1Z4IA

Structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with deoxyribouridine 5'-monophosphate
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase
publication title Structural basis for substrate specificity of the human mitochondrial deoxyribonucleotidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 64
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1z4iA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4iA01
4UASA 2OBBA 4Y2SA 2YMQA 5ALKA 1O08A 3N5KA 5ALOA 1RPZA 3IJ5A 5AW8A 3KC2A 2OM6A 3CZ4A 3QUBA 5AM0A 4UM7A 3L0CA 1Z4PX 3E8MA 1WPGA 1VFPA 4XOUA 4YCLA 1RDFA 3PGVA 3MC1A 3WK6A 3W5CA 2FPSA 1L7NA 3ZW7A 2HO4A 4XPZA 4OHFA 1LVHA 1ZRMA 4BEVA 2C88A 5AW6A 1Z4KA 5AM5A 4EX6A 4MUMA 2ZBEA 1S2OA 1N8NA 4FYPA 4HYTA 2I6XA 5AM2A 1U7OA 2Q4RA 3WGUA 1S8OA 5AKXA 2GFHA 4Y2PA 1CQZA 2WHEA 2PR7A 2IOHA 3ONNA 2G80A 4IFTA 3E58A 2RARA 3U19A 3ESQA 3I1YA 4BKMA 2OA0A 5AW0A 3SLRA 3DAOA 2ZG6A 4E88A 4UAUA 4EX7A 1SWVA 1VJRA 2YN4A 1YS9A 2HX1A 4YIHA 2R8ZA 4CF3A 1Q92A 1T9ZA 3I28A 5IS2A 1XVIA 3U7GA 3AR2A 4KYTA 5AKJA 3W5AA 1NF2A 4C4TA 2AGVA 5ALYA 5AI6A 2YFYA 3QLEA 3M9LA 3QU2A 4JDPA 2DQSA 3AR8A 2FDRA 3NALA 4QJBA 3SF0A 4F72A 4UARA 3N28A 5JJBA 1ZS9A 1RMQA 4UW9A 3E84A 4BX0A 2HOQA 4DWOA 2P69A 3QUCA 3FGOA 5AVVA 3OCVA 3VAYA 2EARA 3DDHA 1RC8A 2B82A 5AI0A 2Q5EA 4BNDA 3L1UA 3ET4A 3L8FA 3WKDA 2W11A 1WVIA 3AR9A 5AESA 1ZJJA 3IB6A 1CR6A 4YCNA 3OCYA 3B8EA 2IA5A 4FFDA 2WF5A 4CE6A 1T5SA 4NAVA 4Y2UA 1YV9A 1N9KA 2W43A 3OTQA 3NAMA 2PQ0A 2NYVA 1KYTA 3NRJA 3WK9A 3KOOA 3WKAA 5AKEA 4Y3UA 5ALWA 3RFUA 4RETA 4EENA 2FPXA 3NANA 3QU5A 5ALMA 5ALZA 5A3SA 3SKXA 4Y2TA 3A1CA 1RMTA 5AVRA 2G1AA 4BX2A 4HGRA 3D6JA 2I55A 3M1YA 3CNHA 3N1UA 3U7HB 4ZEWA 2G09A 2Q4TA 1U02A 2BDEA 5AW1A 1J97A 2AUTA 3AR4A 4NABA 5AHXA 4G63A 2WF7A 2HEGA 4HGQA 4Y2YA 2FPUA 3E81A 1RQNA 2IOFK 2MU1A 2YJ4A 3MPOA 2FPRA 