTA 2OHJA 1B3BA 3GD7A 1V16B 3CUYA 4I8DA 3MT9A 4JVSB 2PEYA 3O38A 1ZJ5A 4DIFA 1JU4A 1M2HA 1OT5A 5BV1A 4WINA 2BUBA 5D00A 2R60A 4N65A 4KGZA 4QARA 4L5JA 1FU8A 1GCOA 1ICEA 5TC4A 1MQ9A 2YZGA 5K8LA 2BEJA 2ZIXA 3AJEA 3RAFC 3ONWA 1ILWA 2X8JB 5JWRA 1R6XA 3FTNA 2ID4A 4E7OA 1IBKB 3FOCA 4LYFA 1G8MA 2K87A 4MP8A 3PNLA 1UMBB 2QZSA 4DMHA 1H05A 1JWAB 1KK3A 2FKNA 2VDLB 2ZI4A 5G0VA 3RROA 3S29A 5B3JA 4DBLE 3K9BA 2R6GA 4P1ZA 1RLUA 1PK8A 3DYBA 4KJXA 3VDMA 1OCEA 5C8VA 5J47A 1QYDA 2BP7A 2G25A 2QL7A 4CODB 2CCKA 2YOHA 3V97A 2AW5A 2ZUWA 3INGA 3OLYA 1GAXA 1G1AA 3OPQA 4YRQA 4YRNA 4ETIA 2GKOA 1NXVA 1BU5A 5E7IA 3MAJA 3ZHTA 3ZVKA 1O0SA 4H17A 4JLWA 4B84A 1GP2A 1XTJA 4UDOA 1Y8QB 5AHOA 1NV8A 4C2AA 1QAOA 4COKA 4F8YA 3ZWVA 2MOKA 2BM0A 5BNTA 2QUJA 2Z6QA 4MAFA 4OSEA 1UBNA 3A9UA 4LXGA 4YRPA 4LY9A 5DGIA 4Z0NA 4G2NA 3ZWPA 2C92A 3MRXA 3S6JA 1ZUD1 4KR2A 3OX2A 1T6ZA 3WLJA 5F91A 3OZFA 3PDIA 1KQ7A 4KEAA 5K3EA 3L8HA 4WZ6A 3SJUA 2X22A 4X9XA 2LIPA 4JA2A 4US0R 1H0SA 1T4BA 5C4IA 3IT3A 5HQ3A 1FP4B 4O4LA 4KW7A 2HLHA 1RMTA 2FG5A 1V1MB 5J59A 1X87A 1NI5A 3ZS8A 3E1KA 2EIHA 3I1JA 4B4VA 5HKBA 2YFQA 3KKKA 4KKVA 4LVNA 3OOYA 5TQ2A 3A4TA 4E3WA 1JSXA 1TNDA 4QQNA 3SYNA 1G3RA 1C1DA 1SHZA 1XDZA 2QGZA 2FB9A 1W4LA 3DC2A 1R12A 1PFGA 2GCIA 2X77A 3SDBA 3H8VA 6AT1A 2P35A 2Q3LA 3BHMA 2G5PA 1HE2A 4HLUC 1RAEA 5F3DA 1L5GB 4BLVA 2C61A 2GDJA 3OOWA 1D1SA 1NJ1A 1DRVA 1GPWB 4LPKA 1N34B 3AVTA 2CNWD 4V2IA 3H1FA 3IULA 4CQLA 4Z54A 3TLAA 2OESA 2WKSA 1IHDA 5JC1A 3SVLA 2WWXA 4D8YA 3EXIB 4QRHA 3B20A 4QREA 1GXSA 4XYMA 3WLSA 2Q1TA 5KTMA 3LWDA 4HNAA 3NHKA 1RCFA 2EKZA 2YXDA 1HL3A 3CRNA 4IOMA 4N3BA 5HIKA 3LCCA 1R64A 3PQ7A 3H0CA 1J00A 1VG9B 3BFVA 2X0KA 3NIFB 3ELYA 3SX0A 4UBLA 1RLTA 2IF2A 2OHOA 3IDSA 5DM1A 4DAEA 5A3RA 1U31A 3TI9A 3AK4A 4J29A 1C41A 3SSNA 5KBYA 2G9VA 3FIJA 2IYYA 3AJAA 3GDOA 4FHFA 4JBWA 1XZMA 3PGVA 4QXAA 1ZRSA 1ZW6A 2ODAA 3ICCA 4O4HF 3H3JA 1SVIA 2NAFA 1HSZA 3P9YA 3WTCA 2WIGA 3GT4A 1E0KA 1JTEA 4JVMA 1SKQA 3LVQE 3OKFA 3GLGB 1CRPA 4KGXA 1QK5A 1XRPA 3M4NA 5H82A 4YMHA 5CB4A 3T3DA 3EMVA 3K9QO 2BRUC 4MV3A 4UHCA 5THQA 4JMPA 2AJTA 1N57A 1DHRA 2OVBA 4RS4A 3QPBA 5LUBA 4CI0B 2YXLA 2CZQA 2CZGA 1XELA 5AI9A 3RTEA 2X3UA 1QJCA 2VF2A 5FAKA 1SXJA 5BO5A 3MJVA 3V32A 2WWWA 1L8XA 2YRFA 4L0QA 4B3FX 3AF5A 3P9PA 3TLBA 1UOEA 2BF4A 2NUPB 5I3ZA 3CLRD 3U5TA 4V3CA 2JFQA 4M9QA 5C1IA 3ZDXB 1TT7A 2VWQA 4RSGA 4BAZA 1Z5OA 3ZX5A 5BQ3A 2WIAA 5ETJA 2Q07A 3WNDA 1CW2B 3RNOA 4HPXB 1DQSA 1TUBB 3F46A 3MS7A 1TM1E 3OI7A 4WGFA 4YRCA 3EODA 2GBLA 4G9GA 4DVGA 3GWZA 3NBXX 1QG4A 5B58T 4CUJA 3PL5A 1T0BA 4PY2A 4EIWA 3OTHA 2F8TA 1U0EA 2O1EA 3CLHA 4MGEA 2WIKA 5E8RA 5DSZA 1ZISA 1CUAA 3HABA 3DE3X 2HSWA 3W3ZB 1ZI9A 4JYAB 1GT6A 4YJ2F 4S1OA 5C4MA 3I1FA 4UU0A 2V4MA 3M6IA 3W2HA 5EEHA 2QIPA 2FSHA 1VB3A 1K8ZB 2ZKIA 1BXZA 3B48A 5BR1A 1UP7A 1HV8A 3KAJA 5DASA 3C1TA 2CHGA 2QS9A 1KE2A 3TI7A 4B3DA 4J1TA 4MHSA 5MFPA 4MCJA 4TLMB 4NLEA 1LSUA 3AESB 2BYTA 3VNSA 4CEIA 1XVTA 3D8TA 4O4HB 2OHGA 1HO3A 1AV6A 2WZQA 2VDJA 4NCIA 4MX2A 1RTKA 4GXNA 1VSBA 1KEVA 4KDFA 3LIPA 1AGPA 3ETEA 3QA3E 4MV4A 3HA2A 4C3UA 2HA3A 3GRCA 1VL0A 2CHFA 2ZSIA 3DM9B 3CXUA 2BIFA 4ON9A 3FYTA 4JQCA 3G2PA 1LXCA 3KEMA 4IQGA 3DBLA 4P5EA 5TR9A 3VSDA 3WY9A 1HLPA 5AXCA 2WVAA 3THYA 1Y1PA 3HWX1 1NWHA 3VQTA 1N2SA 4HR7A 3RS8A 2JLWA 3CW8X 2C83A 4Y9TA 2VPZA 5K8VA 3P26A 2WWFA 2AC2A 1MBZA 2HCRA 2LR0A 1KP9A 3LX5A 4FGSA 4DG9A 4EZIA 1O6ZA 3LDGA 4RHEA 3EF3A 5FEUA 4B2PA 1AXRA 3C1OA 1NBMA 4M1SA 2FSVC 4JLMA 3E9MA 1QWSA 3HXTA 3JQAA 1RRFA 4HAUA 1C0KA 4KO2S 5CFPA 1DBVO 3CWQA 2XQVA 2ZRQA 2F3QA 4AUNA 4EW1A 5J1SB 3THXB 3GA0A 2O9JA 3BQNB 2JD2A 1P1CA 1X42A 3JYHA 4EG6A 1Y6FA 4S2EA 4PFJA 4J76A 1WSAA 1AKMA 2H17A 4QFCA 1V11B 4NU5A 1S2LA 1W5AA 3CLSC 3H17A 3I01M 4XKJA 4YLGA 4A0SA 1G8PA 3SHFA 4ZI3A 5JJIA 4P4GA 1NW6A 1P77A 1NASA 5JDIC 4UUPA 3VZSA 4HVCA 5DOVA 1R0LA 2D54A 2DCMA 2REXB 1PKEA 3DBHB 3N28A 4TTQA 2RGAA 3GZNB 1OAOA 4EF5A 3N5KA 4OUKX 3ZE0B 2Q2VA 4MVJA 4L4XA 2I54A 2UZ1A 3EIHA 3OLQA 3NETA 4PYLA 4B4UA 5K0GA 2PUHA 3LW7A 1NPYA 3QPWA 4QYTA 1YZNA 4TYYA 1CE8A 1C0IA 1QV6A 3A6KA 4LGMA 5ALSA 3R7BA 1LSJA 2O0JA 3A6LA 1T1GA 1LPBB 3CLUD 3RUCA 3V9PA 3ZEIA 2QKYA 1WQ4A 2BGJA 1FDUA 2XRFA 