1Z4IA

Structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with deoxyribouridine 5'-monophosphate
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate specificity of the human mitochondrial deoxyribonucleotidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords 5'(3')-deoxyribonucleotidase
total genus 64
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1z4iA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4iA01
2YJ5A 3AR9A 3QX7A 4YH1A 2HCFA 5AKEA 4EZEA 3WK6A 1Q91A 3B9RA 5ALTA 5ALKA 4KN8A 2WFAA 3D6JA 1EK1A 2GHQA 3WKAA 4BBJA 3B8EA 4YGYA 1X42A 2YMLA 3OCWA 2Q4TA 3EF0A 3P96A 1Q92A 2ZBGA 4IG4A 4KX5A 1CR6A 3UMGA 4OHFA 1QQ5A 2G80A 5AW9A 3ET4A 2FPRA 3QYPA 5AVTA 4ZEWA 4CNQA 3ZVLA 3CNHA 2W43A 5ALXA 1N8NA 5AK5A 4Y2YA 3TLMA 3N28A 2HSZA 3N1UA 4OCZA 5ALRA 5AI0A 2R8XA 1L7PA 5AM5A 4CF5A 3PDWA 4CF3A 3L8EA 1SU4A 1T9ZA 3GYGA 1SWVA 3PGLA 5AKGA 1O08A 3OCYA 3IJ5A 4Y2UA 4HGRA 4B6JA 3KBBA 4IFTA 2ZXEA 1Z4NA 3PCTA 3W5AA 1RQNA 5AW1A 2YMMA 3WKCA 2CFTA 3UMBA 4KX3A 2VKQA 1PW5A 5AKJA 4XPZA 2JAWA 1Z88A 4BX2A 4EX6A 3W5CA 5IT4A 5ALVA 2FDRA 2YJ4A 3U13A 3RFUA 2AGVA 5AVRA 3I28A 2FPXA 1RKQA 3L5KA 2EATA 3DAOA 1T5TA 4AP9A 5ALGA 5E0OA 2BDUA 4F71A 2NO4A 5AVXA 1TJ5A 5AI5A 3E8MA 3QUTA 3E81A 4HGPA 5AESA 5ALQA 1Z4LA 1XVIA 2YMQA 2PKEA 1SWWA 3U7EB 2I33A 2B1RA 1MH9A 2NO5A 2ZBFA 3QUCA 1QH9A 5AI4A 5IS2A 5AK3A 1K1EA 2B82A 2MU1A 5A3SA 3L8HA 4BEWA 1L8OA 3MN1A 4QQFA 2JAOA 2CFRA 4UMEA 2YMPA 5ALEA 3QUQA 5AICA 2I7DA 2G06A 3ED5A 1Z4OA 4PNHA 5AKXA 3NAMA 3WK5A 3AR4A 3AR6A 3R9KA 2AH5A 3WK4A 2G09A 1ZD2P 2C88A 1F5SA 2OA0A 2YY6A 2IA5A 3I76A 3VAYA 2AMYA 3OCVA 1Z5UA 3MPOA 4BYGA 2RAVA 3FPSA 3K1ZA 4EENA 5AW3A 3KD3A 3M9LA 1Z4JA 1O03A 4AS3A 3KOOA 1Z4IA 2ZBDA 3QU7A 4JB3A 3SMVA 5AW5A 4EELA 4C4SA 2HDOA 4HGQA 3NRJA 1EK2A 2O9JA 3PGVA 4L6AA 5ALWA 4EEKA 5A3RA 4NWIA 1Z5GA 5AKKA 5AI9A 4NFLA 3QU9A 1Z4KA 4MUMA 4Y2XA 1AQ6A 5AKZA 5AVVA 5ALHA 3RF6A 5ALFA 2ZBEA 2GO7A 4HGOA 1VJ5A 1L7NA 4UMVA 1LTQA 2RB5A 3OTQA 3I6BA 4UU0A 5AKIA 3L8GA 5AW7A 2Q4RA 1U2TA 2HO4A 4H1WA 4RESA 2FPUA 2WM8A 2DQSA 3KC2A 4GIBA 3FVVA 3NASA 4QJBA 3U26A 1Z4MA 4BX3A 1RKUA 4OFZA 4UAUA 2I6XA 3SHQA 1Z4QA 2WF9A 3L7YA 4BNDB 3W5BA 2I55A 3WKBA 2R8ZA 5ALPA 1IWOA 2G08A 1QYIA 3R09A 1XPJA 3E58A 4C4TA 3E84A 3OCZA 1NNLA 2EAUA 2C8KA 3AR2A 1Y8AA 3U19A 3U7GA 3DNPA 1JUDA 4I9GA 5ALYA 5AVUA 3QNMA 3U7FB 1U7PA 3UMCA 2BDEA 5FP0A 3ZX4A 2WF8A 2HEGA 5AVSA 2CFSA 2B0CA 3OCXA 3EWIA 2YJ3A 5AVQA 5AKLA 2ZOSA 4AS2A 4Y2VA 2MSNA 4UMDA 4DCCA 3ZI4A 2X4DA 2CN1A 4YIKA 1LVHA 4CF4A 3U7HB 4HYTA 4DFDA 3WK8A 3QUBA 4UM7A 1WR8A 1RC8A 1YV9A 2EARA 1ZD5A 1ZRNA 3QU2A 5AM2A 1ZRMA 3HYCA 5ALUA 4XOUA 3N5KA 4UASA 2P27A 4DWOA 4DW8A 4G63A 2OYCA 3NALA 2YBDA 4MWOA 4ZEVA 3QU5A 2IOHA 2FI1A 1YNSA 3AR3A 1TE2A 3EF1A 1TA0A 3WGUA 5ALMA 1RLMA 4Y2PA 1RKVA 4I9FA 1WZCA 1ZJJA 3L0CA 4E88A 1L7OA 3ONNA 3ZWKA 3ZVMA 1U7OA 4YCNA 2GMWA 1U2SA 4F72A 3M1YA 2B8EA 2PR7A 1ZD4A 5JJBA 1ZD3A 4RETA 4EX7A 3EPRA 2HHLA 4KYTA 1WPGA 4NABA 5AW6A 1RLTA 3NANA 2HF7A 4YCMA 3KDPA 5AKYA 2G0AA 1L6RA 2W4MA 4YCLA 5AM0A 2RARA 5IT0A 1J8DA 4C4RA 2C8LA 4KNWA 3F9RA 3DV9A 3QU4A 4BKMA 2R8YA 1T5SA 3IRUA 1RMTA 2WF6A 3J7TA 1QQ7A 5AHXA 3ZTYA 1S2OA 4Y2QA 3QXGA 4Y2JA 3WK7A 4O8CA 4ZEXA 3ET5A 2PQ0A 1YDFA 1RMYA 2B8JA 3ESQA 2HOQA 3ESRA 1VFPA 3A1EA 3FPBA 3WKDA 5AIBA 2W11A 3L1UA 3WK9A 4L6CA 1S8OA 4UM5A 2QLTA 3OPXA 1WVIA 3AR7A 2AUTA 3I1YA 4FE3A 1J97A 3DDHA 4KNVA 3SLRA 2OBBA 5ALDA 1ZS9A 5ALLA 2IOFA 5AW2A 4CE6A 5AVWA 1RLOA 3A3YA 4J03A 3HLTA 1KYTA 2OM6A 3NUQA 3ZUPA 4Y2SA 3WKEA 2JARA 5AI8A 3L0BA 2RBKA 5T41A 3IB6A 5ALIA 2JAUA 2HF2A 4Y2RA 4BNDA 2R8EA 5AM3A 3ZTWA 1L7MA 5ALZA 4UATA 2G07A 5ALOA 3ZW7A 1ZOLA 5ALSA 3A1CA 5AW4A 5AVZA 2D2VA 4UMFA 5AIAA 3BWVA 4HAIA 1RMQA 4GXTA 4NAVA 5AK4A 1NF2A 5AM1A 2FEAA 2C4NA 3KZXA 1RPZA 1YS9A 3SD7A 3N07A 2BY4A 3S6JA 1U02A 5AM4A 1FEZA 5AVYA 5AKHA 2FUEA 4Y3UA 2G1AA 5AW8A 3SKXA 1N9KA 2P69A 2ZG6A 4UAVA 3FZQA 2JGAA 2O2XA 3FM9A 2I34A 3L1VA 5ALNA 2QYHA 2GFHA 3L0YA 5A3QA 4UU1A 1XP5A 2FUCA 4UARA 4BX0A 1Z4PX 1VJRA 3QLEA 2P9JA 2YFYA 1CQZA 4G9BA 2HX1A 3N8GA 5AW0A 2NYVA 5ALJA 1QQ6A 2HI0A 2WF7A 2C9MA 4XQ0A 2I54A 1YJ5A 3UM9A 5AI6A 3ZVNA 2IOFK 1RRCA 5AK6A 2GHTA 4JDPA 2YN4A 4UW9A 1RDFA 4J2TA 2WHEA 3ZX5A 3SF0A 4Y2TA 3ZWDA 4BEVA 1TJ3A 2YJ6A 3W5DA 3BA6A 1RQLA 3OCUA 4FYPA 3B9BA 2ODAA 4NV0A 3L8FA 3NIWA 4OD0A 4HGNA 3AR8A 3MMZA 3FGOA 3WGVA 3A1DA 2FPSA 2IYEA 3AR5A 2B30A 4XE5A 2B1QA 2WF5A 3MC1A 3QGMA 3CZ4A 4FFDA 4YIHA 1L8LA 1TJ4A 3SKYA 1YMQA 4L57A 2FPWA 2Q5EA 3ZU6A 1NRWA 3R4CA 2P11A
chains in the Genus database with same CATH superfamily