1ZOLA 3J7TA 3KD3A 3P96A 2HF2A 2RB5A 2C9MA 3EF0A 2I7DA 4IG4A 2YMMA 4HGNA 5AM1A 2RAVA 4KN8A 3U7FB 1TJ5A 3EF1A 1YMQA 4Y2JA 2NO4A 5AVTA 2JARA 1Z4MA 5ALNA 1AQ6A 3ZVNA 2YY6A 1Z5UA 5AI5A 3R09A 3SMVA 3I76A 2FPWA 2OYCA 5ALJA 3QX7A 4BX3A 4EZEA 4UMDA 4KX3A 3K1ZA 5AI9A 3ZWKA 3ZX5A 3R4CA 4NFLA 3DNPA 2FI1A 3NASA 5ALLA 1SWWA 4OFZA 1K1EA 2EAUA 5IT4A 3QUQA 2YMPA 3QUTA 3AR7A 1J8DA 1PW5A 1WZCA 5AM3A 2HI0A 1L7PA 3OCWA 3QU7A 1EK2A 2G0AA 1Z4NA 4KX5A 4NV0A 3EPRA 5AKLA 2ZBDA 5ALUA 1YJ5A 2JAUA 3UMCA 1Y8AA 3U7EB 2JGAA 4CNQA 3OCXA 2G08A 3GYGA 3ZUPA 2D2VA 3AR5A 3QXGA 1IWOA 1X42A 3B9BA 5AVZA 2ZBGA 3NIWA 5AK5A 1ZD5A 1Z88A 5AIBA 4C4RA 1NNLA 5AI4A 4Y2XA 5ALIA 2HCFA 2B1RA 5ALRA 4J03A 2YJ6A 4ZEXA 3MMZA 4UATA 5ALFA 1Z4QA 3ZU6A 5ALSA 3ZWDA 5AW2A 4DCCA 1RKQA 5AKKA 3ZTWA 3QNMA 3WK8A 3L8EA 4XQ0A 1RRCA 4HAIA 1Z5GA 4UMEA 1ZRNA 3WGVA 3OCUA 1EK1A 3PGLA 3FM9A 3ZX4A 3FVVA 5AK3A 3EWIA 4UU0A 4I9FA 2IYEA 2I34A 2R8XA 4BYGA 1Z4LA 4L6AA 3W5BA 4OD0A 5ALEA 4AS2A 2B1QA 3ESRA 3ET5A 3ZVLA 2BY4A 3WKEA 4F71A 4QQFA 2CFRA 4DW8A 1RLOA 3R9KA 3A1EA 4AP9A 5AKHA 1MH9A 3BA6A 3ED5A 2FUCA 1XPJA 4CF5A 2RBKA 2C4NA 2I54A 3L8HA 5AW4A 2CFTA 3FPBA 3PDWA 2WFAA 4H1WA 2B30A 4BEWA 4Y2VA 5AIAA 5FP0A 1QYIA 2I33A 2VKQA 4AS3A 3QGMA 4JB3A 1RQLA 4Y2RA 2ZBFA 1O03A 3NUQA 4L57A 2HSZA 4NWIA 3ZTYA 2P27A 4I9GA 1U2SA 1TJ4A 2C8KA 4KNWA 1FEZA 3WKBA 2R8EA 4EEKA 5AVWA 2IOFA 3UMBA 4C4SA 4B6JA 4MWOA 5ALPA 2JAWA 4GIBA 5AKZA 5AW9A 3UM9A 1RKUA 3PCTA 3SD7A 1ZD2P 1JUDA 5AW3A 5AW7A 1Z4IA 5AKIA 5AM4A 2AMYA 2QLTA 4KNVA 3F9RA 4BNDB 5AVQA 4J2TA 3N07A 3UMGA 4UMVA 3QYPA 2X4DA 5ALQA 4HGPA 1F5SA 4EELA 3KDPA 3IRUA 1XP5A 3W5DA 3TLMA 1L7MA 2GMWA 2C8LA 2P9JA 3HLTA 3SHQA 1QQ5A 2ZOSA 5E0OA 5AKGA 5AK6A 5ALDA 4YCMA 1VJ5A 2YBDA 2GHQA 5T41A 2WF6A 1Z4OA 2O2XA 3RF6A 4UM5A 5ALTA 3WKCA 5AICA 2AH5A 2CFSA 1U2TA 5AW5A 3WK5A 2O9JA 2HHLA 5AVUA 2ODAA 3L7YA 