4IJMA 1HH4A 1MRSA 2L0XA 3OT4A 3TPZA 4MRSA 4NFYA 8AT1A 4J0GA 3B1YA 5JQWA 4W5QA 9ATCA 3OIYA 1BWPA 2DTDA 4N9WA 4LJ9A 1NU6A 2FQWA 2NZXA 4S3MA 1E3WB 1E9CA 2O20A 4HEA1 4L02A 5TF4A 3NGMA 4PSUA 4UD6A 3TIFA 4AF6A 4B46A 4PIMA 1LPOA 3VKFA 1E7MA 3WRVA 1BA3A 2FEOA 2JI7A 2XUKA 4MP6A 1RQRA 1T13A 3NM5A 4MQ4A 5TNXA 2ODNA 1QKIA 5B1HA 1C4KA 1G59A 4PZCA 1AA9A 3L2OB 3QUBA 1SKMA 1LK5A 2CVZA 3C15C 2C2BA 2J87A 3OIGA 1KWKA 1I01A 3UCEA 1C9NA 2O6HA 4ZT2A 1DBWA 4RTQA 4O5OA 3I4CA 4D44A 3VR0A 2EFGA 2R66A 2QP4A 3IUEA 1CC1S 3N58A 2ZQ5A 3RTCA 1G5QA 1NF2A 1YR6A 3PF8A 2NIPA 3N39C 3WRXA 3MMZA 1SBHA 1I2ZA 4CM1A 1JIXA 1KYYA 1O5IA 1PQYA 2JGLA 2JASA 2W58A 3IE0A 4TMYA 1FFSA 5BPHA 4HQRA 1JNXX 3NO9A 3RK4A 4EKEA 4ZV4A 4AUEA 3EK2A 3A27A 4P7FA 1BDMA 3H5NA 3AMVA 5FNVA 1HRKA 2R44A 5J4VA 3THWA 3QXJA 4LJRA 4QYMA 3OJEA 4CLDA 3DTTA 3LPDA 1PL0A 1TW3A 3AUXA 3CKMA 1NX6A 1VCMA 4YFVA 5HE9A 3G88A 4O4JA 4UNPA 3MWLA 1XHEA 2QN8A 2NZUG 3IBYA 4P86A 5EG5A 3LYLA 1Z12A 4M1ZA 2H8KA 3P32A 4ZGWA 3UGTA 1GHTA 2NSYA 2W2NA 2IW3A 2WJVA 4JP3A 5TJHA 1WW2A 2BBSA 3K6KA 1ZUIA 2Q3BA 1D5CA 1U6IA 1N5IA 1Z3CA 1P9WA 3MQ4A 4HN4B 2C4KA 5JVDF 2ZRHA 2HPZA 1US8A 1YASA 3DAYA 4J9VA 5L3ZA 4AICA 1Z0JA 4BQFA 3G2NA 1SCAA 3ETGA 2CDRA 4MGZR 1UMKA 2O0MA 5DJ5A 3VKHA 2AYXA 3BF7A 1ZIOA 2I1WA 2V1UA 1RWNA 1RBMA 1TIKA 1IXSB 3I9LA 2WJJA 3DVAB 2QL6A 4LZAA 1VDMA 4KQHA 2P3OA 1PJBA 3ICVA 5AOCA 5BWOA 2C95A 4JJZA 3GVPA 3QVOA 3T7RA 3S2EA 3HMKA 5C8DA 5KTSA 1E2KA 1CIVA 2IIQA 3VHXB 1A4UA 4Y9UA 2AE2A 4D0GA 1WCWA 3HZZA 4EPRA 3T4XA 4HUJA 3UJPA 4MR7B 3C5WP 4M8NE 3TNDA 4B4KA 5AUPB 8ADHA 2Q9AA 3IQEA 2AXPA 421PA 3RUHA 3FVQA 4ZN6A 3D6MA 4Z4EA 1G1MA 3FG9A 4BTVA 3NHUA 5BOSA 4QPCA 3VZDA 4RZUA 3O3OB 2XWBF 3EVGA 1CUJA 2NUTB 4R3UC 3VPAA 5A9SA 5CD9A 1YDHA 1SRQA 3KKOA 4V0ME 1TJ7A 3WAGA 3KUDA 2OBNA 1EP2B 4C7BA 3L43A 5JMOA 4XX1A 2JIZD 2CK3D 3OC0A 1G41A 3A1WA 4CG0A 4Z7QB 2PUAA 3V1NA 3B70A 3K72B 4MUKA 4JU8A 4DB2A 1N1DA 2DWOA 3ANNA 1IONA 1K9SA 3EEYA 3GHHA 1SELA 3IMFA 1RKXA 3MERA 4FWBA 1WSWA 2O0LA 2PZMA 1VPEA 3DTVD 1C8BA 3HU2A 1X7YA 3HKEA 3QI2A 3SXPA 3GUYA 4LF7B 1KC1A 2KE5A 3I8SA 3A6DA 3QVXA 4GOND 4P33A 1PNTA 3PUKA 3ZWAA 1YFZA 1NTRA 3NGXA 5L7YA 4PPGA 2EFYA 5I9MA 3VPBA 4FWIB 1F4VA 3FWHA 5IPFA 1HT1E 5JVDB 1LDYA 2FZEA 5A06A 4LK2A 1KO8A 5SY4A 1W36C 5FQNA 3NNDA 1XEWY 2PUWA 4H3KB 5CTJA 4CW7A 4B3GA 2OBYA 3NJ8A 3O4HA 4RDCA 3TSZA 1YQGA 1L5MA 1JIUA 4ZCLA 2O1WA 3FWKA 3BCUA 3FAZA 1DHTA 1DUSA 4F86A 3D6FA 5T41A 3TINA 1CQXA 1SUCA 1XA0A 3IQZA 2J4DA 3MWDB 1ZXLA 1SBNE 1M1YB 5J2UF 3F6YA 2M6LA 3SKYA 1PEYA 1B14A 3N0WA 1U2GC 1GPMA 1UXIA 3KOYA 5CIWA 2B82A 5F1PA 3VO8A 4EA7A 1P5RA 2P79A 3OZRA 1KDVA 2YV1A 3R7SA 1E1RD 1PWXA 4RXUA 3GNSA 2XB9A 2XHZA 4PN7A 1J06A 1GTL1 1I24A 2DOKA 3NU1A 1N8SA 3BUSA 4I55F 4KZPA 3RSSA 4HY3A 4R1NA 1KL7A 4YT5A 4DMFA 5HJEA 3KOWA 3AERB 4L4SA 3GEBA 1V47A 2PZFA 4PZLA 2O8DA 3EIFA 2GN2A 1M33A 3BM5A 2Z08A 2OCBA 1NF9A 3PLNA 3HR7A 3E8MA 3T9FA 1KU0A 1CBUA 2ZAIA 1I7NA 1K7FB 2WF5A 2XA9A 2X42A 1O57A 1R9JA 3LVRE 1JQDA 4FGZA 4W1PA 5BUSA 1NMSA 2A9KA 2V6GA 1P7CA 2P6PA 3HVUA 4AWAA 1ADGA 4MWBA 2R7LA 2HN9A 1FP2A 3OX1A 3EY4A 5BWBA 3O0DA 4WLUA 3C98A 4DLAA 5FUVA 1W29A 2BBTA 2V5UA 1K6EA 1YBHA 3L3BA 1T2NA 3BD8A 4FW9A 2JJ8A 1YT5A 2CE7A 3ABQB 3KFXA 4R40A 4KFSA 2YN4A 4MVJG 3IP7A 5KVCA 2BONA 1UBOS 3FSGD 2QRZA 1R0CA 1WG8A 1E5TA 1YQEA 3NT5A 3OIWA 3KXKA 3WLAA 4L50A 2EW1A 4HTFB 4BE9A 3UK0A 4BAGA 2D2EA 3HZHA 1FVOA 4IRXA 1KVTA 4B17A 1YDEA 1FUQA 4RADA 5SV2A 5IDXA 2XXJA 3D8SA 3D6AA 1R6UA 2ES4A 2GMWA 3GDFA 3KUCA 4EJMA 3ZJUA 4BC1A 3RRZA 3BGWA 4ZEMA 3OZTA 4FQ7A 4DIEA 4JL8A 3TD6A 5JISA 4Z3OA 1RU3A 2VPXA 1AKTA 3ILHA 2Q21A 4K6FA 5FA6A 1NGSA 1I3LA 4KMOA 2R6HA 4EW6A 5CFMA 3PR2B 1SQ5A 1TK2A 3KZOA 4NPAA 4EL0A 4M46A 2IHNA 5JW6A 4JBLA 4MNTA 2R5WA 4JYCA 4IG4A 3WYNA 1AV7A 3VOBA 5JFGA 3A1SA 1LQTA 2CUNA 2K4MA 1IN5A 2BWJA 3UVEA 2D1SA 4AZSA 2Y1LA 2P7HA 4I6JA 1V7QA 2WSSD 3B36A 5EP4A 3C3YA 3MAGA 1P2UA 2Y0EA 4EO9A 2VF5X 3RS2A 1FJGB 4I55B 1TQHA 3E2PA 4NE9A 4RLHA 4JHXA 4KQCA 5IBQA 5TVGA 3AHDA 3X1YA 1VC2A 3WISA 1HFJA 1S89A 1UZLA 4FCTA 1MT3A 3A70A 3OLXA 3VOAA 2ZI5A 1NBIA 1KXJA 1ISPA 1M6YA 2O3JA 5AJWA 3ZWOA 4EI7A 4K9MA 2HA2A 1AZLA 1KP2A 