4MUMA

Crystal structure of mitochondrial 5'(3')-deoxy ribonucleotidase alternative spliced variant
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
207
structure length
198
Chain Sequence
SNRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGTGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Mitochondrial 5' nucleotidase
publication title Kinetic and structural characterization of an alternatively spliced variant of human mitochondrial 5'(3')-deoxyribonucleotidase.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 198
sequence length 207
ec nomenclature ec 3.1.3.-:
pdb deposition date 2013-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4mumA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4mumA01
1X42A 3ZVLA 4J03A 5AW1A 3WK6A 3PDWA 5AW8A 5ALOA 3E58A 4I9GA 3NIWA 3FM9A 4OCZA 3L8GA 5AESA 1NF2A 4ZEWA 2WHEA 5AK5A 2B30A 1TE2A 3L1VA 3UMBA 3L0YA 2G80A 5AKKA 5AW7A 2G1AA 4BEWA 3L0CA 2PKEA 1S8OA 3HLTA 5AVXA 1QQ6A 2OYCA 4EELA 5ALJA 3WKCA 2YJ3A 1RRCA 3L7YA 5AW2A 1CR6A 1U2TA 2C8KA 5IS2A 5AICA 1RMQA 2EARA 4JDPA 3ZVNA 4Y2VA 2CN1A 3TLMA 1L8OA 3L8EA 2NYVA 2D2VA 3B9BA 5ALXA 4HGPA 4CF4A 3KD3A 2HF7A 2FEAA 4YCLA 3K1ZA 3OCZA 2R8YA 5AI6A 5ALUA 1Y8AA 3MPOA 2VKQA 2W4MA 5AHXA 4GIBA 4PNHA 5A3SA 4EX6A 5IT0A 5AVQA 2WF8A 3MMZA 1SU4A 2GHTA 4HGQA 1ZOLA 4UW9A 2FI1A 2I33A 2P11A 3N5KA 1O08A 1S2OA 4CF3A 2YJ4A 2C8LA 3AR6A 2C88A 4RESA 1T9ZA 3U7HB 5AW0A 2FDRA 1JUDA 1NRWA 3KDPA 2HOQA 3QYPA 4ZEVA 2QLTA 1L7NA 5AW9A 3U19A 2GMWA 2ZG6A 4KNWA 5AM0A 1U7OA 3L8HA 4Y2QA 5ALLA 3HYCA 5FP0A 3EPRA 3KC2A 4IFTA 2YJ6A 3WK9A 2WFAA 3ESRA 2HDOA 2RARA 3IB6A 3QLEA 1J8DA 3SMVA 1U2SA 5AK3A 2I6XA 2HCFA 4UMVA 4HGNA 1ZD3A 1CQZA 5AVVA 4XOUA 3L0BA 2FPSA 5AM3A 1EK1A 3FVVA 1Z4JA 4UMDA 5AVUA 3QU4A 4DCCA 2CFSA 5T41A 3A1EA 4L57A 3OCYA 3SLRA 1LVHA 4Y3UA 3AR7A 2FUEA 4FFDA 2B8JA 2R8EA 5ALTA 2YMLA 3QUCA 3E8MA 3ZWKA 2DQSA 3EF0A 4OFZA 1K1EA 3QX7A 4Y2JA 5AM1A 3WK4A 4BNDB 5AVYA 2YY6A 1LTQA 3W5AA 4HAIA 3ZX4A 1J97A 5AW3A 4HGRA 1ZRMA 5AKHA 2P69A 3N1UA 4NAVA 2WF9A 5AI9A 1RQNA 5AW6A 4AS3A 1VJ5A 3KZXA 3F9RA 2G0AA 3ONNA 2W11A 2W43A 5ALSA 3SD7A 4B6JA 5JJBA 3EWIA 2O2XA 3DDHA 2CFTA 3N8GA 3MN1A 2WF6A 3W5DA 4UM5A 2BDEA 1Z4QA 3ESQA 3L8FA 1SWVA 4AS2A 4NWIA 3AR4A 3FPSA 5AKIA 3B9RA 4EEKA 5AI5A 3NUQA 2I7DA 2YMPA 2HHLA 3L5KA 5ALPA 1F5SA 4AP9A 3WK5A 2EAUA 1RMYA 3R4CA 3R9KA 4BBJA 2NO5A 5AKEA 5AVRA 2YFYA 1EK2A 5AKYA 1Z4LA 4XPZA 1U02A 1Z5UA 4E88A 4JB3A 5ALHA 2PR7A 1Q92A 2I55A 4YH1A 4BX0A 3OCVA 5ALVA 4YCMA 5AKJA 2ZXEA 5AI8A 3IRUA 5ALNA 2FPRA 2O9JA 1YJ5A 1RQLA 2B0CA 4C4SA 5AM2A 3ZX5A 3BA6A 5ALWA 1N8NA 3I1YA 4NABA 2B1QA 2B82A 2IOFA 3KBBA 5ALKA 2GHQA 1L7PA 3FZQA 2HSZA 1WVIA 2OM6A 3EF1A 2RAVA 5AM5A 2G09A 4IG4A 2JAWA 3MC1A 1T5SA 3D6JA 3R09A 5AKXA 4BEVA 3ET4A 5AVTA 2EATA 4UU0A 1RC8A 3WKEA 1Z4PX 4NFLA 1Z4IA 1WZCA 2RB5A 4RETA 3OTQA 3WKDA 1SWWA 2G06A 4O8CA 3UM9A 3I28A 3U7FB 1U7PA 3E84A 3P96A 1QYIA 1L8LA 4Y2YA 2GFHA 1RLTA 5AKGA 5AVSA 3E81A 4KN8A 2P27A 4Y2SA 4XE5A 5ALDA 1L7OA 2G07A 3A1DA 4UAVA 5AM4A 3SHQA 2Q5EA 2WF7A 5ALQA 3OCWA 3SF0A 4G63A 1ZJJA 3W5CA 4H1WA 3QU2A 4KX3A 2OBBA 2AH5A 4EX7A 3CZ4A 1ZD2P 3PCTA 2B1RA 2IOHA 4DW8A 1Z5GA 3QUTA 1N9KA 1RPZA 2QYHA 3WKBA 4ZEXA 3PGVA 3QXGA 3U7GA 3OCUA 4HGOA 1YNSA 1Q91A 4UU1A 3KOOA 4UASA 5ALEA 1YMQA 4F71A 4G9BA 5AIBA 3U13A 2JAOA 3QU7A 5AVZA 2BDUA 3FGOA 5AVWA 1YV9A 2FPXA 4KX5A 4XQ0A 3ED5A 3S6JA 2GO7A 4MWOA 2WF5A 4BKMA 2AUTA 1ZRNA 4J2TA 3N28A 1XVIA 3AR8A 4BNDA 4YCNA 2OA0A 3IJ5A 5ALRA 3ZTWA 4C4RA 5AIAA 3NAMA 3DNPA 3AR9A 2YBDA 2C4NA 4EENA 1TJ5A 2Q4RA 4DWOA 3N07A 5AK6A 3RF6A 1QQ7A 3WKAA 1XP5A 2JGAA 1L7MA 2AMYA 2FPWA 3DV9A 3RFUA 2ZBGA 3WGVA 3ZUPA 3QUQA 1YDFA 1RKUA 5ALFA 1Z4KA 2HEGA 5AW4A 2YMQA 5AK4A 3ZI4A 3AR3A 4Y2TA 1XPJA 1FEZA 1RMTA 3M9LA 5ALMA 3PGLA 1NNLA 3NANA 4Y2RA 4BX3A 1VJRA 3QUBA 1RKVA 4DFDA 3WGUA 3AR5A 4Y2UA 3W5BA 4OHFA 4UAUA 2R8XA 4NV0A 3AR2A 2ODAA 3OPXA 1O03A 3QNMA 2NO4A 3ET5A 4EZEA 2YN4A 2JAUA 2HI0A 3A3YA 3QU5A 5AKLA 1ZD4A 1TA0A 2HO4A 3NRJA 2CFRA 5AKZA 2JARA 4YGYA 2ZBDA 3ZTYA 3CNHA 2BY4A 3ZWDA 4BX2A 2AGVA 2I34A 1YS9A 4UMFA 2R8ZA 2MU1A 1TJ4A 1VFPA 2B8EA 2WM8A 4QJBA 3GYGA 4BYGA 4UMEA 3NALA 1PW5A 5AI0A 4C4TA 4UARA 2IA5A 2P9JA 1WPGA 3ZU6A 3J7TA 4KNVA 1ZS9A 2FUCA 1KYTA 4QQFA 2G08A 3M1YA 1RKQA 2YJ5A 3ZW7A 5ALIA 2FPUA 3FPBA 4CF5A 1RLMA 3B8EA 4UM7A 2C9MA 2RBKA 4FE3A 4UATA 5AW5A 3A1CA 3QGMA 5A3RA 2HX1A 1RLOA 1Z4OA 3OCXA 1MH9A 2IOFK 4MUMA 3I76A 4OD0A 5ALYA 2IYEA 4F72A 5ALGA 2ZBEA 5ALZA 4CE6A 2Q4TA 2ZBFA 2MSNA 3I6BA 3UMGA 1Z4MA 1Z4NA 3UMCA 2YMMA 4Y2PA 3NASA 3L1UA 3ZVMA 4I9FA 1TJ3A 3WK7A 4HYTA 4L6CA 3SKYA 3U7EB 1AQ6A 1T5TA 3SKXA 3WK8A 3VAYA 5IT4A 4FYPA 2PQ0A 4YIHA 4GXTA 2HF2A 3DAOA 1Z88A 3BWVA 1ZD5A 3QU9A 2X4DA 1IWOA 1L6RA 2ZOSA 2I54A 5E0OA 1QQ5A 1WR8A 5A3QA 4CNQA 4L6AA 4Y2XA 1QH9A 5AI4A 3U26A 4KYTA 4YIKA 1RDFA
chains in the Genus database with same CATH superfamily