5ALHA 3WK7A 2GO7A 5ALXA 5AVYA 1L7OA 4L6CA 2YJ5A 4CF4A 2WM8A 1TA0A 1RKVA 5AKYA 4ZEVA 4HGOA 4PNHA 3SKYA 1YNSA 4YIKA 1U7PA 3L0BA 3A3YA 2BDUA 1SU4A 4BBJA 4YGYA 4UU1A 3MN1A 3DV9A 3L0YA 2B8JA 3KZXA 5AVSA 4O8CA 2FEAA 2FUEA 2G06A 1WR8A 5A3QA 2GHTA 3L1VA 4OCZA 2WF9A 3HYCA 4RESA 3QU9A 1RMYA 3U13A 3QU4A 1Z4JA 3FPSA 2YJ3A 3N8GA 2HDOA 2QYHA 2PKEA 4GXTA 4Y2QA 3OCZA 2W4MA 1ZD3A 1RLMA 3OPXA 1NRWA 1L8OA 5ALVA 3L8GA 3AR3A 2P11A 2B0CA 1RLTA 4UAVA 3A1DA 4DFDA 1QQ6A 5ALGA 1L8LA 1QH9A 3ZVMA 2CN1A 4YH1A 3WK4A 1ZD4A 1YDFA 3FZQA 3L5KA 3ZI4A 5AK4A 5A3RA 2ZXEA 2YMLA 5IT0A 5AI8A 2HF7A 2WF8A 2NO5A 1QQ7A 1TJ3A 3B9RA 3KBBA 4UMFA 1T5TA 2R8YA 3I6BA 2JAOA 2MSNA 1TE2A 4FE3A 1LTQA 4XE5A 3S6JA 3U26A 4G9BA 5AVXA 3AR6A 1Q91A 2EATA 1L6RA 2B8EA 3BWVA 2G07A
chains in the Genus database with same CATH superfamily
4C29A 3I45A 2BVNA 5K99A 1WBDA 4H4DA 1AS3A 5JNVA 3MTAA 4IXDA 1SCQA 1XMJA 2Z83A 1P2FA 3BTUA 3DMFA 3HCFA 3ZXIA 4EMBA 1AGRA 2GCPA 2QMQA 4H0FA 4UUPA 3D3KA 2EZ8A 3H42B 1U4SA 3UMMA 4BC1A 1ML3A 2HA2A 2QRMA 2IYVA 1Q1EA 2M6SA 1CX9B 3LUPA 2V7UA 4CQMD 2PANA 4XKJA 2ZCVA 4E5VA 3QW4B 3TW4A 1OUMA 3TE6A 4D96A 1INLA 2AE2A 2RH4A 2WLSA 4LHXA 5C52B 2PZKA 4I4NA 1FTYA 1G64A 3F98A 2IGBA 1E1KA 2IH2A 2PXXA 4WACA 4TRJA 1XX6A 5J2UB 2XY4A 5JH7B 4IS3A 2Z57A 1BHO1 4LHVA 1VLJA 1AGNA 3Q87B 1YBFA 3OMXA 4NYJR 1X80B 1YL6A 4P54A 4QXMA 4KPUA 3T3HA 4YP1A 3REOA 3AINA 4ZPJA 1T0IA 5DNVA 5FTMA 3J7AC 4M0DA 4KXLA 2P9GA 3MTBA 4I4IA 3U31A 1X15A 1ZSYA 2H1SA 1GA4A 1XDWA 2PA3A 3A1WA 4GWLA 5A6VA 2G80A 3WBJA 4PLVA 2PRYA 3AX6A 2EC5A 4IO0A 2YH2A 4TT8A 2P62A 1VLHA 4XWTA 3WJ7A 4CPDA 4S1VA 1KOFA 2CV0A 4UAUA 4E88A 1MVLA 2XW6A 3U6BA 4DEXA 3N7AA 4E51A 3T3MB 4CF3A 2BFBA 2JIMA 1NSFA 4I6JA 5G0TA 3DEFA 4LWOA 4W1SA 4CM3A 1L5OA 4YECA 4QKQA 1OR8A 3HDTA 3C7KA 3HRIA 5IFLA 3Q3IA 3GMDA 4FFBB 2OE2A 2A9VA 3GMTA 4OI4A 2XRFA 3GOQA 2GPYA 