1Z4IA

Structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with deoxyribouridine 5'-monophosphate
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase
publication title Structural basis for substrate specificity of the human mitochondrial deoxyribonucleotidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 64
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1z4iA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4iA01
4UM5A 3ET5A 5AKLA 2YMLA 4BX2A 3N5KA 2CN1A 5ALRA 1WVIA 3B9RA 4Y3UA 2EATA 4Y2TA 1EK2A 4NV0A 4BX0A 3HYCA 2OM6A 5ALTA 3L8GA 2R8EA 3E84A 4Y2SA 1WPGA 3OCYA 5AVQA 4FFDA 1ZD2P 3B8EA 5ALLA 4YIKA 4CF4A 5AVWA 4XOUA 2EAUA 3VAYA 3AR4A 4KNVA 1L7NA 2R8XA 3AR5A 2ZXEA 1U2SA 2QYHA 3DAOA 1Z4JA 5AVZA 2DQSA 4KYTA 3UM9A 3A1EA 5AESA 5AI5A 2IA5A 1X42A 1IWOA 5AVXA 3S6JA 2BDUA 2FUCA 3K1ZA 3R4CA 3ESQA 3U26A 2NO4A 4XE5A 1RLTA 2B30A 5AW3A 3WKDA 2AMYA 2I33A 2WM8A 3DV9A 5ALHA 4CF3A 3ZWDA 2C8LA 2YJ4A 5E0OA 1NF2A 2FI1A 2FPSA 2HOQA 1LTQA 1ZS9A 5AW7A 1ZD4A 1U2TA 3L8EA 2YMQA 2HDOA 4MWOA 2W4MA 3I76A 3NIWA 4UMDA 1T9ZA 2FPUA 3UMCA 5ALYA 4UU1A 1QQ5A 1TA0A 1VJRA 2CFRA 5AW2A 5ALFA 4G9BA 5AVYA 4NWIA 5AW4A 3L8FA 2FPXA 3A1DA 3F9RA 3E81A 5AKJA 2NYVA 3WK9A 2PQ0A 1QH9A 5FP0A 3L1VA 2BY4A 2ZBEA 5ALGA 4BKMA 3FGOA 2IOFA 2HF2A 2Q5EA 3EWIA 3L7YA 3OCUA 3ZVLA 1O08A 1TJ4A 3WKCA 3QX7A 5AKGA 4YGYA 5ALNA 2I55A 1F5SA 5AK3A 4ZEXA 3WK8A 4UASA 5AKZA 4Y2VA 2X4DA 4H1WA 3NASA 2P69A 4KN8A 2ODAA 4BNDA 2YJ6A 4I9FA 4O8CA 2FUEA 3FM9A 4KX5A 3R9KA 1Z4OA 3L5KA 2G06A 2W43A 2B8EA 5AIAA 5AVVA 2G1AA 2WFAA 4DWOA 1SU4A 3SD7A 4ZEWA 1ZOLA 4DFDA 3W5BA 3SKYA 1Y8AA 2C8KA 3WK7A 3QNMA 4EX6A 5AM3A 1RLMA 2HEGA 4CNQA 3KC2A 3ZTWA 2B0CA 1KYTA 3ED5A 1RMQA 1N8NA 2P11A 2JAUA 3L0CA 2R8YA 4OHFA 4OFZA 1AQ6A 3AR6A 4Y2PA 4C4TA 1YDFA 1QYIA 5ALKA 5AHXA 3QU5A 3SF0A 1RMTA 3W5CA 2D2VA 3QYPA 5AW8A 4I9GA 4NABA 4XQ0A 3MC1A 3AR9A 4C4RA 1CQZA 5A3SA 3SLRA 1NRWA 3A1CA 4NAVA 2PR7A 5AI6A 4UAUA 2FEAA 4AP9A 4UMEA 2RB5A 4BNDB 3P96A 5AM1A 1L8LA 3ONNA 4CF5A 4YCLA 4YIHA 3OTQA 3E58A 3AR2A 3WK5A 4E88A 1U7PA 3SHQA 1Z88A 4Y2QA 3IRUA 3U7HB 1L7MA 3A3YA 3WKBA 5ALDA 4QJBA 4ZEVA 3FZQA 3QU7A 3RF6A 4YCMA 2G07A 3L1UA 1Z5UA 2G80A 2B1QA 2VKQA 4L6AA 3AR3A 4HGRA 2CFTA 2JARA 2MSNA 5AKIA 3OCWA 3W5AA 5ALMA 1N9KA 1VFPA 2IYEA 2I34A 2HO4A 1RC8A 4GXTA 3ZX5A 2JAOA 1NNLA 3QU9A 5IS2A 2OBBA 2AGVA 1VJ5A 5A3QA 3ZX4A 2YBDA 5AM2A 5AI8A 2HI0A 1L8OA 1Z4PX 3N28A 3UMBA 4XPZA 2G08A 3PGLA 2Q4RA 1Z4QA 2Q4TA 5AIBA 3M1YA 3KZXA 3DDHA 5AKKA 5AW0A 1RRCA 3CNHA 2P9JA 2IOFK 1LVHA 2W11A 5ALZA 1O03A 3ZU6A 3BA6A 4GIBA 4HGNA 4QQFA 4EX7A 1SWVA 4DW8A 1QQ7A 3MN1A 5AI9A 5ALJA 1L6RA 1ZD3A 2B1RA 5AI0A 3U19A 5A3RA 2YFYA 1Z5GA 4KNWA 5ALUA 1TE2A 2R8ZA 2YJ3A 5AVUA 2P27A 4EENA 5ALXA 5ALIA 1XP5A 3WKAA 2YMMA 3PDWA 2YJ5A 4HYTA 3NUQA 3U7EB 3OPXA 3J7TA 1SWWA 4PNHA 2B8JA 2C9MA 3QUQA 5AI4A 1Z4IA 3QUTA 2CFSA 3U7GA 1S2OA 3MMZA 3U13A 3ZWKA 4JDPA 2WF6A 2YY6A 4BEWA 3QXGA 3ZVMA 3NANA 1L7PA 5ALWA 4YCNA 5AK5A 3ZW7A 2HF7A 2ZG6A 3OCZA 1XPJA 2OYCA 1YMQA 1CR6A 1TJ5A 4IG4A 3QU4A 3KD3A 4UARA 3QUCA 3ET4A 4EZEA 1Z4KA 2GMWA 1Q91A 5ALQA 3QLEA 4B6JA 5AW6A 2HX1A 4Y2YA 3EF0A 4UU0A 1YJ5A 1YV9A 5AW9A 2WF8A 4UATA 2BDEA 3NAMA 5AW1A 2I7DA 4F72A 3N8GA 4DCCA 1ZD5A 1U7OA 1WR8A 2WF5A 3QU2A 2HHLA 4JB3A 2FPWA 4UW9A 2WHEA 4EELA 2JAWA 5AVRA 2G0AA 3AR8A 3UMGA 2C4NA 2RAVA 2O2XA 3WGVA 1L7OA 3ZTYA 3MPOA 1ZRNA 4C4SA 2C88A 2MU1A 2AH5A 3E8MA 3PCTA 1FEZA 4AS3A 3OCVA 1RQLA 3L0BA 5AKYA 2GHTA 1WZCA 5AM0A 2I54A 2B82A 3FPBA 3PGVA 3RFUA 1Z4MA 1U02A 3SKXA 1K1EA 2EARA 4L6CA 3NALA 2YMPA 2G09A 3EF1A 3I1YA 5AKXA 1XVIA 1JUDA 3OCXA 4Y2XA 3WK4A 1EK1A 3L8HA 2OA0A 4Y2RA 5AVTA 2GFHA 4HAIA 2NO5A 4MUMA 2ZBGA 4HGPA 3M9LA 1T5SA 1Z4NA 3N1UA 1RPZA 1ZRMA 5ALEA 3TLMA 3BWVA 4UMFA 1J97A 1RDFA 3KOOA 4NFLA 4RESA 4AS2A 3IJ5A 3L0YA 2JGAA 3WGUA 1Q92A 4OD0A 1RKUA 5AK4A 3QGMA 5ALOA 4F71A 1J8DA 1YS9A 4FYPA 5AW5A 2FDRA 5AKEA 4Y2JA 5AK6A 1RMYA 1PW5A 1Z4LA 2O9JA 1TJ3A 4BX3A 2HCFA 2QLTA 4RETA 1RKVA 4EEKA 4G63A 4BEVA 3N07A 4FE3A 4OCZA 4UM7A 2HSZA 4J2TA 5AVSA 5ALVA 1RLOA 3I28A 5AKHA 2WF9A 4KX3A 1MH9A 5AM4A 2PKEA 3D6JA 3GYGA 3KBBA 4UAVA 2WF7A 2ZBDA 3SMVA 2FPRA 2ZBFA 3R09A 4IFTA 3QUBA 5JJBA 3IB6A 1RQNA 3DNPA 1T5TA 5IT0A 3ZVNA 5ALSA 3KDPA 2YN4A 2GHQA 2GO7A 4HGQA 2RBKA 5AICA 3I6BA 3ESRA 3FVVA 4BBJA 4L57A 1S8OA 3NRJA 4Y2UA 1ZJJA 3B9BA 1YNSA 5AM5A 3EPRA 3ZI4A 5ALPA 1RKQA 3FPSA 3HLTA 3WK6A 4UMVA 2RARA 5T41A 4BYGA 5IT4A 1QQ6A 2I6XA 2IOHA 3W5DA 3CZ4A 4J03A 2AUTA 3AR7A 4YH1A 3U7FB 4CE6A 3WKEA 3ZUPA 4HGOA 2ZOSA
chains in the Genus database with same CATH superfamily