1I51A 2C0QA 5JHHB 1UDRA 2B2XA 3H83A 4YCAA 1XWOA 1ISFA 3FA2A 2HWUA 4MI1A 2J4CA 2HM7A 5JAHA 4AJIA 1GN9A 1GM5A 4AXXA 2HO5A 5AW1A 9ABPA 1O5TA 1H93A 1Z2OX 3QYJA 3GEHA 4YBRA 1PVOA 1S9DA 1U2EA 1BSVA 2X3YA 4ZAWA 1TVMA 2I4NA 2GN8A 3WIUA 4BNNA 4I9HA 4DW8A 2GNOA 3AF1A 1ZFNA 1JSCA 2PZLA 3MMNA 4LZPA 5JASA 4Z4QA 1MRNA 4R6WA 4NMXB 4ZVMA 1M2OB 2O7NA 5IX8A 1NYLA 3NBYC 2GXAA 2Q5QA 1G7RA 5I8ZA 3L0CA 2WTXA 3H7AA 2Q7OE 4ZTUB 1D6MA 2YBEA 2O2EA 3S2SA 3LP5A 1P5HA 1ZCZA 3X3HA 5CLHA 2M6SA 4V0OA 2HBQA 2PVPA 3BDIA 4GM4A 4GSLA 2YTZA 1VKNA 5DK6A 4XARA 3JCZA 4X7PA 4ZYLA 3CVXA 3DZGA 3F98A 5DX1A 4JGGA 3GLFB 2NU6A 4RIGA 5K4GA 3JS5A 2I5PO 3H5RA 4NJOA 4D3ZA 5JDCA 3TF5A 1Y4UA 3B3FA 4P83A 1WUIS 3RSZA 3ABIA 3IEVA 2I4IA 2MR6A 4L6IA 4J2OA 4R2KA 4KYTA 1TFUA 1Y6QA 5G4KA 3TNLA 2ZROA 2J0VA 1H5NA 2QM7A 1GZ6A 1LNQA 1WHSA 3C3WA 4YJGA 3UK7A 3R6TA 4GPZA 4D3XA 4YCLA 1RQ7A 2XTJA 3IURA 2CHEA 1KYWA 4X62B 2QJOA 3O83A 4DR5B 4RMIA 5IHPA 3EAFA 1XMXA 2BHNA 4WXHA 3NDPA 5LA6F 3PCRB 3HVJA 5B1EA 1PNQA 3KT0A 1AG9A 2OCAA 3NEPX 3R5SA 2W70A 4EJSC 3T95A 3O90A 1IDN1 3PP8A 3N0RA 5CFQA 1T9BA 4I5EA 1EP3B 2CXUA 4J3JA 5K1ZA 2NTJA 4A73A 4D2IA 1BOFA 4PLWA 4LC1A 1Q5PA 1IZZA 2VP3A 3AV3A 1ZL0A 1GQYA 1SZPA 3A2MA 3DO5A 2FWBA 3NIBA 1KZ6A 3ZKAA 4GGMX 1DBQA 1L4EA 3CZAA 3G0OA 1M0WA 3RJZA 3IT1A 5AVQA 4DABA 1DCFA 1P33A 1B6RA 1Z28A 2Z3WA 3B1VA 5MFZA 3ZLJA 2WM9B 2QTNA 2W6JA 4EUNA 2ZWVA 3KKNA 2VA9A 1I0ZA 2YX1A 2FGJA 1KETA 3NFYA 3SBDA 1W35A 2IX3A 5SZHB 2NZ8A 1CRLA 1YR7A 3KOXA 4QO7A 4BLSA 3KDSE 4QUGA 5ALMA 2VLIA 2Q6VA 2RFLA 4NPHA 3GJ5A 2Z98A 4LYDA 1L7AA 5F3RA 3WC4A 1J33A 3BMCA 3HSKA 4KWIA 2RBKA 5ED4A 2B99A 2OZEA 1V26A 2WOOA 4JSRA 4PGAA 5NULA 3RFVA 5BYKA 1Y8ZA 4W5JA 1A5AB 1E9DA 3BA6A 1G291 3N8IA 1F06A 1LB1B 1NM5C 1V48A 1XTSA 1M1NB 3DEZA 4J0JA 3HDGA 4FHEA 1QSGA 2C4NA 3GW8A 4POAA 3LLUA 3WDLA 2I6TA 3WLRA 3AX6A 4A9AA 2AEEA 2VHJA 4R5MA 1N6NA 5FOUA 4GU5A 4YRKA 5C52B 4BEJA 3MGCA 5J5VA 3DQPA 3HB1A 3KR1A 4C4RA 3FZYA 3JD4A 4KGVA 4R8RA 3T61A 3U4CA 4EECA 4ZMRA 3USZA 2F64A 2QZJA 2H06A 2WSYB 4KQ9A 4QM6A 2CK3A 3R3SA 3CX8A 2WYVA 4M8SA 3L40A 1J97A 2WD9A 1YJBA 3JTEA 2J3LA 4UVEA 3R7NA 5JYBA 2QV7A 2R87A 3OEED 4K9QA 1QE5A 4FNMA 3PTZA 4K2HA 2DRIA 3DH0A 1ZH6A 2A9OA 3TSCA 1JLSA 1TA0A 2RJOA 4XUGB 3ZH9B 1K7YA 1BG6A 4AXBA 1LS1A 5T4FA 4BTEA 2AI1A 5CDHA 1XJCA 3JQ8A 4U6NA 4OX9Y 3PT5A 2FE4A 5FULA 5A2QA 2NQ2C 5CFNA 4G23A 4RNDB 3P0EA 5HVNA 6NULA 2FV8A 1G3QA 1XMIA 4RVOA 2XE8A 1JW9B 4KQIA 2IE8A 3RIXA 1J6UA 1ZUNB 3ZYCA 3WGVA 1EG7A 1OX6A 2X6QA 3JQCA 1ZPDA 3KRTA 3HL0A 5ELLA 1QQBA 1UPTA 3EVEA 1HDIA 1RWVA 1BXRA 2JIDA 2OGZA 4YCMA 3EHDA 2ZTUA 4IIJF 3LJKA 3P9CA 1YWGO 4LZLA 4WKBA 3BZBA 2WTUA 3GLHB 1FP6A 1SOWA 1MEEA 3BJRA 3QE0A 2ACEA 3W0LB 3YASA 4RL6A 5ADWA 1NZDA 4RTMA 1ETUA 2GJ4A 3ESCA 3WR5A 3INTA 3MNFA 4RIFA 1E1RA 3QG5A 5CCDA 1BE8A 3WBBA 4ZA2A 3PTAA 1UINA 5LP6F 3FCCA 2SBTA 1T25A 3R23A 1EX7A 4WDQA 4M9RA 4DLLA 1HFKA 1VA5A 1UC9A 2P8JA 2IZZA 4KOEC 1Z63A 5HUQA 4BZXA 4PONA 4H1WA 2IYUA 3RVMA 4ACAA 3IA7A 3LA6A 2GBFA 5CDYA 3ZDZB 2VCYA 1TF7A 1RHUA 2R84A 5GOTA 3HE3A 3FOAA 2FPOA 1TMOA 4NWIA 4G26A 1SXGA 4RPIA 1KKMA 1O0CA 3ZIDA 2GAAA 1OWPA 5A4DA 3CVYA 4C4TA 1E69A 3PCXA 2UUBB 1LK0A 3N2ZB 3KZXA 4KI0A 1ZBQA 4LTDA 4RPGA 4E08A 1NVXQ 1KOGA 3MTAA 2WSLA 4HEQA 3RSOA 3EDOA 2H92A 1BEUB 4OGGA 5GZ6A 3D7RA 1JALA 2C5GA 1FMTA 2C3YA 2YDXA 4OYLA 3RS5A 1EU1A 4HQ0A 4A1FA 2VUTA 3IV6A 3EQZA 3HPRA 2CGEA 2X8AA 5T5QA 2R3SA 1TO6A 3FYUA 1OJ7A 1XEAA 1CUDA 3PL1A 1BKYA 2IDJA 1N5MA 2J5QA 1W0JA 2B1IA 1A9PA 2HNKA 4CL8A 1ISMA 3OCYA 3UUEA 1B1CA 3HYLA 3L7JA 4IIJB 2J9YB 4R0MA 1D6JA 1K6XA 4YCDA 5DLQC 3E3LA 3CUKA 2PMDA 4UNNA 4DLYA 1VGVA 3C5VA 2RBEA 2XOEA 4FT4A 1WKCA 4P35A 3WDKA 5L3SB 4DRZA 2WTMA 1PWHA 2IYOA 1JSWA 4S0XA 3UFBA 3RRYA 3VVLA 4A8HA 3ICPA 1EINA 1RHJA 3IDAA 1NN0A 5WRFA 2I2DA 3K70C 5CJ2A 3IQHX 1OFUX 4Q4HA 1UAAA 4PX3A 4ZREA 3WLIA 2C29D 4IIBA 4U4AA 5IKMA 4BEBA 5DLDA 1S7CA 1YCDA 3GRVA 3ZG6A 4BB6A 4ZYWA 4JKYA 2A0FA 3FOWA 2WUFA 4GDFA 4BFXA 1LVUA 1A8HA 3HH8A 2JI9A 3KHUA 3MTQA 3HADA 1U0TA 5DYTA 3IAHA 1KKUA 3VGJA 4I36A 4PRYA 5DU2A 1TQ4A 3F5DA 1QTNA 4C0HA 3JQFC 2E7ZA 2I2CA 4B47A 3BRSA 5K3SA 4XVUA 3FMOB 3F67A 3KOZA 4JY7A 2C9CA 