1Z4IA

Structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with deoxyribouridine 5'-monophosphate
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
b'RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase
publication title Structural basis for substrate specificity of the human mitochondrial deoxyribonucleotidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 64
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1z4iA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4iA01
3U7FB 1YNSA 4YCLA 1L8LA 3AR3A 1X42A 3A3YA 1F5SA 5AKEA 3M1YA 2RAVA 5AKYA 5ALOA 5AVQA 1Z5GA 4EEKA 2ZXEA 1RQLA 2FEAA 2IOHA 2AGVA 1RC8A 2HX1A 1ZD3A 3ZI4A 3M9LA 1JUDA 2I34A 2OA0A 5AKIA 4ZEWA 4RESA 3L8HA 5AVRA 4UW9A 3FM9A 5AVTA 2HO4A 3L7YA 4YH1A 3OCZA 4CF4A 4NWIA 4UM5A 2G1AA 4NV0A 4XQ0A 2I55A 2YJ5A 4KX3A 4XOUA 3N07A 2OBBA 2ODAA 2FPUA 2I33A 2P69A 1ZJJA 2PR7A 4Y2RA 5AI0A 3IB6A 3WKDA 5ALYA 1ZOLA 2G09A 3R09A 5ALIA 5ALFA 3N8GA 4NABA 3TLMA 5ALUA 4I9FA 4C4SA 4EX6A 2HHLA 5AM0A 2B82A 3L0BA 2AUTA 4IG4A 2QLTA 2C9MA 2O2XA 2YBDA 2IYEA 2NYVA 3OCVA 1CQZA 2HF2A 4E88A 2R8XA 4IFTA 3P96A 3WGUA 1ZRMA 2EAUA 3MPOA 5AICA 3RFUA 3BA6A 1RLTA 2C4NA 4MUMA 3OPXA 1J97A 3OTQA 2I6XA 2I7DA 1Z4OA 3WK5A 1SWVA 1TJ4A 4CNQA 4JDPA 5AW1A 3ZTYA 5AW7A 3CZ4A 2FDRA 2RB5A 4BEWA 5AK5A 4HGQA 3AR8A 4BKMA 4KX5A 1Z4LA 4GIBA 2WF9A 2YMPA 5ALHA 5AW9A 3ZX4A 2HF7A 4YIKA 3EF0A 1YMQA 3QUBA 5AM1A 1QYIA 2W11A 2ZBEA 1XP5A 5AIBA 2VKQA 3U13A 4QQFA 3E58A 3A1EA 1Z4NA 1U2SA 4OCZA 1U02A 1L7PA 4XE5A 4EZEA 3QYPA 1CR6A 3WKEA 3CNHA 4BX3A 1RLMA 3ZW7A 4DFDA 2MU1A 5AW3A 4NFLA 1T5SA 4AS2A 5AI4A 4L6CA 1T5TA 2WF6A 4Y2PA 3MC1A 1RKVA 2ZBDA 1TE2A 4J2TA 2C8LA 4Y2YA 5ALGA 3AR7A 2JARA 5ALQA 5ALNA 2FPWA 3R9KA 1Z4IA 3WKBA 1Z4JA 4G63A 3WGVA 2G0AA 3SKXA 4RETA 5AK6A 3OCXA 4OD0A 3MMZA 5AK3A 5AVVA 3KBBA 3NAMA 3W5BA 2ZG6A 1SU4A 2CFTA 2EATA 3QNMA 3OCWA 3L8EA 3HYCA 1YS9A 3L8GA 5ALXA 3U7EB 2YJ4A 2WF7A 4H1WA 1QQ5A 3W5CA 2GHTA 2HSZA 3I28A 1T9ZA 1L7NA 3ZX5A 3FZQA 4BEVA 3AR2A 3IJ5A 2IA5A 4AS3A 5AW8A 5AW6A 3KC2A 3WK8A 3UM9A 2WHEA 3SKYA 4BBJA 3R4CA 2GFHA 3U7HB 1RRCA 1U7PA 1L7MA 4UMDA 5AM4A 2EARA 2BDUA 4BX0A 1RQNA 1RPZA 3AR4A 3L0YA 3MN1A 2B8EA 3PDWA 4YIHA 2HDOA 3NIWA 4Y2SA 2JGAA 3WK7A 2RARA 2B30A 1AQ6A 2JAUA 2I54A 1L7OA 3PCTA 2Q4TA 4HAIA 3SHQA 1MH9A 2JAOA 3QUTA 5AM2A 4JB3A 3UMCA 2WM8A 4YCNA 5AW4A 2B1RA 3ESQA 2FPXA 3WKAA 4AP9A 3L5KA 2Q5EA 5JJBA 2W43A 1RLOA 1RDFA 5ALPA 5AW2A 2YY6A 2P11A 3QUCA 1LVHA 4BNDB 4DWOA 5AKGA 1Z4QA 5AESA 3QX7A 3WK4A 2WF5A 5AVWA 5AVZA 3ED5A 5T41A 3ZWDA 2GHQA 4NAVA 5ALDA 2YJ3A 5AI8A 4ZEVA 4UMVA 3GYGA 3KD3A 5AI6A 3UMGA 1YV9A 2HOQA 4EX7A 2NO4A 2HEGA 5AKHA 3S6JA 4G9BA 3N1UA 4HGPA 3ZUPA 5AW5A 2HCFA 3I1YA 3U26A 5AKXA 1Z4KA 1TJ5A 1RMQA 4YCMA 5IT0A 4C4RA 1K1EA 1ZD5A 3RF6A 2YMMA 1LTQA 1J8DA 2CFRA 4FFDA 4DW8A 5AKZA 4BNDA 5AI9A 2FUEA 2OYCA 1XVIA 1KYTA 2QYHA 1S8OA 1PW5A 5ALEA 3B9BA 2G07A 4KYTA 4DCCA 4Y2QA 5AIAA 3SF0A 3ET5A 3I6BA 4L6AA 1ZD2P 2NO5A 3L0CA 4FE3A 3KDPA 4C4TA 1ZS9A 3IRUA 3SMVA 3HLTA 4HGOA 2GO7A 5AKJA 3QU9A 4Y2XA 5E0OA 1YJ5A 3UMBA 3OCYA 5FP0A 4I9GA 2FI1A 5ALMA 1VFPA 1O08A 2W4MA 4UATA 5AVXA 3VAYA 3ZWKA 3QU2A 5ALTA 2ZOSA 2X4DA 4ZEXA 2CFSA 5AKLA 1ZD4A 2R8ZA 4HGNA 3NRJA 4UU1A 2YFYA 2AH5A 1XPJA 4Y2TA 2B8JA 3A1DA 3QGMA 3QU7A 4Y2JA 3EWIA 3A1CA 3DNPA 3L8FA 2BDEA 1RMTA 4PNHA 1N8NA 5AVSA 1Z5UA 2C88A 2D2VA 3QXGA 4Y3UA 5AM5A 1RMYA 1N9KA 4KN8A 2FPSA 1QQ7A 2AMYA 3I76A 2WF8A 4HYTA 4UASA 5AVUA 2MSNA 5A3QA 1QQ6A 3PGLA 3E84A 3EF1A 4CF3A 2FUCA 3FPBA 1VJ5A 2OM6A 4UMFA 1WZCA 5ALLA 5ALZA 4UMEA 4F72A 3FGOA 4J03A 2G06A 2P27A 3F9RA 2PKEA 3B8EA 3SLRA 1L6RA 3NALA 4UM7A 5AHXA 3NUQA 3ZVNA 3J7TA 2B1QA 3ESRA 3N5KA 3QLEA 3NASA 4Y2VA 2YN4A 3OCUA 4GXTA 5ALWA 3KZXA 3PGVA 3FPSA 2O9JA 4HGRA 2PQ0A 1Q91A 2B0CA 5ALSA 3K1ZA 5ALVA 5IS2A 1RKQA 3NANA 1L8OA 4UAUA 2G08A 3KOOA 4OHFA 5IT4A 4L57A 1WVIA 1RKUA 3AR9A 1SWWA 4OFZA 2YMLA 3ONNA 3DDHA 4UU0A 5AK4A 3ZTWA 4EENA 1Z88A 5AKKA 5ALRA 5AM3A 3WKCA 3ET4A 2R8EA 5AVYA 1S2OA 2C8KA 3SD7A 1U2TA 3WK6A 3U7GA 2WFAA 2IOFK 2P9JA 3WK9A 3QUQA 3BWVA 1NRWA 2ZBFA 4UARA 3E8MA 3AR5A 2FPRA 2GMWA 2CN1A 2IOFA 1U7OA 3AR6A 1Q92A 1IWOA 5A3RA 4CF5A 2YMQA 4UAVA 1TJ3A 1NF2A 5ALJA 4FYPA 3L1UA 5A3SA 3EPRA 4O8CA 3ZVMA 2G80A 3B9RA 4QJBA 1EK1A 2ZBGA 1WR8A 1O03A 4Y2UA 4BYGA 4MWOA 4KNWA 2YJ6A 4YGYA 2RBKA 1TA0A 3U19A 1Z4MA 1WPGA 4XPZA 5ALKA 3ZU6A 3ZVLA 2R8YA 1FEZA 4BX2A 2Q4RA 4F71A 3QU5A 1NNLA 1ZRNA 3FVVA 3D6JA 4EELA 5AW0A 3E81A 2JAWA 3QU4A 1Y8AA 5AI5A 2DQSA 3DV9A 3W5DA 1VJRA 4CE6A 1Z4PX 1EK2A 3DAOA 3L1VA 4B6JA 1QH9A 2BY4A 3W5AA 4KNVA 2HI0A 1YDFA 3N28A
chains in the Genus database with same CATH superfamily