2BEVB 4XJVA 1W0JD 4WFJA 2QMZA 3A4LA 3K9NA 4OXQA 1X1DA 2GVZC 2VAMA 1R12A 3KEGA 1AHIA 1EVZA 3BMNB 2ZE8A 3EJWA 1PD1A 4NCAA 1WHTB 2CV0A 2H2DA 2ZWOA 4JUCA 3CTMA 4NICA 4JXXA 5I4KA 2KWIA 3RC8A 4KDRA 1M66A 1ZM4A 3OD1A 2OBYA 4IWNA 4PVDA 2WU4A 3AW8A 4KI7A 4LYGA 3A6PC 2MINB 4BVGA 1ZZGA 2FPKA 3I5UA 4BMOB 4WERA 2KLBA 3E04A 5KQPA 3VNQA 3H16A 1NX6A 1ODJA 2KE5A 4HPXB 4IHKA 4NAUA 4IH9A 2JAQA 1COZA 2XDWA 3JQ8B 3ZLTA 5MGBA 3PD7A 1CUDA 1PEYA 3D7MA 4NI5A 2OHFA 4E1AA 4EECA 4F2HA 2BFPA 4LUCA 1E6WA 2W6CX 4REMA 1L1EA 4JKYA 4WCFB 2WIFA 3QEOA 1J7JA 1EQUA 4ZOBA 1E7MA 3BOSA 5CLFA 2WHQA 4XWTA 1P3JA 3M6LA 1T6NA 4V02A 3RREA 2TS1A 4NY1A 2CHFA 1UXJA 2GBFA 1NDQA 1ULUA 3GPIA 3M3PA 1TIKA 1NZDA 2BR5A 2GLTA 3WWOA 4D0LB 1M2OB 3LC7O 3E3LA 7YASA 3V1KA 3MWKA 3RV4A 3SXUB 1WUTA 4R81A 4CUZA 4QUDA 2IYAA 1Q1BA 3DEKA 3ICOA 3ZNOA 5JI3E 4ARSA 2OZLB 3CZRA 1P6XA 4MV3A 4UMDA 2AE2A 4GLBA 2I4MA 4RD4A 1IM2A 1EDEA 2FSVA 5AHRA 4H0CA 3QEKA 3DB1A 1K7SN 1VJRA 1Z6YA 2W0MA 3AWIA 2FCAA 2NU6A 1MJFA 3HYTA 5DYGA 1VPLA 1PR9A 5CCXA 3OEEA 3U09A 2AFRA 1SQ6A 2FW7A 3GRPA 5AKJA 5DTEA 5BQXA 1DRVA 4F45A 4XYGA 2O8FA 2IDKA 3QELB 1QH9A 4WLFA 3Q2OA 1BDBA 3H0EA 3L1VA 3SSOA 2C97A 3CJTA 1O4WA 2RMKA 2GRAA 4NPHA 3MFYA 1QF9A 3EEQA 4RIHA 3R7DA 4C0QC 1IJFA 1DO8A 2P3SA 2C0QA 3ICPA 1JAHA 3C87A 3HG7A 4P8RA 1P4GA 4ZQHA 4I1UA 3WMWA 2JDID 4BNNA 3VOAA 1MC4A 1O77A 2II6A 2CXPA 2Q29A 2G71A 2VSOA 1IN8A 1NN0A 3FNQA 4DQKA 2AKEA 3AHFA 1NC3A 4E3ZA 1WLSA 2EHDA 2IV3A 2O3TA 2VHZA 3IDAA 4M36A 3RBAA 2B3TA 1DQZA 1MIOA 4JUBA 3RFXA 1MIHA 3U5ZB 1HK7A 1YOVB 4M7OA 4ZV7A 4I55B 3QE3A 2PV0A 3B7GA 3D6MA 1I3LA 4Y2VA 4XA8A 1YZ3A 1CJUC 1LDGA 3GEIA 1ZZEA 3F71A 4ARBA 4E22A 4PG8A 1NUTA 5HZGA 1Y6JA 4WLOA 4C7JA 5IDWA 3K4HA 4GMKA 1FY2A 3RVMA 1KIAA 3V8EA 4RQAA 5KVSA 3EFOA 4X41A 5K5EA 3K9HA 2C5AA 1RQXA 3QYFA 1X8KA 2HK7A 4G1EB 1RWWA 3N7UA 3SXJA 3L4JA 2YIDA 5FEMA 2Z6AA 3GZJA 3GJ8A 3ELDA 4ER6A 3R5FA 4NBNA 5BMOA 2WG1A 5KOYA 4Q7JB 2DB3A 3WQHA 1TMYA 3KB1A 4Z7JA 3JCZA 3WJ2A 1KO4A 2O5VA 2GA9A 3T7JA 1C7IA 2WC1A 1BD3A 4AY2A 2XCIA 1VBKA 1Y7PA 3K35A 1Y1KE 4DR3B 1ZRSA 2XADA 2HRCA 4KKVA 4HLQB 4K9NA 2Z5VA 4UUPA 4CLOB 5HXAA 4DRXA 4UCFA 1RRKA 4TXJA 3JQ7B 2CVHA 1XRPA 3NEAA 1I8TA 4TKZA 2J8ZA 1NBEA 3SF8B 5JCZA 3OI7A 4MGZR 3RWBA 2XVAA 2OHOA 3N76A 5F9FA 2R8YA 1J39A 1CUVA 4MCIA 3PIRA 4JLBA 1ZM9A 2XQKA 2FLVA 1YDFA 1X7XB 2QRQA 3S5UA 1JT9A 5CW2A 3SF0A 4LJ5A 1VE7A 2D0PB 2DU8A 4N3BA 4P82A 3JATA 2NM0A 5EZSA 4YP7A 4F96A 2H0QA 2C3PA 3OIVA 4B85A 2H92A 5LBUA 5EESA 1KDRA 4J29A 4C7BA 4IS3A 5BYBA 3T61A 1KOFA 1E0KA 4QOHA 4CIWA 1FPMA 2PUTA 2QDXA 2JGMA 1NGSA 2V7TA 2H7CA 1NIPA 1UOEA 3DZBA 3MRXA 3NIFB 4FD2A 4HAOA 1WCIA 4LISA 5FTNA 4F93B 3QF4A 4GX5A 1SQGA 4CMHA 3QKSB 1AXEA 2PLWA 5CK4A 1XEFA 3VI3B 3WL6A 4BATA 2JA2A 4C78A 4MYTA 3THRA 2ZR0A 4MHTA 3BFXA 3M6MD 9LDBA 2UKDA 3D3JA 4BMYA 4BKUA 1IOLA 1BRTA 1M34E 4KQFA 2EGHA 1D2EA 1LBEA 4GZ3A 4R6XA 1H8HA 5CBPB 5LM3A 1FJGB 3W3ZB 4FB5A 4HRAA 1YDMA 1SBIA 2B1JA 4DNOA 5ALDA 2CNWA 2FW8A 4HTAA 3RS5A 1EHYA 4U2KA 4LPSA 5FQNA 4B3DA 4DV3B 2OR3A 2HWKA 1NBME 2OHXA 2XB2A 4OUDA 2B1QA 3CHYA 3AETA 1MR3F 3L05A 4W7IA 3UW3A 3RASA 1EESA 1E9FA 4GMFA 2HSDA 5JARA 2XCOA 3B70A 4OYYA 1KY4A 1DC6A 4WTOA 3V4SA 3EEOA 2VDKB 4XVHA 1PG5A 2GZHA 1M8KA 2HO4A 2BOVA 4NEHB 4JQZA 3NZEA 1MT3A 2X1MA 3RUFA 2BM8A 4M0EA 5KAPA 5HDBB 5CW1A 1W1UA 1E58A 4BRWA 1Q5NA 4HWSA 1WMFA 1XZFA 1VJ5A 4X6UA 1W87A 1SRRA 3AG6A 2Q2NA 3BORA 1MABA 2YBDA 4LCJA 1U7TA 3ZI0A 3ZZNA 2NTYC 4EFMA 4GFDA 1WABA 3WRWA 4HEQA 1EXDA 1X1CA 3N28A 1P1BA 2WKRA 1FP1D 1LDMA 3DVQX 3GYBA 3AO0B 4TV9F 1DX9A 4F4IA 4X93A 3TM5A 2PKWA 3DDOA 3NNNA 3ZTTA 4A8JC 1I3KA 3DDHA 1ZIYA 3ETEA 3SBOA 3G7NA 4I50B 4K9RA 1ESEA 1VLMA 2WNIA 2DHQA 3DTNA 1WKCA 1CUIA 1Y1LA 2SKCA 3EEIA 3GEBA 1NFFA 4AKSA 1NN5A 4K9MA 4CQLB 4D5GA 4BCBA 4EYQA 2X40A 1AKMA 1TUGA 1Z82A 4AWBA 1LQ2A 1AS2A 1RKXA 2X4GA 3EFHA 4M76B 4OOEA 1C0IA 2ZB8A 4GP9A 2EGUA 3DHEA 5JAQA 5I7RA 1WD7A 1FDVA 1XTPA 3OBIA 4XWOA 3AV0B 3LK7A 2AHRA 5EQFA 2HV9A 2NOAA 3SC6A 2X1HA 1YBFA 4TTSA 4H1HA 3R5TA 4TWAA 1YVRA 3ETDA 1O96B 1NLMA 1E6LA 2WVJA 1XAGA 2KBFA 2WOOA 4FOOA 3NTUA 3ZWOA 2BFNA 2OXIA 3JRNA 1TE2A 4Z0TA 2AQKA 2GPNA 3HKEA 4MRVA 3DH0A 4O4HB 4V0RA 3Q9NA 2HYIC 2CLLB 1SXGA 1FUYB 3PNYA 1RZVA 1Z8NA 4PAGA 2PFMA 3TW6A 2BFEA 1NVAA 1J6UA 1XTJA 3AHGA 2QSZA 4D4IA 4MP8A 4EHLA 1GA1A 1PBTA 2ASVA 3WO1A 1W5TA 4J1TC 3IR5A 3EW7A 4PZDA 1U5BB 2D0IA 2DFLA 3OPXA 1TZCA 3P19A 1GV0A 4X7PA 1P6QA 1V25A 2BP7A 3NDBB 4PNHA 3CF4G 5B58T 3K70D 4H16A 3AESA 1BO6A 2WHRA 3B78A 2YQZA 2RHWA 4N49A 4YVFA 4JWTA 3I92A 5DI3A 1K8QA 1YC2A 2PR2A 5F1PA 3EGXB 2H29A 3RBXA 1QHYA 3AF4A 1GSHA 4FX2A 2B83A 1N6IA 1LK5A 4MKXA 1OI3A 4W6QA 3COSA 3IXMA 4FLEA 3I9LA 1TLLA 3ZHXA 3ZK7A 2ZG6A 1KP9A 3ILVA 4ZVTA 3LGSA 1XPJA 3PT9A 4YFYA 3ZQJA 5IK2D 2EG5A 3GPCA 1HG1A 2GFQA 1R0CA 2Z04A 3GEDA 4X92A 5EMNA 3ABQB 3IKVA 3KLOA 1Z6XA 2BI7A 4JH0A 1OLOA 3PDUA 4RQBA 1ZK3A 3V2GA 5F33A 1JVSA 1A8PA 1ZOSA 1W1WA 4MWZA 1YCHA 1UJ2A 4UDNA 5TQ0B 4WXRA 2BGMA 2HX1A 3HVRA 3KKQA 1E79D 4L72A 3TR0A 1PJ4A 2C2OA 2LVBA 3VYRB 2VNAA 5B6PA 4XX0B 1G8YA 2GERA 3OA2A 5KPJA 2RK6A 5EJ7A 2UZ3A 1NXSA 1KI6B 2E2WA 1FSPA 4I9UA 4E94A 5IUNC 4PGAA 1B4DA 2PD3A 4F72A 4LFBB 3KZMA 4PSCA 1IHOA 3QWAA 4ND1A 1DC5A 2N75A 5AVKA 1KQ3A 3ZEAA 1KEEB 4NONA 1Z5WA 3GMDA 3RYIB 5FAKA 3I58A 2FN7A 2JGNA 5LLSA 3BGWA 1NOIA 1NBOA 1YI8A 2R6AA 2UU9B 3AR8A 5JSKA 1UXHA 3OZXA 1Y5MA 1XTIA 2WJHA 1F51E 3AFGA 1MB0A 9ABPA 2CWDA 2QPTA 4K26A 2NIPA 1SD2A 2QQ0A 3PBKA 5F2OA 2WQ7A 3W5VA 4ZKEA 1GKKA 1RYFA 1N6NA 2IUFA 2IE8A 2EJWA 2IVZA 3CZMA 2VBFA 3OO0A 2WHPB 3E1SA 1IY9A 1Q16A 1YZLA 2NN3C 2OWDA 2IDJA 3VO1A 2P5TB 2YZNA 4IR7A 4ZEOA 1Y9ZA 1TQHA 3VDRA 1N25A 