3JAKA 2R84A 5MN6A 2W83A 4YCSA 1JH9A 4NCIA 3AEKA 3KR1A 4J03A 4BRWA 1XLTC 5C8YB 1VDMA 2C9ZA 2RI0A 1NBOA 4HXEB 2Y71A 2FR8A 3SICE 4UU7A 3TWOA 5LM3A 4RCVA 2FK7A 5AUQA 4EPVA 1P1CA 2PANA 1NXSA 5D3MA 4K9MA 1L5OA 4REQB 4Q9NA 2OAQ1 2ODEA 2ID7A 4FILA 1ZGGA 4HFRA 4PZZA 5AOAA 5FV4A 1OD6A 1J8QA 2G80A 1SD5A 4CR7A 1WBDA 3NYQA 3SX0A 2FFHA 1YXMA 2J9XB 3ZW9A 4JFRA 1DFGA 4RFLA 3TQHA 3CW2A 1J5EB 1L3BA 2ZYUX 5ALJA 2R7NA 3GLQA 4KR0A 1JHYA 3NFRA 2EGGA 3OX2A 3T5CA 5HG0A 3RUCA 1XKTA 4HUTA 5AW2A 2AEEA 1LJUA 3VPFA 4BDSA 1BA3A 1TT5A 1NKSA 3TGWA 1IHYA 2RGAA 4M6WA 4RF4A 1E96A 2C07A 5DXFA 3Q5EA 4I1VA 4US0R 4KLAA 2P5SA 1MB2A 5JSKA 3VKHA 4RU1A 1E7WA 2FEAA 3IOEA 1P5ZB 5GADl 2J4DA 1PYGA 3BL6A 1FTQA 4YMUA 5FHQA 4DIOA 3K1AA 1Y8AA 2QM3A 1QE0A 4BLOA 4BASA 3HU2A 3VKWA 1KI2A 4BFVA 5JCPA 4CLEA 5IH7A 4O5AA 3GLRA 2HMYB 4MW7A 5IM5A 2XADA 1MC1A 2NVUA 3ZLBA 4A5OA 4C7KA 2J1LA 1Y6ZA 5BUSA 2F4VB 3T5DA 3JVUA 4U2KA 5DT9A 2PUAA 2P9QA 1XCPA 3VX4A 5FTJA 7MDHA 1IATA 5LVAA 5DX0A 4AKHA 2P79A 2Y1LA 4OXXA 1SFRA 3TW6A 2I6QA 3JQ7A 4IV5A 3VISA 1T9GR 3RQSA 4ZEVA 3BMCA 1E59A 5HKLA 1P0FA 2F1JA 3QITA 5JU6A 3ETJA 1Q0UA 4QYMA 1C7QA 3RH0A 3RM3A 3DGEC 4XM1A 4XUGB 4HS4A 3SEZA 5K0EA 4G0XA 4DEYA 5BY2A 4I5FA 1UAAA 3KE8A 3IVGA 5BSRA 1C8KA 3HBLA 3W4JA 2QE6A 3KUXA 3Q0TA 4DPKA 2UYYA 1Q0RA 2H0AA 5AXAA 2XCSB 3ZGNA 2YJ6A 4O4HA 2CMKA 1C7JA 1F0YA 1Y5IA 1KZ4A 2W58A 2ZULA 3FCOA 3O38A 4BFZA 2X8JB 2OEPA 5LOVF 2EOAA 3ZD8A 5KNDH 4Z4EA 4OA5A 5EKTA 1FTWA 4KR3A 4N7BA 4MJ3A 3M81A 3UUWA 2O1WA 1N9GA 2G17A 2J5BA 4GWKA 4HD8A 3U9TA 5FOWA 2NV6A 3FIUA 1SCIA 3M5WA 1P7PA 4IDCA 1O94C 3FPJA 3JWPA 4TLBA 3O26A 1USKA 3GRZA 3TLJA 1JU3A 2IYUA 1EFLA 1VBKA 2OC4A 4FYHA 3TZEA 3ABQB 3LHSA 1HRDA 1IN7A 2B8JA 2R8EA 5ALTA 2YMLA 3QUCA 2NZJA 2E9SA 4RELA 1IHPA 2DQSA 3OECA 1ZICA 3SX4A 3B38A 4QL3A 1NI5A 5THXA 1KDZA 3ITEA 2X0IA 3CUEF 3HKDA 3T9BA 1K1EA 4BMSA 1UFKA 3AFGA 4Y2JA 1GGMA 2QL7A 4KL8S 4QHTA 5EJ6A 2J0EA 4JHXA 3AP2A 2C94A 1LPMA 4JY7A 4XJSA 1KGDA 3A4TA 3GDOA 1T5HX 3C6BA 4DA7A 3EXG1 1E1LA 2W6ID 3I09A 2A92A 3OWHA 4LYHA 5AJYA 1MXHA 4F56A 5BR1A 2W22A 2YVKA 1KPGA 2G4CA 4ZZ0A 4LGMA 5A06A 4H6WA 1NQXA 5G0TA 4G1UC 1XVUA 2RHLA 4GPEA 3THYA 2WJPA 1SUBA 3N6RA 3VU3A 4MQEB 1A1VA 5KWEA 1XF1A 2R6AA 1DUVG 2VPXA 3KZXA 1E60A 2BFBB 5B53A 4BTEA 4CT5A 5KVSA 3IA2A 4RMGA 1E1RD 1KZ7B 2WIFA 3PG5A 1FDOA 1P44A 1RT9A 1JHMA 2RI1A 4CBVA 1OUMA 2O2XA 3CEAA 2OQVA 4BNIA 3LUHA 2BM1A 4KXQA 3CF6R 1R6UA 4G9GA 3S4YA 3I5XA 4G26A 1UFRA 4YP1A 3ONVA 3VHRA 2NXEA 4BQRA 5MFZA 3F2VA 4GW3A 1L4LA 2JA1A 2EHDA 1JR3D 2D0IA 3M9XA 3K9GA 3FPSA 3P52A 1NW7A 1FC0A 1VI5A 1Z0SA 4H3VA 1KMIY 1BXRB 4TWBA 3I52A 4INAA 3QWBA 4O6VA 5ERGB 4ZIRB 4R69A 2M6LA 4MGIR 2CZCA 1W9MA 1XVVA 1JXAA 5DIFA 3LPCA 2AI3A 4BGIA 4J7XA 2B78A 2GYWA 5DTIA 4JLDA 4D57A 3OTGA 3PVCA 2IYSA 5JZ9A 1GQQA 4RULA 2JJ2A 1RMYA 3J81k 5LZ5A 2JHPA 3X1DA 4FGKA 4PXYA 4A7PA 4LFAB 3U31A 4D4GA 5AKYA 4EI9A 1BN6A 1MMFB 3P9CA 3GLGE 4NL4H 4NZYA 3CLRC 4LTDA 1V5IA 1JG4A 3FCSB 3BILA 1FTSA 4BMVA 4B73A 2IDZA 4PFQA 3H9BA 5FA6A 4D9IA 5LU9A 2R0QC 3CSDA 3CTMA 4XW2A 1W96A 2J5QA 1ACMA 3DEJA 3F8SA 2OHXA 2E18A 3CA8A 1KP9A 3WZLA 2E48A 3UJPA 1ATIA 4ZVQA 1U4NA 4N01A 1XWIA 5C2JB 3AUAA 4BZQA 2QRZA 3ZZNA 1VGVA 4F86A 1M2FA 1RLJA 2QPAA 1G20B 4C7XA 4D42A 1X2BA 4REQA 4MYUA 2LDBA 3QQ5A 3OOJA 3UYLA 3DE6X 3SLGA 5AM2A 1SQ5A 1YI0A 5IXYA 1YZNA 2DQKA 4HFJA 4OB6A 3CUVA 2GNPA 1HYBA 2YYYA 1I10A 3EAGA 3FBTA 4PO9A 1BQ4A 3G2NA 5FH9A 3CIFA 1RP1A 2AN4A 2FPMA 3ILXA 5DE3A 4B9AA 5ES3A 2WZBA 4TZ0A 2PLRA 2DLDA 1HT3A 4IG4A 4AKTA 4DWJA 3ZEIA 1H2EA 1VKHA 2A0UA 3KXKA 4EWLA 2J5RA 1WY5A 7REQB 2ES4A 1MU0A 1QZUA 1ZG3A 3AZQA 2KI5A 1FDIA 3ZYZA 1SC1A 2ODPA 4HXYA 2H65A 3DBOB 4KLNA 1ECGA 2BEJA 5CA1F 3NHRA 2P6UA 1JMKC 3AL3A 1PR3A 1MGOA 4Y9SA 3M5PA 3V1TC 2C5LA 4NK5A 3D0RA 3I9KA 3NONA 2WJGA 1OOEA 2OOSA 1G6OA 3KJZA 2I7VA 3ROFA 1D2AA 5J40A 2IWRA 4TT3D 1UUFA 1SG0A 1I2ZA 2JJQA 3UV7A 1JQDA 1NF3A 2FX2A 2YFKA 3JZMA 1SKYB 4GUDA 4IJWA 4YMIA 4CKZA 3Q7SA 4B3XA 3PFNA 1UJMA 4GPIB 3TOZA 3NV9A 1CNMA 2QTLA 4ZVTA 2UZ0A 5F51A 1HOTA 5M34A 1L8LA 2AFIE 1TJUA 1U3UA 3UJCA 2V96A 2P4UA 2CBXA 2YKGA 4CIDA 1NUQA 4XE5A 1HY0A 2JI7A 3JU3A 1VIYA 2C8JA 3GFVA 2EQ5A 3FPFA 3YASA 4ZYZA 5BOSB 2MTBA 5AH0A 3GP5A 1GPH1 1NC3A 3WLFA 3JW8A 3I01M 5DTEA 1K0UA 1ZYUA 1JB1A 2GSDA 3RTGA 1KSFX 4XX1A 1UC9A 4D99A 4WBNF 4C4ZA 5KWJA 4WLEA 3EF3A 3CLVA 2I22A 1XK6A 1ZMXA 4V38A 3ISVA 2EKPA 3A31A 3UOAB 2X8JA 3WRXA 4W9MC 4TV8F 3M82A 4DW8A 2QZSA 2UXDB 3ST7A 2E6KA 1J3UA 1NXPA 1P75A 3KDSE 1S1CA 1W52X 2CUTA 3V1YA 3OO1A 3M6FA 3RSGA 3EXG2 4XEHA 5K0CA 1TFRA 1IAQA 2Y66A 3QSYA 1I80A 4X92A 4CKYA 4G0MA 1T0UA 3RARA 2HXYA 2P6MA 1VCNA 2XF2A 2P0YA 3GA7A 4FBLA 1YNSA 4GMGA 4X8MA 4BY9E 1QJ4A 4QJ3A 4UCQA 5JJIA 5KYYB 1U2EA 1JEEA 2H54A 2C2XA 2CFIA 2C2BA 2FR8C 3VC1A 1IEXA 4EPRA 4D6XA 4EA8A 2XQVA 3B5JA 3LPLA 1SD2A 1EXNA 4RXTA 1YH3A 4HNRA 4CKXA 4J1TA 4XQ0A 4ZK2A 1X7ZB 3HJFA 3F7MA 2CLIB 3I9NA 4RHUA 3HCOA 1NBMA 2P1ZA 1KY2A 5FNZA 1KOJA 1QIJA 4J2TA 1QKJA 1T25A 3GI1A 1ZEJA 1VBMA 1FVHA 1M5UA 3AI2A 1E94E 4RV4A 1CR4A 2FX3A 1PK9A 2Q3CA 4Z86A 1A7KA 3LRPA 1WEKA 4TL6A 4EKNB 3N07A 4DR1B 4YRPA 2P62A 2G67A 5EXEA 3O8QB 2BKXA 5LMCA 1UM8A 1V1RB 1MQ9A 1D7OA 5DTJA 5FV7A 1V6AA 2OZVA 2OK7A 3E0XA 4GSLA 5HVNA 4FE4A 9LDTA 2F1HA 1E9FA 5TMDA 2WG0A 1IXRC 4PAWA 2OYSA 1VB3A 3RTAA 4FIZA 1E7QA 1KYYA 2HHJA 4MQEA 4XGIA 1ZITA 2BFBA 3QWHA 2HAEA 2PMKA 3UJ3X 4AXBA 3HI6A 4H16A 3SC4A 1GPYA 4Z99A 1WSBA 1XPJA 