4EBBA 3R9XA 1BDJA 4MX8A 1VSQA 5DBGA 3N6VA 3VR2A 2Q2NA 1L8LA 1HDGO 3BGOS 3UJNA 5GZ6A 3OQPA 4JIMA 4HAYA 2O2HA 3U0VA 4ZOBA 1ZI8A 3NH6A 2ZJ6A 4P2GA 4WNAB 3K71B 1FFWA 1JEEA 3WO1A 3HZHA 5JY1A 4BIIA 2XAUA 3G5UA 3AIOA 1GG9A 2YZMA 1SBCA 1ML3A 3M9LA 4QASA 5C0OE 2Y1DA 2A0KA 2GM9A 4EG5A 3RU9A 1XQYA 2CBXA 4ZEWA 1RRFA 1XKLA 4B7ZA 1IHPA 2YRWA 1O6FA 3CLRC 3ENQA 2N1BA 4HQKA 2Z2XA 3A2MA 3V1YA 4ATNA 5LZ4A 4JGIA 3F5QA 1E5XA 1F5NA 1Q17A 1RI2A 1SIOA 3FLBA 4E21A 3JR3A 5FAKA 2YXDA 1R2QA 3B3FA 3VSAA 2OCIA 3DHVA 5ERGB 2D3TA 2OBLA 2OK8A 2RHGB 2EJUA 2XMBA 3MTJA 4YVFA 5IJ0B 1KTIA 3B82A 3ZDFA 3V42A 2P78A 4KX3A 4OKIA 3NDBB 4QJ5A 2VHVA 2B7BA 4AKTA 2NVBA 1H2RS 2IPMA 3KSZO 1PK8A 1XYYA 3ELDA 4JBWA 4C76A 1Y48E 3BRSA 3OIFA 1AIPA 1I10A 2WZCA 1ZGHA 2RHBA 3H3FA 4NESA 2ZR8A 1WQ3A 1I2CA 2I7TA 1PV2A 2QKYA 4KO3S 2ZE7A 2ONYA 4YUAA 4IUDS 1FUYB 3FPEA 4E5NA 3AVXA 3KQUA 2OV8A 4R3NA 5TGTA 1M7GA 4P3PA 1EK5A 2HBQA 3FY4A 1SOMA 3FAZA 1UJMA 4JCOA 3P71T 1VLVA 2PQ2A 1WXXA 4QULA 5LA6A 4E5MA 4FB5A 2RGNA 1G41A 1V47A 1Y9AA 4V2UA 3OOJA 3H2YA 4HX2A 4I6JA 1TIBA 4F91B 3HSSA 2FVXA 2HD4A 2LKDA 2C9MA 3FUTA 1MO2A 3PXEA 3FFXA 2O2XA 1DTWB 4AN0A 4MW7A 1D2GA 2ZTVA 2PXHA 4LHYA 1U0TA 5HF6A 2ZT8A 3BD8A 4FEYA 1F8XA 3RRZA 2HF2A 3KAPA 2VJPA 3UWPA 4GKVA 5F5LA 4D4LA 2GA8A 2HRCA 2X4LA 4RFSB 1MH1A 4FZ5A 3MPOA 3R8CA 3ZS9A 3B9QA 2ZUVA 5EIBD 6LDHA 3QF4A 2GF9A 2C7VA 3NHFA 1A04A 2WM9B 3L40A 3E53A 1SUIA 4U2FA 3R7BA 3S4YA 2WIDA 3S1LA 4GXQA 5BXQC 1RXEA 4EA7A 2V1UA 1PJRA 5CA1B 1OV6A 1MPXA 4TMWA 2RGXA 4ARZB 1RYZA 2EJCA 3VHRA 3ZWCA 2PR2A 4I1UA 1FBNA 3ML1A 2HF8A 4GKKB 1Z37A 4HSEA 1D9ZA 4L3OA 3CMMA 2ZR9A 3BH7A 4B79A 3H8JA 3AB7A 1U8YA 2RGBA 3PLNA 4ZCQA 3T5MA 4EATA 3TR0A 1BD3A 4QTXA 5C8YA 3V9AA 2O0HA 5B64A 1I2ZA 2E5FA 3VR1A 2EP8A 2VYNA 3P94A 2GBCA 1WVMA 2NXNA 1EFVB 1TRHA 2DZDA 3NM6B 3E9DA 2XNHA 2COEA 2ZYUX 3K0AA 4FHCA 2P4QA 4QC2A 3UQZA 4BS9A 2SECE 2JNWA 2XTZA 5DVZA 3KSBC 1W6UA 4F9GA 3G2PA 3G7NA 2CXSA 2H2FA 2KPOA 1RAAA 3HCPA 3LUCA 2I1QA 3IP6A 4D80A 1HDRA 5K0SA 4DV3B 4RHUA 3J7AC 3D3KA 2Z2IA 1O94D 3U13A 4UUOA 1TO6A 1DIBA 2WJZB 3CCCA 4L1KA 5CB0A 5KX5A 3HEAA 1JALA 4QPCA 5AXAA 2YBEA 3CFYA 2BC9A 3GRRA 1IEWA 2Z2ZA 1EZ1A 1OX5A 2HWUA 1PFYA 4MR9B 1DFGA 1QB7A 3BE8A 3SEZA 1OFGA 4HX9A 3LE8A 2J5KA 4O25A 3WKEA 1ZHHA 1CY1A 2O59A 1FCJA 1RBZA 3Q3IA 4MI9A 1ORWA 3DE0X 4MHOA 5LXTF 5TRTA 4WLNA 1F8UA 1FW8A 2RAPA 4L6CA 2UZ0A 3Q3JB 1IQ0A 2AQIA 3WIOA 1PJBA 2DHRA 1MQ8B 4Q21A 4JIGA 4Z7JA 2WUFA 3PVZA 4Z1OA 4X20A 2OAP1 2UU9B 3NJRA 2JARA 5G3YA 2X5KO 4PY2A 1X92A 4MVJD 3TRHA 4GXNA 5LNK1 1P17A 2H1IA 4IMJB 1FJGB 5TT1A 1GUAA 1GZ4A 1ZJ4A 3EISA 3F4BA 3D8BA 1E92A 5JMWA 1LB1B 2QUAA 3EQ6A 1Y6QA 2JB9A 3NHYA 2O2IA 3OZVA 3ABQB 2HRBA 5TB5A 3GPBA 3JZAA 5E1OA 3TLJA 1SUFA 5KNDD 4DMLA 4I1PA 2E5LB 2NAPA 3KYCB 1KRXA 5DM4A 3FSEA 5IKEA 3W5BA 1G5QA 1G60A 1DIOB 2Y1EA 5F77A 3RSOA 3CKYA 4RDIA 4MZDA 1HTTA 1B6TA 4PHCA 2YXNA 2HFKA 1TFUA 5JROA 1ZIOA 1TYBE 1RADA 2L82A 3AH8A 1GQOA 1XHEA 3IV7A 4NCAA 3QBPA 4PRKA 5ELMA 4H1WA 3V1TC 4KE7A 1SQ6A 3EWSA 4UNSA 3WB2A 1CW2B 3ASUA 2UYYA 4MZXA 5IK2A 5HZKA 4MS4B 4QHSA 2G0TA 4D0LB 4DMMA 4QUBA 2Q7DA 4CTKA 1RNLA 5K3BA 2PUTA 5EKTA 1XP8A 1E9CA 3BSFA 4RS3A 3IAEA 2FP3A 4C1BA 2OPHA 3U4DA 4F21A 5I7OA 5JQGF 2C8JA 4OQFA 5F2NA 5ADHA 2H1CA 4CXMA 1XD8A 2MTBA 4JOBA 1BGXT 1EU1A 4BVBA 3NIWA 3TINA 1EG2A 3ORHA 2RARA 2FZLA 3LC0A 3LWZA 4FJ2A 1E69A 2LD4A 3D1VA 1B76A 4J16A 2QPTA 4B9AA 3RV4A 4K1XA 4BVGA 4IGKA 4RIGA 1KEPA 2WVAA 4Z9AA 3HKEA 4K6MA 4R1LA 1I30A 5D1NA 3RUAA 1DJOA 5HTOA 3OPYB 4DYDA 1OX6A 2NW6A 2QMZA 4OG2A 2PCJA 3WLNA 2CYAA 4RTPA 2AJTA 5CLIA 2DWPA 1KRHA 2X9LA 3BB1A 2PYZA 1B00A 2VHWA 2JFOA 3DMPA 3IEIA 3RFFA 4F60A 4LYFA 4RSMA 3LC7O 3WWOA 1ZQ9A 5H59A 3CR7A 3A6GA 3IQFA 3SSMA 1FMLA 4D8XA 2EGUA 3OQJA 4BUZA 5JYBA 4BNVA 4NFYA 3QUCA 1N9GB 1QRAA 3K3PA 2B8TA 2QV7A 4G3XA 5KWSA 3FOAA 1BVUA 3C45A 1PGJA 3DULA 3WIBA 5JG7A 4A6XA 4E2XA 4Q0MA 2A35A 3T5GA 3RTEA 4BQRA 1JU3A 3QELA 4K9OA 4TMXA 3CCFA 1EGMB 4D02A 2GHQA 5DULA 1AK1A 3Q10A 5FTWA 2RG7A 3SPXA 3FR7A 3T3IA 1G3UA 1VMAA 5AI8A 2NO6A 5EC8A 1Q57A 4AZ0A 4ZV4A 3EOBI 4LZNA 4MKFA 5HOEA 3IQIX 3P9ZA 4J7AA 3AQ4A 5DCYA 5ILQA 1KEWA 3RVBA 4D9HA 2WICA 1O7JA 2Z3WA 3GEGA 5AUQA 1OX4A 1Y3CE 1X7WB 1XSEA 5CDSA 1AUOA 2GGSA 4HMOA 4HGPA 4WE3A 1A2OA 1FFGA 4ABTA 3MB5A 2J5XA 3U7RA 4E08A 4AX4A 4EA6A 3FD8A 4Y1GA 5HMMA 3RRXA 3IP8A 1N0WA 2FSVA 2XA9A 4FU0A 1Z06A 4E3WA 4YRKA 4GWLA 4RKRA 4ZQIA 4W1SA 5C8ZA 2GXAA 1CZNA 2YMMA 5M2QA 3O8OA 3ZCTA 4D57A 3VO8A 2BD0A 2B61A 1V4NA 3FYUB 4DLUA 4FXOA 1FTYA 2AJ8A 3B2EA 3FUWA 5GOTA 1IY1A 4LE0A 1WSAA 5KOJB 1CJSA 1KI9A 5KMGB 3L4EA 3DEHA 2HPAA 1EFCA 1ZCFA 2ID4A 3DHWC 3GEHA 4F3CA 2Q3FA 4G5HA 4RY8A 1EGAA 4A0SA 1P7VA 4YJFA 4YECA 3EXHB 4QNMA 5EP4A 1TUBB 5HYVA 2XECA 2FMXA 3QE2A 1MV8A 8MHTA 2OORC 3N87A 2YQ4A 4U0KA 5J2UF 2ZP1A 2WTXA 5IULC 4U1RA 4HGYA 3AMVA 3ZWOA 4Q9NA 4X0EA 2P6NA 3E61A 3L9WA 3RQIA 3TE7A 3OQOA 3SQLA 1WF6A 4EJFA 1CY2A 3DMYA 4BQPA 2XNDD 1TMOA 1DC6A 4R2JA 5HW0A 1IY0A 4LQDA 3CNBA 1AZWA 2KI5A 5JTUA 4P1ZA 4JOCA 5BRAA 2Z2JA 4F9EA 2VA8A 5LMZA 1TDJA 1QDLB 1ZJZA 4I9GA 1E61A 5B1DA 1GYRA 4A0QA 1KYXA 4S2EA 1X7ZA 1JTFA 2XTAA 4GI2A 1B0UA 4GECA 4E2ZA 1T0JB 3QXXA 1IB6A 3DVRX 2MSDB 4P9NA 3O2NA 4AXBA 3U3JA 5LLTA 3HCNA 4DR1B 2YWRA 2W0MA 3DHYA 3MJDA 4JL5A 1MX5A 3PKIA 4XM2A 2RD2A 3AXSA 4BGUA 1PKXA 4DNXA 2WHYA 4G36A 2JFXA 3MUOA 2B25A 2JJYA 3B7WA 4IS3A 1ZM2A 4DBVO 3QGMA 2JG3A 4OHKA 4G89A 3L4BC 2EDCA 4FSHA 2ZUWA 1TMGE 3HJRA 4WQMA 1SK8A 4IIJF 3M2PA 2C88A 3D0OA 4QM6A 2NU7B 3QXGA 4ZVRA 3TPZA 5HZHA 5K8VA 4WN3A 2V59A 4MEAA 5L53A 4MP8A 4Q4JA 3W8EA 2GAAA 2XMQA 3Q72A 4EPXA 4JLAA 3R1IA 1INLA 