4MUMA

Crystal structure of mitochondrial 5'(3')-deoxy ribonucleotidase alternative spliced variant
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
207
structure length
198
Chain Sequence
SNRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGTGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial 5' nucleotidase
publication title Kinetic and structural characterization of an alternatively spliced variant of human mitochondrial 5'(3')-deoxyribonucleotidase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 66
structure length 198
sequence length 207
ec nomenclature ec 3.1.3.-:
pdb deposition date 2013-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4mumA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4mumA01
2OYCA 3ONNA 1F5SA 3R4CA 5ALJA 4XQ0A 3DV9A 4DCCA 1QH9A 4L6CA 1NF2A 1RMYA 1CQZA 3MMZA 1Q92A 3U19A 2R8EA 4UM5A 3QXGA 1FEZA 4UASA 2R8YA 1ZJJA 4G9BA 1AQ6A 1J97A 2CN1A 2FPSA 2Q5EA 5AI8A 2FPWA 3OCWA 5AW6A 4HGOA 3A3YA 4C4RA 4UATA 3CNHA 1L7PA 3QU5A 3EWIA 3J7TA 5AK3A 1T5TA 4HGQA 3I6BA 2C4NA 3NIWA 4KNWA 2G1AA 2MU1A 1YS9A 4GXTA 4MWOA 1JUDA 1TJ5A 2P11A 1RMQA 5AIBA 2X4DA 5AM4A 1RLMA 5AKGA 3L5KA 4O8CA 4YH1A 4AS3A 1YNSA 4IFTA 1RMTA 3WKEA 4I9GA 5ALMA 3N5KA 1KYTA 4UMDA 5AW3A 1RKUA 3L8FA 2I7DA 4KYTA 5AKZA 2NO5A 2EAUA 3KOOA 4GIBA 5AKYA 1L8LA 1L8OA 2JAUA 4EELA 2HF7A 2OM6A 2IA5A 2RARA 5ALZA 4Y2VA 2HO4A 4JDPA 2YMMA 4YCLA 4AS2A 2G09A 3F9RA 4EX7A 4MUMA 5ALVA 2FPRA 5AW1A 1VFPA 1Z4IA 2BDUA 5AICA 1U02A 2I33A 2HI0A 4UMFA 2NO4A 3N07A 4BEVA 2R8ZA 2WF9A 1YV9A 2G08A 4F71A 5AVUA 4EENA 1Z4NA 1Z4KA 2PKEA 4OFZA 1RDFA 2BY4A 3EPRA 2O9JA 3IJ5A 3E84A 3L7YA 4HGNA 1ZD5A 2FI1A 1ZOLA 3OCUA 2AH5A 1T9ZA 1ZD4A 2P9JA 2G80A 4C4TA 4DW8A 2WM8A 4XOUA 4OCZA 3E58A 2WHEA 3KC2A 4Y2JA 3NRJA 3L0BA 3NANA 5AW9A 5T41A 3MPOA 4FE3A 5IT0A 1O08A 5AW4A 5AVSA 3N8GA 2W4MA 5ALOA 4NFLA 3QU9A 5AKLA 3A1EA 2P69A 4UM7A 2NYVA 3KBBA 5AVRA 5AVQA 3QYPA 3ZWDA 4HGRA 5AVYA 5A3SA 3OPXA 4L6AA 2RAVA 3OCXA 3IRUA 1EK1A 4B6JA 3HLTA 3OCYA 2CFSA 3FPBA 5ALGA 3SHQA 1RRCA 5AI5A 4CF3A 4YCMA 1SWVA 1ZD2P 3QGMA 2QYHA 3SKXA 5AW0A 1SU4A 2AMYA 2YBDA 2B0CA 5AI0A 3FVVA 3N28A 4BNDA 3BA6A 5AI4A 1Z4JA 3QNMA 2Q4TA 4AP9A 5AVXA 3FGOA 3QUTA 5IT4A 4UU0A 5ALUA 1L7NA 3OCZA 2W43A 4L57A 3WGVA 2C9MA 3WK8A 1QQ7A 2FPXA 5AIAA 3A1DA 5AKEA 1NRWA 2HEGA 1NNLA 4UU1A 3UMCA 3WKAA 4BEWA 3AR4A 3MN1A 2P27A 1Y8AA 5AM3A 1U2SA 1VJ5A 4JB3A 3WK6A 2CFTA 3U7FB 5ALRA 3QUCA 1TJ4A 2ZBEA 2EATA 2FDRA 2IOFK 3L0CA 3U26A 3QUBA 5ALQA 1SWWA 2JAWA 3PGLA 5IS2A 1TE2A 5AK5A 4I9FA 5AK6A 3W5BA 3PCTA 2YY6A 2YJ5A 1N9KA 1O03A 3K1ZA 2OA0A 4YGYA 3U7HB 4BNDB 5ALYA 1Z5GA 2B1RA 2OBBA 4Y2YA 1Z4OA 2WFAA 5AW5A 4Y2QA 1Z4MA 2MSNA 2AUTA 2WF5A 1S2OA 2YJ3A 1L6RA 2ZOSA 1T5SA 1ZRNA 4BX3A 2WF6A 1RQLA 1Z5UA 3ZX4A 5AW7A 4HYTA 2HHLA 4G63A 3ZUPA 1WPGA 2BDEA 3S6JA 3E8MA 3IB6A 5AKKA 5ALFA 1CR6A 1VJRA 2HDOA 4Y3UA 5ALEA 3WKCA 5AVWA 3WK4A 5AVTA 3L0YA 4UARA 4Y2UA 2PQ0A 4UAVA 1XPJA 4HAIA 4CF5A 1RQNA 3M1YA 4Y2PA 3I28A 3AR9A 3VAYA 5AW2A 3MC1A 4Y2TA 2FUCA 2YFYA 5ALSA 4BBJA 2FPUA 1L7MA 3SMVA 3NUQA 1RKVA 3QLEA 3NALA 3FM9A 2ZBFA 3BWVA 1L7OA 3ZI4A 3WK9A 4KNVA 1WZCA 1Z4PX 2R8XA 2YMPA 2YMLA 3D6JA 3R09A 4CE6A 1MH9A 3L1UA 2W11A 2GHQA 3L8EA 1Q91A 1U2TA 4Y2SA 2AGVA 3TLMA 1RLTA 3ZW7A 1XVIA 3WKDA 1Z4QA 3ED5A 3OCVA 2B1QA 2B8JA 3RF6A 2Q4RA 2G06A 3ET5A 4UAUA 1U7PA 1Z4LA 5AK4A 3AR7A 3QU7A 2ZXEA 1PW5A 5AM5A 4Y2XA 4KX5A 5AW8A 1WVIA 4CNQA 2DQSA 2ZG6A 3NAMA 3W5DA 3B9BA 5ALLA 5E0OA 2I6XA 4F72A 3W5CA 2RB5A 3WKBA 2C8KA 2HX1A 3EF0A 1ZS9A 3UM9A 5FP0A 3SF0A 2ZBDA 5ALNA 2HCFA 3FZQA 4NWIA 2WF8A 4RETA 3AR5A 5AVZA 1X42A 3ZTWA 4QJBA 3R9KA 1K1EA 5ALPA 3GYGA 5ALKA 4CF4A 5AKJA 4XE5A 3SLRA 3FPSA 3KDPA 5AM0A 4PNHA 5ALXA 3A1CA 2G0AA 1QQ6A 2C88A 3DDHA 1QYIA 2HOQA 2IOHA 4FFDA 4NV0A 4Y2RA 4YIHA 3N1UA 1TJ3A 3E81A 2YN4A 4NABA 1YDFA 1J8DA 1RKQA 4ZEXA 5AVVA 3B8EA 4YIKA 4UMVA 3OTQA 1TA0A 3ESQA 4UW9A 5JJBA 3QU4A 3L1VA 1ZRMA 5ALIA 2ZBGA 4BKMA 5A3RA 5AM1A 5AM2A 2G07A 3AR8A 5ALHA 3WK7A 3HYCA 2I55A 3ZVMA 4H1WA 2I34A 3L8HA 1QQ5A 4UMEA 2B8EA 4IG4A 2GFHA 5AI9A 2JGAA 2I54A 3UMGA 4DWOA 3ESRA 3U7EB 3QX7A 3SD7A 5AHXA 2GO7A 1N8NA 5AKXA 5AESA 1RLOA 2O2XA 2FEAA 4YCNA 1IWOA 3L8GA 3B9RA 4ZEVA 5AI6A 5A3QA 2YJ4A 2B82A 3AR3A 5AKHA 1ZD3A 2HF2A 3CZ4A 4DFDA 1RC8A 3PDWA 3ZVLA 3KD3A 3DAOA 3NASA 2ODAA 3UMBA 4OHFA 2B30A 3QU2A 2QLTA 3AR2A 3EF1A 4QQFA 3W5AA 3RFUA 2EARA 3U7GA 2C8LA 3SKYA 3I1YA 4XPZA 4NAVA 3ZU6A 3WK5A 1YMQA 1XP5A 5ALTA 4KN8A 2GHTA 2GMWA 1WR8A 4RESA 2PR7A 1EK2A 4FYPA 4ZEWA 4OD0A 2FUEA 3KZXA 4BYGA 1Z88A 4EX6A 4EZEA 5AKIA 2JAOA 1LVHA 3M9LA 2HSZA 2IOFA 1S8OA 2D2VA 4HGPA 3U13A 4J03A 4KX3A 3ZWKA 1RPZA 4E88A 3ZTYA 3ZX5A 2IYEA 4BX2A 2YJ6A 3P96A 3WGUA 2YMQA 2CFRA 3ET4A 4EEKA 3AR6A 5ALWA 3ZVNA 2VKQA 5ALDA 3I76A 3DNPA 1YJ5A 3QUQA 4J2TA 2RBKA 4C4SA 2WF7A 1LTQA 1U7OA 2JARA 3PGVA 4BX0A
chains in the Genus database with same CATH superfamily