5JSZA 2AZ4A 1XZIA 4TV9A 3BWBA 1W0KD 1R9MA 1HSZA 3E3AA 4PPYA 4WBXC 1YQTA 4JI5B 3STWA 2MDTA 5AHWA 4AT1A 3LY8A 3LXXA 1ADGA 1O1YA 4XXHA 1WS6A 4MULA 1XD9A 4IIBA 4II3A 3WLQA 2IW1A 3D8NA 4QFCA 4RO0A 4LF7B 1JEOA 3LIPA 2Q27A 4DABA 3MGAA 1Q44A 1ECJA 1XYGA 3DE5X 3MINA 4J0DA 3U4CA 1NKTA 2RGWA 4BLTA 4ZMSA 2RHTA 4R3NA 4D3FA 4HXFB 1NYQA 2J3JA 3H0CA 2FHSA 2RHGB 1N9GA 4ZVPA 1I2AA 5IXYA 1SXJA 1BMFA 2SICE 3EXEB 3IUJA 4IMIB 4NEQA 2CLSA 2D2IA 2HIGA 1UPFA 3ITKA 1XJ5A 4AIIA 1QO0D 2D1RA 1QRSA 4PCUA 5B2EA 4U7JA 3QVUA 1OAKA 2VDPB 2VG8A 1BD4A 4HNGA 2ZUFA 4MR9B 1C5KA 4P92A 5HX7A 2ZSFA 4Y1GA 5DBOA 4HXEB 4UTPA 2R96A 1NPYA 3K0FB 3K6SA 1M10A 1ORTA 1XVLA 3OQNA 1G6KA 5CUQA 4GS5A 3JQEA 1KY2A 2P90A 4HX5A 4W5RA 5AK4A 3ZGNA 4N0DA 5CB4B 3V8MA 1XK7A 1QQAA 2AF3C 3BRWA 4KLNA 4N65A 2XXAB 1XCGB 4UOZA 1RZUA 2ZYGA 4EHJA 1RXEA 4PYMA 1WE2A 2PXHA 5HGXA 2O2GA 4ZT3A 4EFLA 2H63A 1Z4LA 4R8SA 3B2QA 2EOAA 4HDKA 4AJNA 5BOSA 4YQFA 5J4YA 4KSCA 3N0VA 5CR9A 1TF7A 2HJRA 3I12A 4ZC8A 1QAMA 3LW7A 4MP3A 3C8HA 3G5LA 4E7OA 1JKIA 4Q21A 1VQ1A 1O5TA 3WV4A 4BV8A 4PN3A 5KJFA 1JU9A 3ZV6A 2AS0A 2D8MA 3P2IA 3QVSA 1VKNA 3PQ2A 3LM8A 2YXLA 3GLHE 1X70A 2VZ8A 3TQCA 1QIKA 2QUZA 1NE2A 4N0EA 3ORHA 4EIWA 4MVJM 4KDEA 4UEWA 5JZSA 1Y8ZA 4N48A 3HVHA 3I28A 3QOWA 2HIHA 3GZNA 2A0YA 3J81A 1C8LA 5H81A 1JZTA 1E5LA 3ZDRA 3C4JA 4PNPA 1ZWLA 1ZIXA 1R9JA 3ETLA 5DJ5A 5T6MA 2ERXA 3ABSB 1RACA 3H1GA 4DLZA 4G0MA 5I3ZA 5I9TA 4YQZA 3IP5A 6REQB 2ZJ1A 4RADA 2YKGA 5SZIA 2CCJA 4TL6A 3EAQA 3RYTC 5FFFA 1E2IA 4N6OA 4A2CA 4O4LF 2AEJA 2IZOA 2OOSA 3IQZA 1AV7A 3C8MA 3OIYA 2M9MA 4CV2A 1NKVA 2D5IA 2PYDA 2RHMA 1T5TA 2BR3A 2FP4A 2P9FA 3AUKA 3L7LA 3R44A 4V0MA 3UHPA 1YBHA 1H4SA 1R66A 3U0BA 2W58A 3EZFA 4Y18A 1RAEA 4N40A 1EK0A 4DLVA 4RACA 3H19A 1UC4B 1WDTA 2Q8PA 3LV8A 2FA9A 4LTMA 3G8CA 5BN4B 5T4FA 3ONFA 4C7OB 1A88A 3CKYA 1Q1ZA 2IZ0A 2GN9A 4IV0A 1AF4A 1ZJJA 2BFWA 4QELA 1ZINA 3R20A 4A3SA 2GX6A 1NUUA 2Q8NA 3ROPA 3W9YA 2AUMA 3ZE9A 5C80A 4CKCB 4LRYA 2RAUA 1C1XB 5KC9A 3JZDA 4HT3B 1CE8B 1ZU5A 3WK6A 4BP9A 1VKZA 1M7GA 1VMDA 3ZHCA 2G5PA 2QHXA 3S2EA 3W5DA 3KCNA 2LP4Y 3NUZA 1CVIA 2GYVA 3GGSA 4HDMB 1WB4A 4V24A 3RG2A 5CPFA 3CX4A 1B8UA 1DE0A 1ETHA 2HBYA 3EVNA 3HJNA 5I7VA 4NEGA 3W5UA 3IUNA 5H16A 4MZDA 5I5GA 3T7CA 2P62A 4CQMA 4UOEA 3HNOA 5JECA 3CEMA 1XNJA 1B00A 2YUTA 3TZBA 4LTDA 3ZCUA 3TSZA 2OQVA 4BQNA 2ZRFA 1O2DA 3T5BA 5DWQA 5A4DA 3DHYA 1QV6A 3KOZA 3HI4A 4AVYA 3UT6A 1XXLA 1XFAA 2XWJI 1IN7A 2CBGA 2M6RA 2WW8A 3CSUA 4JITA 3U4QB 4KSBA 3BD9A 4GRDA 3UMYA 1JEEA 1A04A 1F60A 1G3UA 2ISCA 2ZJBA 3OCYA 3BMQA 1AK2A 3EH1A 1YJAA 1SIUA 5JNTA 1U0SY 3VNUA 3RTAA 2I66A 4S2EA 5FUMA 3SNKA 2JA1A 3AR4A 4PZUA 1THTA 1U2GC 4AZVA 5JZBA 3G82C 1RPJA 4KXXA 1ENPA 2QYHA 5E6UA 3ZEIA 4UNIA 4BQPA 2OD9A 5TEWA 4L8LA 4DWJA 3PUVA 5IN4A 2DH5A 2P0YA 3V80A 4BO3A 3JD4A 5AESA 5I9SA 2XGSA 4DJFC 5LDHA 2H1OA 1GZ3A 2J3LA 3PP8A 3GJSA 4B82A 3H1BA 4ENRA 1GGJA 3R4CA 2Y9MB 3B38A 2Z83A 1CF4A 1A9RA 3U7IA 2ZXUA 1R15A 1GQYA 1UJ4A 2O6HA 4OJKA 3ZXIA 1N2JA 1YA8A 5HS6A 2IEGA 2J4FA 4WXYB 2P41A 1F48A 5C8XA 5C4MA 4IUCS 2YMQA 2ZJ6A 3HPQA 5ADUS 2AWOA 1ONPA 1PS8A 1FNMA 2XMRA 1QC5A 4X95A 4M53A 2FPUA 2DWCA 1RYZA 1HTWA 1QYDA 3HBJA 4QQNA 1KI4A 1QQ5A 3RVBA 3ZNPA 2DKOA 1SULA 1USVA 1JQEA 1K97A 3GAFA 1K4YA 3PFCA 4MEBA 3ACCA 3IEUA 3N74A 4BMZA 3VPDA 5IH3A 1NY6A 4OGFA 4FCCA 4JJZA 1Z0IA 1Y81A 3MMSA 3ORRA 3W06A 3FB1A 1FQKA 4Y6SA 1K62A 2PEZA 2PIDA 3K0CC 3PEVA 4R1TA 1HT3A 5EPOA 4D6PA 1AS0A 1NT2A 4DSOA 3K6RA 2A0WA 3DMYA 3W34A 5CDFA 1G98A 4LDPA 4WASA 4LI0A 2IOFA 3B36A 3UOAB 2D2EA 4ER0A 4TUYF 3PEFA 2Q3EA 3RAEC 1DRWA 2YJGA 4MS1B 5EQTA 4R9VA 4TWJA 2C1EA 3ZDFA 2WAMA 4WZ6A 4ZOAA 3UK6A 2DCMA 2CV2A 4O4LA 1FDTA 3TUIC 2I1WA 2X6QA 1X2EA 1UCFA 2QG9A 3HA7A 1D4FA 3LA8A 4OH1A 3KJNA 3SYTA 3UA4A 3L4EA 1GPLA 1U98A 2JEYA 2EVWX 2V4ZA 3KZOA 1KC1A 2EIHA 1IE3A 1O94C 8MHTA 4MEJA 3C2QA 1QUEA 1KVUA 1ECPA 4R3UC 4ZVOA 2IH4A 1YAHA 4JGIA 1HNZB 1MXFA 3PYMA 2ZP1A 5JS7A 5ESRA 2VJNA 3D81A 4WNIA 2XTJA 3EYWA 5HILA 1LLQA 1TVCA 2X23A 1Z6GA 5LZ9A 4TTPA 4PYKA 2FZ5A 2B8EA 3DD5A 4WKNA 3WFJA 4G5HA 2CFOA 1R4AA 2H1VA 5I6DA 3JQCA 2GF9A 4RL4A 1PTKA 1ZOLA 4KWEA 2I2BA 2X8BA 1Y7HA 4A6XA 2ABWA 4BB5A 3F1LA 4MUAA 3M5PA 2ROQA 5KYUB 3SR4A 5M34A 2XMCA 1OGIA 4MV9A 2J6HA 1DG1G 2ZIUB 3FYSA 1KYVA 5AJXA 1TK2A 5F1YA 4A4DA 4OLFA 3U6BA 1HYEA 2ZSAA 2A67A 2V7QD 2COKA 1R6AA 2X14A 4PZYA 5DT9A 5LP6F 3NWEA 1E1CB 1MC5A 3FZNA 2QQEA 4N6GA 3BB1A 4R8MA 2JRLA 4C04A 4D9NA 4FDVA 1QVRA 2F43A 3UPDA 3B8HA 2OGSA 1CB0A 1T10A 2P2YA 4OFZA 4QTZA 1P4JA 3HJUA 2XT9A 3SS8A 4J6FA 3HR8A 5G4KB 1PS0A 5I9BA 4OGLA 2KLHA 1WETA 3B9PA 2CT8A 1E2PA 2R87A 5JBQA 4P38A 4HKTA 2FU5C 5IH7A 1E96A 5TGDA 3BBLA 4EUHA 1Y9DA 1LDYA 3PI6A 1OJLA 1SZCA 4KTVE 1TUIA 3WS7A 3K2IA 3ABIA 4YRLA 4F9EA 2GKGA 2ZRBA 4KWHA 4YRZA 3SIPA 2WE8A 3FPFA 1OGJA 1Z6AA 5C5EA 3QFFA 2HSGA 1JR3A 4Q4JA 3EA5A 4KGZA 1I36A 4E30A 4W1QA 3THSA 4AF7A 1DFIA 1KGDA 3JD0A 1QOZA 3KKPA 5ARDA 5L53A 4GKJB 2VF7A 3L40A 1CX9B 4WZAA 1SCAA 2GH1A 3B82A 1FUUA 2A92A 2Z57A 4AWAA 1OKKD 1E5XA 1G7TA 3X1XA 1ODSA 2QM7A 4DGSA 1WOYA 3ONNA 1VXOA 3JYLA 2C9CA 5A6VA 1NBAA 1JSWA 3V8NA 1BFKA 1OTYA 1W76A 3EGDB 