1Z12A 3AINA 3WO0A 5I01A 4L9RA 4FE7A 4PX2A 2XOXA 3G0CA 3TZKA 3EPKA 4JV5B 4LW8A 1XF9A 4L5YA 3GRCA 1EGVB 3OBBA 3QVXA 1C1XB 1PJ2A 2FYTA 2HTFA 1FS6A 1QCCA 4YGYA 3DFKA 3NXKA 3B6MA 1LX6A 2BELA 3CE9A 2I7VA 3G9UA 1Q92A 4IG4A 3OSUA 4M8LA 3PGA1 4AKGA 4JXJA 3OO1A 3NOXA 1D8AA 1U31A 3D54D 1JG1A 4UQPA 2BCEA 3W8RA 3C41J 5CEFA 1ORWA 1WLSA 2H0RA 2Z3VA 3OLCX 3ZWPA 4ZI2A 4I1SA 3W9SA 2UYCA 4HDOB 3ET4A 3BMXA 5HQ3A 2IUEA 1WLYA 4K1LA 1W19A 1KJYA 2GVDC 5BNIA 3IX7A 3L4BC 4R0MA 2WPDD 1I3LA 4WAUA 1N25A 4PBRA 1MAHA 4ZC1A 2PRYA 4JELA 4BB0A 2AG6A 2Y1CA 1I0ZA 1LLDA 1U0GA 4DLVA 5ELXA 3PC8C 4RWEA 5ALRA 4K1XA 3DEHA 1QTQA 1UAGA 3U7IA 2CLDX 3FNEA 4CF5A 3IP7A 4NBWA 3GEPA 3NEAA 4G65A 2F1IA 3GPCA 3PGLA 4I50B 1S3SA 3N87A 4EQ6A 1B26A 3BZUA 1EH5A 2VHCA 4Y2UA 1K6IA 1CFJA 3OM8A 4LXHA 1F12A 2NTNA 5J4KA 4BUJA 1CRWG 1HQCA 3WWYA 4PO3X 4X61A 1F6WA 3JYQA 2Q8PA 3BK1A 1P4GA 3QE2A 3IQWA 2YOFA 1XEAA 3GD5A 4UUAA 4CN8A 2EFGA 2X0KA 1Z88A 4EX6A 5B7NA 1O6BA 1VKOA 1CJBA 1RYHA 3LDFA 3LOUA 1Q1NA 6ADHA 4NDAA 3EXFA 2AZDA 4ZVQA 3K0SA 3P19A 5EXDA 4G41A 3IMGA 5U9CA 2ZYIA 1T13A 3Q1LA 4I1VA 2ZRGA 1CULC 2YC4C 3V00A 5J59A 2ZYWX 5BOSA 4HAOA 3I1FA 5DCYA 5ALGA 3FHJA 3LFTA 2RHCA 3TQCA 5ESDA 1FFDA 1CYDA 3Q7QA 4Y6SA 4F6RA 4ECEA 1S2MA 1XD2A 5DNDA 2ZW9A 4Q3CA 4S1OA 4MCJA 5CGZA 5TQ2A 1VKJA 5TT1A 1YQTA 3M5WA 4UEQA 1RJDA 2OHHA 5AMXA 4EB6A 5GINE 5KOHB 2PO7A 5D51S 1C1DA 2G5GX 2VNAA 4JDUA 2CK3A 3SG0A 1GUAA 3T5TA 4U7JA 1MORA 5KWIA 4IIFA 1U4NA 3LL4A 3PWSA 3U7EB 4YJKA 5CDFE 4WK6A 1PR5A 2VEOA 2ZE5A 3PC6A 5B58T 1B93A 1B3RA 3ZI0A 2Y27A 1GN8A 1CEQA 2KLBA 1YZYA 1P3Y1 1Q6ZA 4M6WB 2YUIA 3T61A 4C2UA 4KPUB 1DV1A 2BEJA 2H57A 1W9HA 1AKRA 1GIAA 2CFRA 3CT6A 1U0NA 3G9QA 3PR3A 1P1KA 4IHJB 3U3MA 2I7DA 2O3QA 3EGXB 1M34E 4L0MA 1H66A 1HFWA 3AERB 3KJQA 1U11A 4R8MA 2BE9A 3ZU2A 1HRDA 4FW8A 2IXFA 3DKIA 3RD8A 4B7XA 1XZAA 5MN6A 3ZJTA 1UQUA 1IJFA 2W0MA 3CBGA 4LYGA 3QMMA 3ZG6A 4GGPA 4M55A 4BWGA 3I01A 2O4CA 3CNLA 4U2BA 4ZO7A 1CYEA 1CUEA 4HWGA 1W5SA 4GU5A 3R23A 4AQYB 5JTUA 1M9NA 1FE8A 1P7PA 3EZ6A 3ICWA 4M99A 2JEYA 4BYGA 3DWGA 7MHTA 1PS0A 4L3WA 4LJKA 4EG8A 6NULA 3QEBZ 1VZ3A 1OX5A 1U2DA 2WK1A 4JJAA 4AF8A 1YQXA 1FURA 4BZQA 1CDEA 1P1CA 2ZDHA 3M6XA 4YWHA 4CTJA 1JFFB 1V7QA 4ZYUA 4URFA 5LBUA 1PW7A 4AWBA 3MB8A 3QTBA 5TPZA 4IGFA 4WTOA 4KXNA 4C08A 3R1IA 2EGHA 3Q2KA 5ITZA 3UT5A 3RT1A 3GCDA 4MUHA 1MABB 4HDCA 4IMIB 3CGGA 5EMHA 5T57A 4EKEA 1PFGA 1Z68A 3NRJA 5EVCA 3CISA 4AY6A 1XTUA 4OXKA 2QX6A 1UOPA 3ABRB 3M6MD 1PG0A 2ZUCA 4K6FA 3LUPA 2F4VB 2Q5HA 1OU4A 4HXGA 2CLFB 4K86A 3RF6A 1ODKA 4Z7OB 1M2FA 1XAJA 2BMDA 2ZBEA 3F5FA 3GLSA 1CVLA 4HN9A 1JTEA 1KXJA 1WXHA 1YQ9A 4HHEA 2IPLA 2JZCA 3H75A 3KLBA 3OZCA 4ZQFA 5GZ1A 2G25A 3DEZA 4EUHA 3K6KA 3OEYA 4PZEA 4FQ8A 1YOVB 1UJ4A 2LD4A 1QZ3A 3AT1A 5INTA 4IX9A 3ANTA 4G89A 4D3DA 4R5MA 1E1QD 4OMCA 1YQDA 4CHGA 4DLYA 5KKCA 1EHIA 2IIVA 1XTBA 2FN9A 2IY7A 4IKOA 2F1JA 3WQQA 4WY2A 1FQWA 3C2QA 4B0OA 2OO7A 8ABPA 1UKCA 1GZ4A 4CM4A 2II6A 5E4YA 3KR9A 1GNPA 3CEPB 3H2GA 3RT7A 1VPDA 2VWHA 2C3YA 3T3IA 4JLUA 2Q4DA 2FK7A 4BB5A 1GNQA 3IXMA 4AJLA 3EQ2A 4H0FA 4I08A 5HE8A 3VSBA 4BNDB 2IZ6A 5ALPA 2WJHA 4LYEA 3EIUA 3KP1A 1E3QA 4S12A 4WK2B 3KX2A 5FI3A 3BWYA 1XUOA 4PLGA 5MHTA 3NH9A 1FRQA 4L5IA 2W2LD 1PJTA 3C3PA 3DTVD 1NNLA 4OFBA 3ESBA 1DBWA 5HS6A 1JJBA 3SZ3A 2Z8ZA 2X5JO 1AS2A 1YCFA 1OA1A 4MGZR 5DLPA 4L5CA 3EF3A 2VJBA 4D80A 1DAGA 1ODLA 2WTAA 3JZFA 2VF8A 5F2KA 1ZH2A 3KYJB 3FVTA 4QHTA 3CQ9A 4EW6A 3HYTA 1CIVA 4BAUA 1BRTA 1VLZA 4TV8B 2AYXA 3LOQA 2NZYA 3QVOA 4R01A 2CJYA 2CYCA 1EINA 4G0XA 4DJTA 1SEVA 3UOAB 3BILA 4F5EA 1RHKA 4J1SA 2HK7A 3WDLA 3A28A 3N2ZB 2R5WA 3OCXA 1UMDB 5MFPA 1L7XA 1G3MA 4UTPA 1E63A 1F38A 1AO0A 4V0RA 1PT5A 3B6KA 4EA7A 1SD5A 4MLPA 3MA0A 1NBMD 1K6JA 1XBTA 2ZP1A 4IVNA 1Y4DE 3ZU4A 4CF4A 2MYPA 4LWPA 2C5GA 2VYCA 4DC9A 1TCVA 3FPFA 3AEYA 4JA2A 4D4KA 1Z7EA 3B8HA 3FZNA 5JHGB 1FW6A 1M34A 1P7CA 1TD9A 2CC2A 5FTMA 3SQOA 1J8FA 2I4LA 4XX0A 5F9MA 1D7AA 1FP2A 4DVGA 1RYBA 2GWHA 4HAVA 1E66A 2BFEA 1X3LA 4BLVA 1ZAYA 1UK8A 3V55A 1IJBA 2CMHA 1VMAA 4DNOA 1P31A 2FDCA 4QU5A 4TT3A 2P27A 1P0MA 3DB1A 1DKRA 3H87A 2GAFA 2OCBA 2HJGA 3B9PA 3L01A 1WKVA 4QATA 4R8VA 2P9FA 3ZZNA 1U0LA 2GVZC 3FHOA 3UG6A 2ZJ0A 4DV6B 3IEXA 1B0UA 1KO7A 1WMBA 4L73A 5EVJA 5IKMA 3FVWA 5JMOA 1N8TA 1G0NA 4LYFA 3RARA 3HJTA 1BWRA 1SCUB 4FUTA 3X43A 5IUJC 1H0KA 4QPCA 3PV0A 3CF6R 3LZCA 1RYDA 2HU5A 4QRDA 2VYNA 1B6RA 1XNGA 2YZNA 2Z5GA 5ALMA 4A15A 3WDMA 2C2MA 5K7SA 4ZWNA 2PM8A 4CG1A 1IHPA 2A0WA 5LWHA 1ZJJA 2XVZA 4QOJA 4WACA 2OV4A 2IU0A 5JS7A 5K09A 5FTWA 4YMLA 2UZ4A 3GJ4A 1O58A 3LVFO 3JWHA 3T7SA 4EAAA 5L7TA 1W34A 1ZLYA 4KQFA 4MCHA 3K30A 4YQEA 2GN8A 1ZD4A 3D8TA 2D2EA 5EUMA 1CUUA 2QE7A 5L7YA 1SB9A 3R7LA 3M6IA 1TZKA 5B2EA 4IR7A 3U4DA 3HPQA 3OZUA 3A9SA 2GM4A 1N2CA 4HF7A 5AW6A 1MA3A 1J20A 1AS0A 3X1KA 4AZWA 3L4BA 4BFUA 4GSKA 5IJWA 3JY6A 3ZLUA 1IY1A 4QVGA 3BHGA 1N5IA 2QXTA 1COZA 4MKRA 4ARVA 5JSFA 5IT0A 1AZWA 3T94A 3RANA 4ZFNA 2QTHA 2IE8A 1Y3IA 5HG0A 4NV1A 4AWXA 3ZHUA 1ECPA 1R0YA 2PUVA 1W35A 1TTTA 2IS1A 2VSOA 5LBIA 4C0LA 3DV9A 4UKDA 2FF5A 1CTQA 1AY0A 3N9IA 4P4TA 2JKZA 5K0GA 3FTDA 3KQOA 3PWZA 4KYVA 2EJTA 3C7AA 2IY9A 2XECA 4P2GA 1DCMA 5F73A 1W1IA 1LVUA 3C74A 4HLNA 4Q4HA 1N9ZA 5B3AA 4KQXA 1FK8A 3WWEA 1KJNA 3NPMA 4NAHA 3O21A 1FX0A 3B3FA 1YFKA 4ZT2A 1BU5A 3D7LA 3JZIA 3LZ6A 4JLPA 4Q4AA 3KS9A 4YXWA 3SR0A 5IULC 1U0BB 3SEZA 1DHTA 3U9LA 1CRPA 1NXXA 3E5MA 3A1EA 4RVGA 3JQCA 3WLQA 2NP6A 1U8CB 2A92A 4LHSA 1JXOA 1R5JA 4LFAB 1JEDA 1U2PA 5G0VA 2G0TA 3AJ9A 3KLOA 5J2TF 1FDWA 4FYHA 3W5HA 4JS0A 1HT0A 2WINI 4L6CA 5E6SB 3UK0A 3A3OA 3L7BA 4UC0A 3VJMA 1MJGM 4AY4A 2R00A 1WVIA 2YJNA 2HA7A 2XDQA 2DTEA 3G6KA 4HJXA 1K3UB 2Y9PB 3I30X 