4L4RA 5DTQA 3V4LA 2JF0A 2PX8A 4CMCA 3OE4A 2WYIA 2X13A 2IGBA 4PYKA 2PSSA 4ZVNA 4JBGA 3QWAA 2MMGA 2PMFA 4JNKA 4LJYA 4OFXA 4E5UA 3WFJA 3UB2A 2PHZA 1E79A 2QRUA 2WT9A 3X1KA 2A94A 2GQ0A 4H18A 4F2PA 1QC5A 2QMZA 2PR2A 3LNTA 1KFKB 3DONA 3U7GA 1SOMA 1T4GA 1K3FA 2XIJA 2HJWA 3D2CA 2BI7A 4GICA 1XTRA 2VXCA 3FFTA 3G68A 3Q7EA 4HXGA 4HLDA 4YT8A 1KH1A 1MAWA 5GGYA 4GAEA 3IHLA 4D26A 5JANA 2QL5A 1F8GA 2VC2B 2I2FA 3T3EA 3GGJA 1XZHA 3DL4A 4JIMA 1A97A 2FEWB 2J3HA 2Y1DA 4QUJA 4TL9A 5AQEA 2C2MA 2LCIA 3L79A 3D4OA 3RUFA 1EK0A 1GNTA 3BD9A 2OGSA 2YUTA 4UUQA 4CLEA 1U6JA 3R40A 1NF3A 1XP8A 4IFBA 1I4EB 4KXLA 1U8XX 1XQXA 2JIMA 3C8UA 1GKUB 5SYAA 3DV0A 2H3EA 1Z4NA 4JC5A 1ZO8A 3UJNA 3SFZA 3I6BA 1ECBA 4ND3A 1VI5A 2BHLA 4JZYA 4F1JA 4DR4B 1YRHA 1E2JA 4H7PA 4L51A 5FPTA 5AUNB 1ULAA 2F3UA 3GYGA 2QLBA 4IZOA 5K2MA 3X2FA 2X5XA 5ELXA 1DTWA 4CDNA 3TM4A 2QLMA 4B6FA 3SQLA 3JRXA 3KYCB 5BRAA 2YXPX 4Q4DA 2QSUA 3QFHA 1G5TA 4ZT6A 4WJZA 5FA5A 1YQDA 3VC7A 3TBHA 3ANSA 1S3IA 4I1PA 2KPOA 1XJWA 4OAQA 1AKRA 3THRA 2OUKA 3DWFA 3NHJA 5FI3A 4I50A 4C3VA 1MIOB 3RRXA 1NI4B 5CFLA 4ARIA 4OMCA 1FUPA 4C4YA 1RYBA 2QNIA 4NYJR 4R0NA 2AQIA 2ZJYA 2VN8A 2XCOA 3EY9A 3MINB 3Q6NA 2IXTA 4JWKA 1J9EA 5FBLB 5J23A 3AJDA 3WBJA 4LBVA 4KR7A 4GIBA 4U7HA 1RWXA 5C7OO 2HEIA 4QBHA 2J7PA 1IOLA 4IDCA 2NUAA 3IOEA 5HIJA 1B2LA 5H16A 3P2EA 2HY7A 3HCOA 3KKPA 3NIGB 3UA4A 3ZV6A 2B8NA 1EWQA 1HE1C 1U28A 2BZGA 2Y0DA 4MV8A 2J3EA 4DWWA 2IHBA 1UBLS 1WA5A 3QJYA 1H6CA 2V59A 3PRYA 4HG2A 4M21A 2X0NA 5CIQA 2P75A 2V6MA 3VKWA 3T8YA 4C5CA 1JQKA 1TF5A 2W71A 4BKMA 4G3XA 5K45A 1CJSA 2FUKA 4NAUA 1MH1A 4E2FA 3AU9A 2DLNA 4LXQA 1O7JA 4WCDA 1ABFA 3D5QA 3L7AA 5GTDA 2D7DA 4IMIB 4A0FA 1GAEO 4YH1A 2ZUEA 3ZHQA 1JMVA 1UBMS 1MO3A 2H5JA 3CPEA 2F3RA 3USES 2JD1A 3RVDA 4D9JA 2B83A 3LDUA 3SHWA 4I4LA 2H51A 3FNHA 1I1OA 3MTDA 4RVNA 3RJMA 3ZHCA 1C81A 1NXTA 1QPBA 2VDOB 2P77A 3A2NA 4BBZA 2C5AA 2WF9A 4K6OA 4W8GA 5FUQA 1Q91A 2CDCA 4Y67A 1G21A 1LCIA 2IA5A 3PE6A 1ZK4A 4Q3EA 4U9IS 1CSEE 1WUHS 4A2WA 3BVPA 4J07A 4QJ4A 5EKSA 4EG0A 3EXAA 4EG7A 3GGGA 5AXDA 1G98A 1GTMA 2HU2A 2JGJA 5CVEA 1P4GA 2EG5A 3BGIA 4PPNA 4R1OA 1V7PC 2JFYA 1VP3A 3UMFA 1O6CA 4KRXA 2OORA 4XD2A 1EMDA 1C3EA 4B7XA 3T3NA 4QE3A 1XTUA 3I5AA 3QU7A 2JAXA 3Q87B 1CUFA 4RGQA 4YRBA 2PLRA 5JCOC 3ZY3A 1LS6A 3AXTA 3EF0A 4R2XA 4YQFA 4XD7A 2VPWA 3GEPA 4EMTA 1SQFA 4LPSA 1N5LA 2B4YA 3H5OA 2P2DA 2Z2XA 3WZMA 1NLYA 4EM6A 5BVHA 1VMEA 2A5FA 3C3MA 4W8HA 5F76A 2NO4A 4LC9A 1H3FA 3ND8A 3OO0A 3PQFA 3HJFA 3IR6A 1LZKA 2WDPA 3F4BA 4R69A 1AQNA 1P91A 4P93A 2P9TA 3UAGA 5IYZA 1N33B 2BFDB 1VDZA 2NQ8A 3BFKA 1EE2A 5DHTA 5C8YA 2CMKA 1EAYA 2GO1A 3FDFA 2W6QA 2JEOA 3NVDA 4DYDA 4HVLA 2A4MA 1MJNA 2OBLA 4IKOA 4MYTA 3TIVA 3U7QA 1N2IA 1JZSA 2DFTA 3PFNA 5E7MA 3CCCA 3E82A 4NYMQ 4ZAVA 3AM3A 3JD2A 5IAGA 4MQUA 1KBQA 4CM6A 3NNNA 3QZUA 1XCLA 2DFPA 2FPXA 2X9VA 3CEPB 5DYIA 3AFNA 2QYHA 4KX3A 3DKPA 4WZZA 2VP2A 2O48X 3QVKA 1I1HA 4MA4A 1ZNWA 3TJRA 4D1YA 4G2TA 4RIEA 1P8AA 4TKVA 3V5NA 4YRGA 2I67A 2CFOA 3ESAA 4MJ3A 4XB2A 4B45A 3D1JA 2P41A 1CEXA 3L92A 1Z5GA 2GETA 2Z8XA 4HGRA 1JVSA 2HZ7A 3L6CA 4KQXA 4LXXA 2IPAB 1IEVA 2GVDC 2W2XA 4NE7A 5DCWA 3LGSA 1CQWA 4J2TA 4X66B 3TTWA 1SHTX 2PWBA 1HEYA 1HDZA 1YU6A 4MITA 3HYCA 2WNIA 4UTVA 2BM1A 2R7NA 3I2JA 4NVRA 5CT4A 2HK9A 4OHOA 4BNZA 1JFSA 1CPYA 1YA4A 4G36A 4WECA 1PJCA 2EW2A 4I66A 2FWNA 4KQMA 3RO7A 5EZ6B 3A4LA 3DLBA 1DB3A 3TV2A 3EXFA 2A1TS 4TXMA 5IJXA 2ZWMA 3R8XA 3RHZA 4ENSA 2PG3A 3I5YA 1H4SA 2L2QA 2ZAMA 2GM4A 2YZNA 1P3Y1 2ZT7A 3HEBA 4Q12A 4HNVA 4BNFA 4MKIA 5KB3A 3IP6A 2W2LA 3VU3A 1KFJB 4OOEA 2RAVA 1R15A 1SBTA 2IPOA 1BH2A 5EN4A 3UMSA 3HO8A 4HN2A 3WO0A 4B6OA 2W42A 1JR3A 1OREA 1QCDA 2ZAYA 3RCBA 1EJ0A 1N2ZA 1M2NA 4Y0AA 3FTDA 1F0YA 3HLYA 2BMAA 2CYCA 3IP9A 3UK2A 1LQUA 1J70A 2VS1A 2A8YA 3IAXA 2UYYA 5KDOA 3T41A 2O8BA 4KU4A 5H8WA 3W5CA 1XCMA 1JU9A 2P9GA 5DNYB 4A8JA 1Z26A 2PBFA 1NDUA 3CR3C 4DWJA 3ZV3A 4KN5A 4LHYA 2IODA 4NMWA 1D04A 1WMFA 1E5LA 1V1RB 3FR8A 4XJVA 2O52A 1PWYE 4H6PA 4E5PA 4P0QB 4YRTA 1TZBA 4RJ2A 1AZSC 2H16A 1XZGA 3WV5A 4JELA 2LV8A 1TYBE 4TKZA 4WXMA 1DX4A 2UXCB 2HSJA 4IFIA 4WNIA 3ZC3A 1QMGA 4RTSA 1XF9A 2NVWA 1O96B 4QDUA 3ZVLA 4P81A 2ZSUA 5EMNA 2GLXA 4PAWA 