2EL9A 5NULA 3ISJA 5C37A 1URPA 1RZ3A 5LKAA 1IN6A 4CM3A 1F12A 1H5QA 5K3OA 3DXZA 3ESXA 4DDWA 1MVNA 3EF3A 4DRZA 4BO5A 1N5MA 1JECA 1ZXLA 2HBRA 2VRWA 3ES9A 1IJEA 3FDFA 3TTUA 1CV2A 4DQDA 5U9CA 3OE7A 1KK3A 3OP4A 3FPBA 3D4NA 3PPYA 3QUAA 1OAOA 2Q41A 1R0BA 2OZLA 1CRZA 4XLLA 4FR2A 5A02A 3MS4A 1YCFA 4X6UA 1SG9A 1F2TA 1R15A 3PPVA 3FGOA 3C7DB 4UMEA 2G1JA 3ROFA 2R68A 2ATXA 1LI4A 1YKGA 2VF2A 4IIFA 4B85A 1GYQA 5K8TA 3TECE 5AJHA 1EFDN 4ID9A 4ZI2A 1XMXA 2CJWB 4D79A 4DV1B 1VIDA 1QG0A 5JS6A 1YIAA 1Z0ZA 2GN2A 1T2DA 2C96A 3NUGA 4IVQA 2XKJE 3ASVA 4WY8A 3IHWA 4ZI7A 3A6DA 3CVUA 3OY7A 3NYQA 4JBGA 1ZRHA 3WLQA 3WQQA 1CFJA 1GSIA 2Q2WA 2O9JA 2QSUA 2Q5CA 4GU5A 4HGRA 2R1VB 2BEVB 4JVMA 2II6A 4L16A 1XFDA 1BDIA 5ALVA 2JLWA 5HF9A 3PC3A 1BEZA 3TM5A 4WBSA 4ZT3A 4UEWA 5BO5A 4TLMB 3RIGA 4D45A 4I19A 5EZ6B 1XTVA 2FPLA 1VL2A 1R12A 2QM0A 3ESYA 4JGBA 1U9ZA 5DX8A 2ZRGA 3VO9A 3ZV3A 1EFLA 3LU1A 1B8PA 2DPMA 1NXSA 1L2TA 5K4HA 2BHTA 3FOBA 5DNYB 1KU0A 3C87A 1EK6A 3ZHYA 3JAKA 5DRTA 1P0IA 4FVTA 2GAJA 1ORVA 1SKQA 1T3LA 2BEWB 3BGWA 3QNUA 4MARA 1DQNA 1XMVA 2B5WA 3I34X 4R71A 2NVOA 5EJAA 2RH5A 4JU9A 5B1HA 4AULA 2X0DA 3GFGA 5JPIA 3KG2A 3TLXA 2QMHA 4IHQA 4MIEA 4Y0NA 2WFAA 5JCOC 3K92A 2D13A 4PSCA 3C5WP 1SOAA 4B3IA 5KSZA 2UXCB 1QG2A 2DVMA 4YRAA 4ZJUA 1RZRA 2Q50A 1XTPA 4KXXA 2XWQA 4B6OA 1C7JA 1D1TA 4BFVA 1SELA 2FZWA 4D3ZA 2IXFA 2Q3JA 4N8SA 1DJNA 3MOGA 5MF6A 1L5MA 2BMEA 2FPRA 3RK4A 2O0MA 1P44A 4NENA 4EQ6A 1ZIPA 4A10A 3GLHE 3NWJA 1XZJA 3PR2B 4MYTA 1R8XA 3CC8A 4G07A 5CYPA 4A2CA 4CLOB 4H3VA 3E9ZA 2B1IA 2C1XA 3KXIA 4PCLA 3TVYA 2ZRDA 2IJGX 1LPAB 1QRUA 1QOPB 4CIYA 3KTFA 3N2GA 2R4UA 2XYRA 4TVKA 3CINA 3ORSA 4P7GA 5FI3A 5FOVA 5CLFA 2R6AA 3FFTA 2O05A 5KAPA 2NSJA 2Z4TA 3N9IA 3R7NA 5A5DA 3E35A 3E7DA 5FPYA 2G4LA 4HWGA 4WCFC 1NT4A 4BPBA 4W7SA 2PUWA 3IQHX 3MGKA 2FXVA 4EPRA 1O5TA 1Z4MA 1WPGA 3OFNA 4XPZA 3IO5A 3BX1A 1T9KA 4KAJA 1HYBA 1XAGA 1H2WA 2A59A 4EELA 2JIBA 5F21A 2C00A 4PSUA 4AUNA 2IXBA 4MROA 1OBOA 1QGUA 2QTNA 4D7AA 2DQSA 3I9V1 4F9TA 3GZHA 5GONA 2BFAA 5HA5A 1HGXA 1YO6A 1WETA 1U9CA 1XOIA 1GPH1 4K9MA 1PW7A 5EIOA 2I3ZA 4RCVA 3L43A 3RLFA 1Z22A 2VPTA 3OG9A 1F7VA 4L5AA 2J9RA 3EXAA 4IIVA 1ZIXA 1G7TA 5CNKA 4O4IA 5DYYA 4V0KA 1XV5A 3W78A 1BDHA 4LTDA 1RS0A 2RBEA 1XTRA 1TPZA 2GBIA 5L6LB 4B31A 3PTAA 3MUEA 1FP1D 1UBOS 1MNAA 1V0JA 2YVQA 4HRXA 3AF2A 2XUJA 5A4DA 2NZ2A 2BJWA 3RUIA 1RBYA 4RK6A 1TLLA 1NJFA 4AY5A 4ZOAA 4EEKA 5G0VA 1ZOIA 3ELBA 3KETA 3UJAA 5EXTA 1SCDA 1V1RA 2IXDA 4OU4A 4UUMA 3H5OA 3HXKA 4L85A 2R8RA 1PDWA 1KK0A 4ZK2A 5CCBA 2WTAA 3GT3A 2I87A 3EPKA 1PTJC 2LE0A 3AG6A 3OTIA 4NHOA 3OU6A 5C4GB 4Q9AA 1J5XA 3V1NA 1ECPA 2AN4A 2YNMD 3L7YA 4LHSA 5IC6A 3GZJA 3V1UA 3PHHA 3AI2A 4YAEA 1K6MA 4BB0A 5DXFA 1SZCA 4TZ6A 4OJQA 4YHHB 3BE6A 4IQ8A 4ZO9A 3SIWA 1KQGA 3BAFA 1NWCA 1U98A 1Z8FA 1KQ3A 2G70A 4XASA 2AG5A 2ODAA 2PT6A 3Q12A 4Y7CA 1Z8DA 5H7XA 1Q16A 3LKVA 2COKA 1ZJJA 2PR7A 3JATA 1UMKA 3V2IA 1HQYE 5AI0A 3HXQA 1WLYA 4HFNA 3VYTB 3GUYA 4C4OA 3ZI0A 1M8FA 1TZBA 1YVEI 3KL4A 1KQ7A 2SBTA 2ZANA 3N8GA 3E3NA 4M9RA 3JZMA 3F9IA 3NHKA 4TTQA 4G5FA 1NI5A 1B6SA 2QG6A 2B82A 1BAPA 2QYSA 4F4IA 1Z0FA 3PT5A 4QFBA 4Z7OB 2HEIA 4MB2A 4LF4B 2ZJ7A 3IJRA 1EG7A 4L72A 2PK3A 1ODFA 5J1SB 3RFCA 3U37A 2VEDA 2UYHA 1KAEA 1AXRA 2QMQA 4GPEA 1GTSA 3FWZA 3HK2A 3HADA 1K0UA 1QUEA 2QI9F 1OZHA 3W2FA 1FSFA 1Q11A 2IYFA 4ARSA 4MGYR 2BKLA 1K6EA 4MO9A 3WV5A 5AICA 1ONSA 3NEPX 3DL2A 1MQAA 3EZNA 3UTCA 1J97A 2VCHA 5C52B 3ED1A 4OB7A 1EVLA 4BRZA 4QYIB 1UOEA 3BUSA 2OE2A 1Y8CA 2OFFA 2OY0A 16PKA 1EZ4A 2I2AA 4B83A 4K40A 2G6TA 1XDUA 3GPCA 1EX9A 1FNSA 2XQKA 3M70A 4RCYA 5EQJB 2O3JA 3RBAA 4NJEA 3S55A 3SLGA 3WTCA 4TQAA 2XVXA 2ZWVA 2ZB4A 4R2MA 1U2ZA 2OXEA 3QKSA 1VB3A 2VP9A 2C9CA 5I3CA 4MYCA 1W76A 5FNVF 1J2TA 4MS1A 4DZTA 4GLJA 1XB2A 3QLVA 1EFKA 2O20A 5FPKA 3I1JA 3I9JA 1IJBA 2AG6A 4O2AA 3ORFA 3D3JA 4IJWA 4XSVA 4FKBA 2GO1A 2F64A 3I8OA 2Q9AA 2BP7B 3HDVA 5BVHB 2OBMA 2R4TA 1V3UA 3F6EX 3SICE 2IE0A 3K0FA 3RTBA 2B6HA 1XPOA 4MAAA 1NFRA 3DFKA 2AHRA 3KPUA 2H3EA 3IULA 3V8PA 2EW1A 3QYAA 2O5CA 4MTLA 4YP1A 1HSZA 3T5PA 4D92A 2JD0A 2VUHB 3SFZA 4EZEA 5M04A 1YBAA 3MCZA 5A9TA 1NP3A 2FX3A 2P9EA 4PZUA 3MWLA 1WHTA 3CNHA 1KO1A 1ATZA 3DAHA 4L15A 4MYUA 3RT7A 3ZW7A 4E5KA 3VKGA 4KQWA 5AW3A 1H2AS 2BAGA 4EG4A 4WLEA 3B5JA 1T5TA 1A4XA 3ONDA 2J4CA 2IV3A 1C3VA 3KB8A 3N3BC 1KF0A 1TCCA 2XYQA 2PL9A 1RPAA 4J2TA 4M87A 3IJPA 3FF4A 3AY7A 3LT5A 1PFGA 1I01A 3R9KA 3GVHA 2O4UX 4K46A 1Z4JA 4UHFA 5I8ZA 1TA9A 2LUOA 3PDHA 4TS3A 4D4KA 1A82A 1SUEA 2WABA 1JQJC 4LAFA 1NVXQ 2E4UA 3QXSA 2QJRA 3VR4D 2H4ZA 5LB4A 4M1KA 4RWZA 4LDJA 1UP4A 3L9XA 1KDTA 1Q1ZA 4QUJA 4ZVKA 3D4BA 2XB2A 2XCIA 4GPD1 4TTVA 1G7CA 2D1RA 2VP6A 3KP1A 1JW9B 5FT9A 3IP9A 3NAMA 2X0FA 1YS1X 2OGTA 5CIYA 1SKBA 1I4TD 4NF2A 2P4HX 4XGKA 1M2VA 4M7RA 4J1TA 4I50F 1P0FA 1FXWF 5EE3A 4S1OA 1J24A 2JS7A 1IQUA 3AXTA 1QQ5A 2REQB 1FUPA 2GHTA 2CVFA 3JD1A 4KDEA 1YULA 3ONWA 3ZVRA 3FOFC 2P8SA 2G17A 4OA5A 2YY5A 1NVBA 1PP4A 3CE6A 1FZQA 4IDBA 1X1BA 4JR2A 1E18A 4JUFA 1NP7A 3VPDA 2REOA 2IC5A 3DYBA 2Y1LA 2PUDA 5JAHA 3B6KA 3EGCA 1P39A 2MMCA 3OPNA 1AUVA 4P31A 4WDRA 3FWYA 3UH1A 2UUOA 2IUTA 3CO0S 4UMDA 3DCYA 