4MJLA 4O4JF 1R4AA 2ID9A 2P3OA 1D2HA 4UHDA 2CNNA 5IJ9B 4OAQA 4DBLC 2F3RA 1Q0LA 3CINA 3ABSB 3R4CA 1IBMB 2WR8A 4KHZA 4II3A 4R5MA 3EH2A 4P7KA 1LI7A 1VP3A 4E5PA 1DO2A 1NY5A 1DBWA 1X1QA 5G02A 3DD1A 1BG6A 1K75A 5C8YF 1QCCA 5JQGA 1AF7A 2XNHA 1XYVA 4MVJD 4U9IS 3SYMA 2CMGA 1ZC4A 1J24A 3U19A 1PJ8A 3DBHA 4M0KA 5HJ5A 3DL7A 1MDBA 1M7BA 3FUUA 2I03A 1P5FA 3UJDA 4XVCA 3AXSA 4D45A 1HNNA 2E9SA 1OI7A 3OKFA 2AYZA 3KV1A 3E9EA 3MMSA 5F64A 3O8OB 1ORWA 2HBRA 3W5UA 5KS2A 4J7AA 2GPAA 1AVTA 1CUSA 3OZBA 1JLLA 1E1CB 3LL4A 3LO5A 4ZKDA 5KQGA 1VJCA 2OAEA 3G8DA 4X8LA 3LIIA 2QE7A 4JT2A 1Z6GA 3LHDA 4N5IX 5F33A 4ACBA 4BYMA 3FSRA 1EE1A 4GMKA 1FC0A 1QGUA 3M49A 3E70C 2R2GA 4G1VA 3GDGA 5JPIA 5T57A 3VR4H 2IOYA 3N74A 4RJKA 1HSZA 3R5XA 4PG5A 4Q39A 5ELMA 3KETA 3HTXA 4HEA6 3VZRA 3TQRA 1RWPA 4Q15A 1S6YA 2IFTA 3ZCUA 7AT1A 4DMRA 1JXOA 3GLVA 5EUMA 2J9FA 1ZZGA 1RLMA 2PIAA 2OD2A 1H1TA 4E46A 4KMMA 4BMZA 3CB4A 2D0PB 5BWLA 2X0JA 4RTLA 1NJFA 3V1TC 1Q5PA 1B3RA 2K5UA 1RRVA 1RMTA 1Z62A 1Q1GA 1IHDA 4JYBA 4KXYA 2P4SA 4M9UA 4WINA 5FOTA 1KQ3A 2EZ9A 1XT6A 4AZTA 4G89A 1NXWA 5HUJA 4PZYA 4YROA 3VPGA 5EOVA 2Z5LA 2E4ZA 1XZKA 4Z2AA 1E5XA 5ED0A 4MKRA 1G16A 2PS0A 1E7MA 3OZFA 3IYLW 3K2BA 3Q0IA 3V4PB 5ALZA 3AESA 1JSXA 4JFAA 2HO4A 2VJDA 1XJCA 1U65A 3DZGA 5FKJA 5FAXA 5IUNC 3K5HA 5D6BA 1BMDA 4ZICA 1NMSA 2DZDA 3OKPA 3F9RA 3DAYA 4B7CA 1QG0A 1PFWA 2M6LA 1Q44A 4X61A 5TS3A 3TAHA 3DZHA 4JLDA 4O0MA 3KB8A 1U0HC 2AFHE 4GRIA 4PCVA 1Y1KE 1KI3A 1EXMA 3DBRA 3H99A 2BDUA 2H9IA 2JFPA 3NZEA 4FYHA 5BW5A 1WDTA 1R9JA 1AO0A 4ZVQA 2FMTA 3CVOA 4K88A 2R8ZA 1JEOA 3BXEA 1IU9A 3HADA 1MHTA 4RTMA 5JCZA 2TS1A 1QC5A 5HZMA 4IQ8A 5CFMA 4GI1A 4Y1EA 1O0BA 2W83A 4FCVA 2O2SA 1Z5PA 4ZQFA 4REQB 4GHWA 3RK4A 4W5RA 4EG8A 4D1YA 3M34A 2OGSA 2FN8A 1ZGBA 2VZ9A 3ZU5A 1M6NA 3D43A 3LW8A 4QBFA 1JLSA 1WPXA 2I67A 3DHWC 2JLZA 1XU4A 4TQAA 1Z6TA 1Q0PA 3HKCB 5IFLA 2PUTA 4C0SA 3DH0A 3AP3A 1AS0A 2QK4A 2WHEA 3EY9A 4Y2JA 3UF0A 5GPBA 1YSCA 1UKYA 2VHQA 3AFGA 3TQOA 3D2BA 2QR3A 2F00A 3GFFA 3FWPA 3W2IA 1EFUA 1SKYB 3EBPA 1XYGA 3RU3A 1EVKA 1AUWA 3RU2A 2EL9A 2V1UA 2ZAIA 4NBLA 2BM0A 3R6VA 2BR3A 3L9XA 3QU9A 5AJWA 3RHZA 3L7KA 4EGFA 3KBBA 3CKMA 3CO5A 4ND6A 3ILVA 1ONSA 4DN6A 1GPAA 5JC1A 4YJ2A 3PLAE 2Q41A 3Q10A 3WRXA 3TZEA 5KYKA 1QANA 1Y5LA 3OLZA 1NDUA 1UJBA 4I3FA 1UC4B 5FBVB 5KC8A 2QRNA 2VZLA 5LKRA 3GJ6A 1OWMA 1J39A 2EGHA 3CH5A 3RREA 3RFTA 4BCCA 4LI0A 5KVQA 3T15A 2WWGA 4KUGA 5AWFC 5FL7A 1R5OA 4WXHA 3UC9A 3C45A 1F14A 3FGPA 2BM9A 3C15C 2YBEA 4I0WB 5E2AA 4CYMA 4EMBA 1I9GA 3QA3E 1TAUA 1AKEA 4IIUA 5HQ3B 3L92A 5KQSA 5I3ZA 2UUOA 3VDXA 4B3SB 3OZTA 3HB9A 3VR4D 1F2DA 4N76A 3O9MA 4H08A 4CM1A 1ADBA 4FOPA 2VP0A 1TK3A 2XWBF 3L1JA 1ND6A 1HE4A 1QH8B 2QRPA 2XOKA 4HD8A 2FG6C 5EQDA 3G2PA 3W77A 4LSWA 4H0NA 3CRW1 1Y1QA 3RW9A 4PX9A 3CM0A 4PM4A 1QS0A 1E8NA 3ZDCA 4ZU6X 2X0NA 3I32A 4R2LA 3OE7A 1UIMA 1KBOA 2XCLA 1RADA 1NRWA 2J5BA 2GBIA 4RC9A 4RE5A 5BR7A 4LVOA 4OL9A 3LO8A 4KXUA 2Y1FA 3S7ZA 2IYPA 3LZ6A 1S1MA 2IUUA 1YMVA 2OZLB 3EVDA 1XD2A 2FY8A 5AM3A 4XD2A 1R37A 1JMVA 4ARCA 3G17A 4OK6A 1U8ZA 4HADA 1XN4A 4V1CA 3P9YA 1SBHA 3QUCA 1SVWA 1GN8A 4Q01A 1GPMA 3B12A 3EEIA 4TT3A 4Y6LA 1JHYA 4AK9A 4YXFA 4ZCMA 2Y71A 4D9GA 3MB5A 3KALA 4YV0A 2WYUA 1UJ2A 1C4XA 3J81k 1V1MA 4AJJA 2JAQA 1E4VA 1NXXA 2CK3D 3GA0A 4HL6A 2OLKA 5CB4B 2P9YA 1H0RA 4FMCB 3LBHA 4ARZB 2B1RA 3F67A 4JCCA 3SBEA 3WLFA 1U98A 1UFKA 3D1JA 1BQEA 1DWUA 2P9BA 4PZAA 5FV7A 4MI6A 5K0FA 4JEIA 3FB1A 4HR7A 3AY0A 4ARBA 4HHEA 4BMOB 3RYIA 2PZKA 2WYHA 3A4NA 4LHWA 4CDGA 3M6MD 3A7DA 4W63A 3FRJA 4IR7A 3N3AC 2X86A 5U9CA 1M72A 4PXSA 3K9FC 2W6ZA 4U63A 3ZUPA 1RQRA 4WK2B 3UH1A 2R1TA 3ESAA 5T64A 2RBEA 4Y1FA 1JT2A 4CCWA 1YDMA 4AUNA 3PVSA 2BZ0A 3LMKA 1T9BA 5B55A 1EIWA 1TYBE 1YDGA 4NARA 3WGLA 4KXLA 4QGGA 1NFQA 3L7MA 4IHAA 4H3KB 1MIOB 5B3JC 3HP7A 4YYEA 1M6VB 5EJ8A 4NPHA 2BFAA 3GVXA 4DANA 5BYKA 4R7ZA 2F1IA 2AXEA 3PQFA 3VKFA 1G8KA 1PNTA 2FUCA 4QHTA 3PUVA 5BSUA 5BN1A 2NADA 1LTHR 3SMVA 1GZ5A 2BL4A 1LBEA 1VCIA 2G5PA 2VXOA 2BH2A 4ZDKA 3SJBA 3UIEA 1CFJA 5CUQA 5GVSA 2GERA 1US8A 1UMDA 1Z17A 2QDXA 3IUPA 4L2IA 4XDZA 4UU8A 4UFPA 3DCJA 1SOVA 4OKIA 2ZWPA 1LRJA 1NIPA 4YXWD 3G13A 1GP2A 4M0DA 1IVSA 1MEOA 1SBZA 3A11A 3VPDA 4CE6A 4D98A 2HTEA 1G5PA 5EP2A 2JJ1D 2QLJA 4KV7A 4L85A 3C6XA 1IHOA 3UK0A 5AUNB 2GHQA 2FSVA 4BMVA 3WBFA 1F12A 1JKXA 2RHOA 5JQGF 4LJLA 3OX1A 4YRIA 3Q5GA 4M83A 2GHIA 3QVVA 1IK4A 3C8UA 3OZWA 5EXTA 3ED5A 5KSYA 3FD8A 2R0QC 1T5IA 1BMTA 4IJ6A 3W2FA 2LCIA 5JSHA 3U4MA 1YQGA 4AX8A 4W9NC 3DT6A 4BFSA 1J21A 2XHEA 5A4DA 2FW6A 1G42A 1ZJZA 2NZXA 2OILA 3PVCA 4PG8A 3LGAA 1BH6A 5DN6A 1VHDA 3SQLA 2AMJA 3PBKA 1XWIA 2WU1A 1ZHHA 2PMEA 1E6KA 1VPLA 2AUNA 3LSTA 1EWVA 3LUAA 3ZQJA 3I73A 2AV6A 4E5UA 2VP5A 1GQOA 3Q2KA 2GZDA 4O4IF 3CNOA 3TX2A 4DR7B 4TS9A 1CY2A 5EMMA 2JLSA 4MW6A 4PHHA 2FZCA 5CT4A 1B2LA 1L5KA 1CSEE 5ALLA 3VPSA 4YRAA 3B6KA 1PLJA 5C1OA 5FH9A 2F1JA 3NJRA 2C8VA 4RCZA 1PR9A 2C8KA 3ED1A 4DIEA 1H2XA 3U3ZA 1E7SA 4RZQA 1AQJA 5H82A 2R1VB 3EISA 2XUAA 4GDFA 4H59A 4CMIA 3TIGA 2WHPB 2CW5A 2UXBB 2Y6UA 2Y27A 2WRZA 3AUUA 2CD9A 5K0SA 3QTTA 2JCBA 4NYMQ 1T9DA 3IESA 4LVNA 3UUGA 3V4SA 1BMFA 1LPPA 2LDBA 1XQWA 4DR3B 3LYAA 4QPCA 1IM5A 3SSOA 5EQTA 3OOHA 4TMKA 3LPCA 3GH3A 3NM6B 3D8RA 1OGJA 4QEDA 4J0IA 3JTMA 1VCNA 4IVRA 2H3EA 3K1YA 1R15A 4IS2A 3HB4X 3F6YA 4BO3A 4EGAA 1PJ4A 3FCUB 4NCJA 3W8EA 3ZXUB 3ZZMA 3PQCA 4ZPJA 2RK4A 3G89A 4Y2RA 1YDWA 1SVUA 5DNVA 5TR9A 1UQRA 1XK7A 4DS3A 1X1EA 2AJ8A 