5A62A 3HZOA 1X80A 4R2JA 3NTXA 3N86A 3Q98A 3K9GA 1QNLA 4U6SA 3FZEA 1YNSA 2Z09A 2WG0A 2VTBB 1X7ZA 1UKYA 4Q4JA 4CLOA 5AJZA 2JI4A 1VLVA 1GG5A 2G9RA 2IITA 1U3DA 4KI7A 1SVNA 3DDSA 3O8BA 2IWRA 4KUEA 4HJXA 5JD3A 2Y4OA 2DQYA 3H1GA 1UBJS 5KAMA 3V8BA 1ZOPA 4XW2A 4WNAB 5D2CA 2FDRA 1WW8A 1NQTA 1XAIA 1J49A 2FPLA 5KHOC 1CXZA 2FYTA 2N0SA 3E7FA 5LIPA 1A1VA 1YZQA 5SY9A 1DAKA 4LSWA 2FFAA 4ND8B 2I7XA 1UMDB 3C6ZA 4CM9A 4CM4A 2Z1MA 4IJUA 3WL7A 3ZCRA 3I2YX 3T5PA 5EESA 1YR8A 2F8MA 4ND2A 1X1RA 5K0NA 3UKJA 4LZNA 4O4LF 8ATCA 3GDWA 1QX4A 3HQ4O 2X9QA 1IYZA 1FLVA 3I9V6 1MUUA 1GPUA 2QQFA 2YHUA 3N07A 4RNCA 1QFMA 2I2WA 4BFLA 1T5HX 3WL6A 4BN0A 1BH6A 1C2TA 1SQGA 5TARA 4Q3CA 4FEYA 4EY5A 1WMAA 2JANA 4QXMA 2ZIXB 1W94A 3FGNA 1N7HA 5KQLA 3GLUA 2GM9A 4FLEA 4WTOA 4ZXFA 5AVUA 2GAJA 3LDAA 3CNBA 2CUZA 4P4NA 4FMBB 4KR9A 2Q5JA 1NN1A 3DB2A 1FA9A 1POWA 3K20A 2X75A 1JKJA 3BOSA 4ZYUA 1KR2A 2C9MA 3W6NA 2MSKA 1KVQA 4Y2TA 3FSEA 4DXDA 2V7EA 2WAMA 3AWDA 2ROQA 1JHDA 3A05A 4I5GA 1CUHA 1R9MA 2BP7B 1L6RA 5H9VA 3KSRA 2EEPA 1JLKA 4YO7A 4FXPA 4CCAA 1ACLA 2PSEA 1Y98A 3P5BA 3MT7A 4HQOA 1HQYE 5JEEA 1P62B 2VQ3A 2VSOA 3DD1A 1K62A 1PHPA 1H4VB 3ORSA 3LQQA 4I1IA 4RVSA 4FS3A 5FORA 5BURA 1ILEA 2RGRA 4Z86A 4MV0A 1ODSA 3SBEA 3CIOA 4NZZA 5DN6A 1T1JA 1XTVA 2DETA 4GMXA 1LH0A 4HO1X 4NDZA 1H9CA 1DIOB 3VSBA 2NO6A 1BKDR 3NEYA 2WF8A 1RQXA 1GTG1 3JQGA 2BE7A 1E89A 3B6EA 4URFA 4L9AA 1II9A 2VYND 4MJ7A 1PEAA 4N9QA 1EG2A 1O95D 1JXQA 3N74A 2QSJA 1Q0RA 1DDIA 5I7AA 4MP3A 1E61A 3WLLA 5CB4F 3KALA 3PDIB 5EHNA 5A4MS 4BB0A 2NT3A 4IICA 5HQ3B 3NV9A 4DM4A 1N1EA 4LJLA 4EG8A 3Q7QA 1ZVKA 4O4LB 4KNVA 4MV6A 1W9HA 4FD2A 4DADA 1WM1A 4FFMA 2PZEA 4RD2A 5F92A 8GPBA 1WVIA 1ZK0A 1TKCA 2JIQA 2XOKD 5TQ2B 4AJ9A 2J9FB 2PBZA 2ILVA 3PC2A 2VVTA 3W8NA 2C3MA 1C1DB 1CIJA 2O07A 2JAPA 1A7JA 5IKOA 4TLCA 2Y71A 4CGYA 1VG0B 4IOJA 3GH3A 3L8GA 5HK8A 1EESA 4YX9A 1OZGA 1YR3A 4NZNA 1R0WA 2FUNB 2QZ4A 4PVDA 5KNDH 4ASUD 5EE9A 1RKQA 4CQLB 5CD1A 5FPSA 4O29A 5ILGA 1JX6A 2QGFA 3WX0A 2AMVA 4PZZA 3ULKA 4BS9A 1FRZA 1GXSB 3IEMA 2XA1A 5ENDA 2QMUA 4IZIA 2IRWA 4HNAB 4U7DA 5FHQA 2YR0A 4LF8B 1JT9A 3QFCA 3KCNA 1TJ5A 4TMKA 4BWYA 2C9BA 5AXBA 2XITA 3H2GA 4EO7A 2D62A 1AZWA 1DZ3A 2OAEA 3CZ5A 2C07A 2VP0A 3G9XA 1QP0A 1ZLXA 1H2EA 1RZUA 3HYTA 3DEKA 3N6VA 1C8LA 5PGMA 1TCCA 3L04A 1A82A 1I9GA 1IW7D 1H2XA 1WWKA 1M34E 3EFHA 4ENWA 4AZTA 1V7CA 3PPVA 2O2IA 3OLCX 3W8RA 1TGVA 2IEAA 3WB9A 4J03A 4XOIA 1BQ4A 2PKRA 2PUJA 4DLRA 5F4ZA 2C98A 2QE7A 2WMDA 4XB1A 5G3YA 4IHAA 4G6ZA 3D2LA 4PGMA 3T3IA 2ALJA 3A8TA 3PIDA 3SC3A 4P3OA 3SDSA 2D2VA 1GA6A 1PN3A 2JRCA 1FE8A 2W2MA 5AI8A 4FR2A 3G59A 3GJYA 5CB4B 4GXRA 3UATA 5A5FA 3CS3A 1IPFA 4O1HA 5FR1A 3MWKA 1JHZA 4XVQA 5ITZA 5KYKA 1LPMA 1YO6A 1QHHA 1L7XA 1ABEA 3L9XA 5JYDA 1L3IA 4MKXA 2WEKA 3LBYA 2O4CA 4KLRA 5IDYA 3ZI4A 3H5WA 1SXJB 3UPDA 1XMQB 4KFRA 1WZNA 5IVHA 1Y6ZA 1D07A 3PYLA 4NZPA 4BXOA 1S2MA 1W44A 1U16A 3PR3A 5L3QA 3CUUA 1E96A 1QYWA 4Q4CA 5J4LA 5JY1A 3F9IA 3FZNA 5H1YA 4XZ3A 5LMUB 5JS1A 3WGHA 5A3QA 2ZWPA 5G53C 4Q1BA 1CZHA 1W5SA 3CJQA 4E21A 1MO4A 2D3TA 3HUDA 3KQKA 1DSSG 1KGDA 3OEHD 4KR6A 3IAAA 3MTJA 4ZTBA 1CF2O 1PDVA 4RH0A 2MWMA 3PD1A 3WADA 3L07A 1ZEMA 3DQZA 4Z6KA 1MHPA 1NG1A 1XWWA 2CXPA 2WNHA 2QX4A 1VL6A 2P2ZA 1O54A 1N8NA 4IIUA 3WK9A 1BA2A 1QHEA 3D7KA 4WD3A 1PLLA 3HR4A 1G17A 1PR9A 2NV2B 4J7UA 4MUYA 2G1JA 3B13B 4J0EA 4KNWA 4YJ3A 1I1NA 2G8NA 3TEMA 5AW2A 5IZCC 3KLOA 3PHIA 2EDAA 3NORA 4FJ2A 2MINA 4LNHA 4MVJF 3VISA 2PGXA 1AUQA 3PDCA 3KZMA 1BVYF 5G0TA 5EZSA 3JWHA 1PO7A 3CCBA 4I0WB 4UEQA 1XVVA 3HMQA 5M34A 4CEIB 4E03A 2A1UA 3DE4X 1YS6A 4L78A 1BROA 4RVDA 5DM2A 1NPDA 1SQ6A 2CW5A 1G0OA 4E1AA 1B41A 3NJ4A 4WN3A 1C8VB 3H8WA 1MJ5A 5A9RA 1IQPA 1Z0KA 1CJBA 1YZTA 4IVRA 621PA 1IL0A 1JFLA 1Y6JA 4F9GA 3KLPX 2DF8A 1NBWB 1YFEA 2R2AA 3DBLB 1M7BA 3BE5A 2BFNA 2WHPA 3PNSA 3ENWA 3K09A 3THYB 1X7HA 2G5TA 1Y9EA 3UJ3X 1J20A 1WXEA 2FOIA 2VRCD 1TJPB 1KPGA 1S01A 3FDJA 4M2LA 2NXWA 4WERA 1T8YA 4BGUA 5LXTA 1LRLA 4LXYA 4FCWA 1OKKA 1T26A 2A3RA 4URWR 4XIJA 4UEWA 3QLUA 5JMPA 1G8YA 3ROQA 4KMMA 2A67A 4UBOA 3EAQA 3IBFA 4G07A 3AFHA 5P8WA 3SSMA 2CWDA 1FS6A 2KMLA 1SCBA 2C78A 5BSRA 4WI1A 4KUHA 3U40A 1ND6A 1QIGA 3K1JA 3UMGA 