4QDKA 4RM3A 3IBCA 4RVUA 2YWHA 4AKEA 4CM7A 1W8DA 5EIXA 2GKSA 1DV2A 5LXTB 4UQOA 5ER9A 4DV2B 1A7JA 1XNJA 3V4LA 4AXXA 3IYLW 1K8RA 3MUNA 5BMVB 3EC1A 3BILA 4FGLA 4UPDA 5HJEA 1ESZA 2VEOA 3O31A 4ND5A 4Y2SA 4AZVA 3QEMA 3DVAB 3PGA1 3Q9UA 3ROEA 4DDHA 2PY6A 2VRNA 4BQFA 4ENPA 1KP9A 2J0VA 2JBAB 2C5BA 4CIXA 5CD9A 3UV6A 1XZEA 4W63A 2HQRA 3FNRA 3PNMA 3HL4A 5EXPA 3VHXA 2PS9A 3EW7A 1PJLA 3GEEA 1E4OA 4I1RA 1LUAA 4H1VA 1P5RA 4HYYA 3FI0A 1T2UA 4M0CA 1E63A 2O23A 5AW4A 1A7UA 3ESQA 3P9CA 3VPFA 2UDPA 2IEAA 2DGDA 3LX4A 1SC1A 3P97A 2CNWA 2VPIA 1ULTA 4MVJG 1QIJA 5T4HA 2PMFA 1J09A 3VDQA 3JQRA 3EARA 4DQ0A 1W1WA 3FIUA 3MCWA 3UFXB 2ZRCA 4BL5A 4HZGA 3PFNA 5JEDA 5BW4A 3IOCA 4I4TA 1EH5A 3N8IA 1XLVA 2NU6B 3THXB 4TL8A 3FLEA 1QVWA 1Y4AE 4Q9IA 2D0PB 3L84A 3U62A 1TZJA 4M8SA 4PGAA 2QRMA 2DP4E 2NPIA 3DBVO 2PWZA 3BFPA 3NTRA 4UMVA 2Q3DA 1NQWA 4WWHA 1E1CB 3AI1A 1XU7A 3LM8A 3EJ6A 5T4EA 4BC1A 3CF2A 5T6MA 4CG3A 1V96A 5DBOA 5LC1A 1HFJA 1YGYA 3DKRA 1N25A 3AF3A 3DFFA 1GQ2A 4CV3A 3RUHA 3OEHA 1ZSNA 4JOSA 7REQA 3RSZA 1Q84A 4IV8A 4ZQCB 1NXXA 3WSVA 4OLFA 1FYDA 4FYIA 5B58C 5LLDA 3DOHA 3EG9A 5HG0A 2ABWA 1N2BA 1DBWA 4G81A 2FTKE 3DONA 4KJZA 3UXHA 5I4IA 4KCGA 2PSFA 4M8IA 1ZUD1 4WZBB 3MWEB 4RF3A 1YTUA 4REOA 5BWBA 1HRDA 1LGYA 2P1ZA 2XCRB 1U11A 4JB2A 2HQSA 2XEXA 1H1LA 1CUFA 1WZIA 2X8JA 5DNWA 4YLYA 1I36A 2YHSA 4G2TA 1CUUA 1TD9A 2XYVA 1FL9A 3AEUB 1Y8RA 4MW2A 3U3RA 3V7WA 3EPPA 1CJKC 4CN9A 2IUSA 1QP8A 4EI9A 3NJ8A 3N8HA 5JNRA 2PX5A 1DZIA 2HIHA 4DS3A 4W5RA 4IP0A 3LQYA 4E07A 4WFQA 3MINB 3DLCA 4J1QA 4P98A 3LX5A 4DLPA 4NJOA 3R23A 3NBZC 4YXFA 3U1BA 2PMKA 3U09A 3WIUA 1HFKA 4MRMA 4Y30A 4LPSA 4GEGA 3TH5A 3AVWA 2PO7A 1NM5C 3KRTA 4F12A 2XGMA 1CRLA 2EZTA 2Q4DA 2QD4A 5H5JA 3WBJA 4D97A 1CLUA 1FIUA 2WA2A 3SYRA 2KBFA 1JU4A 4E4YA 1IMJA 1LPNA 4D3DA 1USVA 3OURA 4IINA 2BFFA 3PE6A 3BTOA 4EA8A 2IYXA 2ALJA 4GKBA 1Y3IA 3UBTA 3O73A 1UJ5A 4RH3A 1K7YA 4QBHA 1RABA 2EL7A 2WW8A 3CXRA 3IT3A 4RK5A 3HGMA 1O5IA 1Z2PX 4IJKA 4ZO7A 4B46A 2ZOSA 1E6UA 3H5TA 4G65A 2DQYA 3WLJA 1Y63A 3D6FA 4ESEA 3PQ2A 1EAMA 2QRGA 1NL3A 2ZSAA 1D2RA 1NXOA 1OXXK 1GFZA 3BTUA 4OHPA 3IEUA 3REQB 1MRZA 4L5YA 3WL8A 1XALA 3ND8A 1ICIA 1H0HA 3A1CA 2BDEA 1TC2A 4WFIA 1JH8A 4OQMA 3R3UA 5ECGC 5KBYA 2XGSA 3AGQA 5CVTA 4EM6A 2Y1GA 2GWHA 3DMNA 4BAUA 4C0KA 5F4BA 5JADA 4XIYA 1KORA 3HKBA 4DDKA 1XTJA 1S8NA 1DWOA 3I2IA 4Q1DA 1N8TA 1WPRA 1DKMA 2I03A 2PX3A 4N4AA 1TAGA 3X44A 4EKNB 1EFTA 4LF8B 4NSNA 2AKEA 4LXIA 5FOWA 1TCUA 4URVR 4LX8A 3BD9A 1O9HA 2G9RA 1YQTA 3LP8A 1H9CA 2DLDA 3QWAA 1DKPA 1THTA 1Z3CA 2FWNA 3PUWA 1EFAA 1G98A 2CV1A 5JBIA 1BHJA 3W05A 2QLFA 4ZVQA 2AEMA 4F3NA 1TYZA 3B8EA 4GLFA 1U7WA 3SLRA 1FB5A 5FI1B 2B34A 1GTG1 1NKVA 5AOAA 3SDBA 3WLKX 1E0AA 3O94A 2VRBA 2PGAA 4GX5A 4ER7A 3L79A 4ND4A 3BD6A 2O7RA 2VDWA 3CV3A 2BH9A 3QVXA 4Q4HA 1J39A 4F5WA 4PX5A 5BN3B 2LNDA 3ETNA 1I6KA 4M76B 3SC6A 4CKYA 5DSTA 2BH2A 3CH7A 4TM8A 4OQPA 4NBNA 3L7CA 2AE2A 2WBLC 1DBRA 3COVA 3KTAA 4ZVOA 3C3YA 3WI7A 4DC1A 3CSSA 2E85A 1W0JD 3O8NA 3MUFA 3PGJA 3ZY2A 1CF4A 1W29A 1LPBB 3HU5A 1UPFA 1WBJB 1ZC4A 3K1ZA 5JC8A 3DF7A 4N8DA 2PL3A 4RGYA 2XOEA 4Z7QB 1E7YA 1I5OA 2Q8QA 4PLPA 3DEIA 1Z25A 4FZRA 4WOCA 4XIFA 5IMBA 4HDRA 1AKUA 2HNKA 1JIJA 5K20A 4HXYA 3SBOA 3NO9A 1FSZA 3WWPA 4BMNA 3H6KA 5EP2A 5FADA 5GONF 4M9XA 3GDOA 3A05A 4UU0A 5JH7A 5KJ6A 1GKYA 5K8CA 5JAMA 2ON6A 3M6UA 5DX0A 3GC6A 4HC4A 5D51S 4YGXB 5FEUA 3QOYA 4R41A 5IVIA 4V0RA 3BFVA 1LW6E 5KQLA 3KYDA 5K0GA 1E3JA 1VGRA 1CD5A 5D86A 1EX6A 1IG3A 2Y77A 1JSCA 1VPEA 3ZU4A 2BUAA 5E1MA 1IG0A 2YVAA 3KKZA 2OSBA 2BCJQ 4L50A 4Q82A 421PA 1GDTA 2YVUA 3BRWA 4KWHA 1H0RA 3V4FA 3M0EA 2WVJA 3MJTA 4JQCA 4JI6B 4G5RA 1T4CB 5B36A 4JNCA 1XLWA 5A6SB 3PFKA 5JXJA 1QX3A 3ECCA 5IC5A 4ZTUB 4K9NA 3N0VA 3QTLA 3RYHB 1PZFA 1IZYA 3PD1A 1K88A 1TT5A 2WJ3A 5ITZA 5C51B 1MOPA 3TSCA 3R9WA 3W6UA 2HK9A 2HGZA 3CN9A 3OD5A 4OKSA 4E14A 3UG6A 1FFCA 3DFZA 3OQ1A 2R8BA 2NNLD 2FEWB 3A1NA 2GX6A 1QS0B 1YNOA 4M86A 4QXOA 4ESHA 4F7DA 2VDQB 1CP2A 3GAZA 4ZTZB 1ZG3A 3A25A 2OGZA 3AY0A 3FRJA 5KNLA 2GD0A 5KKNB 3NFRA 3Q8WA 4DGSA 3EXG1 1FRQA 3T4XA 2ZBGA 3Q4GA 1FLVA 3TI9A 1GQRA 1D2HA 2WJYA 3DDSA 3MMPA 4CEHB 4YCSA 1YQEA 2GBFA 4H7KA 4QFDA 1EEHA 4Z2YA 3DEJA 4E0BA 1TA0A 4N6OA 2X5JO 2YHIA 4MV7A 5C32A 4Y6PA 4FR0A 1W6RA 1DC5A 4B75A 1G0NA 3PE4A 2QNBA 1MTOA 3QU5A 3C2QA 1ONOA 3L6EA 1J8MF 1ZRNA 2W6JD 3BXZA 3D6JA 1IJKA 1PUXA 1E8MA 1Q0ZA 3FVVA 3LQFA 4ZOEA 4FNMA 4ZYLA 1UBUS 7MDHA 1T0UA 1NVTA 2QGFA 1FXSA 2BFBA 3B3QA 4ENRA 1WIWA 3L3BA 1NASA 5AUPB 3TV2A 3NG1A 2GYUA 2I4NA 2Z2YA 1MVOA 3TSZA 4ALLA 2FRDA 1G21E 5D1HA 3ZZ0A 3GCWA 5KCZA 3NWOA 2YZGA 5LP6C 2XUKA 1E1MA 3L6CA 3A9SA 1OU0A 5FV4A 4LRXA 4BXOA 4BTVA 1C4XA 1GUZA 2QDXA 5CT9A 4ZZ1A 1UM9B 1Z6PA 2JKZA 5AJZA 1YNSA 2XQGA 2BM9A 3CF0A 2XMSA 2EOAA 2NU9A 3IGFA 4HLUA 1X42A 4RZXA 4DLSA 1JAXA 3IIKA 3FPJA 2ZUTA 2H4HA 1N6PA 9ABPA 5IAOA 4XWTA 2VUIB 3K6RA 2IH4A 2TMYA 1NAHA 3C1OA 3ZLVA 3E6AA 3G8AA 1QHSA 3DM9B 2GM4A 4L8YA 1FE8A 4W6ZA 1OJ7A 5LIPA 2HX1A 1PEAA 2FMFA 3GF4A 3Q0EA 4GD3Q 4OHWA 2PQ6A 3F4KA 2P5UA 3ICVA 5DRYA 2R2GA 4RZHA 4PXSA 3K5HA 1GUDA 1Z6QA 2JJQA 3VMFA 5L7WA 4ASUD 3O4HA 2IKSA 2P3OA 3KWJA 2ZJ8A 3FUUA 2V65A 