3AYZB 3PRHA 1ZNWA 3AJ9A 2V03A 3R5SA 5CFPA 3R3WA 4ZOLF 3WBBA 3RVJA 2F59A 2RDMA 1LPOA 4RHUA 2AJCA 3DGFC 1RAFA 1U0RA 3GG2A 1EFPB 2WDPA 4BLSA 4BFLA 2PT9A 1AN0A 3A4IA 1Y1SA 2NYUA 3EG5A 1N1GA 1VE3A 4PE5B 1ULBA 2A1UB 1UZNA 2Z8YM 1Z37A 3BIOA 2AQHA 4MV4A 1K8XB 4E46A 1OOEA 5AKIA 5FUQA 5KSYA 3ETHA 3OPMA 2PX8A 1GADO 5BSTA 1NUAA 2PUEA 3G59A 1HQKA 4B7UA 1VIDA 4J16A 3C6QA 2W6JA 1ZHHA 5EUMA 2XNHA 3BUSA 3GNQA 4MGKR 5AOVA 4CCWA 8ADHA 4TKVA 4KAJA 3NI2A 4LF4B 2G9RA 3AMVA 3IUPA 4A0GA 4OXIA 4DGQA 7AT1A 1PW7A 4PYRA 4TUYA 2NU8A 4BJHB 2FTKE 2WT4A 1UJ5A 1JPJA 1XDWA 3CVVA 2O8DA 2NNWB 4YJDA 1CHNA 3BWYA 3IV6A 4PXSA 3T3IA 4E5MA 4D8VA 1G5FA 4G37A 4CMGA 4NZOA 4MWBA 1L9XA 4ZVVA 4UHJA 3UMRA 1KQNA 1T2VA 1WU8A 3EWAA 5CLGA 1M6WA 3F7NA 4YONB 4FCVA 5G3YA 2ZSIA 3QEMA 4LV6A 5KYYB 4KW7A 3AJRA 4ZPJA 3PNQA 3AERB 4PQFA 3PPVA 4EGSA 4ZZ3A 1HBJA 4I81A 4OP1A 5CNKA 1K5DA 3TLZA 3EEBA 4S0ZA 3CH7A 2HRQA 1JR6A 4PVCA 1O03A 3AEYA 4CQLA 1U28A 4D8XA 4A7PA 1W6RA 3KFVA 3KT3A 4LNUB 4AG3A 4RSRA 2A0FA 2V7UA 3HKCA 2JI6A 3PTAA 2FEWB 4IIGA 4LDAA 1G55A 2D54A 5IF3A 1KFCB 1PF7E 2B25A 3UXMA 2VH5R 4A36A 2JH9A 2SCUA 2WINI 5LOVA 5JXHA 1L6RA 2ST1A 3QJYA 1HXHA 2B1RA 5DW0A 2O8BA 4AN4A 3OSUA 3G85A 2Q5QA 4V0QA 5KTOA 1PT5A 1NSTA 2YXPX 1U2DA 4OQXA 4B45A 2Y0CA 1M1YA 2E6KA 1LK0A 3V32A 4OV6B 1AF7A 5J40A 4YUZA 5EXEA 5I8ZA 4C4XA 2D7DA 2RHOA 4DT1B 4G56A 1OTXA 1XOIA 1K3FA 3DE6X 4K3VA 1WOMA 5JHHB 1V41E 2JFVA 2NSJA 1YR1A 3LKBA 4LXUA 3WKAA 1GKIA 1XROA 4RORA 3T7DA 1O97D 4EITA 2AOTA 2X58A 3FPKA 2VYCA 5BSKA 1FDUA 2VPYA 2Y4OA 1Y8RB 3G8DA 4F2GA 1J99A 4LXXA 4A15A 1GQRA 1QIEA 1YU9A 3N2IA 3MS7A 4NK5A 2J41A 5AI4A 3TNYA 1Z4IA 4O2RA 5LZ5A 1XWOA 2CFSA 2BC9A 3VGJA 1QLWA 1P0FA 3UMFA 3NOVA 3WWYA 3THWA 2X0RA 3LYHA 2EKZA 3EN0A 4OFBA 2ZLBA 1OXVA 1BWPA 2OHHA 1T8YA 4QFDA 4RVOA 1P5FA 5E4JA 3ZVMA 1L5VA 2RONA 5CNMA 4YCNA 1CIVA 3JAKA 2BW0A 3OAAD 1FPQA 2EIXA 3JYOA 2QL9A 3KHKA 2BV3A 2QVZX 5H82A 5K0LA 2ZJOA 3OA0A 4HDOB 1ZUNB 3EQZA 4BPRA 2LW7A 3I1IA 3V55A 1KO8A 4RXTA 4EG8A 4PTZA 2OHGA 2ZK7A 3OM0A 3ZC3A 1Q91A 5ALQA 1YE5A 1DIAA 1EDDA 4ZOLA 5FPPA 4Q4HB 2JIDA 4LJSA 1L4YA 1XSEA 2AYXA 2G7MC 1LX6A 1PEKE 1IQPA 4V2UA 4ZANA 1NVDA 1IOZA 1AS3A 4QJIA 3MWLA 4HLUC 2V3VA 4O2AF 4NX2A 1KSGA 4CJXA 3DHVA 1FF9A 4ASUD 1GKUB 1CUBA 1R9NA 2W0SA 4Q7LA 4YBRA 2PZJA 5EMJA 1T6XA 4KWIA 3ZWQA 4QRHA 3FHLA 3AB8A 2AF4C 2FWAA 2WHEA 1Y7IA 2ZRIA 3OE1A 4I8DA 4OHBA 4PHGA 5A7HA 3HVUA 4ON9A 5AVRA 1AQUA 2D27A 1QKJA 2XTAA 4YUVA 1TUBA 9ATCA 3SYLA 4P35A 5J4KA 2QQGA 5LYYA 4RTLA 2HT6A 3HP1A 1F0YA 2B4AA 4FEYA 4Q9HA 1A5BB 1DI0A 5THKA 2XCRB 1QFXA 1RXUA 3U62A 1V48A 2B2CA 2G72A 2YHIB 1LI5A 2W4IA 3DQZA 2MU1A 5F5XA 3K32A 4BNLA 1EFUA 2AH5A 2C9OA 3RDPA 1EK5A 1H94A 1FQJA 1H8HD 1OR8A 4IFBA 4AS3A 4B80A 2OGTA 3CB2A 4PLTA 2GS9A 4YP1A 3I5MA 1S3FA 3TOSA 1LU9A 1KMQA 2CMDA 5GINE 4OHPA 1CDDA 3UWSA 4MW1A 1ISSA 4MLZA 1FFXB 3VH4A 4GH5A 4CCYB 5HE8A 1CQJA 3PJFA 2WKWA 3STHA 3GLTA 1USIA 1Z7WA 5TR9A 3BN3A 3F7OA 4CUJA 3LWBA 4JB0A 5BVHB 2L2QA 2OORC 2VWGA 1Y6RA 2I2XB 3BWMA 3ND8A 5CX1A 4MPDA 4NH0A 2VYND 1EB8A 2JJ1D 3OIWA 1P19A 5D5HA 4BB0A 2B5OA 3CH4B 3OHMA 4XR4A 4IDNA 4CTJA 5C8VA 2VUTA 3BFJA 2IV2X 5TQ2A 3WICA 3YASA 5HKBA 3A6KA 1EBBA 3LDGA 1ZLXA 2AR0A 5JZMA 2CLEB 1RHKA 3L8HA 5GV8A 5I7UA 3NVMB 4Q3AA 3H05A 4WIAA 3TOVA 1IHUA 1NE7A 4KH0A 1J25A 1S7GA 2L69A 3VZCA 1VIMA 2MJLA 2Z58A 1UKBA 1Y3IA 3K4QA 3PRJA 4A91A 1LSOA 2NZXA 4LDNA 1TMGE 2N1MA 1B41A 2FPGA 3L49A 5IJWA 2P8JA 3CMMA 1P2TA 3O3OB 1J97A 4HQLA 2QNRA 3TLMA 5CLJA 3KKMA 3L7IA 4F86A 1Z5ZA 5BVGB 2WBLC 3SIRA 4FR5A 1M2EA 3IAHA 4DV2B 3IAS1 1ULHA 4B3XA 1T6YA 2R6CA 3EK2A 1XTTA 1TTTA 4X63A 2RHJA 3P9PA 2UUBB 4DXHA 1WBDA 3DVRX 2HWYA 5AKEA 5KDDA 3WWPA 5FLKA 1L7EA 2YS7A 3Q7EA 5LNK1 3TKAA 5L3QA 2D1QA 3T0FA 4GKBA 3W3AA 2HQOA 3KLBA 3P52A 3SK0A 1K3UB 2PX5A 1N0UA 2QLTA 4E5UA 3LUBA 1I24A 1WMDA 1IBCA 3AF1A 4E12A 2JHAA 4TX1A 3COYA 3IUQA 1XKQA 4QU5A 5DM1A 1VHWA 3FAZA 3ZE7A 1E1NA 1I6KA 1PAUA 2AUNA 3PVZA 4GSKA 3S8MA 3FG9A 1RNLA 5KTRA 1WMSA 3K30A 3F5DA 3KEOA 3KPUA 4WJLA 3NC1C 2G9VA 1BX0A 4X44A 4ZI7B 1E2MA 5DMXA 4XYMA 4CEHB 2JPDA 1RLOA 1ZXXA 2HJGA 3QK7A 1D2RA 3U1TA 3VPHA 3OX4A 4FFWA 5IBRA 4DC9A 2QZJA 3CRVA 2XJ4A 5C5IA 1Y9JA 1QRUA 2IW3A 4E21A 4DZZA 4PSDA 4ARCA 1L7QA 1PO7A 2DC1A 3BB4A 1J3UA 2K7ZA 3LYUA 3R3VA 1N2SA 4K6CA 1U11A 4OREX 4R4JA 2GPAA 4HI0E 1U90A 4P4SB 3UYLA 3VU9B 3PZBA 2P6UA 1AXGA 4MS4B 2EHJA 4HJXA 2Y1LA 1M76A 4JB2A 4RMNA 5KX5F 3LP5A 5C8YB 2Q8QA 3CJRA 2WHYA 3R09A 5DLEA 2O7SA 1RXSA 2OVFA 4OKIA 2HDWA 3ZDYB 4QXAA 1F4VA 2IKSA 2ZT6A 2IKQA 2VJLA 1ONSA 3FBWA 3LQ1A 4HN4B 2HGZA 2QE7D 4QULA 3KQNA 3U3KA 3HK2A 4LHSA 3JV7A 1SEPA 2JGRA 5LZ7A 3MPUA 3OFJA 2GHQA 4YRBA 1VE6A 4OX9B 2GN1A 1T9HA 2CXXA 1U0FA 4NPAA 2HMUA 3EH2A 3KPWA 4MB6A 1JV2B 5KOJB 3B2NA 1A9XB 3O1HB 3VVCA 3M81A 3DBIA 1OFGA 1QGAA 1MHTA 1MJGA 5IUKC 4GPTA 2H4YA 2FXIA 1KZ4A 2XMBA 2QSJA 2Q5JA 3EMDA 3ELYA 1SCIA 4TQ9A 3SQLA 3EPRA 3AFNA 4PTYA 5JYCA 1SXQA 5ALPA 2YN0A 3C98A 5IJ0A 2HJWA 2E55A 5E7MA 4FMDB 1PR3A 2H85A 3NHJA 4AIRA 4D82A 3D6UA 3ETJA 4ZYXA 3U7FB 3LVFO 1TVKB 2N1BA 3AW9A 2GXQA 3P2KA 1I01A 4HGOA 1D0VA 1E2JA 2IUUA 3KOUA 4UUMA 1JLKA 3NGMA 