1Y8ZA 2R4UA 3D1JA 1KH2A 1GCAA 2AQHA 2XCIA 2YV4A 4RK1A 1UT5A 4RW0A 1X3SA 3K0EA 2YYZA 2EFHB 5JCJA 2VJYA 3KQNA 4ZJUA 4R2MA 2ZITA 3WHPA 8OHMA 2IV7A 3VA7A 1E92A 3RYFB 2XNJA 1C7ZA 1N5DA 1DIAA 3EMDA 3SHFA 3UJBA 1Z0KA 5BORA 2KSQA 3GFFA 3PGKA 2XYGA 2FLKA 1BXRA 4ZIRA 5L3QA 3ZZMA 3I1FA 5B3LA 1T8RA 1YQWA 2ECOA 2IEGA 4HZIA 1DB3A 2FLVA 3SDBA 3TQRA 4TS9A 2DPXA 3G0CA 2A30A 4ESVA 1AHIA 1WHTA 4QYXA 2OCIA 3PQFA 3RHFA 3UQYS 4EFMA 5IVDA 1TLFA 1MD9A 5CFMA 5DN6D 1SQFA 1NNEA 1PJTA 3GT0A 3UUFA 3ULKA 4CM5A 1TLLA 2G7ZA 2G0NA 5AKZA 5LXTB 4JL5A 2O48X 2NTEA 5BYAA 1NMEA 5GP1A 4MIEA 4BKPA 2GBFA 1DRUA 2ISSD 4YRCA 4ZGBA 2O19A 4PM4A 3HYRA 3ZWDA 1NUSA 1YS6A 3URKA 3R5KA 5B6IA 4IH4A 4JLOA 1N2IA 5KSPA 4D9CA 3MTBA 3D3JA 2WSSA 4GS5A 3M3HA 1QUFA 1GTMA 2BIFA 2J6HA 2WM8A 1O8CA 3O3NB 3BM5A 2GPSA 3V34A 1HK7A 3LLUA 5HJ2A 2XTZA 2H8GA 1NBIA 3H97A 4BEJA 1PUXA 2J45A 1G20A 1KU0A 1A76A 2QD3A 3K9QO 1R15A 4UARA 1CQPA 2OD7A 1DAPA 2FF5A 3DJYA 3U7IA 1KE2A 1B14A 3PC8A 3HUUA 5THQA 1S1MA 3UY4A 2JIBA 4UUQA 4Y0NA 2Q5OA 3SR3A 4CV1A 3M1YA 1ZM3A 4C0SA 3ZW7A 1NASA 3FWYA 4TWRA 1A9TA 2AG8A 4PAQA 2C7RA 4MW4A 3SMQA 2XBMA 4QXQA 3AP1A 3RT9A 1RAAA 5IKMA 4BE9A 2ZBPA 2BBSA 3E9EA 2OUIA 1OZGA 2EWMA 3EISA 3ZQUA 721PA 1CUZA 1G63A 4RE5A 4EY4A 1NL3A 3QLVA 2QYSA 1KO1A 3GZ4A 3KXDA 4AUMA 3PC4A 1XRQA 3FFTA 1GKUB 4BQFA 4Z4CA 2VXOA 1BD3A 1YACA 1QWSA 2WU4A 3KXIA 4UNPA 4D02A 4B83A 1AK1A 1QHNA 1M8PA 2WTMA 4ZJZA 1XHLA 2CVFA 2O06A 1ESCA 4X63A 1M6VA 4RUKA 2GPNA 2IW1A 3QYFA 4HQOA 5BQOA 1NYRA 4Q21A 1N77A 3BGVA 5FWDA 4C04A 1PCXA 3AUJB 1U9IA 3EA4A 2CDAA 4OB7A 1J9ZA 2ZQ5A 5D8DA 2Y68A 1CQWA 1K9VF 1GZ4A 4AWBA 3AFIA 3CO0S 3FPGA 4AZ3B 4NECA 3AZOA 3LP5A 5BXYA 1PR2A 3ZU2A 1PJZA 1PL6A 1QVRA 2ZCVA 2BZSA 1RRPA 3HUEA 4MYRA 2WQZA 3QPBA 1EI9A 2CLHB 2ZAGA 3BX1A 1IXSB 2VQ6A 1JAYA 1GG8A 1QR6A 2WVAA 5UKDA 1G8JA 3BTUA 4NBKA 1E2KA 1D1TA 1RPAA 1AKMA 1O0SA 3PUVA 1E6CA 4H0FA 3HWWA 4M0EA 5BOSA 4U7FA 4OXRA 5IANA 5JMWA 2FHSA 4R40A 1ATZA 5KTNA 2HUNA 2A7QA 1CNFA 4HEQA 2LIPA 1F48A 1SHKA 1OQAA 3VR5H 2IHUA 2X13A 1AK2A 1T4DA 5BSTA 3G49A 4UOQA 1JQAA 4HCJA 2P0EA 5EA2A 3X3HA 1NR7A 2EBHX 1AX9A 2NTVA 3ZKWB 5KTKA 2PBFA 3UYKA 1T3HA 2G25A 4EG1A 2A7XA 1F51E 3LOQA 1I3KA 4OB8A 4C0LA 4ETNA 5K05A 5PGMA 2AQKA 4J7UA 1FJ2A 3BWCA 1YC2A 4P7JA 2HPAA 3NIWA 1DKQA 2WEKA 3B6JA 3K0HA 1IZ0A 5CEEA 5KYGA 1U3WA 4RFVA 3KIPA 4TVBA 4JB8A 3EIQA 1WBBA 4KBYA 1P0CA 2VSOA 4NU8X 1XZLA 3L0YA 5J4VA 1L5NA 3E03A 3BXXA 1K6IA 1N3YA 3KE9A 3L0CA 3D6NB 2NZUG 2W90A 3PVZA 1GUFA 4Q9KA 3SDZA 1OFUX 1CEYA 1IQPA 4L9SA 3C3MA 1VMDA 3HSKA 2ERCA 5DHPA 3DXFA 3WDSA 4EB0A 4NH4A 1Z6PA 3OC6A 1KPIA 4QBHA 5EE3A 3WKCA 4EELA 1SVSA 1EK6A 1SC4A 1X7ZA 2JAPA 1CXZA 3PXUA 4TMZA 4Z9XA 2WIDA 3TUZC 2WAXA 3SCZA 5IS2A 5FLXA 1LUAA 3D7RA 1BOFA 1WULS 2GN1A 2IX3A 4AROA 4D9EA 5A7FA 1R12A 2J07A 5EKXA 5JXHA 5KKCA 2V9ZA 4YX9A 3RC1A 4E7PA 3NB0A 3PICA 3VAAA 2VJCA 2PZAA 3JD1A 4Z4QA 3MMSA 2I6UA 1SHLA 2JGMA 1MJNA 1HDYA 4LA4A 1X9GA 2X0DA 3P2MA 1BHSA 5C37A 3HXQA 2AKAB 5H8WA 4RX1A 3M6XA 3OZ7A 1W8IA 1OFHA 1I3OA 3DZHA 3O8QA 4C3ZA 5JRJA 1V1RA 2G82A 5FJJA 3WBBA 4BLWA 3PFWO 1NE7A 4PS1A 2RGCA 3ZV5A 4F2PA 4DLUA 4PNHA 1IULA 4U9IS 3HKEB 5J2UA 5CM2Z 4RFSB 2QX9A 3T06B 2J7PA 3LBAA 1GRRA 3LYUA 2HADA 3N8NA 3DWIA 2PT9A 3Q8WA 2NSDA 4RACA 3COPA 4JCOA 1Y3DE 4J0IA 3R7DA 3PC6A 3WYDA 4RESA 3OHSX 2V6JA 3ZDRA 2XGJA 3UJ6A 4ZZ3A 3R3SA 1F06A 3TIXB 1E5LA 4J07A 4CFZA 3KKLA 3C8ZA 1TMYA 1PSDA 1QF7A 1VA4A 3QYPA 4EA6A 1KERA 2GAIA 3RD5A 3CRNA 1PWYE 3BHNA 3DXXA 4Y9RA 3RYFA 2GNAA 1IBRA 2PRYA 1XN1A 3G1TA 5AQ1A 1PFKA 1Z5WA 1OLUB 4LTMA 1NU8A 3HNOA 2XVXA 2PZLA 4Q7LA 5B57C 4GM1A 4DAEA 3SXUB 5B1YA 1GNTA 2H7VA 2HRCA 1R0YA 4MVJG 1X7YB 2A59A 4A6DA 1NJSA 1DADA 3HBMA 1ZRSA 4R1PA 2Q99A 2A35A 3CX7A 5B4VA 2K87A 1F2TB 4R3NA 5FF9A 1DTSA 4HQNA 5CH5A 5AJHA 4F84A 5JV5A 2JKVA 1JHDA 5LXTA 4JL8A 2Y9PB 1PR1A 3MYRA 4UMVA 1XTRA 1K8YB 1QYDA 3KKMA 3SQWA 1LLFA 1B41A 3RRMA 3C7TA 3G6KA 3IMKA 3OQIB 3QEJA 5E8RA 4IGIA 1YUMA 4UUBA 1E1QA 1EB8A 1N2JA 1ZRHA 1WXHA 3K8ZA 3D3NA 3DONA 2DCMA 3LT4A 3P9NA 3NUGA 5C4GB 1CUAA 5A4JA 4QODA 5CVEA 3JRWA 3W4KA 4NDZA 2GLTA 5L40A 1LVHA 1GXSB 3BK7A 4EUFA 5CDHA 4L51A 5FOVA 1A9QA 4DYVA 1E2PA 3JD4A 1K7FB 1ZM4A 3JSAA 4RHEA 1HR0B 3A3PA 4RNDB 3LUPA 1ULUA 4O1HA 3RRNA 3QE0A 2I6GA 3H2KA 1DIHA 1OXSC 3AQIA 5TRTA 4FFBB 1QIGA 2SECE 1V8ZA 2XNDD 4MUEA 2QGAB 1RM5A 3I32A 3OLQA 4JJ7A 3WIOA 1C9YA 4EDFA 4K9QA 4BNDB 4EMBA 4M0KA 1O95C 5LJIA 5H82A 1M6YA 3PUXA 2GYVA 1A77A 1Z0AA 3GRPA 3PFGA 3V1UA 1P39A 4J1TC 4DUPA 3CWZA 2FF7A 4Q3AA 1T6YA 5IBQA 3UUGA 3B1VA 1XCGB 1NG1A 1E3LA 3H3JA 2CK3D 3HN7A 5K4GA 1STOA 1YR2A 3ONDA 1TRKA 4JYPA 4R0NA 4URUR 5A05A 4I19A 2XMBA 2O7NA 1A4UA 3OIUA 3GJ0A 4MVJE 4B5LA 5CVTA 4G1FA 4BO9A 4P36A 5DNYB 1ADBA 1FP4A 1JX6A 1MPXA 1Z7YA 3F3YA 4WV3A 5T6BA 4NFSA 3IX7A 4UREA 2HF8A 1PKEA 1CLUA 2BZGA 1SD1A 4RK4A 5KMGB 4AB1A 4BNKA 3SD7A 1TDJA 4B6JA 3B2NA 2IY9A 5CCDA 1GAXA 1E20A 1ESNA 3P0FA 1R0BA 4G4SP 5CYPA 1K5DA 3KHTA 3O7MA 4A9AA 4CG3A 3SSNA 1E3QA 1NYLA 1ZVMA 2J6IA 3KQQA 2UAGA 5KNBD 4AZ3A 4ME6A 5GM2A 2Q5FA 1VMEA 3L8FA 5IRCD 2WAYA 1NRXA 3QVJA 5DBOA 3H2IA 4UTZA 4WACA 1AKTA 5EZQA 3RGWS 3RJTA 4AICA 4Z2AA 1VL1A 1PZMA 1XLVA 