2BR4A 4BV9A 5JSYA 3DMHA 4M8NE 1Q5PA 3FBWA 4Z3DA 5K6RA 3DZIA 3IAS6 2VNSA 2VWQA 2HHCA 4EHDA 3Q72A 4RBNA 5FFMA 3VH4A 3BUSA 4RZQA 2ID8A 4E31A 4MCAA 3N74A 4AMVA 4OHRA 1WDTA 2NU6B 5K0LA 3EW7A 4FCCA 1P4JA 1RLJA 1WB5A 4M54A 5KHOC 1V8BA 1M5RA 3B36A 3LC0A 4XM2A 4EMTA 1UWVA 3PEFA 1O8BA 1X19A 2GEFA 1L4HA 2WYOA 3DO8A 4N3AA 1F4PA 3LKDA 4R1LA 2ORYA 3QVJA 3UHPA 3KAKA 3U40A 1RQPA 3PVSA 3QOFA 3NV7A 5JCOA 5LA6F 1BOFA 2DAPA 3CBQA 3S2SA 1X7DA 3ZKWA 4KFSA 4DY6A 4EYGA 3CB2A 3AVUA 1L7MA 1V1JA 2V7UA 5KAPA 1RI4A 4KFCA 2ATIA 2ODEA 5GPBA 2J85A 5D5PA 1EJ0A 2C0PA 4NH0A 4XFJA 2XVXA 2QQGA 1P3DA 3DYBA 2Z3WA 5AIAA 2WWRA 4ZVMA 3GIWA 1XEFA 3X44A 4Z7JA 1X6VA 2QIOA 3E9EA 1XNQB 1S4QA 1VL5A 4EHBA 5IN4A 1R6TA 4YJGB 3EEOA 4KPYA 2ISQA 3VSCA 5CA1A 1D2AA 1MP0A 5FOUA 5LBTA 4AMGA 3OT5A 4DA8A 5LNK6 2ZWIA 4HAYA 3RS8A 3STWA 1KWGA 3H9JA 3N53A 2QENA 5DTMA 2AZ4A 1AG9A 1GPKA 3DOOA 3FHTA 2D3TA 1U3WA 3KPYA 2ZJ2A 4F9TA 2EERA 2BEUA 2IIQA 3L92A 2MSCB 4XJVA 3PEYA 2HRDA 1WCWA 2FOLA 4HX5A 2XMCA 3X1YA 5SYNA 1LLUA 4JLDA 1Q14A 2XE7A 2VRCD 3AVYA 4UEKA 3FM9A 3PIRA 3Q7RA 5H59A 4EGQA 3OTHA 3SR3A 2UYGA 4FFBA 5DX8A 4AJKA 2FETA 1TCUA 3I6ZA 4UARA 3AOGA 5A05A 4RTKA 1E2KA 1TF2A 4G0ZA 5G02A 5C1DA 2GLXA 1Y1SA 1ISSA 2RKWA 4JODA 4R40A 4Y0AA 4M98A 2B8WA 5FXMA 1W0JA 2FWBA 1QQ6A 3RU3A 4HO1X 4XQ0A 3RYHA 1KBQA 1GAWA 5KWSA 2DE0X 2VPZA 5BY2A 3DBRB 1OLSA 2B35A 2GUGA 4Q48A 2I2CA 3FNIA 1TVEA 4CUJA 5A3VA 4UW9A 1DIHA 4NCXA 3NR2A 1L4YA 2G9NA 3THOA 2UYYA 3AJRA 4G81A 1L5SA 4GUAA 1YFLA 3ILYA 4P4SA 2JH3A 2PAAA 3KXKA 4Q18A 4QQKA 5K2OA 4KPGA 4WX2B 3UGKA 4D4IA 3O9VA 3ZBUA 5LJIA 1E2EA 5EKSA 3GROA 3OJFA 5L45A 2VJYA 5J2UF 2DR0A 1I33A 1BAPA 3PDCA 5F4ZA 4A6PA 2H1LA 3A1DA 5CRIA 5IXJA 3AR5A 4AT1A 5EHQA 1M33A 3I04M 3KL2A 4J0KA 1A5SB 3ANYB 2EGGA 1QV6A 3ETDA 4O2BB 3L5OA 3SDBA 5DP1A 5EP4A 1KARA 4NEGA 4RH0A 2OK8A 5IASA 3DKPA 4E2YA 4GKKB 3QJ5A 3MD9A 2FPWA 1VFNA 5GMOA 3M1IA 5J1TB 1NMSA 4F4IA 1AZLA 4R69A 5C80A 3FUXA 3QX7A 3S68A 1WCYA 4H7FA 1JAZA 1URPA 1YE3A 5ALTA 2FXVA 1E2LA 4N3BA 4UUPA 3THWA 2DCUA 3WO1A 2RB4A 3T4EA 5BW4A 1HDXA 1E89A 1FDUA 1YGPA 2EKPA 3CUEF 4TWZA 1E0SA 4HD8A 5MGNA 3FGPA 5HBGA 4Q7KA 4F2DA 2DJ5A 4A5OA 3ACBA 3DO5A 1A2KC 2WVHA 3TQQA 2GZSA 2ISSD 3H17A 4ZANA 5J5AA 1ZD9A 2NZ2A 5F7ZA 1K9SA 5D85A 4KN5A 2B69A 3OPYI 5IW8A 3K8ZA 4IDPA 3DVQX 1VGQA 1ECGA 2OZKA 1OJLA 2C42A 3E8SA 4BMYA 2WILA 2FFHA 1TVKA 2QMUA 4CNQA 1UDAA 5KKAA 1UFOA 5I4CA 3P0FA 1E2GA 2YFHA 1JR4A 2WJJA 2N3ZA 4KBFA 1XNJA 2G0NA 3G2KA 3I9JA 3PVZA 2CL7X 4LS3A 2YXPX 3OHSX 5EAIA 3BYZA 5HKLA 4RGVA 3QHQA 2FWMX 2IJGX 2DECA 4A1FA 1Q20A 2I62A 1YQQA 1GDDA 1XCMA 1PUIA 1T9ZA 3F4LA 2MDTA 5CBKA 1PR1A 3BQNB 3WTCA 1Q7TA 3E5NA 4KSCA 1KR2A 5GOZA 4F60A 1JG4A 1Z4NA 1GUDA 1XMIA 5DJ5A 3FOZA 5FF9A 2YMMA 4RD1A 1IE3A 4YCNA 3QEJA 5GV7A 4UFPA 3LBAA 5DM4A 1E60A 4F4CA 1VHWA 4G1FA 1ETHA 1GT91 2GJ9A 1BN6A 3MCZA 5KDLA 3WI7A 5HW2A 3REQB 2NP7A 3R77A 3DBLB 4FMBB 2G6BA 2AGVA 1O8CA 1NN5A 2J5RA 2JZNA 1C80A 4INAA 4CM7A 4X3OA 5EKXA 2RHDA 3O03A 1JILA 3DXZA 4EPYA 2DKOA 3UT0A 4DLRA 4FYIA 2AOVA 4JBIA 1ZSYA 3IR6A 1OBHA 3AKEA 4PHCA 2XWQA 1RXIA 4RVFA 2XXJA 1ZHOA 1XHEA 2BI8A 2AUNA 4HRAA 3MQ4A 4Q3DA 4YUAA 5I48A 1DHRA 1KJ8A 2GWRA 3HXLA 1HFEL 3SX2A 4D41A 4QYIB 4EG4A 4D74A 5G53C 1H1LB 2QTGA 3B6ZA 4HWRA 3EGXA 1AVTA 4N0DA 4PRKA 4A2CA 2VP0A 4G1MB 4DAEA 1WE2A 4YDHB 3F5DA 3PJDA 4IV8A 4MP3A 2FX3A 2HNBA 4ZCRA 1TB4A 2COKA 2ZSBA 3ZK8A 3GMSA 1E1KA 1BDJA 1GLNA 1YOBA 4KPUA 2V9PA 2VVTA 3ZHRA 2ZB7A 4EBFA 3FFAA 4M6WA 3A4IA 1NR1A 4OQFA 1EYZA 4X20B 4ZCIA 1VSUA 3G0GA 3UKDA 3WLRA 3ZE8A 1ZICA 1LBSA 2QNIA 3BHMA 5A3SA 1OIXA 4IIUA 3T99A 1V11A 2GM5A 2JAOA 1C4OA 1ZCJA 1Q1QA 3C6KA 3RR2A 2XHEA 1JNYA 3ZWMA 1PF7E 3ZDAA 4N41A 5FLKA 5A6SB 1C1DB 4JUCA 4K2HA 1F20A 4L3OA 3ED5A 4L8VA 4II2A 4OB7A 5CLLA 4Z86A 3T3DA 1M76A 1RTTA 2BTEA 2HT6A 1B4DA 1DO8A 3ZY2A 3TQIA 4IZHA 1AN0A 3NAMA 4JQZA 4MP8A 4AZVA 3PFCA 1S2NA 2IUFA 1DU4A 3CV3A 5GJVC 3TTWA 1OVMA 4L78A 3VM6A 3WK4A 2G09A 1OWLA 4XGQA 3GFGA 4M1MA 3Q0EA 4DCOA 4L85A 1RCUA 2JJ1A 4CEIA 4A8JB 3CW9A 1RKXA 2VTVA 3AVWA 3I3SR 5A06A 3A1NA 3K1ZA 1R6AA 4ZK6A 4L4ZA 2IZ7A 3E4DA 3LBHA 3KD3A 2VZ9A 2CNOA 3I37X 1Z4JA 3C7CB 4J1QA 1A9QA 1GITA 3AJEA 2PUCA 3ZLBA 4Z4GA 3KOOA 1ULHA 2F00A 3K2BA 4WGGA 4G4IA 5C46F 1NOKA 2J5QA 4H1HA 2GD2A 1UINA 4FLFA 4O1IA 5DHAA 4JEMA 3RB8A 3MS7A 1H6CA 1BMTA 2LP4Y 4AL4A 2OEPA 2JLWA 5J4VA 1PV2A 2EEZA 1A88A 1EK2A 3PJEA 4I50A 4L6AA 4W7SA 1UWKA 4XWYA 3WBKA 4D57A 4WA7A 1CB7A 1IG0A 4ZDIA 1F2VA 4RTPA 4PNZA 1AQ6A 3CUVA 4KUHA 2APJA 1XLVA 5ALFA 4D82A 2WSSD 3PLRA 2GO7A 4IDDA 1KS2A 4CLRA 3PC2A 4X1OA 3CRMA 3ZNNA 1DKMA 2Z56A 3A0UA 4Y1FA 2ZI5A 3S29A 4BO0A 1VHQA 2Z83A 3BGVA 3MAGA 4LZOA 3TTXA 5BNFA 2RGNA 3JZDA 3ZHOA 5JDIC 3GRYA 1V11B 4UCXA 3TDNA 1TMGE 3OEEA 3QFSA 5F78A 2B3DA 1ESEA 2YWRA 5K0NA 4RHFA 1GJRA 2A0YA 3AM3A 5HE9A 2Q3LA 4X6UA 5NLLA 4E2XA 2GAOA 1WBDA 5DU2A 1BXGB 2HPZA 2XRYA 3USES 5IDQA 5DM70 4UJ3A 2H07A 4HDSA 2KHZA 2X0NA 4K26A 1B8VA 4OFZA 4OQ4A 4ZT3A 3TUIC 5CW1A 2HK6A 3UIEA 3VO1A 4IQ0A 4B3CA 3OBIA 3MYYA 1SBIA 2D5BA 4O6VA 4AJOA 1H22A 2A58A 1C4WA 3MINA 2QUJA 1GQFA 3STTA 2ZBRA 4BO9A 4YK7A 2Q4OA 4X1YA 5BQOA 1SXIA 