3E81A 3EVEA 4AJ2A 4H2DA 1HOTA 2AFIB 1VL8A 3MW8A 2WPDA 1RKQA 3O38A 5LZ8A 2YVKA 3T99A 1X87A 2PO7A 3D3JA 3G68A 3ILYA 4ZEXA 2QROA 3EHEA 1T4CB 1QH1A 2Y1WA 2WABA 3AEKB 3VZPA 2C98A 1Q3TA 1YZFA 2B4QA 4YV2A 1F2UA 2X3FA 1DQZA 3V6LA 1ZUNA 2CB9A 2O0LA 5AM1A 2RHTA 1KGDA 5G1NA 3AX6A 2Z04A 1ODFA 4Q1AA 3CUSA 4H1TA 5J58A 3EGDA 4RMHA 4BN0A 3K9GA 4LDQA 1RAHA 1UBEA 1X39A 3OTGA 4M0LA 4WUVA 2VQFB 2OVBA 3ZLTA 2I3BA 1NVBA 2C2BA 4LECA 3L8HA 2A6PA 2J87A 4BV2A 3L2OB 1SULA 3GLKA 4KVGA 2HLDA 4FFRA 2GFHA 2V7WA 3BE8A 5GINE 2JFUA 3CEHA 3TL3A 4MHSA 2X3YA 1Z68A 2LNDA 4ZOCA 4ZK6A 3PC6A 4DMKA 4EJMA 1MKYA 2CLFB 3V8EA 4E09A 1P7YA 5H0IA 1A8QA 1E66A 1M83A 3TPZA 3H0EA 1GDTA 2PRSA 5EXXA 2HZBA 4HZUB 4QTXA 3LT5A 5AOCA 4NCXA 4GZ3A 1MRNA 3W5JA 3ICVA 3JAWB 3DMTC 4DXHA 4ZEVA 3FYSA 4QHSA 3JWEA 5A3QA 3RS4A 1G2IA 5H8WA 4YLEA 1SD5A 1F0KA 3M8KA 4IHKA 3AEZA 4JQOA 5EP3A 2GM4A 5D3ZA 2XSZA 2OXEA 2JIQA 2NU7B 2O3JA 3K30A 1TUIA 2F43A 1N36B 3CPSA 4JB8A 5JXHA 1HTWA 1FX0B 1Z2NX 2UZIR 1IY0A 3ZVLA 3A70A 1YE5A 5EE3A 4CFYA 2PJZA 4FFMA 1II8B 1SC3A 1GNSA 1HDRA 2OHFA 4B3RB 1UZLA 2WUFA 3ISVA 4QQFA 5DGDA 1R0KA 5P21A 3JYPA 1M2VB 1NLUA 1Q83A 2EARA 3HV2A 4IVNA 1W76A 3PZBA 4JVNA 2A4MA 1D1QA 3BM5A 1V4BA 3ELBA 3M82A 3U60B 5F73A 3L0SA 3I1YA 3ETHA 2E37A 2NU6B 2O7SA 3P0EA 3QBTA 3R0JA 1UXOA 4LSMA 1L7DA 3CWQA 1OT3A 1U6JA 3AHEA 3NC1C 2I7TA 2VJMA 5LWHA 8ABPA 1G8JA 2WT8A 3CNEA 1FTSA 2O6HA 2B36A 2QNRA 2VATA 4LJAA 2XTAA 5DNEA 2VRBA 3RTAA 3SICE 3T3HA 3DDUA 5ESRA 3KZXA 4KXWA 4XYMA 3ZJ5A 5IJAA 4YEDA 5DBIA 2HSEA 1H1LB 2UAGA 5DTJA 4ALNA 4CFSA 1SQ6A 4RPLA 3H19A 1WV1A 1EUZA 1JHUA 1V39A 1JGTA 1YQEA 3OEHD 2XMGA 2G83A 3QPCA 3RUFA 2GN2A 4GO1A 1N0UA 1E63A 5LDHA 3P1JA 1GPWB 2NSDA 3EVZA 1UPAA 1GEGA 4BJ5A 1K92A 1V1JA 1I36A 4UD2A 1C80A 4HMOA 5KVVA 3OQJA 4XX0B 4G2NA 3S2IA 1L5SA 2F3QA 1XMQB 3OT4A 2NUAA 3IJRA 1E2QA 2H1HA 1MGOA 5K8LA 3KQUA 4KIGA 2BRUA 3AF2A 1U7WA 3DW1X 3PRKE 4PNZA 4YRFA 2DETA 3DNPA 4FQ5A 4ZXPA 3D2AA 3TRKA 3Q8KA 2PT5A 3IAAA 3RD8A 2GEDA 1DT3A 1YR7A 5CM2Z 1T6ZA 2B61A 5BMVA 4W8GA 3BTOA 3B13B 4GLOA 3CVWA 1DRJA 3D31A 3ZDFA 4AJ4A 2CSXA 2LE0A 4WWHA 3MELA 4WBNB 2FV8A 1ZBQA 1F5SA 2W2VA 5ALJA 3BYZA 4DQLA 4EO4A 5LIRA 4C0KA 3WB1A 3PZRA 5CCDA 1MZVA 3GROA 5FQOA 3MJCA 4DZTA 4DDKA 5I8PA 5HM8A 4KPYA 1TQ6A 1CDOA 4XQGA 1PQPA 3CR8A 4C5BA 4KXQA 4BVLA 5A4JA 4AG6A 3B78A 1OFVA 5A3JA 2Y1KA 4D4KA 2SCUA 4TYMA 3X1WA 1K6MA 4CHTA 2VG8A 5K0EA 3EIXA 3IAM1 5A7HA 2P65A 2Z1MA 3GG9A 3BRSA 3UJCA 3K0CC 2Q5EA 1Y9DA 5IZ4A 4B3XA 2ZTUA 4WXEA 1OIVA 3P45A 1S2IA 3LPAA 3MQFA 4XGRA 2CCKA 2WAXA 5AW6A 2OESA 1PLKA 4RTSA 3IJPA 2LVBA 1I6WA 3LBFA 3QEMA 5JCOC 4NSLA 4NV3A 5ARDA 2HW8A 2P2CA 4J3FA 3F9CA 2NUTB 3RQIA 1YRLA 3R5KA 3VBEA 1TL7C 2FWAA 4D41A 1E0KA 3DWFA 1OILA 1I5OA 1C9DB 3P2IA 3JQQA 3MIZA 3Q7QA 1LS6A 1O96B 4TRJA 4KIWA 4F6RA 4D8WA 4B4UA 3GP3A 1VE5A 1JU4A 3GAMA 5SZJA 3RYFB 2D5BA 1L2TA 1ZNQO 3KEQA 1RMQA 2ZUVA 4HI0E 1T0PA 3ETDA 5LPNA 3A31A 3SYRA 4F9FA 4FE4A 1O94A 1N6HA 5CITA 5LBTA 3OWOA 5CX1B 2XNSA 5JO9A 3TQFA 5J43A 5K6AA 2P6RA 3H6GA 4MQ4A 5DNDA 2AK2A 4GBGA 3ZK9A 3IVCA 5I4KA 5IKMA 4KGZA 3ZGOA 2I1VB 5CA1A 1YKSA 1U3FA 2G1KA 3H9JA 5DCWA 4DLRA 4OXXA 5JTTA 4UMDA 3UPUA 2H07A 2QZ9A 4GX2A 5IWAB 4J8PA 1CQPA 3U3JA 1AKWA 5BNIA 3IILA 1UAAA 5HRUA 3ZXYA 4PPGA 1XELA 2C5HA 1L8OA 1O97C 4AZSA 3N2KA 1EFPB 3BX1A 1CR4A 3D3KA 3MWKA 1NXPA 3NB0A 4Y1GA 5FWXA 3EGXA 1EFRD 5HF6A 1GNRA 1OASA 3L7IA 3TR6A 3EDMA 2O2IA 2HF8A 1T43A 2BI4A 3HGQA 3RSSA 3T94A 3TFOA 1N34B 1PSWA 2G09A 4Q1BA 4J1TA 3FR7A 4NV1A 3HY4A 4EX7A 1N2HA 3MCZA 3MJEA 3MXTA 3Q4GA 2ZRJA 4JBXA 5CDGA 1NBIA 4NONA 2QM8A 4Z3KA 4ZYWA 5K8UA 4X65B 1Z4IA 4ZWNA 2PX8A 1ULBA 5KYGA 3SYLA 2QL7A 1ZONA 3FMGA 1DCTA 2IWRA 2GH1A 2WF9A 2CVOA 3F47A 5I9SA 1Y89A 3WJAA 4C89A 4F71A 5BPFA 4UBKA 1NQAO 2J4DA 3FDJA 3QJ5A 1RQPA 3VDMA 3WRWA 5LQRA 3I62A 2C99A 2B20A 2CVZA 3PHBE 1KOGA 3CSDA 4A0GA 3NYRA 2QSJA 1YR9A 4MEAA 2J5KA 4PYJA 1U9ZA 2G5GX 1ZD4A 1NOKA 3WGKA 5B37A 4OOEA 5DFAA 4OHBA 1IM8A 1D2EA 1S1CA 1VKJA 2VYNA 2WWFA 2Z57A 4ZO7A 3LCUA 3B70A 1ORHA 3NBZC 5FRDA 3RS0A 2IYFA 5CNJA 2OXIA 2GQ0A 3RM3A 4EHAA 2BEWA 3SJ7A 1GCUA 3HYLA 3IPYA 5EXEA 5KYUB 1SKMA 1QLHA 1YT5A 3BREA 3FSGA 3KAQA 3B6MA 2GN8A 1NJGA 4RKEA 5SY9A 3N6VA 4YWHA 3LX6A 3M4XA 4U2KA 3RROA 5HRCA 3U61B 2VSQA 5AOAA 1PZFA 5JTUA 4ZAWA 2YWFA 1YJQA 1D2MA 3CLTD 3NG1A 1SG0A 5IH3A 4ECAA 3TLGB 1MO4A 3ND8A 3SEFA 5C1DA 1FFYA 2ZXUA 3TWOA 4AQ7A 1JBEA 4BMNA 4K9QA 2ECOA 1WD7A 2IY9A 5FADA 4B6JA 1AB6A 1HQCA 5I9NA 3S8YA 1HT0A 1QORA 4PSAA 2A0UA 5TQVA 2C7RA 1U7ZA 4BO2A 2WJVA 3GCGA 4X44A 4UQLA 2HV9A 1QQAA 5CT9A 4TOIA 1KI1A 4FYKA 2PCLA 3OCEA 2A33A 3DVQX 4L0DA 1W2HA 4LY9A 1C1HA 1ZD2P 2C2GA 1GUBA 4DY6A 1FTYA 5DM70 1Y3BE 1WUJS 1T9GS 3GGDA 3OFVA 4MV0A 3EQ7A 5FA5A 3N28A 3F7OA 1IY1A 4ZARA 1U7DA 4JOCA 2E85A 4N3CA 3QNMA 2Q4TA 2MHCA 3VKWA 121PA 2IU0A 4WK6A 1JL3A 1LSJA 2GCGA 2WW8A 2ZWOA 3CR3C 5KYYA 4AZ0B 1LQTA 1L6IA 2QTVB 3B6ZA 2JBHA 4PZDA 2YOFA 3T06B 4C05A 1FNCA 1KFBB 1THTA 1OOEA 2EV9A 1VMIA 4ZALA 3RYCB 4G25A 1I6KA 3F8TA 4OGWA 1VXRA 5TQ0B 1GM5A 1KJJA 3WB2A 1GA1A 1W6UA 2C9BA 1P80A 2QN9A 1G5FA 3EZNA 3F8WA 4QDKA 4DPLA 4E07A 3PX3A 2CFTA 3U6BA 1JQAA 3VR6H 3D7MA 4EI9A 2O59A 