1HG0A 2HFJA 5AVJA 2UYHA 3F9IA 3L04A 5BO5A 1UPBA 3SFVA 1D2NA 3QQPA 5FB3A 2IOQA 3R9KA 4D2IA 1X70A 2GKGA 3IVAA 1PK8A 1QBKC 1WUKS 3EDMA 5AKEA 3S8YA 5D84A 4JBXA 1VI2A 1GNSA 1PR6A 2UKDA 4XTCS 1P1HA 2V7GA 2W2NA 4BYMA 3SXPA 1R7RA 1DWQA 1VBFA 3BS4A 4X91A 5ALHA 1EKXA 3P2IA 4HBGA 4KQEA 1CUBA 3ZKWA 3SBEA 1VLMA 3EC2A 5EJ9A 3Q7IA 4HDOB 3ZXYA 1NM5A 1FDTA 1FBNA 2P2ZA 4LHYA 4REOA 3FUUA 4LPKA 5BT8A 3HU3A 3HHEA 3UMFA 2NAFA 1ZM7A 1XZAA 3PF9A 2P2LA 4EUSA 2EW2A 3I9MA 3U4CA 2CJWB 1XPRA 4TXLA 4F6RB 3B53X 5HCUA 5LLSA 1GLGA 1WDLA 4DMFA 7MHTA 2CEKA 1EXMA 1QU3A 4HDNB 1PEDA 2MSCB 2OHOA 1B6RA 1IEWA 2DF8A 3BRQA 1SBQA 2VZ9A 4MI6A 5F2KA 2WU3A 3IBYA 3RR2A 3LRTA 1NRIA 4X6LA 3BDAA 2EIHA 3TPCA 4IDDA 3UTDA 3PQ4A 4OQFA 4PCAA 5HXAA 3ZK9A 3EF1A 2VR1A 3E4CA 2FZGA 1KDTA 2HMTA 3ES9A 5DHSA 3VPDA 4EI2A 1QFMA 4CDRA 3PEVA 3Q41A 4UBJA 3SPXA 3OLZA 4Z0HO 2BEKA 5CB8A 1U7DA 1WDWB 4AZWA 1JLMA 1U8FO 1VJDA 2WJAA 2PWZA 3ETNA 5MN4A 5JW6A 5T8KC 3PNMA 2C31A 4JJ6A 1F20A 3CISA 2FMHA 1GYPA 3QLVC 2DUWA 4OHCA 5IZCA 3ZWCA 1TECE 1XZPA 3HKEA 3QVWA 1DAGA 2PRIA 4RFSA 1CC1S 1ORTA 2V7QA 2WBLC 3K73O 4NBSA 3D4LA 4QYSA 3OPYB 1KO4A 4U7HA 3NV7A 2PJDA 4Q01A 5H5JA 2YQZA 2WNIA 3K0KA 4ARAA 4DE5A 3WAJA 1LW6E 2IHYA 4GSYA 4OX9B 1XTZA 2HMWA 3E3MA 3L7NA 1JKIA 1Y48E 2CW5A 3FDZB 4J0QA 1U9IC 3DT9A 3NDJA 4HYEA 3WZMA 1IIBA 4IO1A 4TLDA 1QUEA 1S6YA 5GJCA 4KITB 1IZYA 1E2JA 5ALDA 5K0SA 2LBPA 5HJ5A 4KKXB 2Q29A 2VRBA 4KHPB 1GZ6A 1VSTA 5DBFA 3RJ9A 4FD2A 1LLCA 2B83A 3KTDA 4QDOA 1KJ9A 4D3SA 3SXUA 3VVBA 3NPMA 3W5CA 1NLMA 2R11A 1UJ2A 1GU1A 2IYPA 2TECE 2YXBA 2ZIEA 3PC3A 4IUCS 3W6OA 3BMQB 2NT4A 2WYWA 1R9NA 4KQCA 3CKKA 4GGMX 2ZJOA 5DI3B 3PCTA 1F2TA 3K94A 4ZC8A 5JEDA 5TS3A 1PFWA 1GQRA 3HVUA 2HL6A 3WNCA 4M49A 1QO7A 1R0XA 4RANA 1HY3A 4LSMA 5E9JA 3CMCO 4E5UA 1HNZB 4XYEA 2EP5A 3A10A 1Z2AA 3OQIA 4QSMA 4MRSA 4TLCA 4I5IA 2D28C 4YY3B 4G0QA 1MB3A 4GECA 4L3VA 4Q47A 1Y6QA 1XTKA 4BP8A 4NE9A 1CJUC 2B37A 2E55A 4TTRA 3NC0C 3EMBA 5A02A 1MHTA 4HNHA 1GXSA 1YE5A 5HTKA 4ESHA 3ESBA 3NIFB 1DFIA 3JQ8B 5DM70 2H2AA 1P5RA 2ZUEA 3KB8A 4DL9A 4Z9FA 4MA4A 4GU5A 5H3CA 4F5ZA 2XB8A 4PGAA 3KUDA 1ISRA 1FUOA 3ED5A 7ABPA 5JDCC 4Q18A 4AYWA 1LEHA 4FFBA 5L7YA 1GG9A 1ZRNA 4BU1A 4AZSA 4CTJA 5K3CA 2DWUA 2ASVA 3FDFA 4MCHA 4RD3A 4BNDA 1ABEA 4B7CA 4JHLA 1AKNA 3PI6A 1ORHA 4ZOCA 1RC0A 3UIEA 4F3TA 1X8JA 5KYKA 2GK4A 1P29A 3AR9A 3FYUB 4B74A 3NBXX 5BURA 1WSAA 2VP2A 2W0MA 3I6IA 4LC1A 4QBKA 3B1JA 4G37A 1Z0DA 2G5GX 1M2KA 3PA8A 5G40A 2QP9X 1SBYA 1GGHA 1F5NA 4QUEA 1R0RE 5CJ2A 4CV0A 1H0RA 1V1JA 2XA1A 3GRYA 1CULC 4YB8A 3JYOA 4DSTA 3OLYA 2VH5R 4W5JA 2O5EA 1V5GA 4FN5A 1GPLA 2C3UA 1WNFA 4CUJA 5KTRA 1EXVA 4IJKA 1J0AA 1DKRA 3AG6A 2B4AA 1HDGO 3NNSA 1ONOA 4NS1A 2C3YA 4UUMA 5FQOA 5KMGA 1X1QA 2BR4A 1L1EA 3OZVA 4NJEB 5BRJA 5ICEA 1JG1A 4QEKA 1PNVA 2PUHA 3LXRA 1G8YA 4DG8A 1R18A 4AWAA 4IFIA 4IL5A 1GVNB 2OM2A 3MELA 3PGLA 3VSBA 2AYYA 1Z15A 3E04A 2MR5A 1X77A 2YZKA 4HF7A 3LXUX 2RAFA 3DBVO 3ENWA 3JD0A 4JGBA 1HYQA 3ZR4B 4K3UA 4EO4A 4DA0A 5BWMA 4X6XA 3BWYA 4OUKX 5DLYA 2VDVE 4CIWA 1Z0IA 1J07A 3TOVA 4AU1A 4NSNA 3B1WA 2VDUE 1E3DA 2FZLA 4Q05A 1N2XA 1GUBA 3MJ4A 3AHIA 5F91A 2XB2A 1LSJA 2NO6A 2FJPA 1ULSA 5C8VA 2W8BB 3WHIA 3N7TA 4P4SB 2A9PA 2V7EA 4X24A 4YGYA 2GXSA 1OBHA 2ZBDA 5JNRA 5EWMB 2WG1A 1YFKA 5D7NA 4J6FA 4BX2A 3GT4A 4BC0A 5C8XA 1ECCA 3KQSA 1HE2A 1BOOA 2UYQA 2VTDA 1U8UA 3ID6C 1J9GA 1JBQA 2WA2A 3WL5A 2P1RA 3BVPA 3H9GA 3ZWPA 2NUTB 4YMTA 5MGBA 2X23A 3II6X 4KIJA 4QJBA 1ZD8A 1NOJA 3OQ1A 3VPSA 3L1KA 1FSPA 2FW0A 1KVQA 1R9MA 3RKSA 1GM5A 3GL9A 3OFJA 1E1CB 1NYQA 2Q28A 3AEXA 1TQ4A 2CJWA 2I8AA 2ZSDA 3FUXA 3PT5A 5AI0A 1XXHE 3WYBA 4E31A 2LCIA 3OURA 3DS8A 3PD0A 3W1WA 2IXDA 3PDJA 1ISJA 4HDNA 3J7TA 2ZYGA 4G07A 2PMBA 3N2KB 1YDGA 3ADDA 2PGDA 3Q88A 3GEDA 2P3SA 3TF5A 5F3RA 4IKPA 4JVOA 3EVDA 2SICE 2X2OA 1AU9A 5JSUA 2R68A 3HDGA 3O92A 2X6TA 2ZJ8A 4UQOA 1YFMA 1M34B 2QTHA 3E9QA 3BE4A 5DLPA 1WB9A 4JR2A 5EKDA 3A1CA 1IOLA 2IFTA 5DH9A 4DCGA 2NWQA 4EHJA 3L1IA 4INPA 2OE2A 3H5OA 1PDOA 4RGQA 3LK6A 2XB6A 3QPCA 3CPHA 1A9OA 3X1JA 4MW1A 3HH8A 1FVFA 3PXEA 4BGVA 1EFVB 3GAMA 4YK7A 3C3BA 2WTAA 1N6LA 1GA4A 2FEWB 1Y5LA 4L6IA 5DP1A 3ZV4A 3V1LA 4EEIA 1PFQA 2HWKA 3OPYA 1UKCA 4JP5A 2J3LA 2O2ZA 3TLYA 4I9FA 2JIRA 4L4SA 2ZJ2A 3SQOA 4L6CA 1T9CA 3SKYA 3UK7A 5I7EA 3FDZA 2JB9A 1IHXA 4XQ9A 2G4LA 1IY8A 4FCCA 3JVDA 1KIMA 3EIUA 4DCUA 3GJQA 4U00A 5H70A 4NMLA 1KFKB 4RKQA 4Q03A 4C6TA 3PEWA 2HK7A 1UJBA 2PX6A 5A9TA 5SYNA 2FCRA 2IVZA 3BUSA 2TMGA 4QPJC 1IWOA 1BE6A 4RDIA 2O1EA 1MRZA 2QE7D 4DF3A 4QYTA 1WNTA 3FWNA 4MVJH 2BMJA 1XMXA 1Z2CA 3UWDA 5AP9A 1VBNA 1YVEI 2CLEB 4HUQB 1FRQA 1ZKDA 1J90A 3BMQA 3EQ9A 1GAJA 4RC9A 3DMDA 4D82A 5DI3A 1FFAA 2XTMA 4FZJA 2BTQB 4M53A 3STXA 1NUAA 1EP3B 2PIAA 3I5YA 1RDFA 1E2GA 4N8SA 3Q8KA 3NGXA 2COEA 3ZVLA 4Z0NA 5JZVA 2FW7A 2P3QA 1NVTA 2K4MA 2X9VA 4QXRA 4K7JA 1E0KA 3UFXA 3L8GA 4WCFB 1U7ZA 3NHLA 3OZGA 3AOGA 4C0HA 1Z17A 1IRIA 1U1CA 4PGHA 5LUAA 4IDNA 3H9CA 5L9AA 3MS2A 4MV1A 2IY7A 2F7SA 1QTNA 2G9VA 1NM5C 5CURA 4IOKA 4PTYA 4BEWA 3A6LA 1S8OA 3JQ8A 1QQ6A 2QI9C 5ED0A 4DNQA 2NTYC 4ICIA 1NVVQ 3I9V6 3HQ4O 5I9SA 1GP2A 5JARA 3BRWD 3MTGA 3CKMA 5CEJA 2JLYA 4M7WA 1EFHA 1NX6A 4HYQA 4C4YA 3V8RA 