1XZEA 2XD4A 4PRLA 1QHNA 2QD2A 5EMLA 3ZDCA 1XRLA 4H35A 2WWIA 2XZDA 1FLDA 4MW0A 1L5NA 3LL7A 3TR6A 2GEBA 4A82A 1FX1A 4Q7EA 4O2AA 1FQKA 3GLSA 1E6UA 2Z3ZA 2OZKA 4CL2A 4Y6RA 1UJNA 3H2SA 4JHLA 1R74A 2CVPA 2E89A 1S6YA 1TB4A 2FW0A 2D74A 3ZHOA 1DFHA 1H0KA 1OFVA 5TT1A 2LNDA 1A2KC 1L7VC 4JMLA 3UQYS 4EFCA 1UT5A 3W9YA 1Z25A 3BTSA 5FFNA 2A14A 1ZH8A 2BLNA 2ZYHA 4OMFG 2Y6UA 4N7JA 5CH3A 1VJTA 3F71A 1L7MA 3EBOA 1U0LA 5FNVF 4K05A 1MJFA 1JH8A 1E7SA 2UZ1B 5C1OA 2ZBRA 2ZBEA 2HU8A 2PMKA 3FHTA 5B37A 1R7RA 4UTOA 4O4JF 5A4IS 1LDNA 1XCBA 2MMCA 4JYPA 1WDTA 1X94A 6ABPA 1CE8B 3ZCUA 3OFND 4RDHA 5FI0B 1U8CB 4ZQCB 1NY6A 1Q14A 2HSEA 4QG3A 2EP8A 1SBYA 5J3JA 4IDAA 1SCQA 4K6KA 1H3EA 4L8LA 4JOSA 2OLEA 4NCJA 2P0YA 1E98A 1PUIA 1P2DA 1H8HD 2GARA 3QY0A 1W8IA 4JD5A 2C3UA 1Z56C 3QIVA 5AVTA 2GWRA 3STYA 1YTUA 3MF4A 5E4YA 1HG1A 1TTQB 3K31A 4X6YA 3TN7A 1EK2A 1PJZA 3ND7A 4H6XA 3ENKA 2IYTA 4F2WA 5AIBA 1NVKA 3ORYA 3K35A 3I2IA 2Q0SA 2XB6A 4CV2A 1N2GA 2ZPAA 3ZCTA 1W0KA 5HQTA 1NAHA 4LOHA 1BO6A 4MI3A 1NHWA 5JOQA 3CGGA 3DMHA 1DOFA 2O2DA 2YNMD 1A9ZA 2JGKA 3OJCA 4WZAE 5JD4A 4AMYA 3RS3A 5C32A 3D31A 5BT8A 3CLRC 3HGTA 3AU8A 2CUKA 1GTVA 1IG0A 3LWBA 1ID1A 2J9RA 3BREA 3REFA 3ID6C 1HLFA 2YWBA 5F23A 1SCIA 2HT6A 3VDXA 4G5RA 3R9IA 5FCDA 4M9UA 4N5IX 4EKNB 4J16C 4WY2A 1N92A 2ZVPX 4XEHA 4ZCPA 2CHVA 5H4HA 3TSAA 4A6EA 3V7NA 2HEGA 1Z2PX 1WBBA 3PGKA 4C6HA 1IXYA 1E0AA 5ITSA 4EB6A 5DM4A 3IQIX 3NIDB 5D86A 3EIEA 5I9SA 1FRNA 4M1YA 5DF1A 5DHPA 1WZUA 4OXNA 4XDYA 2XVMA 4WAUA 5FNVB 1N9ZA 3THWB 1S0UA 4HOYA 3BWMA 5CW2A 2XF8A 3TX6A 4E31A 2B3DA 1SVWA 3ZUPA 4RANA 1ODTC 1JEAA 1DQPA 4F56A 4O4JB 3FVRA 3I28A 4X63A 1CF4A 2QUKA 3E22A 3A6HA 2NG1A 4BP3A 2O7QA 2VH2A 3MUFA 4IDHA 1THGA 3OH8A 1P7ZA 2GOYA 2J3MA 3JWEA 4OIMA 1RM0A 3B82A 2IXBA 3UAVA 5JNUA 4WESA 1DAOA 1AQUA 1ZI8A 1UAGA 2XYPA 4FPXA 4G0MA 2WPDA 1REQA 2YICA 1WY7A 3ND9A 3MMXA 4W7HA 1US8B 4FDAA 1DMSA 3NAZA 1ONOA 3UQZA 1CQJA 1AH2A 4D25A 1KQ3A 1ADBA 2PX2A 1C3XA 1XBTA 2XBUA 1ZGGA 2XOKA 3JZDA 3OCFA 1FW6A 3EZ2A 4OGKA 1C9KA 2GBPA 1GPBA 2HPHA 4DHWA 2JZCA 3F8WA 3CBGA 5EC8A 2VHWA 3MMSA 3GMSA 3RFUA 4NCBA 4I9UA 3VTZA 2ERCA 4OUDA 5DBEX 1GGMA 4BVHA 1EHCA 3AO0B 2VWPA 4G9EA 4WJKB 4C87A 3PRHA 5HCUA 3WDSA 3WZ2A 4EATA 1X9GA 4KXYA 2D4AA 4OQQA 2WM2A 3GJSA 1YZHA 4N8SA 3TYXA 2DU8A 2VDWA 1IU9A 1Y5MA 3GBSA 5LVAA 3S2ZA 2E87A 3UMYA 1D1PA 1FMJA 4JGIA 5K01A 3SJZA 1SO8A 2R1VA 1TA4A 1XZFA 2F4NA 3U4IA 5C51B 1YUMA 4IIXA 3KP1A 2DT5A 3SX2A 5BOSB 5AQ1A 3W5SA 1Q1EA 2AR9A 3V8EA 5DE3A 3OOJA 3PYMA 2D06A 2A9PA 4AS3A 5T4EA 5KCMA 3D6JA 3D81A 3ZXSA 4B3BA 3OM1A 1L7BA 2IZOA 1NWCA 1T9DA 3KUXA 3M7IA 4UUAA 3TZBA 5SYMA 3L6BA 2VUHB 4CM5A 4EUFA 4I3FA 4I7EA 3WJ2A 4GYYA 1F4LA 1X7YB 2FW8A 3HKEB 3DOCA 4Q93A 2H52A 3QX7A 2ZE6A 4MJLA 4C7VA 3H8SA 2FW7A 3RWMB 2XVXA 4QXQA 4OXQA 2O0KA 1KYTA 5FL7D 1CZRA 1QV9A 2G76A 3D7NA 5FPQA 4NECA 3T7DA 3ZHSA 2QUHA 5EIEA 3JR3A 5EERA 3VJLA 1Z68A 4YRMA 2AJLI 5LQMA 1NOIA 1JEQB 4P82A 1JDPA 1MO5A 4G86A 5I7VA 1QHGA 1AK2A 3EGIA 2OHFA 2FETA 5LZ9A 2W6IA 3MK31 3JAWA 1W19A 2AOUA 5DTEA 1P7PA 3HR8A 3PPYA 1P31A 4LMAA 3UGQA 5A6VA 3ZDBA 5L8VA 3AF6A 4X92A 4HDNA 3F3SA 2DWPA 2W0SA 2VJLA 1H8EA 1LBSA 1U7UA 1WXQA 2BKLA 2YCBA 5AKKA 1HMPA 1VSQA 4EG3A 4UQLA 3OEHA 4QGBA 4LWPA 2YQ4A 3KD3A 1IWPB 2VAVA 4GQAA 2PRYA 2CXXA 1KJIA 2IHTA 4LA4A 3D8NA 4ANFA 4HDMA 1NUUA 2QU8A 2G5GX 3A26A 3AR4A 4CMIA 2NN3C 4CHGA 1W4AA 4AQDA 4F4CA 2XMDA 1AHIA 1E5VA 2O5EA 2WLSA 3C3JA 2O8DB 2VR1A 5DLPA 3OJLA 4D02A 4DJDC 3SSOA 5TRTA 5DXFA 2VHZA 1HTWA 4LSZA 4IDGA 5DSTA 3OO1A 4CI9A 2ZRGA 3FTQA 1W7AA 2UUOA 3PVSA 2GJSA 3C7TA 5KNCD 1Y4DE 5FOXA 1PU2A 4YRDA 4ZI5A 2E21A 3I9V1 3SP1A 5L51A 1SG0A 2DCUA 2FKAA 3GGPA 1WV0A 4DLUA 5TPWA 3T5DA 3FDZA 4PNEA 1MC8A 1YBFA 2ATVA 2JBWA 5AVOA 1U3VA 1N8TA 3AZQA 2H1VA 5F7OA 5I5EA 1IHOA 1YA8A 1YOBA 3CVWA 3RD5A 3V4ZA 3ZCVA 2UU9B 2KM1A 4HPWA 3O92A 1QONA 1EVKA 1QH1B 3PE3A 4MQ6A 1MEOA 1EXMA 2RH8A 5B4TA 2QRMA 2VDNB 1RIIA 1FYDA 2EJBA 4NC9A 1P60A 4MRVA 4BGIA 3C70A 4BQIA 2QBYA 2G67A 3DEIA 1GPNA 4IHQA 2IJGX 2X0IA 1WPGA 4ZVVA 1DCNA 1UWCA 3B7WA 4FNGA 4ZVUA 3RSFA 2BL4A 2P30A 4X90A 5ULLA 3C2QA 1KDOA 5E7QA 5LJIA 4QPPA 3A9SA 3ZIAD 1HM5A 2XTAA 3ORFA 5C5IA 5D3MA 