3KVNA 3QSGA 4KOAA 5JECA 1RBYA 3GGCA 2QTGA 1Z6QA 3T34A 5F2NA 3M9XA 3OLXA 2PRZA 2BCGY 2D1TA 2CXOA 3SE0A 4CM8A 1QRSA 1SWWA 2A0YA 2P2YA 1XTZA 5AK6A 3Q2OA 1HDGO 4AMGA 1YVPA 1S4MA 4HNTA 1N75A 3OF2A 5IZCA 5JZBA 1JFTA 3VR5H 3O8QB 1GTL1 1PQUA 1ZJYA 3PNMA 3OZGA 3R7AA 3P19A 1A97A 3EPPA 5G0WA 3FI9A 1VQ1A 2W93A 1HDZA 4HQ0A 1OBCA 3KQLA 4QPNA 4YLGA 1U1CA 1JVBA 1UR5A 4R8MA 1LY1A 4X45A 3UTCA 5IAKA 3ZHSA 2HB6A 1L6RA 3DXFA 4WXMA 2Z30A 3O0TA 4CCYB 3D3WB 5B2FA 4ALMA 1OJ7A 4YMSA 1Z7BA 3RBZA 4J90A 1XCBA 3EW9A 2M2IA 4OJQA 1QFXA 2NAFA 4BQEA 1X2BA 4KKVA 3C43A 1TJ7A 4G5GA 4YFYA 2GUWA 3B1KA 2NTJA 3I04M 1Z0JA 4MPDA 2PZ8A 3L79A 2AN5A 3NWBA 1DXHA 1FCJA 1Y3CE 2RGAA 3JQ8B 3GNTA 1WCIA 3RSZA 3SC3A 5DLPA 3F2VA 4OMUA 4E1VA 3UWSA 4CV2A 2PY6A 3JALA 2O52A 2ZZNA 4JZKA 3Q40A 4B3CA 1EX9A 1SBCA 1P0FA 3UWKA 2C4HA 2JFBA 3JXEA 2JGIA 3RHSA 3SYKA 1K4YA 4TN5A 4W99A 4OPMA 1IRIA 3I37X 4EJSB 5J4YA 1VBKA 2WNHA 1K0FA 3INTA 1NKVA 1FU7A 3ZD8A 4GLJA 1D03A 4Z9FA 5IMBA 1ZWLA 2EQ5A 4ONEA 1W6RA 4QVKA 5ERGB 2A30A 5LZ7A 5EYPB 5D5HA 4MVJI 1USWA 3AL3A 3AI2A 4U2EA 4V03A 2UZ1A 2HT1A 3HB0A 3PXEA 2Q0XA 2UZ0A 4OHCA 1QTNA 4ANFA 2YVQA 3H7IA 1A98A 1HNXB 3C1OA 4L4SA 4TMVA 4CIAA 4M8NE 3U0BA 3MYRA 1EM8A 4CEHB 2VQ3A 1FTGA 2N0SA 3L1UA 3N7UA 4AJHA 1YUBA 2QVBA 4M9XA 1Z8DA 4QVGA 3A8TA 1UFRA 4KQ6A 4XKJA 6Q21A 1LFAA 4E1AA 1NF9A 3GGPA 3X2EA 5REQA 5AVZA 2AGVA 1CIJA 5E3JA 5LZ4A 1YZ3A 3DDSA 1MHPA 3ND6A 4ZQIA 1RLTA 3EXEB 1VJ0A 3Q87B 3PTAA 2AKAB 1C9EA 4KK4A 1O9GA 1IZ7A 3OCVA 3IEMA 2WT9A 1LU9A 3DYBA 1W5EA 1ZI6A 2Q1UA 2XUDA 2VHTA 2YV4A 1RBMA 1I2CA 2GZAA 4LJKA 4MQEA 2Q46A 3QHQA 4GE3A 4B4VA 1IB0A 3QV2A 2AOTB 5J47A 5KNDH 4DV2B 4Y98A 4NMHA 4WV3A 2Y4OA 5JSZB 4IFEA 3WOVA 5AJVB 5CYPA 2A5GA 4D81A 4RBNA 4Y9UA 2OO7A 4OBWA 2FKNA 3F3KA 4Y7DA 4B81A 2OAQ1 4YN3A 4BZXA 3W5CA 2C4MA 5ITWA 4RL4A 3FKJA 1XZAA 2B2CA 1T9CA 3I9V6 1ZS9A 2NXJA 4OFXA 3CFYA 3UM9A 3H5LA 2PLNA 2VQDA 2VUSA 1QE0A 2XMPA 5HKKD 4OEHA 2O19A 1DJMA 2QP4A 1MPXA 2PSFA 4FCTA 3B3QA 4RZXA 3U1BA 4IDOA 1XVUA 2VSOA 3PIDA 3TVYA 4YUAA 5K0GA 1KJZA 4Z4HA 2C00A 3DMYA 4DNQA 1R0WA 1Z6AA 1HZZC 2W71A 5JASA 2BD0A 2RHGB 2SNIE 4CQMA 4RY8A 5E9QA 2AFVA 2HBQA 3GTDA 4C2AA 4TROA 4F4JA 4RTQA 2QXTA 5E6RA 4P2BA 6PFKA 3U4GA 3N2GB 4J16A 2VDRB 5JLJA 3GT0A 2CGEA 1QYIA 2HOQA 2CE7A 4O8ZA 4C6SA 3CIFA 4DUZB 2NZVG 2VXYA 4Z51A 2YN4A 1RTKA 2WAAA 4NABA 2M6KA 3GFPA 1VL2A 3HVUA 4K1LA 1NLYA 1D2RA 1KR5A 2BFBA 2W98A 5CX4A 3RIXA 1ODIA 3EWSA 1QBKC 5T8KC 3GIWA 3CR7A 4DA9A 5AO9A 1ENZA 1G66A 2OEPA 4ZVMA 1T6NA 3TTUA 1QAMA 2P6PA 4IMJB 5IYZB 3H9BA 3D7KA 1THMA 5A9RA 2I55A 4QXAA 4JXZA 1F17A 1OAOA 3EZLA 4H1WA 2FEWB 3EGWA 5K3CA 2YCBA 2RB4A 1ZC3A 1LXCA 2GYVA 1UUFA 1XOIA 2AXQA 3OAAA 4IX9A 2RH5A 4AC9A 4F5ZA 5IVHA 4LV8B 4BJ3A 4PO3X 1EUDB 3H9EO 5K7SA 1LKZA 4K46A 2FW9A 4K87A 4NU6A 4IIJB 3BDVA 3PWKA 3K8QA 1F0PA 1DDIA 1NR5A 4HFNA 3CVYA 1QMPA 3WRXC 2EW2A 5I7HA 3SVLA 2GCNA 3OKAA 2QN1A 4IUCS 4JAVC 5ESDA 5HCNA 2G9ZA 1U8YA 4OXRA 5FCDA 1J06A 2YIVX 1NQTA 1X7ZA 4BFUA 1VZ3A 4YT8A 4YREA 1WV0A 5I9TA 5KU7A 3GFOA 3R24A 5JFGA 3IMKA 3MGGA 2OKCA 4MUBA 2B82A 3BQMB 5LQDA 1W52X 2OORC 4P5EA 1VYVA 4ZAVA 3DOOA 4HN9A 3RIEA 4AKEA 2Y8EA 3T3MB 4EA9A 1AGRA 1BH2A 3R0ZA 1XZIA 3W3AA 3WG9A 5JWOA 3TCNA 5A4AA 2ODAA 1N2OA 2Z2ZA 3OIYA 1W47A 1Y7TA 3O03A 4YQYA 4YO8A 3NOOA 3I2JA 4QWWA 4YCSA 2WJAA 3D6UA 5CCXA 4P93A 1JDNA 4IDAA 3PG5A 4LNUB 4H7HA 2CHVA 4N8EA 1QRUA 1N0WA 1AHNA 2V8BA 1CE8B 2G5CA 2REQA 3CRMA 1XNHA 2IYWA 1P31A 4D4IA 1IBKB 1HY0A 1YMQA 1M1YB 1ORIA 2YIMA 3K31A 4HYEA 4MULA 2COKA 2ONYA 3AM3A 3QYFA 2CV1A 1P1IA 3CWZA 5EWJB 2OCLA 3S2SA 4ZDIA 3PUWA 4XUCA 5KBYA 1LPAB 3W3ZB 4AO8A 3DJFA 4HSGA 4I36A 4B9EA 1Z0DA 3BRWA 2AJLI 3AIKA 4JLUA 1VYUA 1OFUX 1S4QA 4UTXA 2VYVA 3V1YA 4EJFA 2ZIFA 4Q4JA 1U6KA 5EKDA 5SY6A 3E0XA 4HGYA 4JYCA 3WAKA 2IU4A 1C0IA 3GEGA 2Y1EA 2O7RA 4FWIB 5I7VA 1RPZA 2DY0A 2FEMA 4YR9A 4G07A 3A27A 4MITA 1SBYA 3B2NA 1G7SA 1F8YA 1D6NA 2CFRA 4WLNA 3BXXA 2WHXA 5CBPB 2QSZA 1U15A 4I81A 1T3SA 4RADA 3LCMA 2EWMA 2OUKA 2IEYA 3TTVA 1E2KA 4KSBA 3V5NA 3HUFA 3NAQA 1LTQA 4FNMA 3ZYCA 1VIDA 4EPVA 1JIKA 2WWWA 1T15A 4RK1A 4Y6QA 2MR6A 1DKLA 3GDOA 3NHYA 4OJNA 4BU1A 3WIVA 3HKDB 1KZ7B 4PLWA 1G9XA 4FK8A 1L8AA 2QGFA 4PPQA 5BMVF 2H0RA 4TLCA 4OUDB 1N2GA 2GVNA 1JDBB 5FWAA 4CUZA 4DL9A 5JD4A 1PZHA 5DX0A 1JZSA 1NV9A 1BXKA 3I9LA 2K7ZA 2RGDA 3RCBA 2R4UA 2V98A 3ZDRA 1VLZA 4RKYA 4LF8B 3I4CA 4QYIA 1W36B 4FGKA 1ZNYA 3QVGB 1AUXA 3PEWA 4LZZA 3ZY5A 4KW7A 2P6OA 1LDEA 3GLHA 1CUEA 2CK3A 2BONA 4IJUA 1ZAYA 1YQTA 2F1KA 5CLFA 4BGIA 5JVDA 1SXHA 4ZRDA 2B6HA 3L5OA 4UPDA 3ETCA 4TM8A 3RFVA 1CQJA 3T7IA 3WIBA 4OQDA 1DJLA 4MYRA 3PNQA 4TMZA 3RT1A 3D4BA 1FOEB 2ZAOA 1X8JA 2XNCA 3I01M 5F1YA 4TZTA 4DGQA 5BT9A 5BOSA 1HG1A 2PKWA 4LAFA 2JA1A 4X71A 5ERYA 2PO5A 3WVNA 1I1OA 2GN6A 2MU1A 1PFQA 1QTQA 1W88A 1JYFA 1BVRA 2BFNA 2W4IA 3IOEA 3DR5A 2H1CA 3K4HA 3T7JA 4B3FX 1H9CA 2P11A 4PYKA 1BCRB 2H63A 4HAUA 1JHVA 1BW9A 2IGBA 3PRYA 3HVHA 3FCXA 4YPVA 2ZI4A 3UHOA 1K4KA 5J40A 3EDYA 1YS6A 5KWEA 3L5KA 3WB9A 5LB2A 2CDAA 4IWXA 2XD9A 4C87A 4CMBA 3WKEA 1JU9A 2AHOA 1JB1A 4BY9E 1BIFA 2IXEA 1SUIA 2XWJI 4A1OA 1KJQA 4XPIA 4NTZA 2J0VA 4Q3EA 4UREA 5C35A 1IHYA 2FSHA 5BXQC 2CB0A 1ONOA 