1BKSB 4LZOA 3HS3A 3AOEC 5M34A 1ULHA 3QU2A 2XNCA 2PZJA 2QSUA 2BZ1A 3JQ9A 5D5QA 2VNJA 4V03A 2WY2D 3OZTA 4HGYA 2KLBA 2Q07A 1JNXX 3L07A 3DMTC 4L85A 4WVFA 4DWOA 2A0FA 5COAA 2O5VA 3EFHA 1NN3A 5MN4A 1DRKA 1C4XA 2CXOA 2D1YA 2I1QA 2CSUA 4MKFA 4RHYA 5IAJA 2I3DA 1S02A 4PAOA 6AT1A 5JZBA 1CS4C 4TTRA 2KI5A 3IJEB 3R0QA 5KSYA 1MX5A 2BFEB 2GTHA 4MZDA 2H0AA 3UB4A 2XWPA 3R75A 4B3TB 1LJLA 3O8QB 5JCXA 4B3RB 5JYBA 5GZ6A 1Y7PA 2ODEA 3CT6A 4JQYA 4ZCPA 4A5OA 1B26A 4NU0A 1N5KA 3EVNA 3FFWA 3FDZB 2PUWA 4LJKA 5T4EA 4LNAA 1CDDA 5E6SA 4V39A 1A9QA 2IDJA 4QOGA 5HIJA 3HL4A 3KEQA 1Q22A 3LUGA 4FCWA 1HR0B 4LE2A 3ZWBA 1KEZA 1LLCA 1GPLA 1S2IA 1SQFA 3PFCA 4MHOA 4Z3KA 4NH4A 4Z4HA 1ZESA 2X0RA 1PN3A 1Q77A 4OXIA 4P5PA 4QUKA 4AY2A 1W46A 4I9UA 3T95A 1UZMA 3EC2A 4F06A 1PKXA 3SZLA 2PA0A 4X71A 5KCZA 4TS1A 3Q3GE 2G9NA 2PTSA 3BB4A 3WKAA 4RFSA 2VHQA 2YL2A 3JQEA 2AJBA 3ME5A 2JJ2D 1DJQA 1F06A 1I7NA 1UF9A 4L9WA 5KYVA 2AI3A 1S3FA 3UXEA 2W2VA 4F0JA 3QU5A 2B7LA 1AKNA 3ND8A 2VPWA 1T8SA 3GIWA 5ALZA 5JFOA 1IZ8A 5HCIA 3VHRA 1OH5A 4RF3A 2AG8A 4FGLA 1GAEO 1KYYA 1N7IA 4JC5A 4XGQA 4EHFA 2Z8YM 1K8YB 3RGGA 1QAMA 5DSZA 3TW8B 2C8JA 3I9OA 4U7HA 4GDFA 3WGZA 4PHHA 5ECYA 3ZY3A 3CUTA 1JHZA 1OU4A 4OK3A 3SE7A 4DYDA 4OB8A 3HXKA 5DISB 5A4FS 4P4SB 3KYDB 2D1QA 5AHXA 3WE7A 3VZCA 2AQKA 1XQYA 1E3WB 2BLNA 3TTYA 2E4YA 1LX6A 3C7CB 3HVKA 3HB1A 4ZVUA 1RQNA 2HYIC 4JX8A 5DTQA 2V6BA 3SYLA 4DHEA 2YJ4A 4U00A 3T3NA 2X9NA 3UUFA 1B41A 4MR9A 2ZBQA 3M4NA 2QZJA 2C5FA 2UYQA 1W9MA 1BHJA 3U62A 1N2CA 5J43A 1S9HA 1L3BA 4BP8A 2VRNA 2WM3A 4KPGA 4IWNA 1QSGA 5K3FB 4AKIA 4P5DA 5CX4A 2FRXA 5FUYA 3S7TA 4HH1A 5K0FA 5M04A 3TZ6A 1HZZA 1K89A 1XDUA 4IZOA 2XOKA 4IS2A 4NZPA 3DFKA 5FBHA 4BECA 4CM9A 1IVSA 3FJ1A 4MVJP 3RYHB 3TOSA 1QFXA 5ELLA 4XWKA 1BH2A 1X9HA 1XYYA 5JMOA 3ZCQA 4DQKA 2ZRCA 2FN3A 1QIKA 2BPOA 5ALJA 5FRDA 3LNTA 3CINA 3FAZA 4MUHA 1SBTA 