5TQ0A 2O2IA 1O5OA 5BWOA 5IHXA 4P38A 1V3VA 3OUZA 4R8KA 4C4XA 1HT2E 1UM9A 1T8SA 4BQSA 2D0IA 3CZPA 1O97D 3ER8A 3GLHA 3KE9A 3H2IA 3OECA 1JIJA 3T9DA 4AO6A 4L0QA 2XUAA 2WNHA 3WFJA 1E0JA 3T7RA 3EGCA 3W6NA 2O3JA 1SQSA 4WLVA 4B8ZA 1ZMBA 2BTQB 1NVEA 2ADMA 4O59O 3W04A 1GFIA 3ABSB 3U56A 3EIQA 4NC9A 2ZOSA 3MJSA 4YCJA 2MSNA 2QX9A 5DIFA 5LN1A 3MCAA 1LDBA 4UMDA 4FYVA 3FPAA 1P8AA 1L1EA 1QIHA 2Q2WA 5JZ9A 2X4DA 3U62A 3R7AA 3VUFA 2BGWA 1I7PA 1SCBA 2VF7A 3K71B 1HE1C 3GFQA 4R2WA 4RTJA 1M72A 1UT6A 3CLRD 2NZUG 4G85A 2PMWB 4YR9A 2XOKA 3ZDQA 1TA9A 2C4UA 2CD7A 4ZRNA 1NLZA 3O82A 2R68A 3OIDA 2QZZA 4CDGA 3C6XA 5HHTA 3PNKA 4PO8A 3VI4B 5HS4A 1FLAA 3CPEA 4UASA 3AUYA 3RIXA 2QUAA 1OGYA 3DLTA 3BBLA 5BSHA 2QBYA 4OI2A 4TZTA 3DQQA 3HE3A 2JEZA 3BRWD 4AZSA 2JI7A 4BL5A 4PPYA 2NT3A 1R12A 3WQRA 4ZZ2A 1A9RA 1W47A 2ID9A 5G4KB 1GR1A 2FI1A 3KKPA 3A1UA 4ZAYA 5ENZA 1PIWA 1JBKA 1OLUB 2AN5A 3UWSA 1I2BA 2AFIE 5CT6A 1TA0A 1H1DA 5DHFA 2ETXA 4UFOA 1U6IA 1SXGA 5BYBA 1PGJA 3SHWA 4GDFA 4D4HA 5HZHA 4ZAWA 2BMWA 5CVUA 3K92A 1FQKA 1RYNA 1SIWA 5IPFA 2RIPA 2NUPB 4HDMA 3OWHA 4DCGA 3Q9SA 3AGPA 4P31A 3SQDA 1BRMA 1CUHA 2OQRA 5JQGB 1AK2A 2XX3A 3UJ3X 1VLVA 4XWOA 1JH9A 4YMVA 2H3HA 3O3NB 3BH7A 1ZKMA 2HF8A 4IAOA 4KHZA 4KWEA 3ROFA 2GYUA 2O2JA 5K8UA 1QTNA 2RHGB 2GI4A 4RHYA 3UAGA 1DXYA 2R7LA 4LBYA 1KOFA 3S44A 4M89A 1CJCA 3KDPA 3HK2A 1JHRA 1CNMA 4Q3KA 5B55A 5KTPA 2QPLA 3KELA 3AHEA 3HL0A 2B2CA 1ZI6A 1XEWY 4UUNA 4C1BA 4R1OA 5BSMA 4OJMX 1T5BA 4FZVA 2P75A 3NG1A 4C4RA 5A4MS 1KBOA 1K7WA 3KYBA 3I8SA 2D4AA 2JLBA 3DCNA 3DR5A 3IAFA 1XDBA 2AQIA 1UT8A 3UMMA 2R8YA 4IGEA 4QHSA 3QLUC 3THXA 2C94A 4RMIA 1YVEI 5MGBA 3N3AC 3WLEA 1ZC4A 3KVRA 1C30B 1CLUA 4MIEA 4BNWA 1HV8A 2XBMA 3PD0A 2FKAA 1PLKA 2OVBA 2C1XA 2H4YA 1LX7A 4O8ZA 1E1CB 4X93A 4Y2QA 1E2MA 2IWRA 1E6WA 4MA4A 4BVEA 4C7KA 4O8CA 5BSFA 3EZ9A 3BXHA 1O95D 2DBRA 3HJRA 4BNKA 3LT4A 1CUCA 1NMYA 2FHPA 2RGDA 5JFGA 3ORFA 1X94A 3R8XA 3BQMB 3TKAA 2XUDA 3FPHA 1ZBQA 1OFGA 1QE0A 2J9FA 4Q1FA 4UE6A 1T2DA 3H5AA 1KDYA 3EVEA 3UK7A 4DUGA 5K8TA 3UWDA 1LNSA 2KX7A 2NTEA 1QGDA 2ZWPA 1T3SA 1RHRA 3HKCA 3W8DA 4LF6B 3P0HA 1YFMA 5B30A 1Y4AE 4CIDA 4AXBA 4URVR 2VUIB 1ZOOA 3CF2A 3O75A 4NF2A 5CFRA 3JS5A 5EZYB 5K3FA 1GCIA 2ZUWA 1A5BB 1F48A 4W8HA 2MINB 4TLAA 1C0IA 4YJGA 1OFIA 3EPHA 3FUUA 4YP9A 4LOLA 1E3JA 1T1SA 2HCTA 4YP0A 3F8WA 3ND8A 3NO4A 1AGNA 3ANMA 3DKVA 4V0NA 5DWVA 5ER6A 5IXSA 2FMTA 1AIPA 4ND6A 4WZAA 6Q21A 1KYTA 1XQVA 1Y9JA 1RABA 1TW3A 3GGOA 3CTPA 3S40A 3KQNA 5BV2P 3D7KA 1AUQA 1I2AA 3HMKA 3RYTC 1JQLB 4FJ2A 4R31A 2JS7A 1HQDA 2ZVPX 1NXQA 3FAKA 1EPUA 1BFDA 1AXEA 2L82A 1KDTA 2UUBB 1IM8A 4M9UA 3UJNA 1D2MA 3NHRA 1JJ7A 5F5XA 4JFRA 2G67A 2GBFA 3JASA 3K1AB 2FSHA 1UMCA 2BBOA 3A10A 1GUYA 4HAIA 1HTTA 1BDMA 1XRJA 4LTMA 1NNSA 2ZJAA 1A04A 4CCWA 1HDYA 2WQZA 3K0CC 5C18A 1RXYA 1T4BA 4ACBA 3U7RA 1YZNA 2A0UA 3PL1A 2QZPA 1VDZA 1PFVA 3NWJA 5JCPA 3QBVA 5KOHA 4Z4EA 2PL5A 4HPJB 2HMUA 5TQ2B 4TTPA 4CLRB 3HB9A 3RSZA 4M0KA 2XMQA 1FMTA 4LXTA 1LLFA 2H5IA 1PJAA 3JYNA 1N6RA 3T7JA 4AY2A 1H2RS 1HDRA 1QGAA 2NTVA 2PX0A 3B52X 4J43A 1P91A 2BDTA 1E77A 1KO5A 5BPFA 4PANA 3DMGA 3H5OA 3OZIA 4FN4A 1C7QA 4W1RA 3BORA 1P4SA 1VSBA 3KSZO 3NHAA 3RD5A 4BCDA 4REQA 1XPUA 2A9RA 3PIIA 2QW0X 4MWGA 3LTNC 4F3CA 2FUCA 3LWDA 3R6VA 1IXKA 1LSOA 4RSGA 2X2OA 4XDHA 2NOAA 1B8PA 5D1HA 4CMAA 2CW5A 3P7MA 3T0FA 5JRJA 2WT4A 1DBRA 2CNWA 4WQMA 3V1LA 4RAOA 1GPMA 2ZSEA 1K7FB 1RWPA 2VH2A 2C29D 1WZEA 1GEEA 3EZ2A 3QFCA 1LD3A 3L02A 3BE5A 4KYIB 1OIWA 3VGJA 1IBSA 4OKNA 4U7WA 1CE8A 4HBZA 4CNBA 1JE0A 2X0EA 3E7WA 4MQLA 4BRWA 5KWJA 4ITUA 3ZVNA 1S01A 3NORA 4HBGA 2Y3IA 4UDYX 4G8CA 1AH2A 1HOTA 4M8KA 1DAPA 5FNZA 3E9NA 1VLJA 4YY3B 2I9PA 1J24A 4WDRA 1Z2OX 3I9V6 1TECE 4NCJA 5LJLA 2C7OA 1JYSA 1NW6A 4LDPA 4ZODA 3UV7A 4B74A 1JT9A 1K2VN 3DE6X 2E4YA 3IERA 1M1ZA 2IUSA 4QO8A 2IYUA 1ODSA 3C3JA 4IDQA 4E4YA 1CNEA 4H6PA 1SHJA 2IP2A 4J0IA 5DGXA 5TIIA 2AKEA 3S2GA 4OHCA 1ST2A 1JALA 2JJYA 1ZXLA 3U6KA 4DUZB 4YCSA 4IH1A 4PYQA 1E6UA 4XUEA 3AHDA 1CP3A 2RI1A 2JLSA 4GPTA 2A5GA 1F0PA 1G4HA 4W5HA 3S2IA 1E2NA 5EWLB 2ZYAA 3RFXA 5IH3A 4BRUA 4CM9D 2SCUA 3TG2A 1L4MA 3CWZA 3N8KA 3OZXA 4TTQA 2Z6AA 4J6EA 3ZS9A 1D6MA 4RD3A 4FFDA 3P26A 3NRBA 5DK4A 2ZJ8A 1L8LA 2DPMA 1QWSA 3I83A 4OGKA 4NENA 3RRXA 4C2AA 3ZDFA 3QOXA 5KQRA 5JPCA 3R4CA 4Z3KA 3KDSE 3NAGA 4MX2A 4ND4A 4FMDB 3TLJA 2G9UA 4EKYA 1FOEB 2ZJYA 5J23A 3IUYA 2WC1A 3WWOA 5ALKA 1TEZA 1VPWA 4D42A 1GTSA 1EWKA 2PZ8A 5I51A 3WKAA 5H82A 3VHXB 1NDQA 1QRUA 1OAOC 4QBKA 3TL2A 1RP1A 1BS1A 4L9WA 4I6JA 2RI6A 1KVSA 5B6JA 1DQZA 1QF9A 2ZBGA 3FPJA 5FJIA 2O2EA 4M3NA 4RY8A 4JX9A 4TWRA 1ZGBA 3WMGA 3DOJA 1ZL2A 3W1VA 1OMOA 1WDMA 3N58A 3QOWA 4UTOA 1KYZA 1GL3A 3TMKA 3WYDA 5F35A 1UOOA 3WAGA 4EMSA 2CE2X 4FYJA 4PV7A 4EKIA 3L4JA 3H0CA 3RC8A 3CXRA 1SU8A 1RWKA 1CVIA 1COWA 2HLPA 3TLMA 3QUAA 3E70C 3PQ3A 3SSMA 1G8AA 2QN2A 4QUIA 4ZKDA 2A7QA 4MW1A 5BV1A 3A37A 1JWLA 5IBPA 1L7BA 3TD9A 3ZDDA 2K2WA 3W3AA 2DSTA 2JG3A 1M1NA 1QP8A 2GGSA 2CUTA 4IFBA 2WWWA 3L8EA 4BQIA 3IJEB 4CYMA 2C95A 2JFVA 4ZQHA 3QVTA 3UATA 4BU0A 2E89A 2JIOA 3PJGA 2XTJA 2X76A 3T0IA 1TFUA 3DMTA 5COQA 3N2EA 3VNUA 2IEYA 1CZLA 2E4AA 2XQIA 