2AF4C 4CQJA 3KVRA 3QNWA 1A5BB 1GO2A 4JLNA 4H60A 4DYHA 1DC5A 3KZMA 4FGZA 1B6TA 2B2NA 3N2NA 621PA 4UEOA 2P9BA 2NYRA 3GA0A 3PNYA 3L8EA 2ZVPX 2GM3A 3FYUA 1PG5A 2XOKD 2XCQA 1BH2A 2XVMA 2Q41A 2A88A 2ZJFA 2IEIA 2Z09A 2CMDA 1U81A 3KKPA 3SK0A 5A5GA 3FDXA 1PZXA 2J59A 3FYDA 4GVLA 1DBIA 1P2GA 1DAIA 2EX4A 1X6VA 1UFOA 2W6OA 2CDNA 2IITA 3Q1KA 4GIBA 3I72A 5DNDA 1L3CA 4X3PA 4ZCSA 2Z8YA 4GPD1 2P30A 1JSWA 1DG3A 2H11A 2DMRA 1WXGA 1XQYA 3MILA 1T9BA 1ZOLA 2VSXA 3CEPB 4FFSA 4BHTA 1VXRA 1Z82A 3GQBB 1ZWLA 3ZE0B 2JGKA 2VP0A 5HSGA 4FR5A 5EXSA 2IU4A 4KO1S 2DBZA 4NJEA 2CZGA 5H1YA 1RZRA 5JXGA 4ZT2A 1Z5OA 5AW0A 4OO3A 3FHTA 3KQOA 1KK2A 4NYIQ 1G4HA 3EZ7A 2V8OA 4CKEB 1I14A 1UJ5A 3SFTA 1G5QA 4LYDA 3U40A 1RKBA 4ZHQA 5LNK6 3TOXA 4KE7A 3AH8A 1KVUA 2ZIXB 3BD8A 3RRZA 2AYXA 3UANA 2YJTD 1CZKA 5KNCH 1P4AA 4UEWA 3SE0A 3HYCA 5JT1A 1U2GA 3BL5A 3EPRA 5DI9A 1U0TA 5IDWA 2O2DA 1J2TA 2C1ZA 3DVLA 4AZVA 4JX8A 1OWLA 4KMSA 5BQXA 2HNBA 2XI4A 1CUJA 5KTYA 4HGYA 1U2SA 4P4SA 2HEIA 4FGWA 3C3JA 3PJRA 3TLBA 2AK2A 5EPOA 2YJZA 5EWMA 2B35A 3ZE1B 3KK0A 1C3VA 3TW8B 1CUUA 4EA9A 4RYLA 2BE7A 2WG2A 3E0QA 3FVVA 3G5UA 3UGTA 3FOFC 5LOVB 2WJ6A 3GEPA 4Z5XA 1REQA 1YJAA 5FAKA 2NUTA 1ZMRA 2X76A 2G8LA 1RZ3A 3GBSA 4JZYA 4CN9A 1THTA 3SZOA 3LT2A 2XHZA 1E1CA 1PR5A 4UUAA 1KO7A 1ACJA 3CLSC 4KE9A 4WXPA 5D5HA 1Y4ZA 1XU7A 2ZUCA 3L8CA 4CQMD 1D1PA 4MULA 2QIPA 1T0IA 1WZIA 3F78A 3IAM6 3LKZA 3LY8A 3MRVA 4YUXA 1UK9A 5I45A 4KSCA 2YY6A 3RJ5A 1P9OA 3VPHA 3K2EA 3IO3A 4EF6A 4GF5A 4RS3A 2PIDA 2QYTA 5TE9A 1IM8A 3WL7A 2G71A 1HLDA 1WXDA 2CHFA 3FTNA 4RE6A 1JSRA 1M34A 1WLSA 4O63O 2VPTA 5JANA 1O89A 3BHIA 3ADKA 3DOIA 3KYIB 3G2QA 1CDZA 3NNNA 2P69A 4QUJA 4AKSA 1EIWA 2HRRA 3H18A 4H1VA 3HO6A 5ER9A 3FR8A 4FUTA 1NZDA 2D1SA 1GT91 2PGLA 3CMMA 1W581 1DSSG 4WZAB 2NNLD 1YZHA 3MMNA 4ZQGA 1SH7A 1I2CA 1EFVA 2GEFA 3A1FA 1E64A 1O97D 2BFDA 3A4LA 5D6NA 2PQMA 4Y8VA 2CV1A 3D64A 2P5TB 1JHPA 3GG9A 4FI3C 4X54A 5LU8A 3ICWA 1T9DA 2ECKA 3O1LA 4LVCA 2VK4A 4S1PA 2PKRA 1U9CA 3GNTA 5JS1A 5JSZB 2D2XA 1JFFB 5IZ4A 4WDRA 3ESQA 3NQ41 4AZ0A 1P4GA 3N59A 3B60A 3FCAA 1DS6A 3B9RA 1IC6A 2QHXA 1MA0A 4NXNB 1NKTA 1B15A 1K4KA 3EWAA 4J94A 4WOKA 4G36A 4EQ6B 2ZB4A 4HPXB 3ZVRA 5C5EA 3ZG6A 3FAKA 5EJGA 5F4ZA 3P9KA 2DY1A 4AC9A 1ODIA 1QBGA 3WSWA 3H7AA 3LAWA 2C99A 3CBQA 3MSCA 3OWXA 4EKEA 4F93B 2ZJ4A 2IBMA 1CCWA 1P9NA 2E89A 3H2GA 3QWIA 5FYQA 1KA9H 3NI2A 3TZCA 2IXEA 4EABA 3FHJA 1P5HA 3ZKAA 5JZOA 1L5LA 1Z8FA 4HUQA 1DO2A 1NWHA 1U0NA 1XPOA 4DR4B 3DO6A 1FPQA 3RS0A 1XZHA 2HDNB 2HDWA 2BTQA 1LWOA 1ORRA 1XKQA 4G5QA 4G8DA 1N2CB 1T0HB 3DTTA 2X0NA 4XKJA 1AKQA 1UPAA 5T4FA 1JIKA 1MTOA 1T29A 2Q4EA 2NVBA 4FDLA 1UPCA 2YCBA 1WJGA 4URVR 4FFWA 4BFYA 3DTYA 8LDHA 4U7JA 3AVYA 1ZHFA 3MBOA 3VUEA 5FNVF 3ZX5A 3MIIA 1RYFA 4WNYA 3W04A 2Z6AA 3G13A 2CEAA 3D1LA 4GNRA 4OGWA 4Q3KA 4WJKB 2R1TB 3GDWA 1E2BA 2AW3A 4I3FA 2QQGA 4WA8A 4CYMA 2W71A 3CHYA 4BECA 2WSLA 3ECCA 4FHDA 4JSRA 1YB7A 3TKAA 4DLBA 5IVKA 2WP8J 3LCUA 4ECEA 4N18A 2DR3A 3DOJA 1S2NA 2Z2IA 1O0CA 5E7JA 4XYLA 4K6CA 3P5SA 3F3MA 3LQYA 1RTKA 1T5SA 4XD7A 1ID1A 2OFFA 3IKVA 5FQNA 3OFNA 4R3WA 3L43A 4MQ4A 1ZK0A 1RYZA 4NX2A 3OTHA 4IWXA 3SN6A 5HS6A 4EAAA 4M1KA 3R7SA 3ICEA 1H5UA 1XIVA 1KC3A 4BLRA 5CT8A 4XEUA 1T15A 2VNKA 2X58A 2I5PO 3DMTA 3LHDA 3T8YA 2M98A 2DKNA 5EJ2A 3UMSA 2JVJA 1M54A 1XN4A 3WDLA 2A3RA 3D81A 4EBBA 3ESXA 1H5NA 1B43A 1HM5A 3CR3C 1Z7GA 3NDPA 4C6HA 2QN6A 2PZGA 3DE4X 2EERA 3HDTA 3KLMX 3S1LA 3P9YA 3ASUA 3TDNA 3FMOB 1V3VA 3IUNA 4W5OA 3IEMA 4JOSA 1BHO1 4BLTA 4CKEA 1NMQA 3ZZUA 4EGFA 1KQ7A 4O25A 1RQPA 1B0UA 1T2DA 5AM4A 1L7OA 3TSOA 2XEXA 2ZIXA 4QQNA 4LMBA 2Q5EA 1RI3A 3ZV3A 4B3TB 1NP6A 2CMHA 3OCWA 1GN9A 1U3CA 3BMOB 3FNEA 4M76B 2C9OA 3RVMA 1Z3IX 2ENUA 3ZIAD 1S01A 2BFCB 3C24A 4ESOA 4QDXA 3WLEA 1ZU5A 2VAVA 4RQTA 4ZOQI 3L1JA 4B4KA 5C8ZA 4XAQA 4PX5A 5IPFA 2FPOA 1AJEA 3D6TB 1CUCA 4JODA 5CVJA 1II8B 4BX8A 2R751 4LFCB 3KU1A 4QDZA 1ZD2P 2MSLA 2UZIR 3IAUA 1OLOA 3MG9A 2JFXA 2R60A 4RYDA 3QIVA 4W8HA 3V7FA 2Q2NA 1P7ZA 1CHDA 3F4LA 4JASB 3BSWA 5FI3A 2JDID 3BH7A 3LA6A 4B5KA 4WBNB 4AIIA 4ZEXA 3TW8A 4NY1A 3PGVA 4GXQA 4KTVE 3D7KA 1UEJA 2I2DA 1LQUA 3GT3A 4FSXA 3U7GA 5LOVA 4DY6A 8GPBA 1HDZA 2QN3A 4HGOA 3PXBA 2GPWA 3VNVA 1YMQA 2HREA 2R5FA 5A7GA 5JZBA 2ACVA 4EVRA 1DO8A 5JJ5A 3C3KA 3KETA 1DJNA 4ZCPA 2REXB 3SOZA 2HO5A 3OF2A 5AVWA 5IP5A 4EI8A 5JFOA 1DIOB 3LQ4A 4OQZA 4QGHA 3HA7A 3CGGA 2CE2X 1YOBA 3KWMA 3M1IA 1Z6ZA 1UINA 2C5SA 3JAWB 3N7AA 2XE6A 3OQVA 4AN0A 2P4EA 3AR8A 5DSZA 7ADHA 2QRJA 1FRNA 4UZFA 4D5EA 1FLVA 3PR2B 4XRGA 3AGPA 4CCWA 3DNPA 4NP6A 3L1HA 2O8DB 2CNLA 5CP8A 1P45A 2BBWA 3HYLA 4RQAA 1ZC3A 3OSUA 2XSZD 2EGHA 3UT0A 3OETA 3JY6A 4URWR 2WZQA 2XMQA 1RI4A 3TLGA 2EU8A 1P9LA 3DAGA 3FSGA 4FHZA 4GMFA 5DV9A 3FYUC 1Y6JA 3AUYA 5HIMA 2A14A 1D2MA 1FP6A 1AUWA 1SBTA 2EJVA 3A8TA 4MGKR 2OBMA 4R5MA 4BVJA 1COWA 5LBIA 4WZAA 4F6CA 3RWBA 4BB5A 4ZQFA 2X6RA 4YRMA 3BJZA 4S12A 2YMQA 3OE7D 4I8XA 3ZI4A 1M1YB 1XEFA 1JHVA 3G9ZA 3S68A 3ND8A 1FMTA 4QOFA 1VKOA 5JR3A 1DU4A 2XWQA 3U80A 4K87A 2VWQA 5IUKC 2IDJA 1CSEE 1JFFA 5CT9A 4FWTA 4TL9A 1ISHA 4BX3A 3KSUA 2QS9A 1XFAA 3OFVA 1GG5A 1DKUA 2G0TA 2GT1A 2I6FA 1NUHA 4HADA 2IWHA 3DR5A 4NOLA 3K9NA 3ZNPA 4EQ6A 