3CEJA 3ERCA 3C15C 3P0IA 1CE8B 3KB8A 5CRIA 2ZUDA 1LD3A 4FNOA 4M99A 5LOVF 1UK6A 3THWA 2BI8A 3C14C 1YMVA 1EDEA 1MMFB 1IW7D 1PJZA 5EP2A 13PKA 1N2BA 4I5DA 3IKMB 4E5PA 3G5LA 4PZUA 4CCYA 2GTPA 3LHKA 3EVDA 4C88A 4BLVA 1II8A 3IVGA 1PW5A 1K88A 4RVDA 1RS0A 2QLFA 2ES4A 5JE8A 3ORQA 3UAYA 1PG5A 1E6EA 1ZRSA 3KCQA 1B73A 1UFQA 2BFNA 4NV0A 3EPRA 3S1LA 2KB0A 2BFPA 2ZBDA 3LP5A 5HIIA 2L69A 3QA9A 4E5DA 3A06A 5HYVA 2D7DA 4MV3A 4WZZA 1V6SA 5A9SB 2C03A 1JF8A 1PT6A 2FP4B 4YAGA 3THXA 4E5KA 2XE8A 1AO3A 3AR5A 1KFCB 3EZXA 3LQFA 3PYMA 4G25A 3SNKA 4D92A 2ABWA 3O3CA 3WQQA 5FLKA 1R7RA 1CV2A 4E2YA 2BGLA 3VYTB 5TS2A 1J2RA 2GZDA 2V7WA 3HBFA 3AKCA 3PR3A 1XCOA 2O5CA 3U9TA 5A7FA 4JJIA 1Q0PA 4QO8A 4OGFA 3VZQA 4MGYR 1NU8A 2V7VA 1C3UA 2X76A 2H06A 4TMXA 3GMIA 1K6EA 2WU1A 1T8UA 1GADO 1UXHA 1W36B 2XYVA 1H05A 2GI4A 1HY0A 1GFWA 1KAGA 5M29A 2O07A 4UPDA 3NAZA 4R3NA 5EPOA 1AUOA 1NUUA 3TTWA 2YWCA 3WICA 1B42A 3V8BA 1J24A 4F5WA 1PJAA 3BZBA 3CQ9A 5KJ6A 1RWPA 1BX1A 4QWMA 4BCCA 5JADA 2FN4A 2A9JA 2C5LA 2JFVA 5JHHB 1X1EA 3WK8A 4M37A 4G4JA 1MJHA 1ZNZA 5KQRA 3A1NA 1GKYA 1X77A 4IYJA 4XQ0A 1SXQA 1K8QA 1E77A 3S27A 4A6EA 1EGMB 2WZBA 1WZ2A 1P9RA 2X8LA 2IP4A 2W2TA 1J8FA 3OJFA 2ZRIA 4RJLA 3K0BA 1Y3FE 2JCGA 4WLFA 4ZT6A 2ORIA 2VXOA 2QWXA 2OLEA 3FKJA 4JEHA 3OF3A 3K1JA 4DRZA 1GUDA 1HLGA 1D2CA 1CQJA 4DCOA 1PJRA 2H0QA 4YJDA 3DVQX 3FUUA 3KD2A 5DXAA 2FX2A 1LXCA 3SSOA 2DOKA 4BWFB 2I2DA 2JGIA 1NYLA 1PS9A 2Q5IA 4O6VA 3TR5A 4CKBA 4QQFA 5J4KA 4CETA 1XZGA 4WEOA 5KB3A 2HLHA 2E3JA 1R4NA 2COKA 3FNEA 3TXXA 4AP5A 5JUWA 1IWBB 1X1QA 4JIGA 3PGMA 1CY4A 2I4TA 3PQDA 3WSVA 4AJNA 4D3ZA 4OQPA 2D1TA 3QKIA 3TIFA 1FDWA 1HRKA 2R66A 5CFMA 2WJ3A 4KIGA 4RZSA 1ZQ1A 1V8OA 1XZNA 1NHGA 1EB8A 3DMYA 2VZLA 4ZMBA 3EXG2 1Z6XA 3DFIA 1THTA 4X85A 3HBAA 4B44A 2PY6A 4EIWA 2K7FA 3QJ5A 1KSGA 1AA6A 3KOUA 1V11B 3NTRA 3ITKA 2Q9BA 2PG3A 5FI3A 3WHLA 4I9GA 