2P78A 4PRLA 2I2BA 3KYCA 5EA2A 3ASYA 3BF8A 3CX7A 2X3YA 1NBME 1J2JA 1GEGA 1ISGA 4UM9D 3TIFA 2BFCA 1CSEE 1DAEA 4IIEA 3I39X 4MRNA 5CHYA 2P5UA 5CX1A 3LOPA 2BJHA 3Q3HA 4BJ1A 5DP2A 3W77A 1YULA 2HF9A 2ZYRA 4K9NA 4GLOA 3AYZB 4RVDA 2M6KA 4TXJA 3RJMA 3RVSA 3RS7A 1Z6YA 2YX1A 2Q0SA 2HRQA 4QYTA 5LD2C 2QRKA 4MRMB 3DCIA 1QYXA 4OKSA 4JU8A 1PL8A 4YB8A 1U8UA 1ADFA 3IAEA 3O4FA 1R4NA 2P2GA 1U8FO 2ZE6A 4DG5A 2QSYA 1KAQA 3K1YA 3NHWA 4ZAXA 2XRZA 1E1LA 1TJ5A 4WKNA 4PSVA 4C3UA 3LHSA 3V8EA 3DCYA 3E81A 5AESA 1HG0A 1SRRA 4MYUA 3EUFA 3UFBA 3OOJA 4F45A 1RM4A 1Z3IX 2QS9A 2PKEA 3H2ZA 4WLOA 1IY2A 2P6MA 5D5QA 2OXTA 3WQBA 1VA4A 3ETLA 1II0A 4C29A 4XIGS 3NOVA 4F04A 3QUCA 3Q8LA 2ZRFA 3R20A 4QUJA 521PA 3URMA 1IXRC 3NHZA 2OYRA 4EQZA 5A4IS 5HM8A 2C83A 5HIMA 1U99A 1MCZA 3ACCA 2CF5A 1FZQA 2YVUA 3WIBA 4ADSG 4CMIA 2QTMA 1WZNA 2PZKA 4CV0A 1X38A 4KAAA 3GFPA 3E0XA 1J0AA 2YMPA 2XR1A 2FWAA 4EB6B 1SC4A 4AZ0A 1Q0QA 3GNLA 3LMKA 3GUCA 2OV8A 2P68A 5ADHA 1NN3A 2PIAA 4F6RB 1E99A 1GXSB 1N77A 2JGRA 1XU7A 4YV0A 2EKZA 1KH3A 2G76A 2JI8A 3V2GA 4RZSA 1G41A 3W8FA 4CCSA 3QHPA 1TZJA 4QODA 3BWEA 4IQ8A 3C85A 3WHPA 5JYEA 1BGXT 3PKJA 5JAPA 4IH4A 5I7EA 4ZCTA 3PF8A 2B0JA 3FCAA 1G64A 3MPOA 4D0SA 2LCIA 1W36D 1MW8X 2AOWA 1FUQA 1OZ0A 3BRCA 3LKZA 2X19A 4C4YA 3DBIA 3IVRA 1U2GA 4AYTA 5BV0A 1VBMA 1F9EA 3S1LA 3BX1A 4AKTA 5L6MB 4Z4QA 2RGBA 3WL8A 4YP6A 1AN9A 4GM4A 2CVOA 3H7IA 4ENUA 3HABA 3F7NA 3GI1A 4GP6A 2QI9F 3NNDA 4CQLB 4F8EA 2AUMA 3QU7A 3GRVA 1PJ8A 1N0VC 3SBOA 1YJAA 3JX9A 4FCWA 1E2HA 2B6NA 2P91A 1CY6A 3KAPA 4EKNB 2ZJBA 2X1HA 2IODA 2O9JA 3PGVA 4WY8A 1Y89A 4IHJF 4F9EA 1B00A 1OOEA 3AIMA 3B60A 3W3AD 4BKRA 2I0FA 4JL6A 3DBOB 4ZYVA 5K6TA 4MVJG 1LK7A 4Y2XA 2ZWOA 1LA2A 1ISMA 1FP7A 2J0QA 4GL4A 1YHNA 2YS6A 1QLWA 1BYIA 2ZTLA 3M5CA 4GF5A 4DM4A 3EGDA 1JHXA 3UB3A 1L7NA 1SOMA 2DTXA 5K03A 3RRBA 2NU8B 1L7VC 3SX0A 4DCUA 3MJVA 1OCEA 1U7DA 4O2RA 3I6BA 4B85A 2IS4A 1KRXA 1PS8A 3MOSA 1RTKA 4DJFC 1UF9A 2VSYA 2WR8A 4RQBA 2HN9A 1U1GA 1WMFA 2ZE8A 1JHOA 3DLPX 1Z37A 3IPCA 3A1TA 2Z9BA 4GFDA 1DCNA 2OGTA 4PU0A 4HEJA 2YW9A 2VQSA 3CKYA 5BR8B 3IQGX 3KC2A 4NG5A 3ZDCA 3HA7A 4LNUA 1OIVA 3NKVA 4G0PA 4IDGA 3U26A 5L9AA 5M5BA 2V0NA 3E2MA 3M3PA 1P6XA 1JQEA 2YJTD 1GSHA 2SKDA 3MTIA 3K6RA 3Q6MA 3FY4A 1L4NA 3N2KA 4O5OA 2I6XA 3EXEB 3T7CA 1OXTA 2ON6A 4PS1A 3NDRA 4TM7A 1HL3A 2WICA 3HBAA 2D0OB 5DX1A 5H16A 3VMFA 3TM5A 4D56A 1D04A 5ILOA 1NWCA 2FEOA 2Z43A 3RUFA 1L7EA 1K4YA 3RGGA 3UENA 1PLJA 3X1ZA 1TYZA 4C87A 3G0DA 1BDIA 3LRXA 1QB7A 1Z2AA 3AF4A 3E84A 1IY9A 5CVVA 3MHTA 3EOBI 3ZTTA 3NUZA 2XCOA 3IVCA 1QHNA 2P6PA 2H8GA 3DBLA 1XK6A 2F67A 3AF3A 3EY9A 1THZA 2DBZA 1FFAA 3KFVA 4J0JA 2C7PA 2HQ1A 4HUTA 1B73A 1GRVA 4U3JB 13PKA 1UODA 3VR6H 3ESDA 1KK3A 4C78A 4QBFA 5HRCA 3A1WA 2XUHA 5KB3A 2YV2A 4BMVA 4DG9A 2ZEJA 1YNOA 1W5FA 3DA8A 4D6PA 3V6LA 1GZ7A 2BSAA 3AFHA 4RL4A 3G23A 1Z6TA 4EM6A 4QHYA 4ASUA 4YPOA 3MWLA 2CCKA 2HXSA 4FGKA 3KJGA 4HVAA 4YX9A 3WGLA 1NZDA 3BGOS 2CFSA 3FMGA 3JAKB 1DKPA 5JQWA 3T1OA 3EWIA 1QIDA 1FFCA 4D3FA 4H0NA 4AS2A 4W5OA 4B3JA 3OCCA 2FP4A 3B48A 2CUNA 1TUBB 3ZZ1A 3U1BA 4DIKA 3SAJA 1L4UA 3HM9A 3HR7A 4WXRA 4XIJA 5FEMA 2VP5A 2AN9A 2O8EA 1YL7A 3WR5A 1X7HA 5EIWA 3ZWWA 3H9EO 3OPVA 4FJ0A 3NHLA 2QAGB 4EL0A 4CL8A 1T0JB 1HNWB 3AI3A 3HN2A 4II3A 4Q9IA 1KKMA 3NM4A 1GUBA 1FP1D 4LGYA 4XEUA 4WK4B 2ZVQX 1F0NA 3LVBA 1GARA 2AXPA 4IIJF 4PWZA 4G8DA 2VNHA 2J33A 2NIPA 1YRBA 3RUIA 4DW8A 2AFVA 4G5YA 1ID1A 4G63A 1ZN2A 4JLOA 3FR8A 3H11B 2OYCA 4C7MA 4DLPA 3PYXA 3R6TA 4OYLA 1M2OA 1NJGA 3G2LA 4AW9A 4EYEA 3TGLA 1F7UA 5G1OA 4MWOA 1PJCA 1QORA 2DFVA 3CUKA 3QU5A 1DGQA 5J2UA 1FZTA 1HYHA 3O4JA 2HWUA 4I1OA 5AVJA 3TCNA 4KXQA 4MA5A 1C8VB 2P30A 3H5WA 2UVDA 1ZIYA 4A6DA 3F5SA 1WP9A 2R7AA 4RYLA 3A7DA 1L5HA 4PLHA 4K03A 2I1WA 1XE3A 3ANSA 4C06A 3NBKA 4NVRA 4HK4A 3JVIA 2Q3EA 1KU6A 4TRJA 4BVKA 1TU3A 3HCCA 3PNYA 1I8TA 2HLDA 4JHXA 1PJ3A 4WUTA 3ILHA 3F6EX 3LH5A 2AVNA 3RLFA 1SHLA 1UBJS 1E6EA 1KDPA 2DJIA 3N7TA 5AJZA 1DQSA 2BOVA 3VPXA 1NUUA 1WUHS 2O8CA 1NVMB 2BWJA 2H08A 2FLKA 3HDTA 2IX9A 1XCOA 1D0VA 4FTWA 4WLUA 5T6MA 3EOZA 2V7WA 2O48X 4ZYLA 1J06A 2FFAA 2PBLA 4FOLA 5AUNB 1YDGA 2VYVA 3ESAA 1DOHA 2JFZA 2XMBA 3GQBA 2P40A 2OAP1 3VH2A 3ZE1B 4B6GA 1HQKA 2RHHA 3RSGA 4O2LA 4MJXA 4TUYA 2RARA 3K9BA 4Y30A 1T9BA 5EXPA 3QWHA 2DR2A 4RF2A 4MIKA 1EVZA 2PRJA 2VTKA 2WWYA 1XMXA 3HRKA 1W36C 5DHUA 1ABBA 3KQPA 1HH4A 3I64A 1HL7A 1OJ7A 3AKYA 4WNCA 4CWAA 5LLDA 1R4AA 4XX0B 3OQOA 5FDFA 5K8JB 3RKRA 1EZZA 3L1HA 3SC3A 2PSSA 3B1KA 1CETA 2P41A 3D59A 4XQGA 3SEAA 3BPSA 5IJ9A 4PHHA 1MOQA 4MTLA 3C1AA 3JR7A 1I4DD 2W00A 3BICA 4QUDA 5E2AA 1JZTA 3ET5A 1WXEA 4C4OA 2VWGA 2ORVA 4PHFA 2D7JA 4DLAA 1LPPA 1TYCA 3BCSA 3ESRA 4P0QB 2FX2A 1TZBA 1Z15A 1V3TA 4ZV4A 3DZGA 3WIEA 4DLLA 1AQNA 2HWYA 3EGEA 1R6UA 1ZJZA 1I24A 2PUTA 3OQIB 3QVKA 4CTKA 4YRGA 3STVA 3ULKA 1TJUA 3B5IA 4NESA 5K0CA 4OA8A 4QFCA 5JU6A 2LV8A 2ZUSA 3LQ2A 4LVUA 4LXGA 5FB3A 3V7YA 4BXOB 2Q99A 3KKZA 4KNVA 4RMJA 3G5MA 3C3AA 3N8IA 4BP8A 2JDIA 3GJZA 1VE6A 4EI7A 3U4HA 5GAJA 5JSHA 1Z06A 4GKAA 3P9NA 5CYFA 5D5HA 4PTZA 3T06B 3W3AH 3JVUA 5F7XA 1R4ZA 3AVOA 4HDNA 4IXNA 5ALLA 1EZ4A 1CY1A 3PFBA 3FNHA 4F2WA 2CXNA 