4BQEA 2GJ9A 1PX2A 3R6WA 3T94A 4G84A 1PUJA 3DZFA 2AMYA 4XAQA 4EMBA 2PL5A 4TUYA 4KO4S 2EHDA 3QTBA 4MIOA 4EQZA 5KWSA 3GQVA 1V3QE 2HW8A 2VDVE 5AKXA 1XZCA 1KK1A 3L4KA 1B4DA 4EZBA 3AKCA 1J1ZA 4HMQA 3QGMA 2DB3A 3U44B 3O84A 1HT2E 2FFBA 5EKXA 3G1UA 3RSCA 4URHA 3T7EA 3P9ZA 1W4ZA 5F2KA 4N76A 1TYEB 3H87A 2H1RA 3OOSA 4PZDA 1E1MA 3NVMB 3TOVA 4C0JA 3NV7A 3RJ9A 1H9BA 4RPCA 1P0CA 1I2DA 5F9HA 4S2UA 3IDZA 5AHRA 1Z39A 1QHSA 2QDKA 2V74B 3BL5A 3DL2A 3E9YA 3TB4A 1VLJA 2DH5A 3KXIA 4DM3A 5I6DA 3ZE2B 4UKDA 2JLAA 5LDDC 3WICA 2XNDD 1PHRA 2ZE8A 1T36A 1H6BA 1Z73A 2QMQA 4IO0A 3CN9A 1H8HA 4DRXB 4YVFA 2QRQA 3IOYA 4AY2A 2JVJA 1TU4A 3H1EA 3RFFA 2MSLA 3UUFA 1UKZA 2QW8A 2ZJBA 3TXAA 5DGTA 4XM0A 4LHWA 2AZMA 1D0VA 4KVZA 4YP0A 3CB2A 3AHIA 4DV2B 4MLZA 4B6QA 3HVKA 5ERGB 4MWDA 1TM2A 4H4CA 4JI5B 3AVYA 2C84A 1DTSA 4RTNA 1OAAA 1AHNA 2JKVA 5K3BA 2X86A 3KQNA 4XDHA 4MWTA 2DFDA 4UBNA 1B43A 2QTCA 4RMNA 4KKXB 2ETVA 2QAGC 3EXHB 2RARA 4OQPA 4JFRA 3H84A 5DO9A 2NU6B 3P7MA 4YWHA 1GDTA 2V0NA 4F4FA 5T3UA 1P1RA 2DTXA 5FOQA 4QU8A 5IDWA 1OAKA 1KRWA 4RTJA 1AVTA 3B5EA 4YJGB 4HWTA 1WHSB 3ZNQA 2QA5A 4BQQA 2H5EA 4DLKA 2NACA 1NMZA 5B55A 3OF2A 5A0FA 1PF7E 1PD0A 2XUDA 3T35A 4LFBB 3QLVC 4Q1DA 3WIBA 4RKFA 2XCQA 3FWYA 4WA7A 4FX2A 5HJ2A 1Q7GA 3Q0EA 4U7WA 1KHTA 221PA 5ESDA 2W93A 5PNTA 4H1VA 5MN4A 3R3YA 5TSDA 2DKNA 1KPIA 4MINA 1N3BA 4RCVA 4F3NA 3KXPA 1DL5A 1G8GA 4KXMA 3CX3A 1T2VA 3GVXA 4A23A 3MLBA 4IHKA 4YXFA 3AM5A 2QN1A 3FF4A 3L6OO 4LXUA 4MUIA 4OHWA 1BWQA 3G85A 4W63A 1XR3A 4Q01A 1LSOA 1P9RA 5IVKA 1QE3A 4PCUA 4MA0A 3EEFA 4U9HS 3ZGVA 3E0XA 5CDTA 2DZDA 3D8HA 2HLDA 3D4BA 1TJYA 2WBLC 5MF6A 4E6EA 1ZXXA 1UZNA 5K3DA 4MMZB 1M1ZA 3D4LA 5D1HA 4KLNA 1D9XA 1BMTA 4CIXA 4DM7A 1L4HA 3I2FA 5IJAA 1Q50A 3Q7SA 4TMTA 4FWTA 1P45A 1DX9A 2IXDA 4MO9A 4KTVE 3L4EA 1F12A 4LYHA 3VPSA 2F8LA 1U4SA 2M32A 1HWYA 5DFAA 5JJLA 4ZOEA 4B43A 4GX5A 3R6GA 3NT2A 4C6SA 4FHDA 2IW1A 2FZVA 3WNZA 4ARCA 2HWYA 4AKTA 1RKBA 1BDBA 1RRGA 4INPA 3BMCB 3U37A 1T8TA 2GJ8A 1ZNYA 1OPRA 5ALVA 4WWHA 1KJWA 4YEDA 1SOUA 2P9BA 4KWTA 1SUDA 1U8AA 2GEUA 2IYWA 2QI9C 5ALFA 5KO2A 3VR4D 1Y9AA 1VPDA 2AEMA 2HDOA 1G20E 2JIBA 4ONEA 1TRKA 1RRVA 1XN4A 2FWPA 4GI2A 4RDIA 5ECDA 5F1YA 3RS7A 1QVWA 3PEWA 4QDXA 1BX1A 1ZYUA 3WNBA 1XTTA 3M34A 3A9TA 2VK8A 2HFKA 3SU8A 4C9BA 2VQFB 3N70A 2RG1A 2IH4A 1WL8A 3AL2A 5I4KA 2XAUA 5F33A 1BFUA 3I4FA 4Q15A 3GN1A 5I4IA 1G8KA 2BV3A 1WETA 4MW2A 4RZXA 2ISSD 3OE1A 2VK2A 2YJ5A 1NZFA 3DLIA 3DTVB 3M3HA 5F98A 1A0OA 4R1MA 2J3KA 3R9XA 4Q48A 3VI3B 1Q84A 4WCFC 4P54A 1DIHA 3T54A 4GKVA 3LC7O 1L7EA 2Q29A 4FB4A 2JGNA 5DLEA 4DUGD 2ON6A 4D5GA 1OTXA 2NTEA 3FF1A 1MB2A 4IOLA 5K6RA 1V25A 1MCZA 4RY9A 3CRMA 3DPSA 1ZGHA 5A71A 3HSSA 4IMPA 1AMNA 5K9ZA 3EPKA 4YCCA 3UOAB 2NP7A 2ZI6A 5KVSA 3GPBA 3RRBA 1BXRB 1ND5A 3CF2A 1EFKA 3K15A 4HYEA 5A04A 4GSYA 3UEOA 1KVSA 1UJ6A 3UENA 2FQYA 2GLTA 5M29A 1FCJA 1T29A 2GAOA 2GXSA 3I34X 3WGTA 4PQGA 1WZCA 3RYHA 2B1GA 1W5TA 3OVMA 5JQGA 4WKCA 2G6TA 3PDUA 5FYDA 3VH2A 2BDTA 4C0QC 3R0ZA 5BUCA 3IA2A 1PTJC 5EYPB 4AZWA 1I5EA 1LTKA 4DFDA 2OBXA 1ZDMA 2J6HA 2VXBA 4JU9A 4ARBA 1PDOA 3G8DA 3M82A 4IGIA 5GM2A 4BIMA 4DN6A 4DLTA 3ISJA 2WB2A 2CXRA 2VOJA 1BGWA 2Q5OA 1R9GA 4AMUA 1VLQA 1YRAA 2M6RA 3WMWA 2WYHA 1X3LA 3GAFA 1DE0A 2ZP1A 1AKUA 4RPJA 3A0RB 1YCGA 5JJKA 1NXXA 3SY8A 2CBZA 2VAPA 3VR5D 1J22A 3CH6A 4RJKA 4FOPA 5BNZA 4U6QA 5HYVA 3I2HA 5HKKA 3AQ4A 3L8MA 1K7XB 4LYYA 1B6SA 3DTNA 2GVNA 2VCEA 1CCWA 3I9OA 5ICGA 1KK2A 2ZXEA 1CP2A 4QTXA 3TDKA 3AVQA 1ZM7A 3ESZA 2CBGA 2G8LA 4MVJM 4OHCA 2IPMA 3STWA 4DS3A 1KOJA 5DYYA 2XQJA 4Z7JA 1RLOA 4MK4A 5TS3A 2YVQA 3TMAA 4ZARA 4E5MA 1ZKMA 1UP4A 3BB1A 5EVJA 3W5AA 3RC8A 2WVJA 3ZU4A 5FD8A 4QUDA 2HA6A 4PM4A 3NX4A 1WCV1 5EJAA 2Q46A 3FRJA 3HO6A 4HATA 1YKFA 2JI8A 3RSGA 4DJFC 2QD3A 3ADKA 2CFTA 5HIMA 3W1EA 4PNZA 4BUCA 3B1ZA 3NTUA 5EXPA 1TJNA 2PQ2A 4ID3A 5CDUA 2C3PA 2GN6A 4EENA 5CBKA 1M8GA 1D03A 2CLCX 3IO3A 5LMZA 1ODKA 3IJEB 1ISHA 4JJAA 3NKLA 2WICA 4BQOA 3LPCA 2ONYA 4KQJA 3V2GA 3H04A 2X2FA 1GFIA 2WSBA 3KE9A 1W88A 3DJFA 3L5OA 4GLJA 3HJCA 4LRSB 4Q4HB 4Z1MA 1KARA 3JTMA 3CVOA 2NU8B 3WMXA 1W4RA 4H59A 1KU6A 3OD1A 1E5XA 1RMQA 4TV8F 5FUYA 4A2CA 2HTEA 4P4LA 4ZIRA 2QRHA 1U02A 1KDZA 