3HE3A 1E79D 4QNRA 1ZHHA 3TDMA 1W87A 2I4MA 1GN8A 4DLTA 3HVJA 3OQOA 3BBPA 3CGWA 2WE8A 2EKQA 2FR1A 3M3DA 4ZDWA 1IH8A 3Q40A 1HYEA 3G0IA 1A8SA 3QU5A 4FOSA 4L4UA 4QPDA 4E12A 2VRCA 4W63A 2AD5A 2XZTA 3S2YA 3KKNA 3LBIA 1C81A 1XRNA 1U2GC 4GDMA 3TM5A 4B82A 3THWA 1V8BA 1N3BA 5E1BA 2H6EA 3IRVA 1LI4A 1XHEA 3JTMA 2W6QA 5KREA 1GPBA 1AURA 1UDAA 2EBWA 2EFYA 2JHFA 2ZT6A 3M89A 5TARA 2O59A 1BTOA 1JVNA 1XELA 1RSZA 2DKOA 2YY5A 5AR1A 2F1OA 3NATA 1UXGA 2MU1A 4NH0A 1TJ4A 1O2DA 1VFPA 2PXXA 2ZS8A 1RACA 3FETA 3O95A 2YWDA 3ZJYA 4QJIA 2COUA 1GFIA 1K63A 3FFWA 4DCVA 4IIJB 2AVNA 3LYLA 2D1YA 3FFBA 2MSWA 3R23A 4IZOA 1VPVA 2CJYA 3OIDA 3DSRA 3OEHA 5I3CA 2P6RA 1PW5A 1Q74A 4WKPA 4IXNA 3O84A 4J4BA 3RVNA 4E5YA 1XU4A 4L9AA 2X5OA 1K7WA 1MBZA 1CUVA 1TI7A 4FLFA 1PZNA 1YR3A 4LC0A 3LDUA 1DAEA 2ERXA 3WB2A 5E2BA 1CS0B 3U1TA 2FUNB 1PX0A 3LKVA 2ZPAA 3CH6A 4R51A 1YGYA 2R1TA 1YQQA 5DRYA 5TEWA 3S7ZA 2A86A 2Q62A 3E35A 2CXUA 5ALIA 1SURA 4HAYA 5GOTA 4YPVA 2FW9A 1P19A 1YK1A 1EQUA 2PZMA 1CX9B 4I4CA 1M76A 1J0CA 5FTKA 2C9MA 3T7DA 4N8DA 4YHBA 5D6OA 2VP5A 2YVLA 3BJIC 4KQWA 5EQTA 5FD8A 4Z1MA 3R6DA 2D59A 3ELUA 3I5MA 2CMFA 1OBVA 1NAIA 1DKPA 3BD9A 2XGMA 5NULA 3PYLA 2AZDA 4YWJA 3RVRA 3GPBA 1AF4A 3FLMA 4PGMA 3RVLA 4B43A 3P2YA 5HUJA 3IE1A 5KYTA 4LOIA 3WOHA 3IBSA 1QM5A 3TR0A 3M1AA 2RHTA 4RVCA 1TOAA 2Q4TA 3DCIA 2MIIA 1JEQB 3OJFA 2MSNA 4J3FA 1DIBA 3OZTA 4YQZA 3R6LA 2Q2VA 3CBGA 2JLSA 1VIAA 3HUTA 4K40A 1CYDA 4BO5A 3H75A 1OH8A 1HEUA 1HH4A 1YQGA 1DWOA 2IYNA 2ZYWX 5AVOA 2PA0A 4LY9A 4J4HA 3IKTA 3WRVA 3ZVMA 4XQGA 4LK2A 2G9RA 2FE4A 1FUYB 1HLFA 4ZC1A 2HV8A 2HTFA 5H4GA 4BN4A 2YVQA 3DE2X 3I0NA 3PSAA 3EW9A 2XDAA 4LNUB 4K9RA 2JASA 2QUBA 3R3VA 5ECWA 1SRQA 1YVDA 1G21B 1PT5A 3UKJA 3R9XB 5COAA 1S96A 1DAFA 5LNK1 4BC1A 1ZD5A 2JFQA 3PUYA 3BMOA 1QZZA 1VLLA 1UC4B 2RGNA 3UC5A 3ZWAA 3I3SR 2BFCA 1NVEA 1UBNA 1M1UA 1SXJE 1Z45A 1RBQA 2NADA 2V5UA 1H65A 3DUFB 3IYLW 1VHWA 3K72B 1CDOA 2HSDA 3G68A 3HSYA 3P2OA 1G6Q1 1QYVA 5DNAA 5ECGC 3HRKA 3PRJA 4PWYA 3X1KA 1II8A 4MWCA 4F96A 1XDZA 3ZLJA 4R7TA 2AR0A 2BPOA 2ZTLA 1JEOA 5K8LA 1JSCA 1F8FA 2ZJAA 4DADA 3K0SA 5LD2B 1D8AA 2FUG6 1R3UA 4PQFA 2Q1TA 4PXAA 5J9FA 2FE1A 3KPJA 4B71A 1YHNA 4WBNA 2C92A 3LL7A 3FOAA 3G8BA 4NEGA 3W9BA 1PYOA 4MRMB 4DMMA 3HM9A 1ECPA 2ZRKA 5DMHA 3N87A 3KXLA 2QGZA 4FYVA 3NHZA 4DDMA 1PLLA 1QX4A 2OO7A 3SU8A 2GR9A 3UOGA 2WHEA 4W5WA 2JFUA 1BU8A 1TE2A 4AM8A 2PMFA 4W5QA 5K9ZA 1FLDA 3AF1A 4AKGA 2O7SA 3TSYA 4KK3A 3UJHA 2QJOA 1VL2A 3D9QX 5DM4A 1DINA 3ZWOA 2LPMA 4FW8A 4WCFC 1OGIA 1KJQA 3S2EA 4I8DA 3CSSA 1NPYA 3AVXA 1A5AB 3CLUD 4CF6A 3BE5A 3F1LA 2JGJA 1CUWA 4OYHA 3TN7A 2O3SA 3JAWA 3ANMA 3IMCA 2C7BA 4ZO4A 5LYYA 2RBGA 3IAM1 4OU5A 1U28C 3S2UA 2AFRA 5G3YA 4D7AA 1JYFA 3T3IA 3VI4B 4DEXA 5BP7A 1NQOA 5I48A 4O3MA 4QGGA 4LNHA 4D9KA 2O8DA 1IPEA 2VH1A 3BDIA 3K32A 3C6ZA 5CB6A 1G291 1J20A 1GKLA 2DHQA 3CM0A 4N6NA 4POAA 2ATEA 3EEOA 1RYNA 1W1UA 5FOQA 3SR4A 4QULA 3EGCA 3ETEA 5FLEX 2PM8A 2YFQA 1UBMS 5AHXA 2VJNA 2YXEA 3DB1A 3G2KA 1NJ8A 1PW7A 3JQAD 2JCGA 3EA0A 3JYNA 3LWBA 4IGKA 1SXQA 1RM4A 2ZBUA 2LR0A 1XNQB 1SU4A 3TLGB 4MHSA 4UDOA 4F5EA 2P2YA 2YQ5A 1GV0A 2VBCA 4JQCA 5HIKA 1KJYA 5J23A 5IYZF 2X8BA 1TYEB 4N8EA 1Z2PX 1BVRA 3WBKA 2BONA 1FFWA 2QGFA 3FE2A 2Z98A 3MQ2A 4FD3A 1M1YA 3DMTC 4G84A 9ATCA 1LU9A 1QHHB 4KRGA 4HLQB 3ZDZB 2J3MA 3BHMA 3W7BA 2WT9A 5CB0A 1Q6YA 1CP2A 3KDPA 1BX3A 3QYAA 1X1RA 3QJGA 4K6MA 1R27A 4PLHA 3FKSD 4U7TB 3W6UA 1BWRA 1A95A 2Y1KA 4B7XA 2F1RA 2AV6A 3JQ6A 4CKCB 1DG9A 5BWNA 4MQ5A 1DXHA 4LXGA 5ALLA 3HP1A 3TPFA 2PGNA 2ZWVA 2UZ1B 3LOUA 4I9NA 3GJRA 4MI1A 1ZN8A 4K0RA 5D00A 4YPFA 3ESRA 3DV2A 2ST1A 4KBGA 2Q3BA 1SB9A 1TJYA 1G5FA 4QXAA 4RH0A 4WW0A 5K51A 5LYJF 3TQOA 2XZDA 2I6XA 1NXOA 3JVVA 4RPHA 1HLPA 2V6FA 1DUIA 4DYDA 2ATVA 3QBDA 4PX2A 4YRGA 5CDFA 1A9XB 1WCWA 1G4AE 2FPSA 2YV1A 4NCHA 4WOPA 1Z4JA 1CY4A 1KQOA 3AEQB 4R81A 1YRBA 1OY1A 2JRCA 4DCCA 1XJ0A 1S02A 2CFSA 2FFAA 3E9RA 3HN2A 3W2TA 2QUIA 3EXFB 4EHAA 4NU6A 2IZ6A 4YP0A 2X7XA 4IIJA 4IHKA 3AR7A 1I1QB 2P78A 3IP8A 2C4WA 3RUHA 3UMVA 1K6JA 1YZGA 5I4KA 1G41A 2WILA 4W5RA 3PQ8A 2JJ1D 4LN1A 4BO8A 1M0SA 5F2OA 3UT5A 3VO8A 3F49S 1Z62A 3DOOA 3GJTA 2OKGA 5T64A 4A1FA 3GPIA 1PNOA 1Y1KE 2OV4A 3GJ3A 3QOXA 4O4LB 4Y6GB 1T8WA 1DKOA 2JH9A 5JD3A 5M5BA 3JWHA 1QMGA 4GR9A 4OG2A 1WKCA 4UJ3A 2O8BB 1F14A 3G5MA 4G6ZA 4WZBE 5LC1A 1ZD9A 2C77A 3CPJB 2CNNA 1ZD1A 5EUCA 2IEBA 1UEXC 1YB5A 3TCKA 3WYAA 1A88A 5C34B 1A3CA 1ABBA 3HCNA 4GG1A 3D02A 3W1VA 1QO0A 1VKNA 3OZAA 5DPMA 1CK4A 3WLLA 5K09A 4G5GA 4TMWA 5A03A 5FO0A 3B70A 4YJFB 1VYTA 4NYJQ 5IBPA 3RB8A 3PZRA 4PO3X 1E2LA 4OOEA 3MXTA 3OICA 2NXNA 3QXJA 4OBEA 3DVRX 3NAZA 4ENSA 4BAUA 3RGGA 2OGWA 5ED4A 3H19A 1JEQA 3BJEA 3QTTA 2PVPA 1AS0A 1PI3A 4MARA 5IEJA 1ZJWA 3V55A 1V39A 3MN1A 3QEMB 4QFMA 3LZ6A 1JLKA 1W5EA 5H59A 4G5FA 4YXFA 3G2HA 1IZ9A 4RXMA 2OK8A 4RADA 4MR7B 3U4AA 3TNJA 3GB9A 1LFAA 1QGZA 1W46A 1WMFA 2KW5A 2R85A 3KAPA 4FMPA 4MJLA 2H4ZA 1MF7A 4NWIA 3BH0A 4FYWA 2MYUA 4IZ6A 2VRNA 3B3FA 4RNCA 5FI0B 1KTIA 4XVQA 4B6OA 2ANCA 3GRUA 3NTRA 3TQSA 4L16A 1TMOA 3DT8A 5HF9A 1EBUA 5A0TA 4B47A 1M6HA 1XOIA 1KF0A 3MJEA 1G21A 3VR3D 2QZJA 2A94A 3KJGA 3BB4A 5IJ9B 5BSUA 2PAAA 1ZJYA 4U63A 3IVXA 3SXJA 