3T1YB 1WL8A 5D01A 1L7XA 3DONA 3OOYA 4GYKA 1M5TA 3FCEA 4R0NA 1NYTA 5DI3A 1Z2EA 3IAFA 1E5QA 2IHVA 5FXMA 2DR3A 3NH6A 3ZJYA 4B5KA 5KDLA 1S3IA 2WMOB 1L5ZA 3HDVA 4JY7A 5AHWA 1X86B 4R6WA 1U94A 3ACCA 3TUJC 4R7TA 5HKBA 4G8BA 3F6EX 3SWWA 2RGNA 2P40A 3TDMA 1PV2A 1RIIA 3ABRB 4B8WA 2J0UB 1U3CA 2F3SA 3G2LA 3SDZA 5K3FB 3I0MA 1XEXA 4XWGA 1CC1S 4JSRA 3ZWKA 2HHAA 3HNPA 5EZ5A 5I7SA 1XZQA 3LY9A 3FGNA 5FFNA 5HS4A 2DE0X 4YY3B 3HZHA 4BO9A 1K5GA 3ABZA 4U00A 3IAS1 4MWGA 1XZDA 5EJ6A 1DMRA 1UKEA 5GJCA 3BMQA 1N92A 4O5OA 5DVZA 3WMWA 4HDKB 3ZY2A 5HP4A 2D3TA 3H16A 3OJEA 1GTG1 3P9SA 1C9NA 1FDTA 4J0EA 3F6SA 2W42A 4P08A 4YBZA 1IN1A 1E2FA 1GGKA 1JJBA 1P2BA 2DUJA 2YYYA 4R69A 3EIEA 3P5BA 5UKDA 4NATA 2FZ5A 2WUGA 4DV6B 4DIOA 3LM8A 2XODA 5E1OA 2CXNA 3OCJA 2NO6A 2OCAA 4K6OA 3RODA 4DC1A 4XVQA 5EIWA 1NQWA 3RJ9A 1XQVA 3E18A 3MWEA 1PWZA 1JIQA 1T1GA 3OQ1A 5FWNA 4O4HF 4RJJA 2G80A 3G23A 2WM8A 1KK1A 3G2IA 2FMKA 1W85B 2WIBA 2CWDA 4LOJA 1QIEA 4Q24A 1POXA 2I2WA 4K6CA 1JU3A 4LCBA 2MMGA 4UVIA 1N9GB 4PPFA 5J5VA 2GA9A 2PX6A 3N3BC 4OQPA 3REOA 3QW4B 3ZW8A 3THSA 1RJ9B 4ZVLA 3L93A 3PR2B 3ROZA 2DG2A 2C54A 2Q5FA 4H31A 2R7LA 1M66A 4S2EA 1YS7A 5EA2A 4NBNA 4YJKA 5AVSA 5IUJC 1Y4DE 2FX3A 2FPGB 3MINA 5E9AA 4UM7A 3FCYA 1IHPA 5AJHA 5L3RA 3GXBA 3ITDA 2N47A 4NPCA 4HAYA 5AVRA 2I29A 2XOXA 1MO6A 5G4KA 1UDAA 2V03A 7REQB 3KHSA 2DUMA 5EHXA 1J7JA 4Y18A 1RBQA 4X91A 2IDKA 4ROTA 4LYDA 5ECWA 3IBTA 3AEQB 2GZRA 3OKCA 2EWVA 2AG5A 1VXOA 2CKMA 2MDTA 2RHMA 4R8LA 5JSFA 2C83A 1A77A 3D4PA 4AJ1A 3OY7A 2ZFUA 3R6LA 5IULC 1T3ZA 3W4JA 4YCMA 4UUPA 1ZDMA 2IPMA 2QX6A 4OH7A 3WNQA 2O3RA 2XJ9A 3ZWVA 1R8SA 3ROFA 1FW6A 2G88A 4UBJA 1L4GA 2JJ2D 3FHTA 3RC8A 3PQ2A 4BHTA 4N40A 1ICIA 1X80A 2ZAYA 4U2GA 5IDYA 1AXGA 2BELA 4HY3A 3GJ5A 4XRRA 3SHWA 4C2BA 4E08A 4E51A 4PFJA 1KMHA 1MAUA 1WABA 1Z08A 2VQSA 4TLLB 1PL8A 2QP3A 5AVXA 1GCIA 1I0IA 3JCZA 1PLLA 3QMWA 1IN8A 3R9IA 4LQLA 1T25A 3PU6A 4JOSA 3CXRA 2QAGB 2OFFA 2EF0A 4EH1A 1MA0A 4AQYB 4X3OA 3A1DA 3WJ2A 3I1FA 4E1BA 1S2MA 2APJA 1Z74A 3HBJA 4MV4A 3WFJA 4CM6A 5JOQA 2X8WA 4ZVNA 2BFFB 3F98A 3ER8A 5AXCA 4JL5A 5IWCA 1BROA 2GEJA 2VCHA 1Y8AA 2V7XA 1OBHA 2X41A 1AC5A 3Q9UA 4J4BA 3RABA 3UH0A 1VKRA 3KKKA 3LS2A 2R7AA 3JAMA 3SLGA 4MWSA 2HPHA 2DEUA 2JEZA 3AVVA 4MMXB 1ESMA 3MAAC 3DL4A 3CBQA 1R27A 5GONF 4ABYA 4DKXA 1XZPA 3QIAA 1HE2A 2IPNA 4AN1A 3C4JA 5CCEA 4KTVE 5A4FS 3QUBA 5ALQA 1EVJA 2JAWA 2EG5A 2J6BA 3E3LA 1AXRA 5MDHA 1E89A 3PCTA 4HEA1 1RHKA 2JHCA 1N9KA 1O03A 1UBJS 2BGRA 1VG8A 2VIIA 1ZH4A 2L19A 3ESYA 4XIFA 1E3JA 1FQWA 5H4HA 4QG3A 1G8SA 4LEIA 1GUYA 1RVV1 4XR4A 3DZJA 4CMEA 4A9AA 2WFAA 2X22A 1IOZA 3F7MA 2AUTA 1G3RA 1JQ5A 3AEXA 1Z26A 2QM0A 3LBNA 2PT9A 3OFKA 3DS8A 3OUTA 1XDGA 4QRIA 4EHDA 3P2YA 3FKSD 3ASYA 3NDRA 1YACA 1ZRNA 4F9GA 2VN8A 4RTNA 2WF6A 1MEEA 1N0HA 3MILA 1PR4A 4CM4A 2JIMA 1GCOA 3O2SB 4HYTA 1NLZA 4GQIA 3BDIA 4XW2A 3L05A 2Z98A 4TVBA 2NO7A 2V6MA 3QVTA 1VSQA 4P92A 1D9XA 4C3ZA 1G6Q1 3S5JA 2Q8PA 4DC9A 5BVGA 2DFKB 2REXB 3VO9A 2PH3A 5KKCA 2RGRA 1P2GA 3T0IA 2WJZB 1RHQA 3BMOA 1X7WA 1V5IA 1I7PA 4MKGA 2PQ0A 1X7XA 2NU8B 3U3RA 1NC3A 1D6MA 1K08A 1J8MF 2VAXA 4LC1A 4A0QA 1VLQA 1XRMA 2J08A 4UD6A 1HYEA 4BLQA 4D26A 2ZIGA 4QAJA 3FWYA 2X0FA 4OHUA 1ESEA 5BV7A 2WJYA 4BPRA 1NQXA 1L7MA 3GQBA 3L84A 4TSKA 4EDFA 4EYGA 5JDIA 2IOQA 4KGDA 2F67A 2YWHA 4PHTA 5DHUA 5HA5A 1TEXA 3Q9SA 2BKEA 2CNBA 2X8JB 3GX1A 1F1JA 1J2EA 1OLXA 2VDVE 4RULA 2DLDA 4ZVTA 1IN5A 3H5VA 4URYR 3BT7A 4MV7A 3PLNA 2Y1GA 1YZUA 2OWEA 3AERA 3T3DA 3KTOA 2ZBUA 2ZRFA 3QVJA 3TD9A 5K99A 5KB3A 1VGQA 4FNAA 1OXUA 4FFVA 1FPMA 3OX3A 4YRGA 4V0ME 2IYZA 1YE3A 4OAPA 2VQEB 1V9LA 3FSJX 2DECA 3VO2A 3VKHA 3WV5A 4FTWA 1GZ4A 2OP1A 3ICOA 4JWTA 5CYGA 2HWUA 3F2IA 5F51A 1AGYA 2HDWA 3BD8A 3KJFA 5FLYA 3FX2A 3A1TA 2LCQA 2B1QA 2O8DB 3FIUA 2PSJA 3A6HA 1H42A 2HV8A 3V7FA 1YRAA 3FRHA 2QY6A 3S40A 1L5FA 5JY1A 3AL2A 3W90A 4OSPA 1RLUA 1IEVA 3PK0A 1O94C 4EY6A 2N46A 3DFFA 5GZ3A 5KTNA 1OLUB 2ZJZA 1FBTA 4GAEA 2RAUA 1R74A 4YRQA 3PHIA 1NM5C 5DP2A 3G82C 3WFZA 1K5DA 1XXHE 3BMXA 4HDAA 4MQ6A 1U5BB 3ZNPA 4A8PA 3L07A 4CKBA 1DOFA 3KZNA 4IRMA 3RK1A 3GT4A 3QFRA 4HWTA 4YI3A 3BMCA 3TOCA 3MTBA 1NLMA 2V7VA 4FQ7A 3D6HA 3K1TA 1W2WB 5ADVA 3IDAA 4G56A 4KMOA 1QHHA 3HJCA 4FUQA 1D4AA 2P90A 1P45A 3NAZA 4ZO8A 4YRDA 1CZOA 1O9BA 4NWIA 3QEJA 3LUGA 1E1DA 1R0CA 1Z9BA 2ZTVA 1DT5A 5F7XA 5C5CA 4URFA 3OU7A 2QX9A 1F8UA 3R2JA 5B6JA 3UENA 3LPMA 4J1TC 2B94A 3EPHA 2O8CB 2GKSA 1REQA 5J2UF 4LF5B 1I9CA 1IHXA 3R8FA 5JEDA 1JAXA 1EBBA 3N8NA 1Q0HA 1JP7A 4P4GA 4UUMA 2OXTA 2XAAA 1FIUA 3OOWA 3HBMA 3LTNC 3D0KA 4HH3C 3S70A 2OQ2A 2IGTA 5FA8A 3SKVA 1QGZA 4YIHA 1QHSA 2BM8A 4KRYA 4S35A 1J33A 4TL9A 5ICGA 1MIHA 3QOXA 3C5EA 4L5JA 4RQTA 5C51B 4O2LA 4BNXA 5ETJA 2FWMX 4A8JB 4M0FA 2ZM5A 5HW0A 5DHTA 4P7BA 2I76A 4S1VA 3CI0K 1MFPA 4QXRA 3H3FA 2IYTA 4OXKA 3WQBA 2H4XA 3BXGA 4UW9A 5JJBA 2QD2A 4KOEC 1SU7A 4DPKA 5LD2B 3CA8A 2FQYA 3ZCQA 4R2KA 2WUWE 2JFYA 4US0R 4P7FA 4REOA 4DEXA 5TGTA 4LDAA 4KUEA 3AWDA 5A3RA 3G5AA 4QYXA 3HWX1 4IDEA 2HN9A 2JGMA 4NYIR 1NPTO 2CBXA 5C31A 4AJKA 4D57A 4F21A 1A88A 4TTSA 2D1QA 3R6QA 2H3HA 2G9RA 1O95C 3GHYA 4S2UA 2QTZA 1CY1A 3AH8A 4UMEA 2L0XA 3JQ7A 5FOWA 3L7NA 4KCGA 1WQ3A 2R6ZA 1WMSA 