4PLYA 2XODA 3QBEA 2CN1A 3D3WB 5DPMA 4GGPA 1EK2A 3QQPA 4IXTA 1GL9B 4C0WA 2ZYSA 5JY1A 2WB4A 1XZBA 1EWVA 2VNKA 1RIIA 3HYCA 3IO3A 4N0PA 2R8EA 3IILA 3EFOB 3ZZ1A 5TT1A 1HDGO 3CH5A 4B3CA 3D0OA 4UBIA 2OXTA 1EFRA 4DJ5X 1XMQB 3KKZA 3VR2A 3JD2A 5ESWA 4ER5A 5IJXA 4WNCA 4GICA 4R16A 2YYYA 3ZGYA 3IIIA 1A8IA 1M8GA 2A9PA 3LC1O 1TUEA 2FFQA 3PC8C 5FAXA 5JYDA 4MX2A 1V11A 2C07A 1H0SA 1F8YA 3ZVRA 5JAOA 5KDOA 1JTVA 5TS3A 3H6GA 5I45A 2YXDA 2QAJA 3HFJA 2NO4A 3LO8A 4INJA 4WOCA 3R7NA 4NENA 1JF8A 1Q1EA 3UB2A 1HT2E 1I2DA 1XTQA 2I80A 3EIUA 3MGKA 1RW4A 3AGPA 4INOA 3WKDA 4EJ6A 1O6ZA 5BSWA 5JC1A 2Y1GA 5JNWA 3CG4A 3TLXA 1NULA 1ZS9A 3H75A 3N2KA 4INPA 4X6LA 3DL0A 4NL4H 5AW7A 3U4HA 4YMLA 3DKPA 3TGPA 3A9WA 3LPDA 1ISMA 3I76A 2A84A 4HF7A 4EBFA 4MR7A 3RG8A 3LF2A 5FWYB 3RIGA 3RUPA 3C5VA 1G21E 4MS4A 1LW7A 1SXJD 5CFRA 1V0JA 3D7RA 2HPHA 3ZHRA 5E9WA 1SB9A 3L8FA 1RJFA 5BV2P 3FF4A 3TIVA 5GP1A 2IWRA 4ANFA 2UZ4A 1G60A 3F9RA 1WCIB 3M2PA 3LQ2A 3A14A 3PSAA 3QF4B 3EEFA 3VR4D 2JHCA 1LZLA 4B4OA 3THYB 1YMUA 2P1RA 2ZITA 1EU1A 5TVKA 6AT1A 3TG8A 2HJ9A 5TB5A 2VNJA 2B99A 3G5MA 5ALGA 2VQSA 1HY0A 1J2JA 2Q3DA 2YICA 3H18A 3ILYA 4HH0A 1CQXA 4NJMB 4RGBA 3RS0A 5E7IA 2PKYX 3BKWA 1HTBA 2IPNA 2JCGA 1HM5A 2WMDA 3BRWD 4G0XA 1W9MA 2ADMA 3II6X 2FW0A 4GR9A 4OQYA 2CNLA 4F1JA 4L76A 1CZKA 5GOZA 4CMIB 5KX5A 1U3UA 3PA8A 1M2KA 1UBLS 1Q7EA 2IPLA 1N2CA 5ANRB 4CIAA 2BKUA 4OHWA 3HADA 1II8A 2JGLA 3CLRD 1YQDA 3OIDA 1R16A 3Q87B 3KWFA 2JNWA 4NE7A 1FFBA 5EJIA 4ZO6A 1WXGA 2HQSA 1ZCBA 3O3CA 3VZSA 1R18A 1WM1A 2BFOA 2RJNA 3N59A 5FWXA 3DJYA 4MVWA 2CXNA 5MN5A 4KNYA 2ZSKA 5DYWA 2HFJA 2QGAB 4WACA 4DMFA 1A97A 1Q77A 2DJ5A 3KAJA 4KDCA 4HQ0A 5NLLA 3DKIA 3NYRA 1IN1A 4EYSA 1SUCA 1USGA 2Q4DA 4HQ6A 2A30A 5LMZA 4DWOA 4P1ZA 4PR3A 2B69A 3RC3A 4PZPA 4XH9B 1H66A 4QX6A 4ZQGA 3ZQ4A 1RADA 4DFDA 1E32A 1WVMA 4B46A 3BMXA 4TVSA 3H7AA 1XL1A 1RHRA 2H57A 3TZEA 1KEKA 5KJEA 1WB6A 1GKLA 4DCUA 4QZVA 3OPYA 3V1LA 1Z7EA 1RXVA 4YJ2F 4YCAA 4M0CA 2YWFA 3IVCA 3GFBA 3ZTWA 3DVAA 2H6EA 1IXZA 4X45A 1BS2A 3AY6A 5SV2A 4W5TA 4R2WA 1S02A 3H04A 2IEAA 4K03A 1WWKA 5F64A 1KJJA 1ZGCA 3RVKA 4JP8A 1SC4A 1X7ZA 5CFMA 1I4OA 3TD6A 3EYAA 1KXZA 3MJTA 4RW0A 5JROA 4CTOA 1MRNA 5KS2A 1ANKA 3AVPA 3BFPA 3P8ZA 3PNLA 3DNMA 4V0NA 1G41A 3HA2A 4IIUA 4YI5A 3ZQUA 5D8DA 3WZMA 4F8JA 1A5SB 4MRAA 5EY5B 4C2BA 1YZYA 3GLVA 1L5HB 3DL7A 1EUCB 3T9AA 1I7DA 1ND5A 3THWB 4PINA 1CYEA 3PX7A 2V0CA 1LDBA 3WGQA 4LYDA 2NT3A 4JLWA 5JALA 2ILTA 1T5LA 1LQUA 3HDVA 3M34A 3NHMA 4WV3A 5H4HA 3SQMA 3UMSA 3ZW9A 2JKYA 3JWGA 3HKEB 4M9QA 1W52X 3KJXA 3O4HA 1E7QA 3OVMA 4UTZA 4BN4A 4CQMD 1TJYA 3G2PA 4FGLA 1TXGA 2XE6A 3H6HA 4C4AA 4XYEA 3PFFA 4I08A 3AV3A 5LMUB 1FUEA 1G19A 4KK3A 3DVSX 2OTCA 3V3KA 4RY2A 4D7AA 4R69A 3AOEC 3UCEA 1GPNA 3EEYA 2C00A 3OU7A 3JQAD 1BYIA 4Q7MB 1L7MA 3FMVA 5F7JA 3WKBA 3U7HB 3TLCA 3VX4A 4B2PA 2DOKA 4FHCA 1NI4A 2GN2A 2QMOA 3PC3A 5EJEA 3NRCA 1WCWA 3RF6A 3E8XA 4MIKA 4P3PA 4JLJA 4ARAA 1T3LA 4FFBA 3AU8A 2WJPA 4XIFA 1KVSA 2OC9A 3KKEA 4KR3A 3IHTA 4JYAB 3O8QB 5IYZF 3OPVA 2C1ZA 5T3YA 4AO6A 1DJLA 3WIUA 1DO0A 3KZKA 1RXCA 4U1RA 2RC6A 4G1BA 2C92A 4BVLA 1U3FA 3ERCA 2JAOA 1CJKC 4G26A 4JVLA 5DNDA 1Y4ZA 2IIBA 4DCSA 3DLPX 3ZVKA 3OIFA 4D4LA 2OBBA 4G41A 2AGVA 4BO4A 3TTVA 3H11B 5A3QA 3WL4A 3KB6A 4KQMA 3IJEB 1RWKA 1YQ9A 3LJKA 4OMFG 2QPOA 5CLIA 3ZJ5A 4CCSA 1WZ2A 3UOWA 5HKKA 4XTCS 2FYTA 4JLNA 5EFZA 1YRAA 1UK7A 4FGKA 4I6EA 3BERA 1GZ5A 1TD9A 4MQFA 4E2ZA 1CUFA 4IIYA 2GFIA 1ZVVA 4TT3A 4QEKA 2DAPA 1JE0A 4M21A 3M1LA 4MVXA 1QS0B 3B89A 3GFOA 4R41A 1E69A 2E85A 1HLDA 4R98A 3HL4A 1DV2A 3S28A 4C29A 2GEJA 2WZCA 1ULSA 3H8WA 4QOJA 3TI9A 2VJMB 4CIBA 3DULA 5LQMA 2O8EA 4D9FA 1CZUA 1QDUA 3QVVA 3PKIA 4QUEA 1X1RA 3QP9A 2XHZA 1RWNA 1DRJA 3EBOA 5CCEA 4BDTA 1SMKA 1ZUHA 4R8RA 3VC2A 5LQNA 1U81A 2F48A 2FWBA 1SPBS 4KWTA 3MJRA 1QHXA 2PSDA 1T3ZA 2ZS9A 3MJDA 2OB2A 1L4NA 1Q5PA 2R8PA 4PQRA 5DM2A 3W77A 4IZOA 2FHPA 3WZ2A 2C5FA 2JC3A 5AVUA 2YJ3A 4YJ2A 4CLEA 4TT8A 2X42A 2CCGA 1TZMA 2EF0A 5JSZB 1PNOA 2C2YA 1TC1A 1FE8A 2AN3A 3UMVA 2RGAA 3GGDA 4E5KA 1N0IA 2EFGA 2FG7C 2ICAA 3GRFA 3LKDA 3PVCA 4FKBA 5HOQA 4IO1A 4IY1A 3A1VA 1DC4A 1YFLA 1TZBA 2WJ3A 3S4YA 2E4XA 3E3OA 3GVCA 3G5TA 3FN4A 2KS6A 1NG1A 2BDTA 5LFAA 3WHPA 3KSMA 3MINB 4PPGA 4FDLA 4ZEMA 3R6VA 1LPAB 4JI3B 3VV2A 3AF5A 2WQ6A 1N9GB 3I83A 2V74B 5D3KA 3HN2A 4QEZA 4DPLA 1PWYE 4FW9A 4LHZA 4G25A 3GW8A 2CE2X 4GGOA 4BEWA 4DDWA 4TL7A 4BE4A 4MJ3A 3EG9B 2R6JA 3TAHA 1A8UA 3PGXA 4PAQA 5E95A 4OO3A 5CVJA 4OQLA 3ZW7A 3F96A 2CL6X 3GUZA 1GYQA 3IAEA 2OYCA 4P7FA 2JVJA 4DTCA 1L4EA 2F1RA 5H1YA 3KT0A 3ZJTA 2Q3LA 1ODCA 4J2HA 2LR0A 3BHMA 3E5RA 2C4KA 2HA2A 4H0NA 3TQRA 4F85A 2AMVA 4OI4A 2A1IA 4K9PA 5ILQA 4D56A 2YYAA 4YLGA 3EVZA 3O8NA 3P32A 5KTNA 3BL6A 1SM4A 2IK8A 3TQHA 4PR0A 5JTTA 3L0DA 4LSZA 3TQTA 1UKEA 2ZYIA 3QTLA 4IV8A 3WQBA 1U8CB 4ATNA 3HV0A 4D8TA 4ODIA 2L18A 3FNFA 2WWWA 2EF1A 1LRJA 1YE3A 2VRCD 3OJOA 1EHIA 5DIZA 1NXTA 1HO3A 1O9BA 2Q2QA 4GXQA 4Y0AA 2Z5LA 4KN5A 4WFIA 3I9V1 1Z47A 2NZ2A 4Y9SA 5FI0B 1Q0ZA 1XGKA 3UJ3X 3ZE6A 3EZ9A 5JXGA 5IYZA 4MI9A 4LMRA 3CR3C 1MLDA 3BZUA 3WYDA 3KQYA 4OU5A 1U94A 3T5TA 3WYBA 3ZNQA 4KVGA 4EELA 1LBIA 3NTLA 