5LB2A 2CJFA 4BE7B 5CNJA 5K6AC 4Z53A 4RD2A 2BWJA 2I55A 3LL7A 4YAWA 3RVQA 3WS7A 1TD1A 2WQZA 5JEEA 4LKOA 3FROA 3K4HA 1VPLA 4FGSA 5LJIA 1GUFA 5CEFA 1EWKA 1WCIB 2A6PA 5HQTA 1AB5A 2JATA 5JXWA 2GVNA 1YR1A 4MULA 3VPGA 3H84A 4N18A 1Q0QA 2QYTA 3D3EA 3I9NA 5A05A 4MCHA 4FFVA 4RD0A 4XFDA 2H52A 3OM9A 2OHHA 3Q7IA 1J5PA 1JFTA 2AJLI 3CEHA 4C0SA 5JD6A 1VYVA 5LVAA 3DMHA 1R6VA 3TR6A 4RDXA 5B4UA 1DDIA 4JP3A 2KBEA 4BJ6A 5ALUA 1L5HA 5EY5B 4UNPA 4EX6A 2JFQA 3ESZA 5EUMA 2GVDC 2QVLA 4XD7D 1K27A 1KOFA 3HP4A 1G20A 1GRQA 3QLUA 5CJ2A 3OLCX 1M3SA 1DCNA 1OVMA 3RSGA 2VTEA 1H94A 1RC0A 5LQCA 3V80A 3ST7A 4HMPA 4WECA 3TKLA 5KTYA 3A3NA 1UKCA 1L5QA 3JD2A 5BSTA 2D0IA 1CFZA 4CMGA 1JQEA 5FA5A 1F38A 1W73A 4FOSA 1K7FB 1ZICA 1W88A 3F49S 4B6FA 5H4GA 3K9WA 3R41A 4RHEA 1FA9A 1KEZA 1F6DA 2WAMA 1GTZA 4H9GA 5FTKA 5K6RA 1SBHA 3WMEA 2IZ6A 3R7WA 2GA9A 1HL3A 2X1LA 4WUTA 1SWVA 3JALA 5JXHA 1TJ4A 3IC5A 5DGHA 3AUYA 5AW1A 1J6UA 1JHZA 4MQFA 5T8KA 2RHWA 3V4PB 5AVJA 4P08A 4ZQGA 2OEPA 4H4EA 4N6GA 5AK5A 4CMCA 2JBWA 4W5TA 3LRXA 3VBEA 4DJEC 4FQ7A 2HY7A 1YA6A 4G01B 4GIBA 5JISA 2C82A 2CE7A 4XUEA 4R69A 4B33A 1EPUA 2HQOA 1NXTA 1LK5A 4DLVA 4DTCA 2KYRA 1L4HA 3W8NA 1OWOA 4ZQFA 1B8NA 2IU6A 3G68A 4JI1B 3V8QA 3ZG6A 3KZKA 3L18A 4LJLA 3IR6A 2VYVD 3AO0B 2C04A 3UJDA 3H65A 2J08A 4QO7A 1RVDA 3MQFA 1XHLA 4ENSA 2E0IA 1Z6YA 5TXGA 1U5CA 3NHAA 3H3XA 5H4HA 5K8IA 3ICOA 2XIJA 3TIIA 1ETHA 2Z8YM 3P32A 3KD2A 4KWEA 3FPLA 4PINA 1II8B 2CXXA 2OUKA 3NHJA 4RH1A 1U8EA 4QDZA 5H02A 4O33A 2ODQA 2QMYA 4R98A 5B3LA 3E70C 3GFFA 4LC9A 5U1PA 2ATVA 4ARAA 4ZYWA 1YXMA 4FMBB 4CI0B 4BX3A 4DFDA 3KR9A 5TDHA 3UC9A 4EGFA 4U7GA 1JVNA 3H8SA 1ZSYA 5ERYA 3UJCA 3EBPA 5HBGA 3TLGB 1UWKA 2V55B 4CMIB 6PFKA 3D5EA 4KAXA 2FPPB 5EJGA 1G6OA 1Y5IA 3IODA 3IFSA 1W4CA 4KIWA 4OBEA 4KTVE 2AOUA 4LBWA 1VI2A 3HZOA 3H4IA 4AURA 1PSDA 1X1TA 2JJMA 4IAOA 1NG1A 1QHFA 4YP0A 2UYGA 2ZWPA 5EPOA 1G3MA 3T0IA 2FW6A 2VSYA 1DC3A 1JDBC 2PA3A 1F20A 3ZIAD 1E77A 1I6MA 1M6VB 1ISGA 2VK4A 3A4TA 4C6RA 2Q0QA 5MDHA 2WNSA 1XN4A 4EYOA 4HT3B 2BGMA 2OGUA 3PC4A 4F0JA 4EITA 2PTQA 2DH5A 3C6YA 3KQKA 1XRQA 3L4JA 1AXGA 1N5DA 1JEYA 1Z47A 1C1DB 2PGJA 1ZINA 5LD2B 3WGKA 1UQTA 2QSZA 5JWOA 4CUZA 1J0CA 5EJ8A 2GEDA 4DB2A 5JCJD 1M6NA 5T4FA 4XRRA 1F7UA 3TPFA 2XB4A 2PWAA 5DJ5A 5ALXA 5EMHA 3SZ3A 1CUZA 3DQPA 2JH9A 3AOGA 4HS9A 1U5BB 2DG2A 2XYGA 3WY9A 2G7MC 1QK5A 2WT9A 1HE1C 2P9CA 4OJTA 1QYCA 4YJ3F 5K0FA 1UAYA 3RK0A 3F73A 3OFJA 4PHHA 2QE7A 2VTDA 4CF7A 1X38A 2XQFA 4CKCA 4OGLA 4DEYA 2GN1A 1SG6A 1XEWY 4X64B 2VHYA 3A6HA 1QRDA 2YYYA 4Q9KA 4BLOA 4RORA 3GFVA 1N92A 2FUNB 4J7CA 3K94A 2AL7A 4DUPA 4EL0A 1JH9A 1KYIA 3ZCPA 3EMKA 3IILA 3VPSA 2GB4A 5BOSA 1QH0A 1RACA 3C98A 1V11B 4OQXA 1MIOB 3HA2A 3F2VA 4YAFA 4TLAA 4WESA 5CJPA 2J9ZB 1F17A 1PZMA 2ZPAA 3SIXA 2PL1A 1XTUA 3FX2A 3NFYA 4OIFA 5EHXA 1C9YA 1K2VN 1E2LA 4YAOA 3C74A 3UPUA 3OM0A 1W8IA 3JYHA 1AUWA 4R1PA 1BW9B 5CK5A 5J4KA 3ZDBA 3T1HB 3PCTA 1WQ1R 2ECKA 3OBBA 4QDUA 4C78A 2W0SA 2WE7A 2Z9BA 5JOQA 1XA4A 5CB8A 4RJJA 4AM8A 2HA7A 3QVWA 4HRAA 4G1BA 4QOFA 5DT9A 4R1TA 5L3QB 4LF5B 1G8SA 4YQEA 4B34A 1RJ9A 3Q7RA 4F3TA 3P2YA 4IR7A 3QWIA 5GV7A 5TQVA 1VECA 2PIAA 5JJBA 1BOOA 4QG3A 1N2HA 1JFFB 4CM8A 3AYZB 3ZGVA 4DM7A 4YMUA 4IOMA 5AW2A 1U3CA 2AZTA 3WWDA 1KHTA 3JD4A 3WMRA 1QWOA 5IANA 4BBZA 1I94B 1ZC3A 3I64A 3TS1A 4I6GA 2ZJYA 1PFVA 2CCGA 3D7KA 2UUCB 1BS1A 4KOAA 4N8EA 2ZUEA 3F98A 1Y6JA 3AHIA 5EERA 2QX6A 3PNPA 3M4XA 1PS8A 3DE3X 4HTAA 3ZWYA 1P8JA 5CM9C 4HNAB 3H5NA 3E04A 1ZFNA 4Y9TA 4ZEVA 3N3AC 4UTXA 4LJSA 4J0HA 1Q50A 3FB4A 4GXRA 4YC7A 3ZEIA 5CPFA 4EX7A 2HYIC 3WL3A 2CMHA 4NYJQ 4NU8X 4N3BA 2BFEB 4LHWA 1Q1NA 3MJHA 4U7DA 3I1YA 3HFJA 4H77A 2ZM6B 4N5MA 3DFIA 4BCBA 4W6QA 4E32A 4NHEA 4A6DA 3D8TA 1IRIA 2O8BB 6NULA 2BRUA 4C29A 4YCMA 3IMKA 3KFLA 3RFXA 5TMBA 1LX6A 2PGLA 2YS7A 3IUYA 4N3GA 1U2RA 2C5SA 2OB1A 4GM1A 3MT7A 1LZKA 3M82A 3OC0A 4DMGA 2XT6A 4JENA 3Q3CA 3LGSA 4DW8A 2NO7A 4BAGA 2I3GA 4J1SA 3U48A 4BNDA 4B3MB 2E7ZA 2OCBA 5CT5A 2A3NA 4YEDA 4P0QB 3KJFA 1U6JA 4GZ5A 3MT9A 1J8QA 1SHTX 1Z83A 2HH9A 1SXJC 1KZ1A 2R85A 2ONJA 3K0CC 5AXBA 1U9JA 4EO7A 3NHMA 3REOA 4KLRA 1N0UA 1RHMA 1V6CA 4TSFA 2AA3A 1S2LA 3C8TA 3PEVA 5EWLA 1SU6A 3W5SA 4QXAA 4P8RA 3WLTA 3I9OA 1KI1A 2RB4A 3K35A 3GEDA 4G1VA 4OXYA 2X7XA 4HGOA 1BZYA 2Q5IA 4JITA 4LXQA 1JKMA 4WEOA 5DNDA 4KR7A 4FZVA 1TVKA 1D5WA 2FRVA 2NN3C 1ABEA 3QU9A 4Z0TA 3RK1A 2XY4A 4D9FA 5HZMA 4UZEA 1N2CE 1IONA 3KZNA 4DVJA 4LMAA 5FNZA 2FDCA 5T6BA 1JSRA 3B85A 4PW0A 3SQNA 1H93A 1KK1A 4RMGA 1N36B 4QARA 5B3JA 3ACCA 4M9CA 3BM5A 3LW7A 4XYGA 2NUBA 3QBTA 4FZJA 4LXYA 3ZVKA 1RQRA 1QHGA 1SRRA 4YRQA 4BQQA 3AZOA 2KM1A 5HUJA 2HJ9A 1E2GA 1A4IA 1JR3A 2HA4A 4PZAA 5E7JA 4DBLC 1N2XA 3SQOA 1H9BA 4HWKA 1QH1B 4HWPA 4NK4A 4YUWA 5BYKA 3BXXA 3DVLA 4AYXA 3T34A 2B8JA 3UW1A 3OHMA 3QU7A 4Q1VA 5L3SB 1DOHA 1YU9A 5KJFA 4EVIA 2ZUBA 1E89A 1ULUA 4P3KA 1FX1A 5BYAA 1E58A 1FX0B 1XKTA 4II2A 1ZOPA 1E4YA 1EFUA 1L4UA 2IHVA 3H5AA 4OH1A 4WDQA 1XNRB 2QTLA 4K87A 2YC2C 4QXRA 3R2JA 1NVMB 2ZBRA 4KN8A 1N2ZA 4O2BB 4OQNA 4XVRA 3ZGNA 4U7WA 4NX2A 3EGVA 3X3HA 5A4MS 3SYMA 2GBGA 2B83A 2I6FA 2I9KA 5GGXA 2JLRA 2QT9A 2CWWA 4P53A 1WTAA 1KNXA 2DJ5A 4G56A 