3WXBA 1FW8A 1DWOA 5D6NA 2PZGA 4BCBA 4P0PB 1ENYA 4I46A 3GEIA 2QD4A 1G4AE 1TO6A 4MJ7A 2EJWA 2I4LA 1QX4A 2ORVA 2H48A 4IMRA 4PFSA 3E03A 3ZWPA 2F1OA 1LSOA 5E3HA 2OBYA 3U81A 4MO2A 4HQLA 4NE9A 4XSVA 4MUEA 5FUWA 4TWAA 4ZYTA 2Y2VA 2YY5A 4RORA 4OXQA 4DLZA 3AR3A 2ZJ7A 5AKHA 2FKAA 5EGNA 4P53A 4CLRB 1UXJA 5B1EA 4RY9A 5IEJA 1E1RD 4JZYA 2IVFA 3IOYA 1RC8A 3ZGLA 1R0XA 1ZA2A 4BPBA 3ABOB 4H3VA 5KX5A 3UC5A 4XGIA 3OT1A 5KMGB 4WHMA 2C57A 2CJWA 1UKCA 4I08A 2F2TA 3SIXA 2X5OA 2COEA 4W7IA 1NW7A 1CEQA 1GADO 2ZTHA 4EG4A 2YW9A 4HNRA 2O1SA 1YASA 1ZG3A 1Z82A 4ENUA 4C6HA 5FEUA 4KRFA 1M6HA 5F77A 4B7XA 1QVAA 5BV0A 2V7TA 1C41A 4KE7A 2JZNA 1UL1X 1TECE 4AKTA 1U0FA 1EGAA 1U1IA 2YNMC 2C2ZA 3TLJA 3L41A 1QX3A 1MN6A 3AOEC 3BWEA 4WKPA 5ILOA 3ST7A 2BGLA 1FF9A 1BC5A 4OATA 4JP8A 2YIJA 1YK1A 3THWA 3BXPA 4GWKA 2WJGA 1L4YA 3QE0A 3OSUA 4NF2A 3TH5A 1TTTA 5KYWB 2O06A 2RCYA 3K5PA 4KPFC 4IP0A 5H7XA 5GP1A 5IANA 4IWNA 1IZ9A 3NHWA 2FPIB 5AJTA 3B60A 5B58T 5D5QA 5FJJA 5DLYA 1EDOA 4NG5A 1RI4A 2C5AA 1DKUA 3PC2A 3BFXA 3K9NA 2CLHB 2VHCA 5HIMA 4FT2A 3V97A 3WYGA 1P3Y1 3ZU4A 3ZX5A 4JB0A 3ZV3A 2YJ6A 3CEAA 3RC3A 1CHNA 4TTPA 3WGUA 3LCCA 1S9DA 1EEHA 2XDYA 4PPYA 1FP1D 3PEVA 3WC4A 4FJ0A 3A2MA 1OWOA 4R9VA 2V6IA 3TW8A 1VGVA 3HS3A 3GLGA 3F4RA 3D1LA 4TWZA 4OQLA 1J4AA 1E6MA 1KNXA 2YS7A 1CT9A 2EBUA 4KN6A 3V4VB 2WF7A 1IQUA 4ND8A 4QUGA 1A69A 2XKAA 3AGQA 5EY5B 3QOWA 2PGOA 2E49A 2M6RA 3VKUA 3IE1A 5CM9C 4ZI7B 1PEDA 5KYXA 1VMEA 4PYRA 4LJ7A 1RI2A 2O48X 2ZDGA 2ZYUX 4PR0A 1T35A 3DV9A 1V8FA 3IAXA 1H4TA 1ODKA 3OCCA 4MQ5A 4OYHA 1TVMA 4DCCA 4K6KA 5IEBA 4DUPA 1VIAA 4ZJZA 4FINA 4KPUB 4E2XA 2YHUA 3GV0A 4Q1VA 4D3YA 2ZIAA 1E32A 1U8UA 4NDNE 1NSYA 1NVFA 2YJZA 4O2AF 3WGJA 3I34X 1WNTA 4OMCA 3EE6A 4OP1A 3C5CA 2P2DA 2CN1A 3KYDB 2CMFA 3EIOA 3FETA 1IBRA 1NUPA 2XQIA 3FF1A 4LXQA 4M6WB 3GMSA 3EA4A 4NOKA 5ILGA 2OBNA 4KIUA 1TUBA 2VR1A 3SP1A 2HF9A 3M1AA 3SY8A 4A82A 5JS6A 4RCVA 1I4TD 3ND9A 4C4RA 4HAWA 5I9IA 3VNUA 1Y8QA 1F38A 4RS3A 3TIXB 3GVPA 5JCJA 3CH4B 1QF9A 3WHPA 4JNKA 3IR5A 3DM9B 4GI7A 5KQLA 3EGCA 3LVRE 2M32A 2R79A 1Q57A 2VF4X 3JQGA 4CG3A 2OFXA 5HNKA 2H5EA 2ZQZA 1WZNA 4PLFA 5ES4B 4U4AA 2NQ2C 4MCHA 1UBOS 4AECA 1QO7A 3RVRA 1AKMA 3EXFB 4HXEB 2GESA 1I4LD 2HRRA 3ZBTA 3PFIA 1UC5B 5CDYA 1BTOA 3I6MA 1B0UA 5K51A 1ISMA 5LP1A 1Y9EA 3B1ZA 3UATA 3ZN2A 4EYKA 4UTZA 1ZVJA 3E04A 1DNPA 1AKNA 3PGKA 3LVFO 1DCFA 4QODA 3QLUA 5A0FA 5F12A 3MIIA 4MW5A 4FBMA 1QE5A 1G20B 3QITA 5HM6A 4WESB 2IXGA 1EZZA 4FIDA 1RHMA 1FFEA 16PKA 3LPLA 2OB1A 2IU6A 1GL6A 2ILVA 4R1PA 4LRUA 1GKYA 1PVDA 2RGXA 4DSTA 5K6RA 8ATCA 3RVDA 2GSDA 1J49A 1JSRA 1V9SA 1X94A 4MV1A 1IRXA 4JWKA 3UXMA 4G37A 4EA6A 2BFCA 1DJOA 4ERNA 3PQ7A 3IQDB 4URXR 4P9NA 5K9ZA 1SXJB 2PGJA 1Y1SA 1YCFA 1ZAKA 3A1FA 3EVBA 5ALVA 1VGRA 3DOEA 3TTWA 1HE3A 5E6UB 1SQSA 1XV5A 1VFPA 3OLVA 4BNYA 3KQWA 4I5DA 1BHQ1 4RDHA 9LDBA 3ES9A 1DC6A 1FL9A 1XCOA 4WZ6A 1R64A 2MSWA 2OD9A 3GD5A 3ANMA 4M7WA 1U0JA 2XDQA 5LQMA 1C3VA 1MZPA 4EENA 1S96A 1W25A 1C9JA 4GX0A 4D5EA 1FUYB 1RQXA 1UADA 1B74A 1J7KA 2PZEA 5DBOA 4M8KA 1GYQA 2QENA 2BT4A 2CL0X 1YONA 4F97A 4IL5A 4YALA 3PPXA 3SHOA 2B4RO 4EG0A 5MHTA 1XRJA 5AVKA 5DBGA 3QKWA 4IIXA 3KV3O 1J1ZA 1HGXA 3TSYA 3WLOA 2ZUTA 3ZLBA 4DW8A 4F84A 4OP3A 3NXKA 1D8TA 2ZQYA 1XL0A 3P9NA 1PYOA 4JX8A 3R7FA 4YAKA 3I83A 1DMSA 2JANA 2JGEA 2XQVA 3ENQA 3MLBA 4P35A 2I22A 4BWYA 3BIJA 1L5LA 1EUCB 2GZ3A 2O3SA 3C3AA 1XG5A 4U7GA 1DBSA 5LU8A 2ALJA 5BUSA 1GGJA 1RPAA 1ESDA 3F6BX 2CNOA 2GAAA 1XAHA 4GGPA 3P2JA 4O1MA 4EMSA 1M7GA 4LOKA 4DMUB 3K1AA 1E1CA 3CX7A 1FUUA 1MTZA 2W8ZA 2WK1A 1EP9A 2P69A 4O25A 4OO3A 4CKCA 1E7WA 5G40A 3H2GA 3EQZA 3KEMA 2WU0A 2BJWA 2FFAA 2BI7A 2C2OA 2C4KA 1YKGA 1AK1A 1KQOA 3LGSA 3ZEIA 1NZJA 3JATB 2IZ6A 3NORA 4B48A 4F9EA 1TAGA 1KHHA 2VI5A 2WIFA 3PC7A 1OH6A 3NVDA 2CFSA 4H0CA 1C7RA 5FOSA 2QJFA 1RIFA 1SR8A 5L4SA 4QBTA 4O2BA 5B3AA 3U4DA 3SJZA 1HNWB 5HDQA 1HO3A 4WZAA 4OKSA 3U4CA 3TTXA 2AYYA 1I13A 2DWOA 4UTNA 2QYHA 4G0WA 4J75A 1B8VA 2V55B 2AMYA 5DBHX 4ATNA 3KQOA 4D3ZA 3EC1A 3OFJA 4MDHA 3KE9A 2W7TA 3ELYA 1W4CA 1TU4A 2ASEA 3W5HA 4E7OA 1ZJ4A 3O26A 1E2HA 1T3GA 4M46A 5AI4A 5JAQA 3RWOA 1JPVA 3V7WA 1Z34A 4CNBA 1OW3B 3AIIA 2QG9A 1G98A 2BP7A 3H87A 2PIDA 2WJIA 4I4NA 2GPNA 4MEJA 2DPXA 1MG0A 4UQPA 2NNLD 2Y6VA 2AVDA 3V48A 1GA4A 2OOKA 4ARVA 4Z1MA 4DSZA 3KRTA 2GS9A 2ZSUA 2I1WA 2C4UA 4M86A 4ENTA 1KQPA 2OZKA 4ZVOA 3GJQA 4HCJA 3WMGA 3GT7A 1OIXA 3MXOA 1Z33A 4AN0A 3I8SA 4WCVA 4JB3A 4F85A 4YRBA 2EFDB 3WFIA 4AG3A 2JW5A 4QECA 3JASB 2ZEJA 3HDJA 4AY3A 5DOVA 2WFZA 2X1MA 1JILA 5ENZA 1NZDA 1OJLA 4PGMA 3WGOA 2Z2JA 2IZOA 4XSGA 3A3NA 2EYQA 3TOXA 3WYDA 3UGJA 4NEQA 4TV9F 1JG6A 5F5LA 2VJLA 3VHXA 1U9YA 1AHHA 3M6WA 1GLGA 1F8GA 3A3PA 1E18A 1JHAA 3HBFA 3PQ6A 4P4NA 3TCXB 4LBVA 5H59A 3SQOA 1XLUA 4BNDB 5JPCA 1AN0A 2CL6X 2AR7A 3QTLA 5KOJA 3TECE 1NHWA 4Y2QA 1C3OA 2WF5A 1HMYA 1Z25A 3TNLA 4R98A 2F4NA 4XFDA 1J99A 2VBFA 2YJ3A 3BWXA 2ZOSA 4WFKA 1QP7A 4ENVA 3HSYA 1G291 3OETA 4YJ3F 3MTIA 4I7EA 1UXKA 4H6PA 4II7A 1P3DA 3X43A 2GN4A 5LNK6 3SDSA 8GPBA 3RANA 4GM4A 3Q7IA 3I9FA 1VKOA 1G4HA 4WECA 3SI7A 3OVMA 1UMBB 4GOJA 1P1HA 5BN5B 3F1KA 4R3UC 4IXMA 4ES6A 1XTUA 2Y76A 2O8EA 1GZUA 3DMHA 3O4IA 3DULA 2PH5A 2QXUA 