4PW0A 2FRXA 2I5PO 3NOOA 3PNVA 3R2JA 4FHFA 3FNIA 4J1NA 2GK6A 1CP3A 2H65A 2PRJA 3KALA 3KTAA 1KMHA 4LRTB 5JXIA 4XGRA 3VNBA 1HEIA 1PEAA 4ZRDA 4A1OA 3NX4A 4ZZIA 3OURA 3UJHA 3NBQA 1T6BY 1ATZA 1GTL1 1RWPA 2H59A 3LUDA 2PT5A 3N7AA 2AMFA 2OKCA 2QJWA 3OWOA 1YDWA 2CW5A 3DC2A 1G8PA 1QCCA 3EY9A 4H2DA 3BFVA 4RDHA 3I5AA 3GTDA 3OCVA 5EWMB 1NVXQ 3LBFA 1E1KA 1JN0A 1T5OA 2RFLA 2CJFA 2ZJ8A 4I66A 2YASA 2ANCA 3GLIE 1PTJA 3MYYA 1U3CA 1VKJA 2IHVA 3QYAA 4HWRA 5A0FA 1JKFA 4WBNF 2W37A 1Z4MA 1XQ9A 1JMVA 3BCRA 3RFUA 2WYIA 4WH0A 5F2NA 1TEXA 2PUWA 2NO7A 5BQ3A 2V5VA 4CKBB 1CW2B 1XN1A 4F11A 2XSZA 5DBGA 1Z7BA 1XD2A 2ZVJA 3GVXA 4NDZA 3B6IA 3H3JA 3FZYA 4LC1A 5KHOC 5JS6A 1MX3A 3WO0A 4HHEA 1ORHA 3G13A 3EVEA 2Z4RA 1GZUA 4Q19A 4A27A 1DQRA 4C2AA 4MYDA 1UIMA 3OZSA 1FX1A 5FPQA 1GPYA 3DONA 2FSFA 1D5CA 3SC2B 3BDAA 2D13A 4HZIA 5TGTA 4BKOA 2CBXA 3K0CA 1V2GA 1II9A 1PS9A 4KXVA 5FA8A 2NO5A 2Q1XA 3MWJA 4F84A 3NT2A 1LZKA 2B5VA 5F98A 2ZIXB 2O1EA 3Q9SA 3N8KA 3MTEA 4Q1AA 1KR5A 4WNAA 3FSRA 5A5DA 2EKPA 5EXTA 2P4HX 4UMFA 2OESA 2FPMA 4E08A 1OZFA 3JASB 2GTHA 3L0YA 1E0SA 1SXHA 2BGNA 5KMGA 2CLDX 1NSFA 1O54A 1XP8A 2PS3A 2WKSA 3T95A 2BH2A 2BHNA 1F2UB 4E1BA 1OLUA 1O94A 1X9IA 2GM9A 3D31A 2OVBA 2GILA 3P9KA 3TPZA 5D7NA 2BBTA 1J70A 2KYRA 4IICA 3W8FA 3QVGA 1NOKA 3JARA 4IHJF 1EAYA 1GGVA 2QGZA 3FWKA 3OJFA 4BX3A 3ZGZA 2PM8A 4YXWD 1RRGA 4EJ0A 2XBMA 1RKVA 2QX8A 1JWAB 4UHFA 3WWEA 1TCBA 3BH0A 2JIRA 3ZWVA 1GAJA 1JECA 1P7PA 4LK3A 4LOLA 4PG5A 1UP6A 1A8QA 2ZRLA 4MDHA 2XB4A 1XRJA 3QFTA 5A02A 4UJ5A 3R9IA 4QECA 2HC9A 2H0AA 3TBHA 5K0NA 4J2TA 5DK4A 1S4MA 5EZ5A 5KKAA 1LPPA 3VVBA 3PFGA 1JILA 1H85A 5LSAA 5AM4A 1AN9A 4GI5A 4D4KA 4TTRA 1AA9A 1Z2NX 3WNVA 4PNEA 1DFGA 1E2GA 1V37A 3ILSA 3HP4A 4I5FA 2PJRA 3KQUA 1WB9A 1U04A 3AQ4A 3BJEA 3D0RA 4ZJYA 1WW8A 3PX3A 4I8XA 5CGZA 3SX2A 4MGEA 1LPSA 4II7A 3ZYCA 3DDNA 2RGDA 5K3FB 5BSUA 1V43A 4B6EA 1JTFA 3QA3E 5A4MS 4Q3KA 2R6HA 3IOMA 4EDHA 2HXSA 1QC5B 3ROGA 1RYHA 1XVVA 1RQNA 2CNDA 4G86A 4U39A 3KT6A 4NV3A 1GFSA 5JASA 1YB4A 4X7MA 5ALSA 3A3PA 5TF4A 4ZCIA 4PS0A 3JAWA 1ES9A 3A1NA 4M1OA 5EN4A 1FBNA 1TIPA 4UAJA 3TIGA 4RJIA 4WK0B 2B78A 2ATXA 4OM7A 3TEMA 4CF7A 2Y8EA 3NBZC 2YH2A 2NT4A 1M2NA 3HKBA 4M8LA 2Y92A 3NRJA 4BNZA 3GK3A 1YNSA 3P9NA 3RCBA 1K6XA 3O1JC 4U7FA 1JU4A 2ZI4A 1SC6A 4DMRA 4BLRA 4OMDA 3JSAA 1VPEA 3FY4A 4R5MA 5EHNA 3VKUA 3PR3A 4AX8A 1A77A 3CW9A 4MCAA 2FX5A 4P08A 3TUZC 3F3SA 3AL3A 1N2ZA 3DAYA 5BNZA 3AF6A 1QWOA 5JS8A 3ENNA 2C2MA 5K3BA 5BWCA 2NACA 2DPGA 3S1AA 1T0IA 3O0DA 2O5CA 4UM5A 1Z0AA 2OE2A 4CKEB 1E0AA 3VKHA 2G0TA 1AO3A 1KEZA 2YMLA 4UUAA 1FK8A 2DWPA 1E9SA 3U81A 1BDJA 2KPOA 4S12A 2I4IA 3BSWA 5KTKA 3F3MA 2I6GA 2FJ0A 1ECLA 5P8WA 4Q4AA 3TMKA 1PFGA 2V7BA 2QMUA 1E2UA 4DQDA 2PX0A 1X9GA 4DLTA 3OT1A 3DE1X 4FD3A 1WPGA 1Y6QA 1ZXBA 2HN9A 3ONEA 4P34A 2JANA 4MH0R 3MJ4A 1WY5A 4TXMA 1TAQA 4GI2A 3L6CA 3KCQA 4RVUA 4V0SA 2I3GA 1AHHA 3UAVA 2W93A 1XDSA 2C78A 2E4AA 3FBGA 4J7CA 4KNVA 2Q2OA 3DAHA 4DZTA 2PGOA 3AR5A 3QBJA 5LR6A 2IP4A 2QBYA 1Z6PA 1HETA 2PLRA 4GKAA 2DQSA 3LPMA 3OEHA 4AFNA 2C2XA 2H08A 4F6RA 1THZA 2C57A 2VT3A 2CSUA 2HPZA 4GSLA 2BTEA 4XWWA 2BDUA 4KBFA 1NVMB 3HCBA 2HU5A 1DTEA 1IRIA 3K1ZA 3PVSA 4UD2A 3WL3A 4BNHA 4IJUA 1AH2A 5DF1A 3IQFA 4ZQBA 2YWGA 2Q5CA 1MV5A 1TCUA 2I33A 3VMFA 3W1WA 4TZ0A 5E0OA 2V5AA 1RAGA 5SY6A 4CLRA 3SZ3A 2HOQA 3GPLA 2I22A 2WZBA 2Z3ZA 3BGVA 1RM3A 2QJOA 1DXYA 1G20E 1VI5A 1Z06A 2GXAA 3AL0C 1HT1E 4KQHA 4XSVA 3L8EA 1UFRA 5LWHA 1CDOA 4ABTA 2EBUA 3NS7A 2X0IA 4IHJA 5D84A 1E2DA 2WYOA 4QPZA 2R4UA 3LZ6A 2LRHA 4H35A 3RAFC 4G07A 1C4KA 2PH1A 2CL0X 3G8AA 4C7KA 3P2OA 4L3VA 1XKLA 4G81A 5FNZA 5ARBA 1K6IA 4Q37A 4RIIA 1F2VA 1A2BA 3HA5A 4Q4JB 1YFZA 2C20A 1IHXA 2Q7XA 1J0AA 1J20A 4JY7A 4GYWA 4IJKA 2QOEA 5CVDA 1OV6A 5CXSA 4MR8A 4K0KB 1N7JA 4DXDA 2VH2A 1J4AA 2WWIA 4Y7DA 3H97A 5B1DA 1W85A 4CMAA 5IF9A 4DV5B 2AZXA 1UKZA 3A3OA 1AZSC 2NSLA 1Z6TA 3DPUA 3HNRA 4UBLA 5B1IA 1A0OA 3B1ZA 5HGJA 2AXQA 2J46A 2PMDA 4KR0A 4C0JA 3CNOA 3LXRA 1QX4A 3AFMA 4IINA 2PCJA 5LZ8A 1U9ZA 4H7DA 2I55A 4AKEA 4FINA 3VNVA 4EF6A 1M1NA 3IIJA 4FGSA 2V1UA 3JQGA 2BEJA 4FQ7A 1JHMA 4OP2A 5D3ZA 4KO2S 1UC9A 2ZT5A 4GKVA 4KAFA 3PNBA 4NYMQ 3A4TA 5IPFA 1L5FA 2VSYA 3M6IA 2W2NA 1R74A 3PD1A 2Q7OE 3SY8A 1PG0A 2APJA 1JG6A 1RBMA 2FFJA 2XA9A 3CLUC 4WRRA 2W43A 4LDRA 3NFYA 4EHNA 2EKQA 1OA1A 1P0CA 3SD7A 3PUXA 1P73A 4ENVA 2H1SA 3DLAA 1BAPA 5IBCA 1CY7A 2PZFA 3QH4A 4KXQA 1Y8AA 1VL0A 3KQOA 4R6WA 5L7YA 3VOTA 5I3CA 4ZCLA 4TZ6A 5L95A 3MT0A 4XVUA 2HEGA 1C80A 2O8DB 2F3TA 3TXAA 1OC4A 1BX1A 1RM5A 2YZGA 3PNKA 4FEGA 4O4IB 2HL6A 2OYSA 4FFSA 4K88A 4RDIA 4EUNA 5CDTA 7ABPA 2B0CA 3ZDCA 2H1RA 1LGYA 2C7VA 3ED5A 3JX9A 2RD2A 4FGUA 4V3BA 4ND6A 3W6NA 1PUJA 3BH7A 2JZNA 1QAOA 4HLUA 4KQWA 1AQ6A 5AJYA 4BEJA 2VYQA 3TECE 3ASVA 5B2ZA 3W8EA 5G0TA 2X0JA 3HNPA 3UBTA 3MB5A 2WA2A 2WD9A 2X9GA 3DA8A 2FPPA 3RHFA 2VI5A 2XWBF 3GBSA 2ZQYA 2ZZMA 2ZQ5A 3QKRA 3Q8WA 1LB1B 1B74A 4DDKA 2WRZA 3HKCB 3MC1A 1KK3A 3FTQA 1NW8A 2AC2A 4LS3A 2RG1A 5K8UA 1EX9A 1KAQA 1WQ1R 3AC0A 4H4EA 4ALMA 4X7RA 4BDSA 1XCMA 1C50A 3FKJA 5EZYF 2PSEA 3NEPX 4U7GA 3TXXA 3VNSA 2CKMA 3GJTA 2O8BB 1P5HA 1UL1X 1DL5A 3GVHA 3Q7QA 3UQYS 