1O95D 4CMJA 2ZM5A 4L75A 5JVDF 2CNNA 1SBZA 4DPKA 4BU1A 5LMNB 4DMKA 3AY6A 3PSAA 5AHOA 1VJ5A 3P26A 3FBGA 4NOLA 2CBGA 1J42A 4I0WB 4AAYA 4V1CA 1XTBA 2CC2A 2RSLA 2G28A 3PX2A 2JFBA 2XA2A 3F9RA 2QZJA 4FILA 2Q5QA 4BX9A 1U8AA 4CMKA 5CLQA 3V8VA 4HOYA 1L6RA 3BEDA 4UM7A 2IBTA 3MTEA 1R0YA 4LNHA 3MTBA 4GGPA 2H57A 4ZQBA 4WBNA 1FNCA 3T8YA 1C81A 4ZARA 2P1DA 1P62B 2ZAGA 3KB2A 1KJIA 4FP9A 2FFHA 3OJXA 2R00A 4DM4A 3PR1A 3AU8A 4TTIA 2ID9A 2IEIA 3AF4A 4M7PA 1QRTA 5CDHA 1QPZA 3BBPA 1W7AA 3H1PA 4K6OA 2QLMA 1JSXA 1SVKA 1WD5A 2AYXA 4Q9JA 4DPMA 5CM8B 3N5CA 2HT1A 2M2IA 4PU0A 2ASEA 2QR5A 3E82A 1M1UA 2PLRA 4YRRA 1UPCA 3IURA 3NANA 4LBZA 4ZO6A 5JYCA 2E4VA 3RIXA 1PE0A 4IEEA 2AFVA 1LLDA 1RIFA 1TECE 4LWZA 2VYCA 4LDRA 2FUKA 1NVGA 2PQMA 4ONEA 3NP7A 5HFAA 4C3OB 4DSAA 1GAQA 2JFGA 2ONCA 5A06A 3V3KA 3IOBA 3UJHA 5IJ0A 4FW8A 4RFLA 2H4WA 2G04A 5ALRA 2BGLA 3ZKWB 1S9HA 2CLEB 3ZOKA 2HUPA 3OOWA 1FLDA 5G40A 3DMTA 1BE6A 1P61B 3WZMA 4MW5A 1HYQA 2FH5B 5G41A 1LC0A 4BBAA 1P1FA 4BLUA 4Z4QA 3LX8A 8LDHA 4NARA 4W5NA 3AM1A 4E2YA 4C0BA 2ID7A 4LHEA 2IUEA 2P91A 4GPBA 2SKCA 2EIXA 4ADSG 2IEGA 3RTCA 1DLIA 5A4KA 3LLVA 2OO7A 1GG5A 3E8MA 4UULA 5BR8B 1IUPA 1QCCA 3KQWA 3AVUA 3R5KA 3Q9LA 2HMSA 1NQTA 2A9KA 1R10A 2EFGA 1RHUA 2OO3A 2WYOA 3DYVA 3OJ0A 5C1DA 1RLIA 3ND9A 3IBSA 3QNWA 1Z33A 4O5OA 5L3RA 4BNKA 4EJ6A 2TSYB 4DT1B 6ABPA 3TMAA 1DTWA 4H31A 5KHLB 1T5BA 4IRXA 3RREA 3G2IA 4F6RA 3G5AA 3DHNA 1QP7A 2VHEA 2CHFA 4PPFA 5M29A 4JJEA 2AWOA 3B9RA 4X9XA 3DVQX 3RS4A 5DGTA 5EN4A 3EXEA 1TLFA 4HVCA 3HMQA 3CLHA 9LDTA 3HU3A 1QFMA 1AHIA 4EB6B 5CA1A 3JVVA 2X6TA 4IRMA 4UKDA 1PZNA 3DZCA 1UJ2A 1WO8A 5EXSA 3FSGD 2FZCA 3A3PA 5P8WA 4BLWA 4F4JA 5A0TA 3N0WA 3V8EA 4MYRA 3CPSA 1LV7A 3QPWA 3PUIA 4N41A 1N32B 1Z62A 4CDMA 2CHVA 4ZXPA 4I5DA 5IXJA 4BZQA 2VG8A 1EGHA 4M37A 1IATA 2W42A 3PRYA 3OTOB 4QXPA 4QFMA 4YCDA 5FTMA 3T1TA 4YRZA 1Z07A 4CNBA 1U8FO 1KJNA 1VRCA 1NVAA 1DC8A 2V5VA 3VJMA 5IEBA 4RZQA 3KSMA 2IQ5A 4TV8B 5G0WA 2P6UA 1EFVA 1B23P 1YI0A 4LECA 4CWAA 4QOGA 5FUVA 1M75A 4BO9A 4PFSA 4G6ZA 3U7FB 4E4RA 3F1KA 4RQTA 1T36A 2H0QA 1BDBA 1C8BA 4TT3D 5IAJA 1NBMA 4WH0A 2JVIA 2V6FA 1E2FA 1PUIA 4L74A 1XDSA 2B94A 4H4CA 4YQZA 5EKUA 2I67A 1OB2A 1DP4A 1Y1PA 2O2YA 4H27A 4IJQA 5JRJA 2D8MA 2P7HA 4EPVA 1EVZA 5C46F 3NV7A 3LP5A 4N7BA 1VM6A 3TJRA 3LFUA 1V8FA 3LF1A 2P2SA 4JWKA 3UG7A 3VKFA 4DLYA 2OA0A 5JS7A 2BMAA 3LWDA 5ILOA 1C50A 2EKQA 3D6VA 1X80A 4EHDA 3L8HA 4RYDA 4YJGA 2GOYA 2Y3IA 1UK9A 3T6KA 1Z36A 4EAAA 5K05A 3OCZA 5D6OA 1NTOA 4C7BA 2EEZA 1VKRA 3THOA 2BFNA 4GSLA 4HVLA 3O1JC 1MA0A 4RZ2A 1JR4A 1PT8A 2YN0A 1KVUA 3BRQA 3ROKA 3TI7A 1XZPA 3VU9A 1JJIA 3N0XA 2OBBA 1KH3A 2QL9A 1MOQA 3FE2A 2BSQA 2F17A 3IKLA 1N2GA 1RM5A 1P0CA 3ENVA 3Q1LA 4BFZA 5B57C 1IDN1 1TYEB 1E3WA 3T1QA 1MN6A 2PRJA 3AM4A 4EG0A 3DXYA 2IVFA 3CLUD 3GRAA 4OXRA 2PKWA 2JASA 4NC9A 1FMJA 5ALIA 5EESA 4GFDA 1VKOA 1UJ4A 3B12A 3W3AD 3T1VA 4PG4A 4I08A 2QRVB 2HVGA 1B4DA 1UJ6A 1M8GA 3SOZA 3L0BA 3VM6A 1AGNA 4N7JA 4CGZA 2JI8A 1W19A 4I8XA 4I7EA 4H2DA 3DEKA 3TL6A 1XZLA 3KZ1E 1XYGA 4LSWA 4P0PB 3R74A 5E6RA 4FDUA 1QIKA 5BSRA 1MF7A 4M53A 1KO5A 3ONVA 1N7HA 1BA2A 1GAJA 2FJUA 5AJTA 3ZLTA 1VSTA 3OPXA 3GYBA 3K2EA 4FLFA 2O2SA 5DPMA 2OO5A 4X44A 3GLIE 3GLUA 4MLPA 1YOVA 2OWEA 3ZNPA 1SD1A 3L82B 4OGWA 4Q1EA 10MHA 2HRDA 3GCZA 3CSUA 3WK5A 1SIWA 2W00A 1H23A 2PS3A 1K86A 4URHA 5EJ6A 1XRJA 1M2GA 1N6HA 2EBUA 3WMWA 3SHTA 1U9IA 3KVRA 1QHXA 4V39A 2VAMA 5DNVA 2Y27A 4RHFA 3NM4A 1X19A 4YBZA 3QW4B 5CG1A 2PZEA 4UTPA 3G9XA 1DV1A 4NJMB 4PXAA 1O1YA 2FSFA 2O06A 3OMWA 4OQZA 1IBKB 3DLHA 4BO7A 2HDHA 4N6NA 3C7AA 3BBLA 4IJVA 2E49A 1YCHA 3I0MA 3KKEA 4LN1A 2W11A 4LOKA 2Y0DA 1WDKA 1DKQA 4PBSA 4ZIRB 1NR7A 2FSUA 4DV0B 5F35A 4JROA 1JG6A 3AEKA 2BSAA 4FW9A 4XPIB 1UBSB 2ESRA 2EWMA 3L1JA 1F51E 4Y6LA 1T5IA 3SBDA 1ILEA 1L5SA 1CZOA 1H8HD 1KI6B 1RI5A 1U2SA 2ZKIA 2LIVA 3AESA 3MFYA 2CXUA 3HR4A 5C1IA 3QYPA 4MKZA 1PI3A 1T2FA 4HUQA 2D7DA 1J0BA 121PA 1KMHB 1S0UA 3ZHBA 1J9ZA 2W2KB 3H1GA 3DE2X 1N0HA 1JIQA 2WZDA 2RGCA 2H2IA 1M34E 2QUHA 3V34A 4G4JA 4AS2A 1GRNA 2EKBA 1HQKA 4PYRA 1CR0A 4DR6B 3AF5A 4PWYA 4P3NA 3EDRA 3EZ2A 5L9AA 4QBIA 4OP2A 4DIMA 3L1HA 4YI5A 4DG8A 4P7JA 1ISJA 1OTHA 3ELWA 4XDYA 1NQ5A 4Q4AB 1Z7EA 2VP0A 1IN7A 1FRFS 2CYBA 2O3SA 1CR1A 2O0KA 2DQ4A 3AM3A 2C58A 3P5BA 3PB3A 3PFCA 3QEAZ 1XQVA 3RS8A 1OLUB 4YPVA 2AZ4A 3S8EA 1ZUHA 1R7RA 1ZDMA 2C5FA 5H3HA 2N47A 3DG9A 2VZ0A 2AR9A 1SXGA 1MLDA 1B42A 3H16A 4PAGA 4AYWA 4DJAA 3TLKA 1EVEA 3KQSA 2EXXA 4PNEA 2UUAB 2H9YA 1DO8A 1M2OB 2F1HA 3V4SA 1P75A 4QUDA 2VAXA 1E99A 1W4RA 3N7AA 2EZ9A 3WMGA 4XQEA 5AVVA 3A1FA 1OH5A 1P2GA 2IS4A 4CEIB 3T4EA 4ND8B 3AP2A 4B82A 3ZNNA 4N76A 4HDKB 1K7SN 3EXHA 3UMJA 3FPGA 2BMVA 3O21A 1YS9A 1A7AA 2C4KA 3BHIA 3H9UA 3CUVA 4KVGA 4NBWA 3D9QX 3O9VA 5FOXA 4BFUA 2JHCA 4YJ2B 4BX8A 3VVMA 4DKXA 1KBZA 1FFEA 2IGBA 1VLMA 2W58A 1UT5A 1O97C 1FDRA 2GUWA 3ADOA 3OBIA 4GE3A 3STXA 1DCMA 3R5XA 5UKDA 3AHJA 1ID1A 3LXXA 4MQ5A 5L8VA 4QYTA 1GA4A 4AJLA 4YJDA 3N75A 3T52A 1M1YA 2AFHA 5AM4A 3G7SA 5LQJA 3A70A 1Y4DE 2CHEA 4L4XA 1KAOA 2ZATA 4IVRA 4XX1A 2IY8A 5AQEA 2QBYB 5E3HA 2C83A 1YRHA 1R4ZA 3K30A 2JFUA 4IXMA 4LYJA 2X8BA 3QKIA 5EJMA 