1XZ8A 3MQ4A 1YE3A 1JYEA 3T7RA 3ZOZA 5CK5A 1FBTA 2IF2A 2BGIA 1Z6GA 1M8KA 4L5YA 1XCLA 4YASA 3PRYA 4KJXA 4OYYA 3VSAA 4E88A 2P91A 3IODA 1BIFA 4FYJA 5DIZA 4AUKA 4IDPA 1U6KA 4J3JA 3IOBA 1BW9B 1X9HA 2D8AA 1BX0A 1MJGM 3CF4A 4CDMA 4EA7A 4FB5A 2CNBA 2D00A 4FP9A 4YONB 4JI2B 4PLVA 3RRYA 3FMGA 3H1GA 4UDXX 4W9NA 4EHFA 1A8UA 3M4NA 3UZUA 2FFJA 1C3CA 2RBEA 1ND6A 1JEDA 2GAOA 4K3VA 1LTKA 3GRKA 4MRMA 4PINA 3OT1B 2QJTA 3B6ZA 3ZNQA 4TTSA 3ZXUB 5A4KA 3T3MB 1ONBA 1YR9A 3KWJA 4X84A 3TD2A 4ECAA 2JI9A 3CEMA 4NRDA 1RQLA 4JI6B 4Z51A 3HWSA 5EHNA 3UXYA 4C4SA 1H4SA 1XZBA 2JW5A 3BTSA 3WMWA 2DPGA 2GGSA 2XZLA 4I6EA 2WWVD 5A4FS 3QA9A 3SVLA 1B8NA 4NABA 4ZOEA 2VNSA 3T1NA 1D03A 3PFCA 2YIMA 2IPLA 4GLLA 3VBCA 1PLJA 2PUCA 1NV8A 5JH7B 3U16A 1XK7A 4GO1A 4Y18A 1X1TA 2WZDA 4O33A 4B32A 2V3VA 3MFQA 5DK6A 3BG5A 2XDYA 4B6RA 3SSMA 1ODCA 4M0FA 3VMFA 4JN6B 3HMQA 4RK0A 5BW6B 2O3JA 2VZ8A 2NN3C 2YW2A 3FSRA 5FUMA 1MZPA 1MPTA 4HJXA 3IDQA 1I3MA 4WLFA 5AVTA 3S70A 3NO4A 1EA7A 5K8TA 1HURA 4BGEA 1NPDA 4L73A 2IELA 5FULA 3WNQA 4JI7B 3PDCA 4FDUA 3WMEA 3BERA 2QEQA 1WO8A 3KELA 3I9FA 5E7MA 2I67A 1NJ5A 2XRFA 3Q3JB 1LRJA 2YWGA 4KQ1A 4ZT5A 2IYZA 1NW6A 1WZCA 1NLFA 3OAAA 1BWQA 2H5LA 4I0WB 5J2TF 3DAYA 1XT6A 1E99A 1N6RA 2C5BA 3B2QA 4IDQA 4RD6A 5F7ZA 2G06A 3U7FB 1JBEA 3I28A 4E3ZA 3I6MA 1W44A 4N0MA 4O1MA 2YIJA 3E5HA 3GGDA 3MB8A 4HEHA 4PFJA 4WMLA 2AD1A 4ZV7A 3MWDA 4LBWA 1IOWA 2FP4B 1QHHA 2CJPA 4O0LA 3WA7A 1KAHA 4RVGA 3I04M 3OQBA 2IIPA 2WUGA 2R4TA 5DCLA 3E81A 5M3BA 3I12A 1XEWY 1A5ZA 3MBKA 2O8FB 3WDMA 4UZEA 2IXTA 2HWUA 4O4JF 521PA 3VKGA 2RGYA 5BMVF 4CKCA 4NV1A 1SHJA 2HK6A 2UZ1A 2PZKA 3I4LA 3QU2A 1KIFA 3DCNA 4NU5A 1YZQA 4KUGA 4LJLA 2Q7OE 3KXPA 4NKRA 3RTDA 1Z39A 3FNHA 3HDYA 3P20A 2V0GA 1DE0A 1VLJA 1N0VC 1GITA 1QDLB 5DGHA 3P97A 4KQXA 4ANFA 1VA5A 2LCQA 1CD5A 2RGNC 1EFRA 2P6PA 1MEEA 3V8QA 2PE5A 3K5IA 3LC2O 5CVCA 1DEHA 4IYJA 5JAUA 2QYHA 1BMTA 2RMKA 4N6OA 2QG4A 3NEAA 1UBGA 3DM9B 4RWZA 3WGHA 4D8YA 1A9XA 3PX7A 3TM4A 3C15C 3WBFA 4LVUA 1J23A 1Y9EA 3EOZA 2PL1A 2PXHA 3H4TA 2PGOA 4UU1A 4CN8A 3F4KA 3PDIB 1NU6A 2I71A 3EXFA 1KAMA 1KMQA 2ODWA 2RFLA 3JALB 4YRFA 1P8JA 1I7PA 5JSHA 4R1UA 2Z1NA 5CUQA 5TY0A 3IL2A 2YR0A 3OMLA 1RHUA 4G0PA 4KX5A 4GXNA 1EDZA 4AO7A 2JZOA 3MSXA 3I5UA 3NH9A 3GA5A 4MIYA 4O4LA 4A10A 4BKMA 1BVHA 1W49A 2XUKA 3DP7A 2Z2YA 3GGCA 4JOBA 2QSJA 4FZVA 4ADSG 2O8BA 4ABYA 1QVAA 1VL6A 3DAHA 1D4AA 3ZHVA 2JLWA 1U3TA 4KLCA 3RQIA 2FH5B 4ZVMA 1EAYA 4KDCA 2ZRIA 3ZPXA 2XMDA 2WHQA 2YBDA 3KJXA 3VO1A 1K3FA 4WBXC 4ACAA 3VSCA 4OHMA 4MLDA 2YH2A 3O83A 5HGJA 4BO4A 4PC1A 4D96A 3N70A 2C7PA 2X86A 3RFUA 4COKA 3QUQA 3E9DA 1W59A 2NYUA 3AI3A 2EIXA 1YU6A 3FCEA 3GGPA 4YJFA 1LWNA 1AIPA 3IV7A 2IE8A 4MWSA 1A2KC 3D7MA 3WGYA 5CDSA 1WBJB 3ICCA 4PYIA 4Z8XA 3SIWA 3WC4A 1R0KA 3V4PB 2VCHA 2PH1A 3H8WA 4GKBA 3C45A 4JYCA 1V71A 4MPTA 5BSGA 3M33A 1XDSA 1D2EA 3L79A 5JROA 5I4IA 3QEMA 2ZP1A 4HVAA 2GTPA 1U8XX 3DB2A 3E6AA 3H1EA 4BKRA 4DJFC 3KT6A 1F8GA 3GAAA 1Y98A 1NNLA 1EZ1A 4I3HA 5LMNB 4H7EA 3NBAA 4R2LA 1DKMA 3KZNA 3N0VA 2VTKA 2WMYA 1OWMA 1P3DA 2Q5IA 4OUDB 2ZYDA 3QX3A 1FU8A 4KYUA 3OD5A 3BFJA 1NT2A 1QTRA 4MVWA 5FIUA 5H16A 3V6LA 4ZGWA 3Q98A 3AR2A 4KGVA 3PP8A 4F4JA 1MC5A 1U11A 1KAQA 1JJ7A 8ATCA 2WB4A 1RXCA 5I8ZA 1HFEL 1W6UA 2PSJA 2WD9A 2XW6A 2YXDA 3HZHA 3M8KA 2CCGA 1E7RA 4I7EA 1KJWA 4ZQIA 1N2BA 4G5SA 4OTZA 2HO4A 2P2NA 1BJKA 3ZK8A 4BV8A 5A62A 2W6JD 5DYGA 3QVGA 4V0RA 5GM1A 4KU4A 5HMLA 1AMOA 2JGIA 4K26A 3X2SA 3K3PA 3IPLA 3SNKA 2FQWA 4YRBA 2I66A 2ONKA 2AC7A 4FDMA 2FGJA 2WKPA 4QXPA 4Y6OA 5JO0A 2XH8A 4LFBB 2E85A 1BW9A 221PA 2QM7A 3OWOA 2ZSHA 4LQ4A 4L76A 2R8ZA 4KAAA 4ITUA 4U7GA 4E08A 3DNMA 4APAA 1Z68A 5FBLB 3OPMA 1ZAYA 1E3IA 2DP4E 1EGQA 3GYGA 4JXKA 2FUG1 3FPLA 5KJCA 3SC6A 3H5IA 1PNRA 5A2GA 2OECA 1T36B 3KZVA 3OT1A 4D4KA 4KE8A 3TQTA 1YJXA 3HADA 4R9UC 2O1SA 5EE0A 2IA5A 2VPZA 4AJ1A 2KM1A 1EFUA 2VJKA 3GLSA 4OGFA 3AFNA 2CVHA 4QU0A 2OVFA 2WA1A 3L5OA 2ONYA 1NW5A 3KHKA 4P5EA 1XZNA 1SPXA 2FLWA 3ZGLA 3OMXA 3KEFA 2G08A 3WWDA 3WDKA 3OC0A 1J0DA 2N75A 3R0VA 1QDEA 4CF5A 3MUEA 3WQRA 5JTUA 2NU7A 5A0FA 4Y67A 3CH7A 5C35A 4JSTA 3A1WA 3A4YA 2RBKA 4QHYA 5F35A 5JH7A 2YIDA 4P92A 1NQVA 4BV9A 5IDXA 4Q9JA 2CLDX 3EARA 1EWVA 3HJAA 4X3CA 4I9HA 1SC6A 1RQ2A 3C6MA 1MH9A 1TC1A 3ILYA 4MVJF 1J8YF 2IHTA 2VP4A 4OD0A 3VI3B 2BZ1A 3QVUA 1K68A 3SM9A 4TMFA 3S81A 1W0KD 3DZFA 4EG7A 3W2IA 1XVTA 3CVWA 2FSFA 4KV9A 4X6UA 3UJ9A 3MTIA 5INTA 3WLSA 1I7LA 3WIBA 4DV6B 1P33A 1PU2A 3I8XA 4NZPA 2AHRA 1CPYA 2WWRA 3HI4A 4KDEA 4P54A 4QRDA 2YIVX 4WKBA 3TJZA 2D1FA 1TYAE 3NEYA 4TXMA 3RAJA 1S89A 2YRXA 1M34E 4AJNA 4RABA 1CY1A 1R10A 4CKBB 4AULA 5JRZA 1ESDA 1BCRB 1G9XA 3QENA 4J1NA 1JP7A 4KWHA 2IHVA 2HPHA 1Y8RB 3HGQA 2FP4A 2ACEA 3RSZA 3U5TA 2GRUA 3GJYA 1T5TA 1ZK4A 4QRHA 1GZVA 4YRSA 2BW0A 4LEIA 3S1SA 4W5TA 2DSNA 4YACA 2IJGX 3EGDB 1IZ7A 4OL0A 5DCYA 4F4FA 4R71A 4LKOA 4I1PA 3T5PA 1OBOA 3PL5A 5P8WA 3RK1A 2J9ZB 3F8WA 2O8FA 5CAEB 1E4VA 4EJ0A 3THXB 1OF1A 4OAPA 2YHAA 1LSOA 3R0IA 3EY4A 4Y1FA 4BQSA 3KSMA 4TLLB 4KN9S 1MABB 5AXDA 2H2IA 2IHKA 3B12A 5KX5B 2AVDA 4DR7B 1DI0A 4EK9A 3ZY6A 1Y9ZA 1R6BX 3OG9A 3RSHA 2VYND 1OIVA 4G0YA 4EUHA 1U16A 4HGVA 1IQUA 1Z25A 2H07A 2KBEA 2FMTA 