1CF9A 5J4HA 3I2GA 2AK2A 3BWCA 2ZJAA 1K92A 1J23A 1TO2E 2JIMA 5CYPA 3TQSA 3UOGA 5LP6B 1INLA 2RGBA 3IO5A 3KIPA 4OKSA 4OQMA 3VSAA 1ONOA 2J5RA 4DNXA 2QD1A 3D8HA 4DANA 3O73A 1SVMA 3NEYA 4G5XA 3SHQA 1JFVA 3KPYA 3SHFA 4POOA 3EVDA 4Q3NA 3TCXB 1T9DA 1FRVA 3Q15C 4B09A 3W4JA 4LN1A 2G5GX 4KOAA 3D8RA 3KM0A 5F3WB 1N2BA 1Q21A 3L0OA 4H6VA 4FFLA 3VR2D 5JCPA 2D00A 3ZWWA 2EBWA 1X13A 4R05A 2JARA 2LBPA 3LOQA 1R4MA 2Z98A 3T54A 4EGCB 4ZV4A 2OMKA 4REOA 2RK3A 2FEMA 4TYYA 3I61A 3OH8A 1P0IA 3A7DA 3DP7A 2HNAA 1P7WA 2X75A 1JJAA 1KGSA 1MQ9A 1OBCA 4G36A 5ED0A 2AJLI 1KYYA 3ZKWB 5C8DA 5IS2A 3HI6A 5TX7A 1HFJA 3V2HA 4BVAA 3MIZA 3CI0K 3DE4X 1T0HB 4JA2A 4O2BA 4Z9XA 1ENZA 4ZOLB 4YMGA 1AKYA 5IDXA 1E6EA 3DMRA 5CK5A 4DRYA 1GGMA 2B8NA 5KCZA 3EIXA 4KGXA 5KDLA 1MW8X 5K8LA 1AKNA 1ZP6A 1WMBA 2HF8A 4M46A 5B1YA 2B5WA 4MV0A 4J91A 5DNVA 3IVXA 4XPZA 3EMKA 1A7JA 4Q34A 2VPIA 4QDUA 1O6BA 1HYGA 4KQ1A 2JZOA 1E98A 1I3NA 1UJBA 1VHLA 4P33A 1DMSA 1OXTA 4JUDX 2C83A 4DXAA 4YUYA 4XFJA 4PSUA 3TJMA 3AINA 1G5QA 1NBMD 2ZYWX 3GDGA 3V4FA 4HV4A 2YHSA 5REQA 1WQ4A 2FMFA 5JT1A 4EI2A 5FUWA 2B6NA 3TB4A 1QQ7A 2IZZA 1D4AA 3P0FA 2PL1A 2VHUA 3TI7A 1IUKA 3N2ZB 1EZ1A 3FTCA 4GC9A 2HA3A 2Q4OA 4YCDA 5LUBA 1EHCA 3FKSA 5C7IO 1JVBA 2BI8A 4FPXA 3QI2A 5CFZA 1TM7E 1FU7A 3L4BC 4GVLA 2HWUA 1Y3DE 3E35A 2XQIA 1GFZA 5ALXA 2NXEA 3GVPA 3KZNA 4KXMA 4C3VA 4G8JA 2PMWB 3FCOA 3RC7A 3TOXA 4PC3A 2VN8A 4KLZA 1HLGA 1B14A 3AIOA 2FMXA 3FTDA 3VR6A 2PKXA 2BF4A 3FRJA 5DTQA 3A1FA 1GCGA 5GY7A 2FFHA 1E59A 3QPBA 4DUGD 1JNXX 5DWDA 5JCJD 2O54A 4RZUA 4MW7A 1DP4A 3AM5A 3INNA 4YPFA 3NTVA 3SHVA 2X2EA 3ZY3A 1OZGA 3IQIX 1S2OA 1UBGA 4S0XA 5F5NA 3TQQA 4DHEA 4EHFA 4RK6A 4R83A 4EY6A 1DCFA 4PZEA 4GXNA 3TRDA 2JK1A 1YMVA 4CEJA 5JCOA 2D2FA 3RNOA 3IKJA 5HUHA 1NM5C 2QD2A 2QSYA 3LGAA 4KPUB 2YXNA 4CM6A 3CF2A 3EA0A 3RM3A 5EHGA 1XNHA 4FN5A 1JYFA 1BU5A 2ZWIA 1BCSB 2XRYA 2W6OA 3OCCA 1S2MA 2OG1A 1F12A 2YC2C 4ZVSA 5B1SA 3OU6A 5FPKA 2H8KA 4OQZA 3KOYA 1Z6ZA 1J00A 3LCUA 2JLAA 4Q47A 3ZHOA 4FDUA 3T94A 4AJEA 3BEDA 1JGTA 2CDRA 2WIGA 3D5TA 1AO0A 2KW5A 4B6JA 2OB1A 3EAFA 4OQNA 5KOHA 2Y99A 2RJ3A 1E1LA 4KK4A 4JJ4A 2IY7A 3RK1A 1ZH2A 3DLIA 1OLXA 3WRYC 3FVTA 1G6Q1 5AW1A 3C5HA 4B3SB 4QLAA 1SBTA 3B7PA 3TRFA 1E3MA 4RAQA 4ONEA 1BU8A 3K70B 1OCEA 2BKLA 1U7OA 4MP6A 4R1QA 1IEXA 4M1TA 3RIEA 3IUMA 4EJFA 4YRAA 4UTNA 3QUAA 1O0BA 3FCYA 1T34A 1QIJA 3PLRA 3A6FA 4DSUA 3NO4A 3QSGA 3VHXA 4HEJA 5K6TA 2Z3VA 3A6HA 3C1TA 4J3JA 4RVCA 4N7BA 5J5CA 3SQWA 3PC8A 4EG6A 3ZZMA 3HSKA 2O2XA 4I1IA 1OE0A 1CF2O 4WA8A 2HBZA 1JJIA 3PC4A 2PVPA 4NYIQ 2QY6A 2IFTA 3KTFA 4QBTA 3TQFA 5HW0A 3KHTA 1Y5NA 4TMKA 3S2SA 1UINA 2O7RA 1QMGA 1TTPB 1E7YA 2C03A 3DJFA 3OPNA 3PHBE 4YA6A 4DIKA 2VAWA 3R77A 4JT4A 4D0RA 5H9WA 4QL3A 1N1EA 4JCCA 1D7AA 3EUFA 4RM3A 4C05A 3R23A 5IT9A 1Y6GA 4B71A 1FYFA 2EYUA 5KCMA 5KU1A 1G3MA 1UBNA 2GJ9A 4M83A 2Q0HA 4R2IA 5JAUA 4N41A 1HKHA 1YRWA 1W5SA 2XF8A 1GQOA 1SEVA 1U02A 2UUPA 3G9UA 4OA5A 5DNEA 1K1EA 4Z1MA 4O2AB 3WISA 5CB0A 4L6CA 3WLNA 3V6LA 2QRVB 3IURA 2JH8A 1X0XA 2E49A 2O23A 3S1LA 2AT1A 2QTLA 4FFMA 4KJXA 1TDJA 4W9NC 5C7LO 1OAAA 1KF0A 1XVIA 2GARA 3ETNA 5F2EA 3GMTA 1W2HA 4OU4A 1NURA 1GUBA 2VK2A 1EK1A 4O5OA 4KQ9A 4LYHA 4RPKA 1EM8B 1TGYA 1WXHA 1KH3A 3CRW1 3NHWA 1GG9A 3P20A 4NAHA 4WJZA 4F2WA 2C2HA 2P9CA 1QGUA 4P36A 1KR2A 4X20A 2BFCB 1PFWA 2ID7A 4EZIA 1R6UA 2QD4A 1WW3A 1MAHA 1V1RB 2ZTHA 3A31A 1VJCA 4JI2B 4QDKA 1CNMA 1KZHA 1XLUA 3EXFA 3PR1A 4NZYA 5IVDA 1RM4A 1BG6A 1Z4NA 1TO1E 1NVVR 1ZRMA 3AUTA 1NASA 3CUKA 2D4AA 4WVFA 5EIBD 2VRNA 1SKYB 4UPDA 3SJCA 1KQFA 1N6LA 2DE0X 5BUSA 3C39A 3EC1A 2QW1A 2R1VA 3LQKA 1XRRA 2CB9A 2WWGA 1GXSA 3BHNA 1HQDA 1SU7A 4GM1A 2NQ2C 2PO7A 3EPPA 3MILA 4F71A 1CQIB 5KWSA 1YS9A 4X1KA 2JKVA 1EVYA 3IAUA 1IBMB 1X80A 2PWBA 3L7MA 4RSHA 3EPLA 2NZYA 4IJVA 1QVVA 4BNJA 5AQ1A 3GFQA 3PXXA 4PXYA 4Y2JA 5AK6A 1GPDG 2VOJA 5F92A 4AW9A 3MNFA 1OT5A 2BMFA 2OPBA 1TJ3A 4HDRA 4CUKA 4AUMA 5CIYA 1RAAA 1OI7A 1XZEA 4QHYA 1EGQA 3WGMA 1DKMA 3DMGA 3WQSB 4J43A 1CZRA 1M2VB 3EULA 3FOCA 3G89A 5FL7D 3FGZA 2QA5A 2QN6A 2VR1A 5DCLA 5K05A 1W36C 2X0KA 4Y0NA 2IXBA 4JBIA 4WKBA 4AO8A 5JVDF 5ELXA 1CD5A 4F12A 4F4FA 2HSZA 5E38A 1EDOA 3T3GA 1MOQA 1KSHA 3QEJA 1FFCA 5DNWA 4ZQEA 3RIXA 4NG5A 1W7AA 1YTUA 4KX3A 4LYYA 2OZKA 1ZMXA 1TJWA 3C3CA 3IC5A 2WWVD 5LQSA 2OQRA 4NFSA 5IVHA 4UXJA 4GOLD 1T3HA 1GUYA 3AZOA 4NENB 3UBMA 2P3QA 4C89A 5BWMA 1YRQA 3PJGA 1HMPA 2F4NA 2AEFA 2JH3A 1FTYA 2PIAA 3FLEA 3O94A 3C3WA 2QIOA 4YT4A 1UXKA 4A8JB 1ABFA 3LDFA 3UG6A 1H5UA 5FIUA 5AUPB 3SYMA 1R37A 2IUSA 1ZAKA 5HIKA 3QFSA 3ZXXA 3IB6A 1JSZA 5ECDA 1QFSA 3UMJA 1DTWA 1U5CA 2FX2A 3TR6A 1AKRA 1UMBB 2A78A 3WLPA 1T5BA 2CJWA 1H5QA 4MYSA 4UFPA 2O5EA 2IYYA 5E4TA 4HGQA 4DBLE 2G77B 4Z8YA 1XV5A 1BYUA 2GA8A 2IPMA 3R7WB 3K9CA 4DV7B 2GN6A 2IYLD 3NTOA 4L57A 4J0KA 5GZ3A 5I7FA 3A27A 4LXGA 1IATA 1KAGA 4H1VA 4Q1DA 4JL5A 4LJ7A 5EP3A 4AY4A 4D02A 3DV0A 5C46F 4Q0MA 2ZREA 2HK9A 3LBHA 3KVOA 3OZEA 3KHUA 4EATA 1RKQA 3QPAA 1Z39A 1OB2A 2J6CA 2VVTA 4F8EA 3WP0A 1OHHD 5AVJA 4XM1A 2PEYA 4YJ3A 2I6XA 2MSEB 3N87A 4ND5A 1XVUA 3ONVA 1N2CB 3LUKA 1SELA 3JQRA 4TROA 2NVBA 3FNRA 2P9QA 3B6JA 1C7QA 2BFFA 5FUBA 