2GAIA 4BQOA 3FTNA 4CU2A 3T35A 3TNLA 1E61A 1FP6A 1MENA 2EGUA 2Z2YA 2ZI3A 1TVCA 4PCAA 1IBRA 4GOKA 1KORA 1U4OA 4LI3X 5FI1B 2VAPA 1U2GC 2WM2A 5T41A 4HYQA 2H1SA 2NQ8A 5KZMB 2OE2A 5A0TA 4UUQA 1AMNA 2QY6A 1MVOA 1V35A 4I5IA 3ZDYB 3MVEA 2R0QC 1X7WB 1PYDA 4EY3A 3OTWA 4WBNB 2AXQA 1O87A 2A1IA 4LV6A 5KVVA 1DIRA 1JSCA 2RJOA 4AZ0B 3A2KA 1HXHA 4ZGBA 5CTAA 1E9BA 1CDZA 1TFRA 4HH1A 4NAVA 2R85A 2D5LA 3DR3A 5EIFA 4TL8A 3HS3A 5AM1A 2HR1A 2NO7A 3H0EA 5CJ2A 2EYUA 2M1ZA 5KPDA 1GFWA 4TYPA 2NM0A 3NM5A 4KI0A 5EXXA 5SZHB 5TPWA 1RZ3A 2BY4A 2FCAA 3NETA 4CM9A 3F7TA 4AKEA 1ZHFA 2GAJA 2XNDD 4TZKA 3T0GA 4GEGA 4X6LA 4KXWA 1CZHA 2LPMA 2PLFA 1OROA 2BEUB 3M1LA 4EFMA 1OC2A 4DRXB 4J16A 3LIIA 3HP7A 4EJMA 1CD5A 2P69A 1REQA 3U49A 2F8LA 3M89A 4US0R 5D01A 1KA9H 2NTJA 3JV7A 4KQHA 4X95A 1XDZA 1ORTA 2MSLA 5DF1A 3WA6A 1ECCA 1DZ3A 4J8PA 1MAUA 1Y3FE 2OCXA 3K4HA 4D8XA 5JSKA 3HZHA 4NHOA 1YR8A 2C97A 2F9FA 2OQVA 4AX4A 4CKBA 5LQDA 1JKFA 1MQ8B 1Y63A 4B6EA 4DRZA 1ACMA 2Q5IA 4BEBA 3GEEA 1TRHA 1U7ZA 3P2IA 2JBHA 4NICA 3C6YA 3LECA 4L6IA 2XBLA 5DYYA 5H70A 1JI0A 2J0UB 4I6GA 1WF6A 1JI3A 3QXCA 5ALJA 2WF7A 4OTZA 1EG2A 2C9MA 3GJ8A 5I4BA 1PHRA 2IYOA 4PZ0A 5G3ZA 5U4QA 2BFPA 2BKLA 1XDGA 1X8XA 4J4TA 4X6XA 3GAAA 4J29A 3UKOA 3VPSA 1SR8A 2OFWA 1COWD 4NPAA 3E9MA 3NBYC 5JYDA 3ICPA 4AN1A 1Q3HA 5IXYA 5CFQA 2YZKA 3CWCA 3CYFA 4J2TA 4R1PA 3KZMA 5EE1A 3E48A 4Z0HO 5CCBA 5K3EA 3MJFA 1JR3E 5HGXA 1SUSA 5C31A 4F5YA 4JI4B 1PYGA 3ZU5A 2FSSA 5B4VA 5LYJB 2C2XA 4NV0A 1A9OA 2BHTA 2Q6VA 4HKTA 3UQYS 4ER3A 1AXGA 3SF8B 1VZ2A 2C07A 1DIOB 4CM8B 4LCEA 5EJ4A 1TUGA 1XJQA 2ORIA 1AUXA 4EO7A 1ILEA 2UUPA 3QZUA 3R3ZA 1DRUA 1MZPA 4IDOA 1XXLA 3R7DA 3UJPA 1AHPA 5K0BA 4ZO4A 5DLEA 5TY0A 5KTRA 4IDHA 4HH0A 1V6CA 2AJLI 3OX4A 3RABA 2IW1A 1O7JA 5C53B 1NG9A 1M83A 421PA 4ESOA 2BCGY 4L5BA 5GM2A 4YJ2A 2PFMA 1IOZA 3FPCA 1VMKA 5A03A 1SHTX 1MQ9A 5BQ5A 4QD3A 4KN8A 3SDZA 3I0MA 4CKCB 3H5RA 3D3WB 1WDLA 2MWMA 3BGIA 4WESA 3BQ9A 4F8JA 3S7ZA 3PUKA 2DWUA 3HO1A 2JATA 4DIOA 5LIRA 2GJ4A 1ITZA 1U8XX 4HOYA 2O59A 2I8CA 3T5AA 2QX8A 1L7QA 4CT0A 2C58A 1NLYA 1G8KA 4OHFA 4RIFA 4V03A 2IQIA 1QQ5A 4Z8XA 3U4QB 5T4FA 2PUJA 1U9JA 4XPIB 5ILQA 2BH9A 3H4TA 1CX9B 5DXJA 4C05A 1VYVA 2D13A 3LGAA 4IYRA 4KWIA 4JBLA 2AXEA 2NQ2C 4DA4A 3UC5A 4GVLA 4JMPA 4AWAA 5ETJA 4CTMA 1EG7A 1NFFA 4G23A 5BN3A 1O1YA 1PR0A 2IU6A 5KNBH 2XXAB 3DKKA 1XMJA 2GZHA 5FA5A 1QRAA 2QOEA 1H65A 4B3TB 2REQB 3VFDA 3G2IA 4AJPA 1SU4A 3ZXIA 4KR9A 2BFFB 3KR2A 5A7FA 1D5CA 1II8B 2A5YB 5AOAA 4AZ3B 3GLFA 4LJRA 4AJ2A 1VIYA 2RHLA 3FWNA 1ODJA 3IEPA 3IJ5A 5D84A 1R6VA 2O0KA 5FR2A 3SYLA 4IFTA 3WLHA 5D3MA 2PWAA 4IDCA 3CU5A 2KWIA 3X3HA 1UMBB 2QPOA 2X2EA 4RKWA 1NHGA 5DK6A 3S28A 3TYXA 1P2DA 3TM4A 4HNVA 3RVBA 3I72A 3E61A 5FBWB 2MYTA 3UHOA 4BX2A 2JGKA 3JSAA 2ZJ4A 3PC7A 2WY2D 5KNBA 4N3NA 2FRDC 2GZRA 4Q1AA 1T3HA 2YJ4A 4JYPA 1A8PA 2H65A 2J9YB 3HB7A 3P9ZA 4AQ7A 1YRYE 3NONA 1EGHA 3I28A 1XK7A 3IKTA 2HIAA 1JH8A 1T1IA 4REQB 4MMYB 3CF0A 3A9RA 5DN6A 5IG2A 2CDNA 2C4MA 4HVTA 1WUIS 4WXMA 2IF2A 5JWRA 1TJ7A 3K5HA 4GX1A 2NO4A 1WY7A 1XVAA 5BORA 1J49A 3IQIX 1T9DA 2HUNA 1TM1E 2I4IA 1AKUA 3G2QA 2IHKA 3BHJA 4HLUA 2WYHA 2OUKA 2JCVA 5IABA 1D4OA 3RVQA 2JA1A 4WJZA 2A9FA 1H2BA 1A9YA 3FGZA 1CQIA 1FMLA 2PX5A 2B1RA 3IS3A 2ZREA 3LSTA 3EVGA 1DEOA 3OF3A 4Z8YA 3TZEA 1VG8A 2Z4RA 4YECA 3M83A 2IC5A 3MOIA 2F3UA 1I3KA 1GG5A 3CX4A 3QI7A 3DD5A 4M1SA 2YN0A 1X39A 4BEWA 2CHVA 4E51A 4RTNA 1RE5A 2Q0QA 2XRMA 1AM4D 2H2FA 3UXMA 5LZ9A 1KZGB 3OLWA 3VOSA 1GNRA 2BGTA 3MUOA 4MWTA 4REOA 1XJ5A 3VYRB 1SKMA 2PSDA 1DTWA 3HH8A 1Y7TA 4XVQA 1TJPB 2PWYA 4OYRA 3ZGYA 1H9CA 3AJAA 1G38A 4Z5XA 3EGVA 1GPH1 3QPAA 5AKXA 4QQNA 1RC1A 1S7CA 3MTJA 1W9MA 1E2JA 3KVOA 1SQFA 3EASA 3VDXA 1M2KA 5ED0A 2DRIA 2AH5A 5TR9A 2DHQA 3CFYA 4I55F 5HKOA 221PA 1IHUA 3F97A 3MMPA 2ZJFA 1H69A 2ACWA 3T1TA 1T8UA 2QTAA 4OUDB 2PX4A 1P2TA 3IOBA 2VI5A 2NN3C 3W9BA 1RXSA 1T8PA 1T5OA 3D8UA 5EHZA 4YJFA 1HURA 4RD2A 4N03A 3RIHA 2EW1A 3ROQA 4B17A 2IEDA 4XGNA 2EBWA 1K6XA 1Q7EA 2ZRDA 1TKAA 3AH8A 3FROA 4AXXA 3U5ZB 1MF7A 4F5ZA 1EFTA 4XVCA 3BULA 5DBFA 2EKQA 2L18A 1CQPA 3BFPA 4J3FA 1EBUA 3T8YA 2NUAA 1QZZA 3ANLA 1ZGCA 1V8ZA 3M2PA 1QOZA 1A1VA 4DUYB 1WDKA 2I4OA 3HKCB 2BMEA 3L04A 1RZRD 5EGSA 5KTKA 1JE1A 4CM1A 3SS9X 2OZEA 1I94B 4HTFA 4P4NA 5I7FA 4BX9A 3OD1A 1QFMA 1VRCA 1QX3A 3FDXA 4ZOEA 4Z0PA 4NWIA 3EARA 4LV5B 5JVDB 2IPOA 3RFVA 3V4FA 4UHHA 4X91A 3QM1A 1C50A 1I0LA 5IFKA 1Q1AA 1WPQA 3DHWC 2C2KA 4OQZA 1U2ZA 3P2OA 1E4EB 4Y67A 1OXSC 2GFIA 3I12A 3L6DA 2BGLA 3K9QO 2E9SA 4K8RB 2B9EA 4U9HS 2SKEA 5ERYA 3A3NA 4BQQA 2R6R1 2VF4X 2BMAA 4LKOA 1UBFA 4PBTA 4B40A 3D02A 1Q3TA 4KQGA 1VPEA 3N8NA 4AKIA 4QTYA 2IYTA 3TJMA 3IJPA 4M9SA 1TUIA 1M0EA 1YJCA 4C0KA 3IKJA 1SQ6A 3FCXA 4RFSB 3TUZC 1GN9A 4DDMA 3F71A 1GLGA 1EA7A 3U3KA 3TEMA 1WW8A 3OFJA 3W8EA 4AUNA 4DKXA 1FMJA 4JB8A 5KKNB 4JLVA 3OD5A 1TZMA 4C6TA 3SHQA 3WGNA 2SKCA 3WNCA 4OPMA 1Q3KA 1Y6FA 3IUQA 1K0UA 2KB0A 3T1QA 4E70A 4D1YA 1M1YB 5CFNA 3OQPA 4AF6A 1VCMA 2C8VA 3COPA 2B21A 3A3PA 1QHFA 4Z51A 2B34A 3ZV7A 3K2EA 4C0HA 1T5LA 1ZU5A 4YLYA 2D4HA 2PZGA 4EFLA 4OMDA 1CHDA 3DMYA 3MMNA 1DWUA 3C5HA 3F8TA 5CLJA 5J2TA 3C8DA 3A4YA 