1TVKA 2J33A 1YB4A 3KKNA 4M22A 3VH4A 4XTRA 2FU5C 2HJWA 4JJ8A 1FMFA 2BBTA 1LV7A 1M67A 3PE4A 1KDVA 5DM1A 2QX4A 2ZT6A 2V96A 4FZVA 3A05A 3SXUA 1GFSA 2FPPB 1EEXB 1SBNE 4PSCA 4LRYA 1UZUA 4YUZA 4ZV9A 2WVAA 3P2OA 4GKKB 3WJ1A 3WLPA 1T5HX 3EASA 2HRBA 1Z3IX 3HA2A 1CRPA 3VR5D 3SS8A 4H1VA 1L7OA 3TG8A 1TA9A 3JQ6A 1LDGA 2XKBA 1XBTA 2WMNB 2J32A 1ONBA 1MJ5A 4I1RA 3T4EA 1CDDA 3G49A 3HFJA 2EDAA 1SHJA 1DARA 2UDPA 4OFWA 2C96A 5ULLA 3G5UA 4HO1X 4PBTA 3VU8A 3R76A 5B3LA 1M2HA 1GVHA 4W1RA 3VRHA 1M8JA 5EKUA 5CFNA 1IEWA 1PZGA 3HC7A 4QUHA 1B93A 5CFOA 1NMQA 4DC0A 3L8EA 4OYYA 1QH8A 2EWWA 4F2DA 1U2ZA 2WTAA 3BCHA 4PN7A 1S01A 4ASUD 5K4GA 2PS1A 2PKYX 4TGLA 3RDPA 5I4BA 1FB5A 3AGPA 3QIVA 4YI5A 4WKCA 1QHEA 2QLMA 3KQQA 5FPKA 5AOBA 4BLPA 3FFBA 2BFOA 3COYA 4L27A 1ITZA 1OGYA 1DADA 3GELA 2VTEA 3MTAA 5JY6A 2BM1A 2HJ9A 2RGYA 2V4UA 2AZ4A 1SCUA 1UDRA 4MWBA 1TJWA 4R1TA 3LCRA 4ZP1A 2HLNA 4QAQA 1M75A 2ZIZA 3DG9A 4BC0A 1N5MA 2E4VA 3EFBA 1JW9B 4EHBA 2B2XA 3H11A 1Y5NA 4CKEB 4AB1A 2JDID 1L5HB 2W6JA 2V7QA 5FPYA 4LISA 1O4VA 2Y4NA 5TXGA 5CB0A 1Z73A 2ESRA 4MJ3A 3MRVA 1PWEA 4MKZA 3RVSA 2HSGA 5HILA 3RS8A 5A4KA 3BVPA 3UB2A 2B6NA 1TIKA 4EUHA 5BWOA 4JBLA 4BNJA 1LPBB 5J23A 1VOTA 4G4IA 2HYIC 3JZIA 3PTLA 5HXAA 2HX1A 1LK0A 4R5HA 2X5KO 4M89A 5H70A 1XRRA 5FAKA 3R5HA 3FFAA 3CLVA 4RYLA 1MX3A 3PFWO 5E8RA 4RQUA 1TM3E 3WISA 4C5CA 5JC8A 2UZAA 5KDDA 2OXRA 5JYEA 1BDHA 2Q1TA 1XF9A 1GKKA 4LRTB 3LLUA 5JU6A 5JHGB 4Z4GA 4E12A 3OCFA 5JATA 3R9KA 2J48A 1UDCA 2R7NA 3HWSA 4OB7A 2V1XA 2O23A 4N3GA 1XA4A 2II6A 3L04A 4ER3A 1N5KA 1E60A 1CLUA 5AP9A 1P1RA 3JD1A 1ZQ9A 3ZBQA 1SHUX 3KELA 4KFUA 4BBPA 2FRVA 1CERA 1NKSA 1ZOOA 4C7OB 5DX8A 1UBHS 1UOQA 3G7NA 1JKJA 3F1LA 4ESOA 3HDQA 4X95A 2NPOA 4H7DA 5IPFA 3IHTA 4PS0A 4BMDA 3DDHA 1E0SA 2Q5CA 4NV0A 3QX9A 2PUFA 4TWBA 4Q9JA 2GA8A 1JEQB 2NSLA 2VJCA 2QB5A 3EZ2A 1JHDA 5HCUA 3RSFA 2OFOA 4ZOAA 4RZHA 1WW8A 1ABBA 5EVCA 3UV6A 4KN9S 5LKAA 1F6BA 3ZE9A 2AWNA 2PYDA 3IDOA 4JLWA 1FP4A 5JE8A 1XCJA 2JFQA 5K8JB 2ADMA 5ALIA 3ZHCA 1ODJA 4WN9A 1L3BA 1MQ8B 3PR3A 4KQXA 3NKVA 1T8TA 2W2OA 5HOEA 5D7NA 4IRUB 2OHGA 3SZGA 2OKGA 2WHQA 3BQNB 3KAPA 5A4IS 4IOKA 1ZBDA 4ILKA 4N5NA 3BWYA 1EZ1A 2O5VA 5DGIA 2JGDA 4MZXA 1Z56C 1Q0SA 1ZLXA 4JS0A 3ZNQA 1A8IA 4OX9Y 1DLIA 1QQ5A 4RS4A 4D7AA 2WM2A 3BFPA 1XDDA 1YRQA 4ZJPA 4I9UA 3UMGA 1LBSA 3OZRA 4RGVA 2K87A 2D6FA 1U0LA 1DZ3A 1V7PC 1XTTA 2RBGA 4I55F 4XCVA 1TEHA 2Q5HA 5ER9A 5A5GA 4CKZA 4NEGA 1VKHA 4FDUA 4MO9A 4RVHA 1FXUA 4RM2A 3SEAA 3UXYA 4UXJA 4UEOA 1WTCA 4L9SA 1UMCB 2E4XA 1Y8ZA 4PAQA 4EHFA 1T6BY 3KVOA 4CMHA 2AJCA 3RS3A 4WFJA 2CDCA 4FFBB 1T4MA 3O3OB 3PI6A 1VLLA 3LRPA 5BUCA 4IDDA 4NBKA 3JQAD 1VPEA 1L7QA 2GNOA 5E1DA 1U2DA 2WIJA 1OIWA 4OQZA 3OWHA 2JCXA 5DW3A 1RAEA 4PSUA 4YYZA 1XMIA 1Z22A 3Q8XB 3QEAZ 2I2FA 2ORED 1Q19A 4ENRA 4EJ0A 1A9XB 1VA5A 2A9FA 3ZYZA 1TB4A 4WBSA 1NNUA 3PFHA 3WWEA 3E9DA 3ESCA 3E3AA 2YXDA 3IOMA 3UHFA 1G6KA 2RHJA 3F5FA 4KXXA 1HEYA 1E5TA 1XK6A 3HHPA 3GEBA 3T1NA 4JNCA 4CQJA 1ZWKA 4NFSA 1A1VA 3T3OA 4OBXA 3H2KA 1WHSB 5TVGA 5A2GA 4B85A 4AMZA 8ADHA 5KJEA 1R5BA 1F8FA 2X4LA 2V7UA 1ABFA 2C8LA 3UT6A 2ERYA 2P4QA 4L72A 2XUHA 1C2YA 3HR4A 2ZJ0A 2PAFA 3EVCA 4RVFA 4Y30A 3TSWA 1VE1A 1DX6A 2GAIA 3GN2A 4BVBA 5EHZA 2IUYA 5L4NA 4NJMB 1YZKA 3DBLB 1BJKA 4FIZA 4JLPA 4ROSA 2GMWA 1CUZA 3PXDA 4DBLE 5C34B 5JXWA 3EGOA 1OVMA 1T2FA 3EVGA 2W2XA 3O2JA 4ZCRA 2NGRA 4EZEA 2XGJA 3H1EA 3E2IA 5KNCH 3ADDA 1LRLA 3CUTA 2W2LA 4GBMA 2HXSA 4REMA 3OQIA 1CS0A 3I9KA 4D5GA 1DAHA 1Q7GA 2IV3A 1XDSA 3CLHA 2JJ2A 3HKEB 4R0MA 3KAJA 2D2VA 2GXAA 1VI2A 4OY3A 3TKAA 1CB0A 4J03A 3VPFA 1KEVA 3II6X 1EH5A 5CM8B 1ZK0A 5EJ2A 2WZDA 3TRDA 1E7YA 1L7AA 2W6NA 1Z12A 4I50A 1NW8A 1UKVY 3SNHA 1FLAA 1Z83A 1PJBA 2Y1XA 4MYUA 4QUKA 3AEKA 1YQXA 3LI2A 1IPFA 2CHFA 1EP1B 3QVLA 3KBOA 2HHHB 4YP9A 5LOVF 2CHGA 1Q22A 1QTIA 3IQXA 4OLFA 1RHUA 4KXVA 2W00A 3LDFA 1R9NA 5EKTA 5BNZA 5AW1A 2DR2A 4RA9B 3AHCA 1GL7A 1U7OA 2AMVA 5CA0A 4YMGA 1H9AA 2EP8A 1QUEA 3I9V1 4F1KA 1KWGA 3OBBA 3L8YA 3M3DA 3CT4A 3QNUA 2Y0BA 3IV9A 2DM6A 1A5SB 4IDQA 2I6TA 1K7CA 4ZVPA 1LBTA 4URWR 1HFEL 4WN3A 4WZBE 5A5DA 1N2CB 3E7XA 4J1QA 1DIBA 3AETA 2HUPA 1C7FA 3TLZA 1SB8A 4D9IA 5M34A 1STOA 3U44A 2O3QA 3G0IA 4ZU3A 4LXXA 1VSVA 3CURA 5BN3B 4NIMA 3M89A 2ACKA 2I4MA 1QO0D 1ZO8A 2G0NA 4MVYA 1MTOA 4NOJA 4Q9NA 4EO9A 1E0JA 3KZ1E 3NEAA 3MRTA 4YMHA 1CX9B 3DFKA 2RGBA 3STHA 4DR5B 1XCMA 2B1GA 5JDIC 4ZZ2A 4R71A 4EEZA 1OZFA 1Y7IA 4XVRA 2VT6A 3QWIA 3SEQA 5JSYA 2HWWA 3HA7A 1XLWA 4M1OA 4A0FA 5EJ7A 4UATA 5BW6B 4NFYA 5B4UA 1HRDA 1TAQA 4G8DA 2VRNA 2Z5FA 2D2XA 4NK5A 4NR0A 2JLCA 4MWDA 1KXJA 1DIAA 4LXTA 2LBPA 1BDMA 1TQDA 2AFHA 2DPYA 4WUTA 4YRMA 3M2PA 2ZWIA 5B64A 4ZQEA 4JX9A 1X8XA 4LOHA 4IUBS 3S99A 5ITZA 1ESNA 1W30A 3T5PA 3D4NA 2ZM6B 4Q6WA 1K4MA 4Z3OA 1UC8A 3ZU2A 2EERA 1QOQB 2D0IA 2ZATA 1F3OA 2ZSBA 4ABTA 4DB2A 3H5NA 5KNBA 1PNRA 4D6YA 1CZRA 1WMDA 1Q0UA 1WMAA 3HWWA 1SQ5A 2MTBA 3Q3IA 5DM2A 2IS2A 1OXVA 1JDBC 5DBFA 1O3YA 3UEOA 2I3DA 4JR0A 4IIBA 3IR7A 4RHXA 1K2WA 5FOUA 1KP3A 2FP4B 1W94A 2ILTA 5I4IA 5EKSA 3QVKA 4EFLA 2YHBA 5EE9A 4S1TA 1LGYA 3W8NA 4E5YA 5AW3A 4JA0A 1W36C 5KTYA 2ICAA 2PUCA 2HXYA 1R8YA 4QPZA 2FPKA 1IMOA 3K0AB 3FHLA 1AMUA 1RACA 3QBEA 