2DKNA 4HAVA 3KOMA 5FYQA 5K09A 2AG8A 3AVQA 4ETIA 1M0WA 4ZALA 1MX9A 1TT5B 4TZTA 1QHSA 4HNRA 1FVFA 1H93A 1PYGA 1SU8A 2PHZA 1TK9A 3K0AB 3LF1A 4Y67A 3E8SA 3L9WA 1EFCA 5HJEA 5IFLA 1IOVA 4DLUA 5ALTA 5KEIA 1RYYA 1T15A 3EDQA 3L8GA 1EMDA 1XTRA 2XX3A 3U44A 4L3WA 4HYQA 3AIMA 4FEEA 3E9MA 4M9RA 1ZIOA 1N36B 3MTDA 5ALLA 2CUKA 1X39A 1O4VA 2DQZA 3A9UA 3L41A 4TWRA 2JCSA 4XOUA 3VOSA 2VHQA 2BWJA 4TTAA 3UGJA 5DTJA 3EXHC 1BDIA 2J0QA 4W7HA 5JBNA 3J81k 2VJDA 2ONKA 1Q17A 2Y93A 3IFSA 1JFFA 2IF2A 1O87A 4KQXA 4WCDA 5EIHA 1XXHB 3OPYB 2N46A 4FHZA 1KJ9A 4NNJA 5DTMA 3EZ7A 2C7QA 4WY2A 3EZNA 1IWOA 4YNBA 1LUAA 3WNBA 1QZUA 3HYRA 3FGPA 1TFRA 5F5LA 4LHYA 3KVYA 2QU8A 1US8A 3SXPA 4RF4A 3TRJA 5C31A 3KFXA 4MI1A 2YJ4A 1OBHA 1OFTA 1W1IA 2FVYA 3PF9A 2FK7A 1YFMA 4QBGB 1JQ5A 3SJBA 3U80A 4G5GA 2FFRA 2AJBA 4ECAA 1WXQA 2VLBA 3VOBA 5BQOA 3KEQA 2HDOA 4MWOA 2QEQA 4TMTA 3VPFA 4G1UC 4PZ9A 4LWZA 3CKLA 3RC2A 4BZZA 5KNDD 5LZ2A 4LZAA 3NHAA 1PG2A 5K01A 4F7DA 1NV9A 4WK2B 2NUTB 5ALFA 1JKJA 1B8NA 1H5NA 2G5CA 2JFBA 1JWBB 1VJTA 3BHJA 4B9AA 4C1BA 4F4JA 4HNVA 4DMHA 9GPBA 4IDEA 5JVDA 2DHRA 3CISA 1B7GO 4A10A 1SVUA 2P5SA 3I37X 2AOUB 5J4VA 1BWSA 2Z1DA 4JXZA 3EUWA 5B4VA 3KVRA 5FP0A 3WLAA 4C6HA 1E3LA 1SZPA 2P6MA 3GPBA 4RLHA 3HYLA 2VJBA 3I05A 5T8KA 1DMRA 5CDHA 3F4KA 4DA6A 1T35A 3DQQA 1IG0A 3FGOA 3OZFA 1E5DA 5SYNA 3SWWA 3BD7A 1G6OA 3T12A 1CY2A 5F4ZA 4D8WA 5CYGA 4Q1FA 4ZCMA 1TEHA 1RSZA 3RUCA 3OCUA 3SEAA 1DRKA 1DAOA 1TYZA 1DT3A 3E22A 3I6MA 4UEQA 5JZVA 5TQVA 5KHLB 5AOBA 2B9EA 3WKCA 2H31A 1RU3A 4I2VA 2SKDA 1UBUS 3E9CA 5AK3A 3WK8A 1CFZA 2F4VB 1T2AA 1HY1A 1GT91 4GZMA 5EOVA 4H1WA 2XD4A 4KP7A 4WOBA 1QE5A 2JHPA 4AZ0A 3LS2A 1LD3A 3KWJA 4O2LA 5B3LA 1U1EA 5HRUA 5G0UA 2VWQA 3BD8A 4B1FA 4BXOB 3ZCRA 2WJZB 2SNIE 2ANBA 1YQQA 3E9ZA 4MTCA 1F8GA 1TD1A 1EFVB 2BEWB 3E48A 1H69A 1SU4A 2X9QA 5IDVA 4DAEA 1Z0ZA 2GM4A 1HH4A 3PXGA 2FZEA 1XYVA 1G0OA 3Q88A 4HLNA 3RIMA 1VI2A 1WDMA 2XKKA 3FPHA 3TAXA 3ROKA 1ZOOA 1PZHA 5FORA 5GWXA 4P4UA 5F77A 1QE3A 2VNHA 4RK7A 1K0UA 4S1TA 1PHPA 3KUCA 4BWYA 5AOAA 1R0KA 3O47A 2ZGVA 4ZMBA 1C8VB 3CLVA 1YR6A 2YWRA 3QNUA 4L28A 4OM8A 4YMWA 3VKVA 1WW2A 2DFKB 2W2LD 3P9XA 4HGZA 4DB2A 5HQJA 3R5JA 2XDQB 4DEXA 4FONA 3W2IA 1T9CA 2B3DA 5K0FA 2HHCA 2V4UA 4K9QA 2VDWA 1BKDR 2X7XA 4MQFB 1ZNYA 5E3IA 3RS3A 4ZGWA 5K4HA 4P6VF 3PZRA 1GZVA 4N1AA 4NVRA 2BVNA 1CJMA 1K63A 4LRXA 4X91A 3FDZB 1EP2B 1VCMA 2CHGA 2QK4A 4B3JA 3QYPA 4UDOA 3Q40A 2ZRJA 4XSHA 1S96A 1TQ8A 4A26A 4KXWA 1D03A 4C4RA 1RPTA 3INYA 3A1SA 3D8SA 1H6DA 1UKVY 2VCYA 3HRHA 2Q6TA 3E15A 2CHEA 1XT6A 1JH8A 3RVRA 1NP6A 3E7XA 4FKMA 4RS4A 5JD5A 3JW8A 2M6KA 2NSHA 1LJUA 3Q0TA 4ILKA 2I4LA 2O4CA 1Z22A 3KUXA 4NR0A 4RFSB 5DBHX 4FJ1A 4RMGA 2YQ5A 1S1CA 3QYJA 1QU2A 3UAYA 5LBTA 5EAIA 2A14A 2FWIA 4IUBS 4JBYA 3UT5A 4DJEC 4ID3A 2VDRB 3GRKA 4Q4DA 5FPYA 1TQ4A 3ZCTA 4YIHA 1XKTA 2QR3A 1OFIA 4U7TB 4L5YA 5KU7A 1PJ3A 2C2ZA 4KB5A 3ZWYA 1WUIS 1T1GA 1IBLB 3KFLA 3VHQA 2PXXA 2UVPB 4BWGA 4BPBA 4KQGA 4P9NA 2YZKA 3DTYA 3NOXA 5CBKA 1QHNA 1FFYA 5EIAA 5F7ZA 2WLTA 5K0EA 3U4GA 4I4TB 3R8XA 3REQB 1JR4A 3B60A 3K2EA 4C7XA 1JALA 2Y05A 4JASB 3KEFA 5E1MA 4HNUA 4WXMA 3ZN2A 3SVZA 1Q6ZA 2XQVA 4NOKA 4W5WA 4WZBE 1KMMA 4YMIA 2GB4A 2KM1A 4Z0NA 5JWHA 4RTKA 1X1EA 1L7RA 4IP0A 1WIWA 4J49A 1G1AA 4ZIRA 5L51A 4KLRA 1QV7A 3CWQA 4WQMA 4JFAA 1UMCB 4KJZA 5BYJA 1JZQA 4ZYUA 8GPBA 2GNPA 2QMEA 4ZC1A 5C1PA 3AEZA 1YQWA 2UXCB 1KAEA 2C54A 4URZR 4EMBA 1DAPA 1Y42X 2P5UA 5IRCD 1XDUA 2OCXA 3H4IA 4DJJA 4HR7A 3ZHSA 4AY6A 2REBA 3EGWA 4D1YA 3RS9A 1F9EA 4O1HA 3O92A 4EARA 1T9GR 4GLOA 1JHQA 5AHOA 4ZRNA 3NO9A 3IIKA 5IABA 1J06A 3TVDA 3DMNA 3MTIA 4C3ZA 1R1DA 1MD9A 1UAGA 2ILVA 4DLKA 3QBTA 2NTJA 3GGPA 2IEBA 1Z56C 1GARA 3CT4A 3VHLB 3B2EA 1C8KA 1NHWA 3FCEA 4WDQA 3LHIA 4OJMX 3QLUA 4P3OA 5B37A 3KR2A 1KYIA 1L7DA 2JS7A 2Q4RA 2VDNB 1XZQA 2FMHA 3C3EA 3N6XA 1MFPA 2GN8A 3OMWA 4DG5A 1I2BA 1Y3BE 4RELA 2XW6A 1Q0PA 3M1AA 4QPJC 4EA7A 4B7CA 5AJTA 1DZIA 4RQUA 3LHFA 1ORDA 3QLVA 2GNOA 4GR4A 1PVVA 2NO1A 3LYLA 3ZU3A 4AJ1A 3NDIA 1AUWA 2YZ2A 2AL7A 2ZWMA 3KYCA 4KUHA 3KTAB 1KMHB 3SHTA 3T0GA 1M6VB 3PNMA 1IQRA 5J2TB 1YS2X 1NMYA 1Q7CA 1XQXA 1GGFA 2HCJB 5ALJA 1YBAA 4NV1A 4UM9B 1KO7A 1KRXA 3IDQA 2AFHB 3ZBTA 4YRGA 1KWGA 1XCBA 3U19A 1GUDA 5A3RA 4R1OA 5A9SB 3WHLA 4NJOA 1KO5A 1NFQA 3PFNA 3TTTA 5JNRA 4EENA 5A5FA 5DGHA 3GLGA 2VAPA 1CHDA 2QORA 1FLDA 3C3XA 3OZAA 1DG9A 1AE1A 3LKVA 3BH6A 4FEAA 2YMMA 3C8UA 1L8AA 2FCRA 2O7QA 3SE0A 1MV8A 3FHTA 1HL3A 1XF9A 2ODTX 3EOZA 3HUTA 3BQMB 3IDZA 3GBPA 3K71B 1SUDA 2ES4A 3OKPA 1S6YA 1M2JA 4LHEA 3OZIA 5BR4A 1I9GA 1H0RA 3CLTC 2Z8ZA 4RHYA 5ECWA 4E4YA 4F4HA 1PKEA 3MMZA 4FDAA 3VSCA 4KBYA 4C14A 1RHJA 4WMLA 1DLIA 2DYKA 3D6AA 3O3MB 4GOKA 1NKSA 4D92A 1LBQA 3TRKA 3Q3HA 4Z2YA 4L1KA 2F64A 1O89A 4DLWA 4CKWA 5IAOA 4JXKA 2QTBA 2WWFA 4H4CA 4YJHA 1EVJA 1EUDA 3KBOA 3U3ZA 4C9BA 2R7MA 2ZJFA 1M75A 1XZGA 2HA7A 1CLEA 1YQUA 4YRMA 1QR2A 3ZJYA 2Z9DA 1UBFA 2D06A 4HH4A 3WRXA 1TJ5A 4DDTA 2FY8A 3KD3A 3M6VA 3E70C 5EWLB 4CYMA 8LDHA 3NXKA 3NB0A 2YNMD 4H3SA 1QGZA 3KLPX 2PZKA 2FLKA 4ZMRA 1U6KA 2LTAA 5AW6A 4P5DA 4RK5A 5JJIA 3SIXA 1L4FA 3CR8A 3T9CA 1HG0A 4HTFB 3RTGA 1XPOA 2JIQA 2R8BA 2FSIA