4YMTA 1V25A 4OUKX 3S5JA 1Z8FA 4LC0A 3KEOA 4E1BA 4YUZA 2PD3A 1DJMA 3GJSA 1WUJS 3LKVA 2WYUA 1BNCA 3Q10A 3UMJA 5LYYA 1Y8CA 1J5XA 3BF7A 4UOQA 1BROA 1L5HB 2C3PA 4N76A 2IYSA 2WWFA 2VPYA 4CW7A 4X65B 2P3QA 1DMSA 3PRJA 5ALYA 2GESA 3U7FB 2QLBA 5EWJB 1J39A 4MI9A 3EOAI 5FTKA 6REQB 1BX3A 4YO8A 1QGUB 2IW3A 4KUGA 1POXA 3GELA 4OP3A 1PI3A 2C9DA 3AI7A 2XXBA 5DBEX 2VXOA 5BWMA 1P0IA 1GFZA 5BV8A 2B8TA 1CS4C 2QW8A 4G6ZA 4XI9A 2IUUA 1XF1A 2B0CA 2CXOA 1RHJA 3E2IA 4CDMA 4DWWA 5I5GA 4ZYXA 1Z3CA 3L8CA 4DA6A 2A30A 2CFCA 3DVRX 5E3JA 1QPBA 1Z47A 4Q82A 4DADA 2M32A 1X1DA 3ORHA 3TVYA 4MR8A 1DG1G 2NT4A 4YIKA 4B1FA 1C9EA 1PUXA 3KWLA 1QR2A 1L5KA 1IDN1 4DMRA 1MU0A 4Q9HA 1MAAA 5HGJA 4B4VA 3I01M 2R1UA 1I7LA 1QO7A 3D8RA 4KXVA 3T5CA 2VQFB 3PLAE 3OJEA 3PA6A 1PDOA 3OSZA 2I80A 4H7HA 5BN1A 2AR9A 5FPTA 3RKUA 3SQWA 2QNRA 4RKYA 1IVYA 1PQYA 2AF4C 1EFCA 2TSYB 4CG3A 5IU6A 2H2AA 3U31A 5T3YA 1ZK3A 2V7PA 3FBTA 4XFDA 4YJ3A 2FZVA 4LV8B 2LW7A 1P75A 3SMQA 3O4VA 1BQEA 2NGRA 3VRHA 4ZI3A 2GBCA 2PX6A 2RGWA 1SUEA 2FW6A 2ZVJA 4G67A 4G5QA 1TE2A 4OHMA 2NACA 2J3DA 1IPHA 1BE1A 1RLMA 2ZS9A 4XM1A 4NCNA 3IBYA 5JEDA 1DKUA 2FK8A 2V7BA 4PQFA 3OTGA 3VVBA 4TVSA 1AGPA 4ZI7A 3ZQJA 3ZDRA 4MKZA 4JI3B 3I1IA 3MUNA 1WHSB 4OXQA 1U15A 3FWPA 4PTYA 3VO9A 4LMPA 5BVHB 5HIKA 4H77A 2VHUA 4DR2B 3MK31 1EQ2A 1TQDA 4WINA 1B43A 1RADA 2EJBA 3WBFA 4ZGGA 3DDWA 4TKMA 3V1NA 3FWKA 3KQYA 3RGWS 2J30A 4D2IA 2IHBA 2FR8C 1E6MA 2HHLA 3EPRA 4WJKB 4DR1B 4DMMA 4ESHA 4GMKA 1S8NA 1VOTA 3AHHA 1SCNE 2QD2A 5AUOB 3L2OB 1WWKA 3RNOA 4XWKA 2D3WA 4NZPA 3F4SA 5C9ZA 5KNLA 1SKYB 4LDJA 5AM0A 3KQVA 1G8SA 3KYDA 4CG0A 5F12A 1IZ0A 4FQ5A 4MAMA 4BV2A 1N2IA 2C8LA 2YZMA 1XJCA 3NYIA 2H54A 2O7SA 5SY9A 1R7RA 2HRZA 4W5NA 1GP2A 1VCNA 2W6CX 3DGEC 2IYYA 3IPYA 2WABA 4GGOA 4WRRA 4WXPA 4EA8A 2IX3A 3JRWA 1L8AA 5KSPA 3M7IA 1J3UA 5I4IA 4P4UA 1V37A 3SSAA 1QRSA 4YBZA 2JCSA 3CVWA 2I5PO 2FGJA 2WP0A 5EIEA 5I7RA 3I9LA 3C14C 3F6CA 3CEHA 4HNAB 3X1XA 4TT3D 2UXBB 2E87A 3ZZUA 4W8OA 5CLGA 1DJPA 1QO0D 2PQ0A 1IZZA 2ZQZA 5JR3A 4A10A 1SC1A 2YW2A 4OYHA 3SZOA 1AQUA 2WMYA 5F3DA 3T52A 4GG1A 4H4DA 4OXIA 3WKDA 4ZMSA 2OXEA 4JNCA 1IJKA 5EPUA 2RGNC 3E9CA 5B1HA 1AS3A 2IHNA 1Q12A 3BA1A 4CMEA 1FYWA 1I10A 2FSIA 4RKQA 1UBLS 3ZI7A 3B2QA 3D0OA 4Z3OA 3B9QA 1GGNA 2J6IA 2YRFA 2MR5A 4XH9B 2M98A 2Q9BA 1VI5A 1P0QA 3I1YA 1OBOA 1I2DA 3MWJA 1OI4A 2H1WA 4URHA 4MI1A 4WN9B 1P6QA 4ZJPA 2Q28A 1MO5A 1ZNYA 5J58A 4Q21A 4YAFA 4EY5A 3CKLA 2O23A 5L8VA 2VATA 4G4SO 1I3MA 4AROA 1G4UR 4KREA 2PZMA 2F9LA 1A4UA 3HFJA 4OK5A 1R64A 3OOYA 4P80A 3E3OA 4G1VA 1QHEA 3E03A 4G01B 2NU9B 3BZWA 3WSWA 1LI4A 1U9CA 3IVGA 4I55A 4RD0A 5KVSA 3DTNA 1AKMA 2J3QA 4UPEA 3E3MA 4OH7A 5FWYA 2BSQA 4UPVA 3ZQKA 1RIIA 4Q6WA 2PZAA 5ALIA 1GD1O 2R48A 3UJHA 2QPTA 3W05A 3HRHA 4JI7B 3R3HA 1NW3A 2W4IA 2PT6A 3V34A 4GAEA 1EXDA 3DHNA 2JB9A 4UNNA 2YDXA 4HS9A 4R2JA 4H2DA 2DKFA 3IT1A 4BIIA 1IN1A 1Y1PA 4DPKA 1WBBA 4X71A 1VIVA 1T6XA 1JDSA 1L7RA 4I4TB 3AFIA 3LC2O 1AKNA 4JXXA 3V1KA 5C4MA 2J41A 4RFSA 4BGUA 4BO2A 1OXXK 2RG7A 4U0KA 2BJVA 2OHIA 1CEYA 3AXSA 1DOAA 5JG7A 2WJWA 3IDZA 4S2UA 3RAFC 1I2ZA 2A1UA 5IJXA 3QKIA 2DSNA 3QXSA 1NMEA 3ESYA 3HP1A 3GPLA 3EUAA 5KSWB 1XOIA 5EFOA 1XQ1A 5KSZA 3GOQA 2X8JB 1WDWB 2WMDA 2FUEA 3AY6A 4KRYA 3ZQ6A 1QGYA 4JP3A 5ITSA 3PGKA 3P5SA 4YRSA 4E07A 1DOZA 2WJYA 1XLWA 3IODA 4QPZA 4DA9A 1KY5A 1XD9A 2VK1A 5THXA 4R71A 3G82C 3TRFA 2YDYA 1DNPA 2BF4A 4TZ6A 1DWPA 3ISJA 4E4TA 4B79A 1OX4A 4N9QA 4KOEC 3I42A 3KPVA 4HR7A 3T5GA 4RA6B 4IJKA 1J90A 2P4SA 2W6OA 3ROTA 3HL4A 4DYVA 4V0ME 1BA2A 1QG0A 3IT3A 2HI0A 3ZYCA 1MH1A 1UEXC 2P9QA 5BQPA 4B3FX 1KE1A 2PJRA 2AFIB 3PFWO 1LU9A 4MUEA 4WOCA 5CT4A 1L5MA 2DLCX 3UK2A 1PJ4A 2QB5A 1F8XA 2W2OA 4QDXA 4Y2GA 4B6OA 3JQDA 4HAWA 3CXUA 2XGGA 4BNYA 1KMHB 4QPNA 1R66A 3ZE6A 1L2TA 1XA3A 1GNLA 4FSDA 3RKSA 3RODA 4DLNA 2R00C 4NNJA 1HFKA 5I8WA 4K28A 2GLTA 3H1FA 3KUCA 3P94A 2YL2A 3F5MA 4GSYA 4MW2A 4WZ6A 1KSGA 3R7SA 4EUFA 2OLEA 5BSWA 1V1RB 3P2KA 5EUBA 4M22A 3K8YA 2F9MA 3TLBA 4CMCA 3GLGE 3GAMA 1Z82A 3HLKA 1EDBA 1VG1A 2NUBA 3OFKA 3QIAA 4EKGA 1KP3A 2V65A 4JBWA 4WN9A 3ZDEA 1HDEA 2TYSB 1A9TA 1TZCA 3TDKA 4XCXA 1YU6A 4JOQA 4YJHB 1JU3A 2B1QA 2NSLA 3ZCXA 1FBNA 3GO4A 3FZGA 5K0TA 5LZ4A 2ZR8A 1DC4A 1GA4A 1M7BA 3CLUD 2Q1TA 1DV2A 2W48A 4L57A 4M7OA 4WT7A 4YRJA 3K2IA 3GUUA 3W06A 4ALLA 2AG0A 1EUDA 1TYAE 2GPNA 3MTGA 4PG5A 4Q66C 2P11A 3WDSA 3O3MB 2VK2A 3RVMA 4YH1A 1FFXA 4LGVA 5KQGA 2ZJ7A 5FORA 3R5XA 4S35A 3B9RA 5DFAA 2ZUBA 1G6OA 5EQTA 2JPDA 3PFFA 3O1LA 4RLSA 2G3YA 1TEVA 3O4GA 4G0YA 4R7TA 6ABPA 1NPYA 3QI2A 4PNEA 3WS7A 4BWYA 4P7FA 3LJKA 3P45A 4B4UA 4CR6A 2FOXA 4M0FA 2XUZA 3FPGA 4ZC8A 3CVUA 1MPTA 1TGVA 1D9XA 4GP7A 4Z9BA 3QE4A 2ZWAA 3F49S 1VMEA 3V8RA 4I81A 1N75A 2PR2A 5CDTA 2QUKA 4Q02A 4R8LA 1AQIA 5D3QA 2Z0MA 1T3GA 4P36A 1A95A 1L6IA 3NBMA 5EWLA 5GJBA 3HZOA 5JQGA 3EFOA 4P4GA 5KYYA 4PF1A 4LRTB 2WU0A 4RS4A 3GZHA 2HHJA 1DIAA 2BHSA 4UEJA 4YRMA 3CLSC 4FDVA 4R9UC 1IIRA 3L93A 4MAFA 1H8ED 2W43A 4RPKA 3SJAA 1IVSA 1N8NA 1KZ4A 1HZZA 2BMFA 2J0VA 4Y2YA 3N28A 3WGGA 1F8FA 2PYIA 2HSZA 3H84A 1EWRA 3JD1A 1GG2A 4O2BF 3PI6A 1T9GS 4F3TA 4NU8X 1JSXA 1MB2A 1G8HA 2DFNA 4HRXA 4GI2A 