5B6JA 1LW7A 1ZWKA 1CR4A 2CVFA 4R0VA 4HAVA 3OBIA 3M9WA 5IKXA 2IIPA 1QZ3A 2G0NA 3QV2A 4HP8A 3L7IA 3QHPA 3TBFA 1YL6A 3UJ7A 1XJQA 3LQYA 1OGIA 3GLVA 4CQNA 3EJWA 4PLCA 1FRQA 2FMFA 4I50F 3K6RA 3LLMA 4PHFA 1RYMA 2WY2D 3V8MA 1P6UA 4R05A 1KQGA 2OO7A 3JZMA 2EQAA 4HUTA 1K8RA 3MGKA 5AJVB 3WK6A 3EQ2A 4JV5B 1QC5B 2YMQA 3O8LA 1WP9A 1U2TA 4XVHA 4JOBA 3E84A 3R0XA 4IR7A 4UHDA 3IUMA 1QGED 3WGNA 5JAIA 1UK8A 2HDNB 4H2DA 5L95A 1WKVA 5TX7A 1JDBC 4ZOQI 2OV3A 4R9SA 4IS3A 2ZYIA 2YMPA 2QTLA 3G5AA 1E6WA 4QYXA 3HM9A 3PQ5A 1XZDA 2PTHA 2XUAA 4D9BA 3VKUA 1FU7A 3QX9A 4L22A 2WW8A 1PWEA 4M37A 4V0MA 4FT2A 4P3YA 1IM5A 3NBQA 3S27A 2J9GA 1T5TA 3W2TA 2ZVQX 9GPBA 2XB2A 1AO3A 4MKRA 4B3MB 1ATZA 2WG1A 3NM4A 3PFBA 4GUDA 2BGIA 5DSXA 2HQRA 2X4GA 4HGOA 5CR9A 2GO7A 3E70C 1U11A 3DV0B 1PGOA 2A86A 3KZCA 2CMFA 2FZWA 3GVHA 3LUHA 4Q7KA 4UARA 4UMVA 3DMTA 1QM5A 5AK0A 4PCAA 1RRPA 4ZVLA 1XZQA 2LKDA 4K6MA 5LP6C 3N7AA 4TV8B 2MSEB 5AH0A 4WZBB 1VMIA 4KVFA 3FPFA 4D6PA 2GZMA 3QVJA 2RI1A 1XEFA 3FYSA 3NC4A 1E1QA 5A3JA 1DTWB 2HYDA 3ZTYA 4CFZA 2DQKA 3FMGA 2O06A 1YHYA 4JEHA 4BNIA 1U1GA 4OXYA 1DXHA 1KNQA 4MKHA 1R18A 1KPHA 1QVVA 2GLUA 4QT0A 2WILA 5ERXA 5KNDA 5EGSA 1VZ2A 2WJGA 4UNSA 2CC2A 3VSCA 4IIGA 2J07A 3A3YA 1E3LA 2V7UA 2XGGA 3ETJA 3EQ8A 3N6XA 1QUEA 1ZM9A 4I50B 4YFYA 1KJZA 4YNBA 3KELA 5GADl 1EUZA 1BX3A 5KJ1A 1F1BA 1ULZA 2ZTMA 1GCIA 2DG2A 4H1TA 5LP6A 2PJRA 4MGHA 3L0DA 3AR7A 1FDTA 1GSHA 3OZVA 1OC2A 5CHEA 1Z4OA 1U4NA 4ZTZB 4DPKA 1VSVA 2NUAB 5HE8A 4K9PA 4D8XA 3L0ZA 2XI4A 5B12A 3PNQA 4FK8A 2Q1YA 4JEIA 2ECQA 2G63A 5DXJA 2Y1GA 5EZQA 5IFLA 3R5XA 4L9WA 3KEQA 4ZDIA 4IXTA 2V4ZA 1APBA 2VHQA 1Z0ZA 3H1PA 5IYZF 4NBSA 1N0IA 3FOBA 1QRAA 3GFBA 3C5CA 3LW8A 4JR0A 1Z6ZA 4EJ6A 5C8YF 2ZUBA 1ADJA 4H77A 5C8ZA 2OL4A 4RHCA 2JLZA 2F1JA 2FUG6 4N18A 1SPBS 4UJ3A 4DBZA 4Q3DA 1XCJA 2FHPA 1W73A 2NOAA 3FGOA 4NHOA 5CYOA 1V8DA 2F62A 5LNK6 2GUWA 3PR1A 3AG6A 4MX8A 4A3SA 1CJUC 1Z5WA 4Q18A 5IJ9A 2GZHA 2OLJA 4O2BA 2PZKA 3CZCA 3QFTA 3DDWA 2GF2A 2RH4A 2R7KA 1AOXA 1AKYA 4J4TA 3QEMB 3PEUA 3NNSA 3B1JA 1E18A 1G21B 1YF3A 5EHQA 1ZVVA 3AUTA 2WINI 4RLSA 3RH0A 1Y1LA 4MVXA 1OYOA 3LLCA 1UR5A 1EK1A 1HFWA 2JJ1D 3C8MA 1BIFA 2YIDA 1NXSA 4RM2A 1THZA 1G6OA 1X1BA 3HJNA 3M8KA 4W9NA 3BCHA 3ETDA 5EQTA 1QIDA 1QVZA 1SXHA 4NFLA 1XZBA 1ZGBA 3DOIA 3S5UA 4DG5A 1VECA 1F9AA 4FQ8A 1JPNA 3VSAA 4NXNB 2UVPB 3AB7A 3DZIA 4YC7A 2A5GA 3BMQB 2X23A 1GPLA 3TCNA 2P69A 4PHCA 1L5ZA 1TX4B 3RG8A 4PCVA 3IKTA 1MJGA 4MRNA 1BC5A 3T7TA 1ZN2A 2ZJ8A 2XMZA 1W0CA 4II7A 1V8ZA 2Q3MA 3QUQA 5E0OA 1IJBA 1GU1A 3OZIA 4K81B 4JOQA 4LZOA 1VE6A 1G42A 3BH7A 3STVA 1NTOA 6LDHA 3W7AA 1KEPA 5CURA 1W85B 5FTJA 3L46A 1QFZA 2P2CA 3NKFA 4V3BA 5BVHB 1CR6A 5DTJA 4H1HA 4IJWA 1SJ9A 3EARA 3L6UA 5E1MA 3UK6A 3Q10A 1QOQB 5IYZB 4JK3A 4Y0VA 3TRIA 3AVPA 4R2LA 3NIWA 3PGXA 4RD4A 2HNAA 4OQFA 3PE4A 5LL6P 3FCSB 1FUOA 1Z2AA 1PR5A 3KQWA 3PZBA 4OFZA 1C7FA 2O7RA 1AY0A 2AXQA 2Z9CA 2BJHA 3M49A 3CIFA 4ZANA 1VPVA 4LS3A 4LGCA 2J4FA 4HNUA 4G89A 4BCCA 3T7JA 1J39A 3S1AA 4AG5A 1T1SA 3VJRA 1Z07A 1KXZA 4CIDA 3PNBA 3IQGX 1N6OA 3FCOA 4NG5A 2RGXA 5AK3A 4WHMA 4TKVB 1P3JA 2IF0A 1DAEA 1AKQA 2YQ5A 5ALWA 3TRHA 4S04A 2H63A 2WK1A 3ONFA 5K03A 3I83A 4RVHA 4OHBA 4F71A 4V0SA 1IUNA 3V00A 1JHPA 3IGFA 4XGNA 1M6HA 3IB6A 4FFSA 2BTQA 4NOJA 1SBCA 2GTPA 1CJVC 4QC2A 2BKAA 5DM60 5JNVA 1NE7A 5A03A 1MA0A 3FX2A 5EXXA 3A10A 4UM9D 4YP1A 2VJQA 3B6JA 1FK8A 1IHYA 1DO2A 3BORA 1Z6XA 3KFVA 2Y6VA 2WR8A 4TLDA 1TM4E 1P80A 5LJLA 1VCNA 1KAEA 2WP0A 3LH5A 3OM9A 3PV0A 3KS9A 3WOHA 3EXFB 4NCXA 4AJ4A 3BWVA 2Z58A 4OHRA 4MPRA 3T3OA 2CDNA 1H2BA 5K09A 2HOQA 1TZMA 1BHQ1 5D5QA 4PBTA 4YREA 2IBSA 4CMHA 4PG4A 5CLGA 4W6QA 2O14A 4XTRA 5ICFA 5TF0A 3A6EA 3O9MA 2FLWA 4CDMA 3QXCA 2IUYA 2B25A 3VZBA 4L1KA 2PK3A 1HDRA 2PSJA 1TJUA 1WKBA 4KE9A 4L2IA 4BKRA 4RMJA 4X1YA 1C9DB 1DJPA 2TMGA 3L4BC 3OZEA 2BEWA 2QVCA 3ILVA 1E3EA 4RF2A 2PUBA 3BCSA 5CG1A 2WUEA 2FPKA 2Y67A 2DPXA 4IH9A 4AJPA 3F6PA 4FYXA 4A8JB 3QSYA 3TUZC 1P6XA 4TX1A 3PC8A 1MB0A 4JYBA 2BSAA 4ISCA 4A27A 5K0SA 2BFBA 1DO8A 4EDHA 2JVKA 2Q9BA 1YZYA 4ZZ1A 2HQ1A 3S4YA 4B3RB 3OQHA 3HUFA 3EHEA 4HUQB 4DLZA 4YMVA 1NLMA 5BNWA 4CLRA 4UDXX 1SKYB 2PS1A 5T3YA 1P5ZB 2V8BA 1U5BB 4FGJA <