1IXSB 4YV1A 5JPDA 5F1PA 1KI3A 1R4MB 3ER6A 4AZTA 1VXRA 3TRKA 4MVJM 1JI0A 1VCIA 1NYLA 2W6OA 3W04A 3C3CA 1AQ6A 1BROA 1LS6A 1DRUA 4K9DA 1V9CA 4NBLA 2A7QA 5TQ0B 3HUEA 1Z74A 3Q2IA 4B44A 2BTQB 1YL6A 4JLUA 3WMFA 4FOPA 1RPNA 2WJIA 4XIGS 4TVBA 2J7PD 3DBRA 5AM2A 4MNTA 4IFIA 1PJCA 2QTMA 4ZVUA 4V1CI 1NI4A 4NRDA 3UMCA 3JQQA 4ZYUA 1DIAA 3L46A 1VBKA 4KVAA 2I6SA 5D00A 2NU7A 3CR8A 1H9AA 3IA2A 5F1OA 4EG7A 3NWPA 1SUCA 1T3ZA 1RDFA 3NBUA 3THYB 2WD8A 4RNCA 2FVYA 4Q66C 5G0UA 1GNLA 1SVOA 3UWDA 2WQ7A 2O2ZA 4BKOA 4YMWA 1TM7E 2P2CA 4A2QA 5JNUA 2PPLA 3RR2A 1UMBA 1NQUA 3KBOA 3Q9SA 3NBFA 3USZA 4BNFA 5LYJF 5IAGA 1SUWA 3PFIA 2VZ8A 4OMFG 5KTMA 1SA0A 1BE8A 2D4HA 1IULA 2WF5A 3O3MB 4XLTA 3WK4A 3I6ZA 1JPJA 2FZKA 4ZEOA 3V4VB 5CX1B 2BI7A 4GI7A 1XNQB 5LMUB 4KKVA 4ALJA 3JTMA 2O5VA 2D59A 4C7OB 3C3WA 3WP0A 4F3YA 2AVDA 5DV9A 5B6JA 5TVKA 3E5NA 2LCFA 3QV2A 1KPGA 5AOVA 4POOA 3H2GA 1CLEA 2HEGA 3CLSD 1W4BA 1YFLA 2Y0EA 4FYYA 5PNTA 4X1YB 3ZUPA 4JLVA 4WFJA 4DIUA 2ZWIA 2AX4A 1I9GA 2ET6A 3KLNA 1JIXA 4KIFA 2BOVA 5BRNA 2XE4A 4KUHA 2OYSA 4OGKA 5D2CA 5B55A 5IT0A 1OA0A 3WL4A 1ZD5A 1WUJS 5C5EA 4YMVA 1L1QA 2QRPA 2PGDA 2ROQA 3ZJYA 1W25A 1K5HA 1NFQA 1RXCA 3B6IA 3GA5A 3GJ6A 4K9RA 1BVRA 3T7AA 3UJPA 4RXMA 3KCNA 1V4VA 5B4VA 2O7QA 3BHGA 3MERA 4RU1A 4MB0A 5EZYF 3SR0A 2I7XA 2B3TA 4G0OA 1CZKA 2G07A 4IXTA 4KZKA 1ZU4A 3IQGX 4IDNA 5F4ZA 5C3UA 5A2GA 5KS2A 5LQNA 1UJNA 3ET5A 3SE0A 3ABIA 3ZY5A 3SJ7A 3QFHA 4M9ZA 3NTLA 4JXXA 4FE3A 3RH0A 2YFQA 4X6LA 3DO6A 1JXOA 3SMVA 3ZE2B 1WZEA 1GGKA 1BMFD 3AJDA 4JUAA 3ZV7A 1P77A 3WNZA 1R6XA 2LGJA 4MR8B 4O59O 1EVQA 4MR7A 2O8EB 3DV2A 2VFAA 4Y9UA 3R0IA 1GRVA 4WKNA 1Z35A 4QRDA 1IU9A 3PHIA 4GYWA 2B20A 3EDYA 1MQ9A 5FP0A 5DK6A 2RK6A 2VBGA 2FZGA 4JUDX 3UAOA 1R5OA 1GAXA 5A7GA 1V16B 2OBNA 1QFZA 1XZHA 4OLJA 5EINA 2RGUA 2J0UA 3QWFA 4KUEA 1OGIA 1GTL1 1NDUA 1M6WA 3KPVA 3L0ZA 4GZLA 4MYSA 2VL7A 3PXBA 4IDOA 4HAOA 3A6ZA 4Z3KA 2AXEA 3EQ8A 2ZI3A 1J23A 1XMSA 1LDMA 3RC2A 4CLOA 1Q77A 1LWNA 1TX4B 3R7AA 1VOTA 4OQQA 5ENVA 1TMYA 5L7YA 2V0GA 1D4AA 1ZVMA 2C31A 2DR3A 5IH3A 3UUEA 1II0A 2IYWA 3VPAA 1ABBA 2FMHA 3NPMA 1L7QA 3HY3A 1SEPA 4QNNA 1TYCA 3VVBA 2FFAA 2CLKB 3IOMA 1MC5A 2AN1A 2AXNA 5D01A 4Y3UA 5AM5A 1H6BA 4IQ4A 3AKYA 1XZAA 3BKXA 5AT1A 1AHPA 4QYMA 4UQLA 1IBLB 2VNKA 2GD2A 1X87A 1GHTA 2J9XB 3P27A 3UMVA 1O2DA 1GAWA 2G9QA 2QW8A 3BAZA 4QELA 4C04A 2WF8A 4ZT7A 3PGXA 2ZTUA 2AN5A 1JAHA 3MLAA 3ZU5A 4PYIA 3SDSA 5DP1A 1YVRA 4OX9B 1NLFA 3EF1A 4B3SB 2Y93A 4LK3A 3FLAA 1S8FA 4WKCA 4C4PA 4DEVA 4A16A 1P5FA 3EQ9A 3Q6NA 2VJLA 4UNNA 3DB1A 2F1IA 3FTDA 2LV8A 1ZZGA 2B36A 3RRYA 4F1KA 2CMKA 1JDVA 1P74A 3CLVA 3MTGA 2WV7A 1DFIA 2IPNA 2QQ5A 2X5XA 1KGDA 1G6Q1 4G09A 1IMOA 4F72A 1PHRA 2XJ4A 3LDGA 5TNXA 1R3DA 5A2QA 1GITA 3WGZA 1C0IA 3FSGA 4KLCA 1OLXB 3AL3A 3UKDA 4PN3A 1FSGA 3HZRA 3RVLA 3QBJA 4FONA 3F6BX 4NH0A 4PC3A 5BR4A 1QIGA 3TCNA 4PO8A 4PIMA 3CPEA 5K2MA 2ECOA 1B8VA 1ND6A 5COBA 4MLDA 4EVSA 4LOHA 3KZXA 4JMLA 1SHUX 3DA8A 4U6NA 5CEJA 3HB0A 2C2BA 4C0XA 4R1SA 1J0AA 4CG0A 2PQ0A 1SHLA 3PYMA 2IITA 3R3ZA 1T26A 4P6VF 3IBFA 2NO0A 1F48A 4M8NE 2QUBA 1JI3A 3NU1A 4TLDA 5BWMA 4NMHA 1FY2A 1VL8A 2I4TA 2ZAOA 1XWFA 1M2KA 2HHCA 3I2JA 1WVIA 3G2JA 1TEXA 3JYLA 3T0FA 4FJ1A 4YNBA 1Z6AA 3WHIA 3SXUA 5CFQA 1JJ7A 4COKA 2NUTA 2AE1A 5ELXA 4R7ZA 3B38A 1HX7A 1GCUA 3V6LA 1P5JA 1UBEA 1TM3E 3HJUA 2V9PA 1YZVA 2XOKD 2O6HA 1OBFO 1EJ2A 1I1OA 2X77A 3Q8MA 1KO7A 4DDUA 4IWXA 2FP4B 1J07A 1P4RA 5IFKA 1OU4A 2C7GA 2C8KA 3M6VA 4L07A 4WKGA 1S3SA 3SHWA 3U7GA 1OE0A 2QAIA 1XTZA 3OLVA 2IU0A 2QGNA 3T3PB 1E1LA 4WJLA 3QYJA 2JLXA 2Y0CA 4JL8A 4EB3A 2FCRA 1WD7A 3F2IA 3NDJA 3BWVA 1OF1A 3I1FA 4NICA 4ZAYA 5BSMA 3U3MA 1W5EA 4R9RA 2ZZKA 2VCEA 3GFQA 1LXCA 4HP8A 2IZZA 3E0QA 5FPPA 3VYSB 5KNBA 2WWFA 4X65B 1HFWA 4E1BA 4YJ3B 3RJ5A 5HPYB 1IAQA 1R6BX 4JJZA 1DHRA 1TJ3A 4EEXA 3K9HA 4TS9A 1OBHA 5KJEA 5KYGA 1JXMA 1L7EA 1XGKA 4KITB 1VDKA 3WNDA 3R9XB 4FUTA 4R05A 5F1KA 1EI9A 1XELA 2DBVO 3FCUB 3QI2A 4O8ZA 4OP1A 4ZDKA 1NOKA 2VIIA 4JFAA 1GFIA 4A0HA 4BFTA 4D9EA 1AZLA 3OFVA 3IPAA 3UYLA 2WYWA 1VDZA 3QFFA 4QYIA 4OY3A 4RW0A 4R0MA 3B1FA 2GBLA 2WZBA 1WM1A 3O1IC 1DBVO 1GPAA 4K9SA 3SC2B 1PG2A 2WRZA 4F71A 2X14A 4MPPA 3GPLA 3L7KA 3UK0A 1NNLA 2DBQA 3BE4A 5HMLA 2AQHA 3MWYW 4DWJA 4MLCA 5SYAA 1E0KA 1HFEL 2XUAA 4HUJA 3K31A 3RU3A 5EHZA 2X13A 2DBYA 3FDJA 2PKXA 3IIIA 1LBSA 4DR7B 1XX6A 3DAOA 5JWRA 1YVDA 2FW8A 4J76A 1PDVA 1FDSA 1KSFX 2OHJA 4XOIA 1PVOA 2JIZA 2IHBA 1N5JA 3L0PA 3RLIA 1PLKA 4IPTA 2CXPA 5KI6A 1OV4A 4LCBA 5DMHA 3F6CA 2YYSA 1D6JA 5DXJA 5BVHA 2GK7A 2Q6KA 1NGSA 4WCDA 1AURA 2MWMA 3NAZA 1BJKA 2HCRA 3F8SA 3R3JA 2HWWA 4BVLA 2XZOA 4JP1A 1T8WA 1NBWB 4J43A 2ZPUA 1WDLA 2QUKA 4CLEA 2Q2OA 1TRKA 2EZUA 3GLRA 2GYWA 4YAGA 1GJRA 2Q3HA 1SZDA 3JR7A 5FOSA 2HWKA 5LA6B 2TMGA 3DJYA 2D74A 4JASB 4PSAA 4B17A 2O7VA 2E5WA 4HGZA 5E4JA 5GJCA 1KMMA 1GPBA 1G8MA 5EP3A 3ZDZB 4URZR 5C9ZA 3ZBPA 5EJ2A 4B6RA 3ZBTA 4C4XA 1N3LA 3DTNA 2MINB 3WMXA 1MB2A 1C7EA 4HDMA 4TYNA 4FD3A 3VDNB 2PAFA 1Q3TA 1AS2A 5DX1A 2SCUB 3VQTA 3LHIA 2PDAA 5IDXA 1LDBA 1R9MA 3I0ZA 1LDYA 1IY2A 5BUCA 4IIGA 1XAIA 3ECAA 1N1DA 2PX4A 4C0AC 4R3UC 2I33A 3VR2D 3VR6H 2AMFA 1DUIA 4MQEA 3H8VA 1MIHA 