2PDAA 2ZAMA 2AOTB 1BKYA 1SXPA 4MUYA 1K5DA 3ZZTA 5E8RA 5BRJA 4U7HA 4HFNA 3GFOA 2BFFA 1FVFA 5L3ZA 3IBGA 2ZIGA 5DW3A 1YA4A 4ZOLF 5FBHA 1HORA 2WIFA 3N2GA 3P71T 3KB6A 3C8ZA 5BSVA 3O8BA 5FBVB 4N5LA 5IAJA 4M9CA 1PW5A 1Z0IA 1E92A 2C5FA 2DPYA 3LLSA 1OXKB 3MPUA 4DQKA 4YMHA 3X0DA 3WLPA 2BTOA 4QU0A 4Y7CA 2PK3A 2RHBA 2X1MA 4FYYA 5CH5A 5DN9A 3RUEA 3EULA 121PA 1EB8A 1RVDA 3JYHA 3L49A 3RVLA 1V16B 2JAQA 1YJXA 2LZ0A 2FPXA 3DDCA 2QUIA 3L5KA 3R2JA 2EATA 4JK3A 4WGFA 5DO9A 5B3JA 3H04A 3TW4A 3ZWQA 2PKXA 4C22A 4MUXA 1P0FA 4C07A 4YJ3B 4EMUA 2OCYC 3HXOA 1EUCB 2G8NA 4P86A 2AMVA 1B6TA 3AP3A 4GYKA 5AVXA 2PH3A 4G1CA 5JCXA 1Y6ZA 3HKBA 3RTGA 1MB0A 3GEMA 2ZIVB 1G2OA 3Q8XB 3JATB 1BA3A 1ESNA 3QYAA 4XUDA 3BGSA 5ESWA 4AF7A 1GTMA 4DEVA 4IP0A 3Q11A 2MIIA 3E1GA 5JSZB 1CR2A 4JJ6A 2WZBA 3H2BA 1SPBS 1SWWA 1UCFA 3MG9A 4IDBA 3C6MA 2WSYB 1C8KA 5CEEA 3CX6A 5HEKA 1M7GA 2P9HA 2G9VA 1X7ZA 1TUEA 2YV4A 4MYSA 5CIQA 2D00A 1ONNA 4XSHA 4GE0A 4L28A 5H83A 2CHFA 4JP5A 2WQ7A 3ENVA 2V59A 4X7MA 2FZKA 1E1MA 4MW7A 4MYRA 3F3KA 4COKA 5ALEA 4G5HA 2GZ2A 3M9XA 4JR2A 2J6HA 2R66A 1L5LA 2WVJA 3VR6A 4C43A 2OHXA 2CBGA 5EC8A 3I9OA 4CM8A 4E13A 3L8YA 1Z4OA 3PUYA 2WYIA 4Z4IA 4LG1A 2XNDA 2EZTA 2Y0PA 3LHFA 4AMUA 4BE9A 2IBMA 2VHVA 3F98A 4XWAA 3BOSA 3FJ1A 5H80A 2B8NA 3L8ZA 4LMBA 2DWCA 2DWPA 2GCIA 2ZAYA 3OC0A 2PCJA 5FAKA 2J9ZB 2PGJA 1TIBA 2P2YA 2Q29A 3QPDA 4HEHA 3WX0A 1N2XA 4FOOA 4HMQA 1Q0LA 3IXQA 4DN6A 3OM9A 2C77A 2CZGA 3BMCA 3C1TA 3N5CA 3P9RA 4LC1A 2XQJA 2ZLBA 4PIPA 5GM1A 3FPSA 1E1YA 3ZJYA 5H4GA 1Y4ZA 4DR6B 4BVHA 4LHWA 3ADOA 2BJWA 4Y9UA 3VV2A 3NTRA 3O6VA 4MRSA 1G20E 1GPAA 3G7NA 4TV9A 4X8MA 2AJTA 2YHUA 3PHGA 1Q77A 1D1SA 1QGED 2VRNA 3CZ9A 3BZBA 4R16A 1U2EA 2Y71A 4R9VA 1TO6A 3T1VA 4NOJA 3FWYA 1NC1A 4D9IA 2ZBDA 3FPLA 3RIEA 2XDQB 3B2NA 3K4PA 2JGNA 3B7WA 1K0FA 3WBBA 4HMOA 2OM2A 3HFRA 4EUSA 2IUYA 5EMMA 4PSUA 1E32A 2C3MA 4CKCA 4Z4HA 5LP6B 4EEKA 1H4VB 3C0KA 2Y9MB 2GETA 2I76A 1JVNA 4L8GA 4BVJA 3MWEA 1CQXA 4AMZA 5H1YA 1XMOB 3OZDA 4D3SA 4L7QA 1SCJA 2AHOA 2WSBA 3AHGA 1NX6A 1J9GA 4RM3A 2OSVA 1LTQA 1WZUA 2IHZA 3P9QA 2CLIB 4FSHA 5AXAA 3A4VA 4GBED 1DUVG 2P2SA 1N0IA 5K99A 1QG6A 2CEKA 3H4MA 4KIFA 5HW0A 2W6ID 2QRVA 1M5UA 3C6ZA 1G2QA 3GV0A 3LP5A 4B9AA 1HX7A 4WKCA 4LSZA 1KH1A 2YH2A 2FUG1 3NASA 1XL1A 3I73A 1RKUA 4P3YA 5AHWA 4XB6B 3SOZA 4OLBA 4Q1DA 1SKAA 3ZJ4A 2C7QA 5DYNA 2O1SA 3ZWVA 4YBRA 1AHNA 2Y1GA 4F5WA 4MPPA 1QUEA 2GHIA 2P9ZA 5CFPA 4FKBA 1KKLA 2H4WA 1NSFA 5EWMB 2GEJA 2EDAA 3O94A 4KGZA 4D4MA 2XV1A 3IA2A 2Y4OA 2GK3A 4RA9B 1Z2CA 3WSTA 3DVAB 4DHEA 1VLQA 1YRHA 2OOSA 4RELA 1Y3BE 4DC0A 3GCWA 2G5CA 1Z7YA 2XUQA 4PO1A 5BWCA 4Q01A 5L53A 3GY0A 4KQEA 1YIAA 5AT1A 1OX4B 2HMVA 3VYSB 1TM3E 3I3OA 2C31A 4NBKA 5EI5A 5L40A 4EECA 3RI3A 4DJJA 4XYLA 3H5NA 2J3JA 2YBEA 2CXQA 2R5FA 1QC5A 3BK2A 3HJCA 3JQRA 3OIGA 4QREA 1OYOA 3P4YA 4UBLA 1UJ5A 1MT3A 1LNZA 1U7PA 3OPYB 3DP7A 1KHHA 1CY4A 1U0OC 2RAFA 1XPOA 3DPIA 3AUTA 3K5IA 1MGOA 5DMXA 1U0RA 2H4HA 2YR0A 1C9NA 1SA0B 3MUEA 1VP9A 3RSOA 3ZEIA 4QOHA 3DUWA 1JPUA 3HVJA 3AW8A 1TCAA 1PZFA 3WMEA 5FUQA 2G1PA 2SBTA 1FP4A 3HC7A 1AU9A 3ZJ5A 4OGGA 3WJ7A 5AKLA 4N0EA 4P32A 3JTEA 2J45A 3M4NA 1JU9A 4YROA 3P20A 3HB5X 4YYEA 3PXDA 2IKSA 5EHXA 2DH5A 3PCRB 3K9WA 5A71A 4A03A 2BRUC 5FPQA 3V8MA 5KOJB 3CNNA 2F1KA 3CCFA 1WQ1R 5IJ9B 1TJNA 4LOJA 4NFYA 3THYB 4PGHA 4CIBA 1ZD5A 4FIDA 5LP6F 3OMWA 4MYHA 3BWXA 1Z45A 4HSEA 1CS0A 4JR0A 4W6QA 2PU7A 3HSYA 4EUNA 1ZUWA 3J81k 1ISFA 4HI0E 3JQGB 4IZ6A 3C8HA 3SIWA 2W6ZA 1P29A 2I6GA 1QMGA 4FU0A 4TKZA 1UQRA 5C5CA 4W5JA 3LDHA 1U1EA 4N49A 4D9JA 1ZCZA 1W87A 2VSNA 3CO5A 4K9PA 4YAGA 4QXMA 4IL5A 4ZEVA 2VZ8A 4QEZA 3DBHB 3WRVA 2OBFA 4MQFB 1US8A 3ES9A 1WEKA 1P19A 3EF1A 3PNVA 4ATNA 4CMHA 4OMFG 4KN6A 3IUEA 2YHBA 2X8LA 5L3SA 4BY9E 4E5YA 1N9GB 6GPBA 7ABPA 3N6XA 1EESA 4BCCA 3L0CA 3IDQA 3NNSA 1EFHA 3QBTA 4PGFA 2FHSA 5BSEA 3JARA 3LF1A 3ZVMA 1C1HA 4C2BA 1YR1A 4INPA 4PC1A 4HQOA 4ED9A 3MGKA 5D3MB 1ACLA 1MNQA 1FXSA 1E0AA 1D9ZA 4GPZA 4JBHA 3P0IA 3QE9Y 2IH2A 1U3CA 4TLCA 3SVZA 3NI2A 2QG9A 1HLDA 1OYVA 2WUVA 1H42A 3EXHB 4L4XA 3H42B 4PEVA 2IV2X 5CYGA 4MWSA 2UUOA 2WZQA 3KOUA 4BQRA 4JOSA 4G5GA 1ZGHA 2J3EA 3T3PB 1FYDA 4D9CA 1E1RD 4EHJA 1UK6A 2RHMA 3C97A 3NNNA 1U5AA 2W0SA 2CEAA 4M2LA 1G59A 1H4QA 2Q9UA 1M2OB 5H5JA 4V3BA 4EJSC 1XQ6A 1V5GA 1L8XA 2LXNA 4QOSA 1S1CA 1JDJA 1NTRA 1RRPA 1MX9A 3MWFA 3P2JA 3WYCA 4AJHA 1C0KA 2J6BA 4F3NA 3GLFE 2PJZA 4L08A 2A67A 1NNI1 3IT0A 1DAFA 3L7JA 4BLWA 4CV1A 1C7ZA 1T5SA 1NE7A 4DQLA 4RCYA 5EY5B 4NBVA 3DVSX 4GRAA 4DCVA 2IRWA 1VRVA 2B9VA 3GK3A 4GECA 5CCEA 4YRNA 4HQKA 2A5LA 4A27A 3DZ8A 2ASEA 3FOCA 3RDPA 4OHYA 4TUYB 2NV2B 4O25A 1YZTA 1HKUA 3D1VA 4MTCA 1JG2A 1UBHS 2VP6A 3M6LA 4QVIA 4IM7A 2QLMA 2VUSA 2GB4A 2QMZA 5D6OA 4C76A 4FR2A 4QDOA 4QBIA 4RGYA 1V47A 4TMWA 2IWHA 3VOTA 3ZZMA 4AO7A 4XRGA 2PL9A 4YT8A 2OXIA 1M8PA 4J9UE 1G7CA 1B41A 2IEGA 2WJVA 3FTPA 5E9WA 1GFSA 2W6MA 4ESVA 1DRJA 4ROSA 1GQOA 1JQDA 2PMCA 1CWUA 1JT2A 3T34A 3CC8A 1UXIA 4E4RA 3A32A 4UNPA 4FE3A 4XD7D 3E5RA 3ELYA 2CLLB 3PUVA 5LB2A 4IKEA 4BWFB 2WOJA 1B1AA 1ZM7A 1ZZEA 3EVCA 1O9HA 3HSKA 4H08A 4P4LA 1F2DA 1TLLA 4U4AA 1SBTA 3VGPA 4BKQA 4ZJYA 2CWDA 2JFQA