1K7FB 2JD2A 4A73A 1VCHA 4XWKA 5JV5A 3C6MA 3BMNB 4DLTA 1XP8A 1Q77A 3ZZNA 4XWOA 5C4MA 1M3SA 1PT6A 2FSIA 2JRCA 1MR3F 3AFMA 3CIOA 3TGPA 3UKOA 2LD4A 4JDPA 1B26A 3OM9A 3A6ZA 1JJVA 1N9ZA 4MX8A 4YCLA 2C5GA 4AS2A 4YFVA 3K5IA 4MGHA 5TNXA 4HWRA 4L9WA 4X7MA 2JFWA 2V0NA 2JVKA 3UJ7A 1MAAA 1P44A 1ULTA 1OHHA 2GETA 2VDWB 4MPPA 5FWYB 4H4EA 5AICA 3PT9A 2XMSA 4UMFA 3D3EA 4M9QA 2RJNA 3H2JA 1U28A 5J63A 2F64A 4JBWA 5BVHA 1UK8A 5B57C 3ONDA 1ZM7A 1W9HA 2Q5OA 1TZMA 3W2EA 3DBVO 2EC5A 3NHMA 4HXYA 5CW2A 1GGVA 3FB4A 4V0RA 3R8CA 4MYSA 2IPXA 1ZPDA 2FPMA 2IQ5A 4FLFA 2EHJA 4H7PA 3DTVD 3I3OA 1G38A 4C30A 2O8VA 4AP5A 4GMXA 2WYOA 4CIWA 3ZLJA 1FSSA 2PU5A 1N1EA 4PE5B 2Q7XA 3UZUA 1RYMA 2CLEB 2KQUA 3A6GA 2N1BA 1E1QD 1QIKA 2ZQ5A 4MLCA 2IVZA 4AL4A 1ODTC 4XEHA 3ZI7A 3ADCA 1XQ9A 1U9IA 2IIQA 3PXBA 3KOUA 1XAJA 3FYCA 3VC3A 4KMRA 4DRXA 1UJCA 4X20A 1R5JA 4OGLA 3AB8A 4KWEA 4XX1A 2XMDA 2QYOA 1O08A 3L7BA 3BTUA 1IPHA 3CEMA 4P84A 1JECA 3VPBA 4ZYUA 3THRA 2ZE5A 1PZEA 3W4KA 2WE7A 4BX9A 3I2FA 4Q4CA 4DA6A 2NZ8A 4J29A 2H2WA 1QZ3A 5DNUA 4TYYA 1BKYA 3HXPA 1OZ0A 3QYPA 4MKFA 2AT1A 2H2FA 1PQWA 4J6EA 1XLVA 1YOVB 3P4YA 2AI2A 3F5QA 5DMHA 3SFZA 1ZP6A 4GW3A 5CNIA 1FDIA 5EUQB 1IAVA 3W5SA 3THXA 5J4KA 2ZIWB 1L4BA 2PVSA 5FNVA 4QNMA 2X0DA 2AKYA 3BJZA 3ICCA 4HDMB 5TQ2B 1JPJA 4OHVA 4L76A 4JKOA 5U4QA 4MARA 2Y0CA 2FLWA 2XV1A 4OYRA 4EQZA 1U1DA 4C21A 4FHDA 3TAXA 3N8KA 4EIWA 2OBFA 2XQJA 5CX1A 3CMCO 5JLAA 1OI4A 1K3FA 1YB7A 3FAZA 4MW2A 3GC6A 2PK3A 5SICE 4XYEA 4EYEA 3M6AA 5BP7A 2FOIA 2QRVA 1NSTA 3DV0B 1JXAA 5KKNB 1ZIPA 1HFKA 3FJ1A 4FU0A 5CBKA 1J56A 2GBLA 4UU0A 5ALUA 2HK7A 3VDQA 3X1JA 1IOVA 1NXQA 4TX1A 1DBVO 3DLPX 3HCCA 5J2TA 1KU6A 1UKZA 1CP2A 2C9MA 2WJWA 4INOA 3I3SR 4JD5A 4K6GA 4FDTA 3UJHA 2FPXA 4E21A 5K0BA 2FSSA 1EFDN 1NTRA 4YUVA 2C7GA 5THXA 4A8HA 3EFHA 4IV8A 2KLBA 2Z83A 4N65A 1SXGA 2IS6A 4HGVA 1G5TA 3HH8A 1X7YA 5LP6B 2I3GA 4Y67A 5IVIA 5C8DA 4JIMA 3LRTA 5CIQA 4D9EA 1V8DA 2ZUCA 3IPLA 1I3LA 2OCIA 2RDMA 2DFDA 3UT5A 1VRVA 2C2XA 3DXZA 1PQ4A 2FQWA 2ZSIA 2EATA 2AZTA 3IBFA 4F3RA 3O84A 4AIIA 3CLTC 4B80A 3OX4A 221PA 1LVUA 4QIHA 4XIYA 1W1IA 1IK6A 2D7CA 2HSWA 3HY3A 4JLAA 2K2QB 4BAGA 1OBVA 2Q27A 3MT9A 3BKXA 5DO9A 1MOSA 2YJ5A 4EZBA 4XWYA 5KTKA 3K1ZA 4LZPA 2EX4A 2NXNA 4RWZA 4JN6B 4X93A 4FYIA 3PDHA 4L02A 4NENB 2XNJA 1D3AA 4HZGA 2NOAA 2XCOA 3QWHA 3SN6A 1O6CA 3DFIA 3EN0A 3QOFA 3K2EA 1T5SA 2Q7OE 1TYZA 3EXHB 4MV5A 3OPMA 2J0SA 3CE6A 4RPJA 1QTRA 2OPBA 3HE3A 3RC2A 1RQLA 4LE2A 5FI1B 3JD0A 4QTZA 1Z47A 1AK2A 5LA6A 2QAGC 5L3QA 1RYDA 4DTCA 4F96A 3LNTA 3ZCVA 4ZHSA 4RIGA 3MTJA 2HQ1A 1NFFA 3B82A 1R3UA 4MOWA 1OC2A 3MBKA 4Q48A 1E4EA 2Q2WA 1COWD 2H51A 2PYIA 1UODA 3QKRB 4GSYA 1BGXT 3M7IA 2P4UA 1R6XA 2OHJA 3QVSA 2VDMB 2ZR7A 2QMYA 3IQWA 3QKSA 5EQFA 5HGJA 4XEUA 3ESZA 4B2PA 2IYUA 2A92A 3LBYA 5BPHA 5IBCA 1NI4B 3T0GA 3E1KA 4JJEA 4RLHA 1BXRA 1V8BA 3ETLA 3GRFA 5B1YA 2WWYA 4FFNA 4GU5A 4UE6A 4LJ5A 1E2UA 4YJHA 5G3YA 3P52A 5I9MA 4YX9A 2Z9DA 3QFCA 1M34E 4JA2A 4RHEA 4EWLA 1A5BB 1FS5A 2XDWA 4L4XA 1ZY2A 4O6VA 5HX7A 4PC6A 5ICCA 1F2TA 1QH0A 2FWRA 2VEDA 4FSXA 1JE0A 1Z4PX 1CJCA 4L1KA 1RR6A 4B4WA 3RU9A 2WQ7A 4MQBA 2W8BB 4LV5B 4EHHA 2AF4C 4I2VA 2OG2A 2OL4A 1G5RA 2PMKA 1KEEA 2IUSA 4LZAA 1SUWA 2HWKA 4HATA 3WA6A 4A8TA 3HPQA 1QVVA 2JF0A 2QYTA 1U2TA 5MGNA 2YRFA 3CEPB 4H17A 1CNEA 3L1KA 4LJ6A 1ZX1A 1TF7A 4A2QA 3MJTA 1P9RA 3VTFA 4B3BA 3WKDA 1PSDA 3FCOA 3OMLA 4NCKA 2QDKA 1GJRA 4HS4A 3THYB 2F8SA 3MGKA 4NYIQ 5LMUB 4HAOA 5C5DA 4NXMB 2HTFA 3P0HA 2DWCA 4NU0A 5EHQA 3IR6A 3BD6A 3SSNA 4L3WA 5A62A 3BFJA 3ETGA 5KTRA 1GNVA 2W2NA 2WD7A 4KX5A 1V16B 4FDMA 1W96A 3IBGA 1DAOA 3LT2A 3NBYC 3N2LA 5B1HA 1IVNA 2QRUA 2X58A 4MH0R 1LQ2A 2BISA 3BZBA 1G21E 1GZ3A 1RKBA 3E3NA 1DB3A 2FZKA 4J7UA 5KYTA 1ESCA 1T9KA 1L1QA 2HLPA 2I3AA 3B9BA 3H2HA 2Q3BA 2Y1LA 3GLFB 4JUFA 3I45A 1NW9B 3KHUA 4RTRA 4NZPA 1EVIA 2PWZA 2P1ZA 4HNSA 1R4ZA 5FL3A 2XUPA 4MVJG 5FTJA 3SF0A 1NE7A 3KSDO 1XKLA 2QMQA 3PXXA 4BWGA 4CLOA 3D54D 5CB4F 2FGKA 4W5OA 2NV0A 3R0VA 2CXRA 1KXZA 3KQTA 4WT7A 3AEUA 1CZUA 1KO5A 3A9UA 3JZMA 4KIJA 4M9SA 5D5PA 1TT7A 2I7VA 1T9HA 1RFLA 1N0VC 2OC4A 3WX0A 1PKXA 2ZRIA 2MINA 2LPMA 1UXHA 3I1JA 4MPRA 2IEBA 2Q2VA 2WZQA 4P8RA 2VZ8A 1JDJA 1SCKA 3IJEB 4G0PA 1TJUA 3UFXA 3SIPA 1RFGE 2D4HA 4CEJB 1ZH0A 2BC9A 3L6BA 5FO0A 1TMYA 4YV1A 3N1UA 4P2GA 3CF4A 2H57A 3OQOA 2YC4C 1YGPA 3KXKA 4I66A 1BFKA 3KZMA 4ZO9A 3G5TA 4EJSA 5CDFA 1GARA 1M2GA 4FW9A 4RFSA 1HMPA 4RHYA 3I39X 2BEJA 3K96A 5JD5A 5IAOA 1ACMA 2BKUA 2I80A 2J8ZA 3HUEA 5LYJA 3WNBA 4CGZA 5CG1A 2AX4A 3C2QA 5JAZA 3X44A 1ZH8A 4WOJA 1QRTA 1E61A 4RV4A 5A3VA 1FFGA 3O4RA 4ALIA 2OMEA 5TMDA 1GV1A 3IVXA 1DUIA 1TJPB 2YZ7A 3R6GA 5HDBB 4D02A 1J2TA 3ER6A 2I34A 3MJFA 4JJAA 4NMWA 4RH3A 5HKLA 1ECPA 2G9UA 4P0TA 3COZA 2B8EA 4XDGA 4CEHA 2X40A 1V3QE 4DWOA 4RSRA 3TTYA 3JQRA 4E4TA 3BS4A 1DO8A 1WS6A 1O57A 3EEQA 3GPIA 1U7XA 4M1ZA 4NCIA 2B8NA 1FFDA 1X7HA 2YIDA 3ECSA 3MT8A 4OQXA 5EJ4A 1M76A 1MT0A 4PLZA 1PBTA 4BNMA 1M9NA 1HQYE 2NUBA 2C2WA 2W6PA 5F35A 4GOND 3OZXA 4GUDA 3PGA1 1V1RB 1VSBA 1OBOA 1FP6A 1ZMRA 2E1RA 3B9RA 2GCPA 3KQMA 3PCRB 5IN5A 1N1DA 1V45E 2F3PA 5ECGC 3UHAA 3LL7A 4BZPA 1XJ5A 3V1LA 2YJ4A 4IGEA 4Q7LA 1XDBA 5EE1A 1AUPA 1KJNA 2I2CA <