5CFNA 2HJSA 5EP2A 1H6DA 4IMIB 1UDBA 3WMRA 3TW0A 4S04A 1RXSA 2WM9B 1NLUA 2JI8A 1Q1GA 4DQDA 5AW1A 1U65A 4LJ4A 5TQ2B 3PPYA 5C1BA 4OHBA 3SY8A 5JY1A 3OI7A 2AKEA 4G2TA 4Z0TA 3CRVA 3ZH9B 2C2GA 2PL9A 5L8VA 1NF2A 4ZEWA 1QC5A 2FEOA 2R8OA 4OFXA 4Q3DA 4YO7A 3QLJA 5AK5A 3SNHA 5LD2C 2X4GA 3PDIA 1DEOA 3JALA 1KIAA 3VV3A 4RTJA 1VG0B 1FFHA 1E77A 1DBPA 4R6XA 2QPLA 4R1OA 1I0LA 2O07A 1YUBA 1QO9A 2ZYHA 3VR5D 1RFGE 2IY8A 3U7JA 3C1TA 3FA2A 3VTAA 1PJ8A 3MCZA 2WU0A 2O0MA 5AICA 4RY8A 1O87A 2B7LA 2JCBA 1QXSA 3I9LA 1NXTA 4FKMA 3UC9A 1GKIA 2IXGA 2J32A 1QKKA 1XKXA 2QNBA 3D5EA 2QGNA 4UFNA 4BL5A 1Y5NA 1GAWA 3SS8A 4AG6A 2H0RA 3TOSA 4CMIA 2DGDA 2Y6VA 3AM4A 4HBZA 2CWDA 5TGTA 4UFPA 2XUJA 2E5LB 1KI9A 4ZAXA 1SAYA 1W5AA 1L5GB 2BH2A 3GJZA 2BCEA 4LZZA 4LRYA 4ENVA 2UUCB 1S7GA 2Q2OA 4D8TA 2V8BA 1BQEA 1VCIA 3NKLA 4EX6A 5IT0A 3PFIA 2GKSA 2GARA 2GJ4A 3LUAA 4LISA 5K1ZA 4F21A 4ZI2A 3K70D 4GUAA 3GP8A 3UPTA 2D1RA 1FS5A 1ZUD1 4J2HA 5HKAA 2J09A 4OBWA 4K9DA 2GO1A 1DEAA 1XGKA 4E1VA 3V8NA 5JCZA 3D8SA 3IT3A 4U39A 5JLAA 1XD2B 3EPHA 3R7LA 2LVBA 4JP1A 3UV6A 1GDHA 1PZFA 2YC2C 3D8HA 4PSCA 4RV9A 1K97A 5KPJA 5F5XA 1ICEA 3OP4A 4L1KA 2ROQA 5AW9A 3USCS 3IFSA 1TAUA 3IAS6 2FUSA 1GFZA 2SNIE 3JXEA 5JVDB 2PFSA 4HPJB 3VPBA 1CFJA 1MENA 1GTSA 5L4LA 3B52X 1X8XA 5ADUS 5FADA 4D98A 4C29A 5A6VA 3KC2A 3KT3A 4KP7A 1IHDA 2FRXA 5E9AA 4XVUA 3PR1A 4WLUA 4A36A 1OU4A 1GU0A 1RHQA 2RARA 2BM8A 4Z3DA 1XRPA 2NGRA 3BGSA 1T1GA 4DQVA 3RWOA 4U1RA 1J8DA 1N1DA 1MX3A 2Y0CA 1K27A 1SR8A 2BUCA 2C95A 2NOAA 2PSSA 2V7PA 1CEXA 3GUUA 3OIVA 5EKUA 4BFXA 5HBGA 4U7WA 5B1HA 1LSSA 4JLPA 3SSOA 2PA3A 1KBZA 1LBSA 4R8KA 4KQ6A 2YWRA 5JAOA 4NOKA 3NDIA 3HJRA 2IEZA 3NVMB 1Q0TA 4HDRB 3OKAA 1JDSA 1FUKA 2GEBA 3DA8A 4FT2A 4K6FA 3BICA 4MICA 1CEEA 4L0MA 3BWXA 4NULA 4UXIA 5KOIA 4AP5A 1TMGE 1ZQ9A 2QP4A 1TJVA 3A1UA 5KYUB 3VFDA 4Q4DA 1XX6A 3EAFA 4FFDA 1JZQA 3Q7QA 5K3OA 2ZAMA 2WOJA 4OFZA 3B5EA 3N75A 4ID9A 1H0KA 2VAWA 4MKGA 4ADLA 1DJPA 4WUTA 3KOYA 1TFUA 3MS4A 4H18A 4RJJA 2B4KA 4B48A 2MMGA 2ZUDA 2B2XA 4GZ3A 1A8IA 1IW7D 2YN0A 4J75A 2ERYA 1WHSB 1NBAA 3W06A 2GETA 2QAGB 3GH3A 4DBVO 1F4VA 4KTTE 4R2JA 2VH2A 3I0MA 3IOYA 1A2BA 1TGYA 3AF2A 3EIFA 4CU2A 4BNYA 5ES4B 1ZIOA 1X13A 2P2SA 4JOCA 3WIEA 4I1UA 1N32B 5FLYA 5FPPA 4G4IA 1M83A 4P2GA 4U2EA 1KDPA 2Y0DA 5DMXA 1SCJA 2BGJA 3D6VA 4S2EA 1IRXA 3IP9A 1GZHB 4KAXA 5ALSA 2ZRBA 4YRAA 2D3WA 2E4VA 2GHRA 4Z54A 1Q1AA 3I9OA 3R3WA 2H2HA 2QRUA 4IEIA 4R4JA 4UM5A 1QVVA 1Z37A 3TQFA 1QF9A 5JD4A 2W2LA 4U0KA 1N7GA 4NCAA 5DW0A 5SICE 2OLEA 1CQXA 3CN9A 3HZZA 4LJ6A 4CKBA 4EGCB 1BCRA 2JLZA 3RVSA 5JHHB 4E0BA 4L8LA 1M74A 3D59A 3K0BA 3EUEA 3S5JA 4W9RA 4EHDA 1Y1TA 3AY3A 2CLKB 3EGDA 3EUAA 4IIYA 3KM0A 4S35A 2MT9A 2WV7A 4YRTA 3L7KA 3ORHA 3WY9A 5CAEA 3WK5A 5EJ5A 4JH0A 4DSZA 3THXA 2Z3ZA 3A11A 4RGBA 2FG6C 1OFUA 3GFSA 3U0VA 5HOEA 4KXXA 3F0TA 1NVXQ 2NUPB 4KMOA 1MABA 3OF3A 5CPBA 2HMVA 1U02A 1QOZA 3CRQA 4JB0A 5KX5A 3D4BA 4URHA 1U63A 2WSYB 3BT7A 3UMJA 5BWBA 4JA2A 3H65A 3DDUA 4JP3A 3UB4A 4YREA 4L07A 1ZZGA 3ILHA 3RBAA 3AB7A 3L7BA 3IHKA 4LC9A 1TTQB 4LYAA 2A84A 5ALVA 2PWYA 2IXFA 4M88A 1U0RA 4ALKA 2FFQA 1W29A 3TV2A 4MA5A 5TQJA 2QV7A 2D62A 3A3KA 3D0OA 3G85A 1QFYA 4YJDA 3ND9A 1I8TA 3RASA 3IPCA 4BRUA 3P26A 5DHRA 5KYWB 2B9EA 4JWKA 2EL7A 3E1SA 4K9KA 3RNOA 1OWOA 5ALWA 5KDDA 3QW4B 3EDRA 4U6QA 1Y5MA 4KJZA 2VHQA 2GCIA 2Z9CA 3IQHX 1CJSA 1H2FA 2PBLA 2QMQA 4Z7JA 1ODTC 1RWVA 1EXWA 2FXIA 4A8JB 2VA9A 5JXIA 4LF6B 1UWCA 3CG4A 4R2HA 2NM0A 1UBTS 2ZJYA 4BUCA 1LK5A 4UKDA 1KU6A 1UC5B 3FKJA 3ZZ0A 1SOAA 3O3MB 4MS1B 1WUTA 3V1KA 3L9WA 1H3EA 1E9RA 4C07A 2QLNA 3ET4A 3N05A 1HMYA 5C52B 1TAQA 1MVOA 1ODJA 4P6VF 3ZGYA 4B3IA 4CF7A 1L8XA 1A4RA 1LJ8A 1WM1A 4W6ZA 3PKZA 3VVLA 4CM9D 2CV0A 3NBKA 5BN3B 3IAFA 1J99A 2XGGA 1MT3A 1HZZA 4RZ3A 1APBA 2A58A 3ML1A 4TQGA 1XLWA 3EEYA 3ZDDA 1FOEB 2W6ZA 4M1YA 1VHDA 3BF7A 3W5VA 2PVCA 4E6EA 1VI6A 5KU7A 3P0JA 3B3AA 3NJ4A 2JGFA 1XU9A 2VSFA 5CD9A 3L7CA 5ICMA 5LQUA 3BWBA 4N3BA 1CY0A 2EZUA 5KNDA 2BM9A 1XD2A 4QQKA 3C5CA 4V0KA 1SZJG 2ZSBA 1NZJA 8MHTA 1KK0A 2CCJA 1DC3A 2BOVA 1J2YA 1OHHD 1AHHA 1YU9A 2X5JO 4MPJA 5ADVA 2J41A 4IXTA 4LG1A 4MIOA 4QTTB 1I5RA 1KJNA 2FGKA 3MJRA 4AYTA 5JVDA 1G19A 1YR1A 4MZDA 5EE5B 5EJFA 4F3KA 4PVDA 3ZUGA 4TVSA 2FA9A 1FSGA 2ONCA 2R1UA 4TQ9A 1OASA 1ZJJA 2O2SA 3S3TA 4D4HA 5J4HA 3N0XA 1M33A 4XFDA 4OXYA 4G5RA 4QT4A 1ZX1A 3QZUA 3TZLA 4UTVA 4B8WA 4BPRA 2D1QA 1JJBA 5FX2A 1AQYA 2B1RA 4MAMA 3KEOA 2QSUA 2ONJA 3VR6H 2NV2B 1DT3A 1Z5GA 3B36A 5JLJA 3HFJA 1AF7A 2FSIA 3WL3A 4F8YA 1THZA 3EPLA 4EYSA 2JAQA 3AFHA 2I3BA 4YBZA 2WHRA 2FMFA 3W0LB 1YVPA 4W82A 1AQIA 1EM6A 3ZQ6A 4HDRA 2KPOA 2PBZA 1KDRA 1VL5A 2WUFA 5GTDA 1KFCB 2XLBA 5I6DA 2GDZA 4LF5B 1WU8A 5K3FA 2OZEA 3GGGA 3I1IA 5KYUA 3HA5A 4ZZIA 4DV3B 4QBGB 4QDUA 1KZYC 1KY5A 1CY8A 3JQFC 3DYBA 4TV9B 4DBLC 2D5IA 4HN9A 4PFSA 1MNAA 2XXAA 3Q2OA 3IE2A 4RTNA 3EYAA 2GO7A 3EG5A 4I81A 4MNTA 4R3UC 4ROSA 2WF5A 4HQLA 4GBJA 4P82A 3CLTD 4LAFA 4Q9IA 2YBEA 1B8PA 1TTPB 3U9LA 1SCNE 3KR9A 4K9SA 2GESA 4HWTA 2PCLA 3KR0A 5BNIA 4YCNA 4LYJA 3CZAA 2D2IA 3IKJA 4GOND 3NAMA 3PV0A 1N2OA 4HDKB 2VBGA 1ZDMA 4CLRB 2ID8A 2OENG 1FJHA 1WHSA 3ZHSA 2BFFB 4R9SA 1UBUS 1CJCA 1ULBA 2QAGA 3KVVA 1DZIA