1GGEA 4IF4A 1QHYA 3IAM1 5ALYA 3R24A 4JUBA 3V2HA 4K5QA 2G09A 2WHPB 2OCDA 4UBKA 4MRSA 5ES3A 2AOTA 2PSJA 4UBOA 4ZANA 3PPXA 4B6SA 3CUKA 4XJXA 2H2DA 2JLCA 3PXXA 2VHZA 3LFTA 2OGWA 5EIBC 5C8YB 2X4GA 1MJGM 2P5TB 1XQ1A 5H8WA 4IIXA 2GRUA 1U0BB 2R25B 5DB4A 1NMQA 2QN3A 4PHTA 2YBDA 4RSHA 3VDRA 1TW2A 2NYVA 3K0AB 4WZ6A 5DKFA 5LYYA 2UYCA 2X9GA 1YRLA 4FGKA 1YHZA 5KKCA 1CRQA 5TSDA 2WKPA 1PD1A 3K16A 1N2EA 2IPLA 3ZGXA 2O3RA 5ECDA 2O1WA 3UZUA 5KX5B 5T57A 3TQTA 1T13A 3HP1A 5EE5B 4Q3OA 4MHTA 2X7JA 3B60A 4DQKA 3MJSA 1D4FA 5LXTA 4YUYA 1G8KA 3T06B 3DLBA 3EIUA 3P52A 5T3YA 1P0PA 4QWMA 4DUZB 2ZJ2A 4UHKA 3WE7A 3N7TA 4EW2A 3TZ6A 3LPMA 3MIZA 4QEDA 3WOHA 3VOAA 4HGQA 1E6LA 3D3QA 1KDVA 1PGPA 1MT0A 3QVOA 1O94C 3TAXA 1USWA 3FETA 3S2YA 2H17A 1V2GA 5JMPA 4EY6A 3C6KA 4I14A 4Y1EA 3HO8A 4GGMX 2WKQA 3JWGA 4J0GA 4B8YA 1BS2A 2POQX 2WU3A 2ZYRA 2DPHA 4CKWB 2HF7A 1HDZA 4DCNA 3O8CA 1Q19A 2FETA 2QN2A 3JZFA 4HB0A 4O4LF 4O4HF 5LZ5A 4AICA 4P93A 2A1TS 4BO1A 1R6AA 1X3SA 2NYAA 2PKYX 2UZIR 4RE6A 5HCUA 4UPVA 5CFPA 1RRMA 4JBIA 2XVAA 4PLHA 3RWOA 5JSZA 1ZD8A 2QROA 4FHEA 2Q62A 4YP6A 2C2OA 5JDCA 3DEYX 3Q7TA 3E58A 1BA3A 3UTDA 4P58A 5HR5A 1SKMA 2XMDA 5BWLA 1TADA 3RD5A 1JR2A 1GTRA 4A1FA 3IVCA 4E13A 2WD7A 3VPCA 1AHHA 5B6PA 1UDAA 4D3YA 4DV4B 5IT5A 1JEOA 1OYOA 2ZB7A 4GSKA 4TLBA 2GT1A 2PD6A 1VHLA 1ELOA 1Z28A 3TOXA 1QLJA 2VYND 2QPLA 1IQPA 3Q3GE 1UXJA 2G6BA 4KV7A 1CHDA 3P0JA 3Q5DA 5C5IA 1VCMA 3GP3A 3JQFC 4YCAA 2I8AA 1Z4IA 2R1TB 2BKUA 2VUTA 1DAEA 2WM3A 2YX1A 3KJNA 2C4MA 4US0R 5B4TA 3CVWA 3MGGA 5IUJC 3HYTA 1G63A 2IHYA 3W77A 3CH4B 1N2CB 1QWSA 2D00A 4B74A 4LNUA 4NCIA 1IZ9A 1V45E 2GPAA 1DJLA 4MJXA 5FBQB 5FQOA 1X8LA 1ZK3A 5CNMA 1I2MA 4LTNA 3DOEA 5I5EA 2B9EA 3G59A 1UAAA 4FGJA 4D0GA 2PUGA 2AK3A 4DV6B 1SCQA 5CH8A 4TVSA 1XD9A 3LY8A 3AEUA 4HZUB 1G20E 4J90A 4Q03A 4RKFA 4F9FA 4ETWA 4P86A 3BERA 2QM7A 2WAOA 2JKYA 3JCZA 5CTAA 3W2EA 4UUBA 2XUQA 2QVCA 4JI5B 3EEBA 1FYEA 2AEFA 2FR8C 3NV9A 4PC2A 1K68A 2J33A 2XMGA 3MINA 4OTZA 2UXBB 1HZZC 1I3OA 3P0EA 4J2OA 2WFZA 3BHMA 5C34B 2CXHA 4XGQA 3SYTA 4NCJA 5IVHA 2RAUA 5ITSA 1Q74A 3A58B 3DR5A 1IVNA 4LC0A 1TQ8A 4MJLA 5DHFA 5F12A 3U7HB 1RRCA 3L6BA 3NIFB 2ONZA 1FNMA 4FMDB 2QZSA 2HT6A 2FSSA 3DUWA 4G8JA 1NX9A 1Z34A 4OHBA 2BDUA 3QELB 1P19A 1RQNA 2BONA 4JSRA 4EMTA 2OLJA 3S2GA 1AHNA 2CNBA 4WLOA 2YQZA 1KQFA 1H3FA 1P0QA 1U1FA 3LDFA 4WACA 1UDCA 1DQYA 1II9A 1ES9A 3OD1A 2P2GA 5FBLB 3X0DA 4EFKA 3FTQA 2B30A 4G0NA 3C1UA 2PD4A 4QG7A 2G25A 1DAFA 2TYSB 2QGAB 1N2SA 3KQNA 3IH5A 4FMCB 1OX4B 5JANA 1EMDA 3LT0A 3OU2A 4KUGA 3RT9A 2C0QA 2X8LA 4QGBA 5K2OA 1QZ3A 3QUTA 2UUPA 2EU8A 4K9PA 4L9AA 4S1NA 4EG6A 3TPCA 1E3DA 5IK2D 3T5AA 4OBXA 5I7HA 5HW2A 3OLZA 1X9IA 4AZ3B 2YKGA 3LUKA 3S1SA 1C3EA 1V3QE 3OZAA 4K3VA 3L5KA 3TNYA 3W8RA 1F8FA 1ODLA 1QOQB 3MBOA 3ORYA 3WFIA 1KVSA 2ZVPX 4D42A 2HMUA 1V5IA 3D6NB 1Q0UA 4IZ6A 2G1PA 3FYCA 2IH2A 1VYHA 2B92A 3R20A 1US8B 4KE6A 5GWXA 2IV2X 4DCGA 4B9EA 5JYEA 2OPBA 1FQWA 4CF6A 5K0BA 3SZLA 1T8RA 5JAQA 1NVEA 3KKKA 2NZVG 1E9BA 5AVWA 2QVXX 4YJFB 2IS1A 4NSLA 2VBFA 2R66A 3K32A 3LCCA 4N0PA 3AOEA 3T9DA 1QK3A 2Y8EA 1SVSA 2B4RO 2ZWOA 4X7BA 5AUOB 2EBHX 3IBTA 4ILKA 4QD3A 4E1AA 3RADC 1RQXA 3LHKA 1YV9A 3S68A 2HIGA 3R5JA 5EA2A 5AKHA 5IJWA 1YR9A 1E3IA 4FEGA 1SVUA 2HSGA 2I99A 2BLLA 1FUQA 1U16A 3AL0C 4YLEA 1HY0A 1P18A 1WE2A 2HIMA 4FLMA 3ZDXB 2OFXA 3CVJA 2DFLA 3LT2A 2DUJA 3UPDA 2BZ1A 5BN3A 1U6IA 1S3FA 4PLTA 1EVJA 1JP7A 2EJWA 4QOEA 4F2HA 1WZUA 4PSKA 4UCFA 2WG2A 4I1YA 2OQIA 2GPYA 5HJ5A 1X7ZB 3LYAA 3VKHA 1CULC 3C5CA 1NVVQ 4EUNA 4ND1A 1EYZA 1WU8A 3HXLA 3QTBA 3Q9NA 3NVAA 2R1ZA 3O0DA 1YVPA 4JH0A 3LQ4A 5IKPA 4U63A 2F6RA 1D9XA 5DBFA 2W2XA 3HDTA 4ZN6A 2I1WA 3W5HA 1ZMOA 4UUNA 5DGDA 1KH1A 5AIAA 3WRVA 1JSLA 4R54A 4ZHQF 1CS0B 1WWKA 1A76A 5A4FS 5JXIA 3EE6A 1I3LA 4ENUA 3CPJB 1TK3A 1C4KA 2YN2A 2GCEA 4D25A 1QUFA 4F4CA 4EOGA 4JXZA 1PS9A 1D0SA 2W22A 2YWBA 4AJ1A 4EFNA 4UFNA 3UXEA 1BG6A 4Q4JB 3N86A 1RTKA 4LRQA 5F5XA 2QAGA 3FI9A 4ZT5A 4GMHA 1HI9A 1E20A 3VA7A 1FVFA 2XMCA 4F1JA 3LO5A 2O2CA 4Y6OA 1K3FA 4R8LA 1G5PA 3D0RA 3PEEA 2D6FA 1GNVA 5BNIA 3FIJA 1YFMA 2VQFB 5LL6P 1T4CA 4D4IA 2OC4A 1GCAA 1VFPA 4L76A 1UH5A 3KQOA 3EAGA 3OZTA 2W4MA 4AMZA 4K6KA 1OYVA 2P2YA 2PSEA 2OZLB 2O54A 2X1VA 4MW6A 2DWCA 4G37A 1RLJA 1E2UA 1F2TB 2CFSA 3PUXA 4FX5A 3NM5A 4AJPA 2F7SA 3OPVA 3QKUA 4HGNA 5EQFA 3BKWA 4KVFA 1RWQA 2EBFX 4UU1A 4QJ3A 4IIYA 1JQDA 4QGFA 1ADJA 2RGAA 4IS2A 5CYGA 1NMSA 1T8YA 2PEZA 3FXAA 3FYUC 3KR1A 2O8FB 4WLUA 3BMCA 3LLCA 1IPHA 5D3QA 4CETA 2QVBA 3QY9A 4C5AA 5JQGA 1AM4D 2F8SA 1V2HE 1RE1A 3LXUX 1RMYA 4YR9A 3WWYA 1QQ7A 1TAUA 2GF0A 1JB9A 2Q8PA 1QYDA 4IJMA 1T9GS 1I8TA 2VPYA 3I76A 4XW2A 5ERXA 4L0DA 1VLHA 1TW3A 1U3FA 4HDQB 3TNDA 3GCGA 2ZZMA 1CQJA 3LFHA 1T5DX 3FVWA 3QE0A 3KOWA 2ZRBA 4IW3B 4FN4A 5DM0A 3QX8A 2C9OA 4L02A 2XHEA 3KS9A 1TM4E 3CS3A 3SG0A 5EHIA 3EA4A 3IERA 4ZCLA 4EECA 5F9HA 5ALZA 3RUPA 1GPJA 4LYEA 4F2PA 3JAWA 2PL5A 4OFXA 5KKAA 4HLNA 2HLPA 4UNIA 3CVXA 4AFNA 4GLOA 4MUNA 4RAQA 1OUMA 5KZMB 3O92A 1WXGA 1C7QA 1DS6A 3NBMA 2EC5A 3VO1A 7AT1A 4LI3X 1E5TA 4OB6A 5CMLA 2DUUA 3BD7A 3ENZA 4XSGA 4CKBA 2O8CB 1T1EA 1GA1A 1F2VA 1KMIY 1O54A 3VC3A 1XVUA 2G76A