2DT8A 1YUNA 2CCJA 1NXTA 2J45A 2R1VA 2VN8A 3LCMA 3G2LA 4IILA 4M46A 4MS4B 1A76A 3B6KA 1LDMA 5B64A 2O2EA 1NQUA 4MW1A 2F43B 2JIRA 2QG6A 2XOKD 5BMVB 1GXSB 3FOAA 4CM9D 1XHFA 3V7NA 1X1RA 2FFQA 3PTLA 4MDYA 2H51A 2VJLA 3DDCA 3O1IC 4MICA 8AT1A 5CCBA 1MRSA 1YVDA 1TUIA 2PYIA 3VA7A 1OB5A 4YRLA 2WYWA 1Z4IA 2OHIA 2ZB4A 4KTVE 4G5SA 4X0EA 2IPNA 3SK0A 2FP3A 16PKA 4EA6A 5C8ZA 1M2EA 3J81A 3AWDA 3F9CA 3MVEA 3Q3HA 4E5SA 1XO1A 3Q5DA 4BMDA 4DXHA 4JLKA 1PUJA 3PQ8A 1A9RA 2F48A 2P5TB 3CNOA 4UNSA 1Y3AA 4PE5B 2XB2A 2EJWA 2GCOB 3IRUA 1P44A 3ITNA 1E60A 1GAQA 2JD0A 2VBGA 3DBIA 3AEUB 3CC8A 3GAZA 3PPWA 3OO0A 4O4JB 4JASB 4O4IB 3FTQA 4R9RA 3A9VA 4QOFA 1UP6A 2M2IA 3PNVA 4QFBA 2O2IA 3PFFA 3ZD8A 2SHKA 4EKEA 3ZCUA 1OX5A 4G5RA 3T54A 3DTVB 4Y9DA 3F2VA 3X0DA 5IC4A 3G0HA 2X8JA 3UMYA 2EQBA 4FGJA 1Z37A 3KJIA 1SXJA 5DCLA 5DKFA 3RYFB 3WK5A 3WTCA 2QI9C 2H4XA 3ELUA 3GN1A 3QUSA 2HHLA 4ZHQF 1Q12A 3L7YA 3DUFB 1XLTA 1VE5A 2HXSA 1EYZA 1TCAA 1CJCA 4G4IA 3R6TA 1YULA 5AVYA 1VCOA 2ZB2A 3RTBA 4X9XA 4NBKA 3FF4A 3L7LA 4GD3Q 2C8VA 1VBNA 1KQOA 5GAJA 1WDKA 3TUIC 1F8FA 1AN0A 1RAHA 1WUKS 2BTQA 3DE1X 2IY8A 4GXRA 4DNFA 1R15A 4R05A 4OAPA 3N8HA 2XPCA 4K7JA 4EB8A 2DR2A 4URZR 2PT9A 2O8BA 1HE8B 1M2VA 3KVNA 1X8KA 3ETNA 3VR6A 4IDBA 2I2AA 4C87A 1RLJA 2XTZA 2NX2A 1WMSA 1ULBA 3K5PA 2JZCA 3G9ZA 4XXHA 1EXWA 3ACCA 1T2EA 2AQIA 4E13A 1AGXA 4WZ6A 1E3LA 4B3MB 2BUBA 2H6EA 2VNIA 4J0HA 2OT3B 4R7ZA 1KEEB 1N0UA 1VCIA 1QDUA 1XK6A 2J87A 4WY5A 2R96A 1LTHR 4G37A 3S1SA 1ODCA 5BR4A 2FPPA 2ZIAA 3HB5X 5CA0F 1KI4A 1CS0B 4HWGA 5T3UA 1RYMA 1R3DA 3GV0A 1DXOA 4P3YA 2VDRB 3DAHA 3H5AA 2DKOA 3LNCA 1MORA 2HL6A 4FEEA 4W5HA 4EPTA 4XDHA 4Z9BA 1H5UA 1WAMA 2GEDA 5KTPA 4G89A 1LQTA 1SD5A 1A71A 1AUXA 2AWOA 1CK4A 4K6GA 2W4MA 4ZYZA 5CDFA 3ZV5A 5HDQA 3T1VA 1F60A 4IJMA 3FPGA 3O1HB 4TWJA 3INGA 3ZJYA 4A8PA 3P0FA 4LQLA 2XGMA 1UKVY 3UJ3X 3R74A 4QTYA 1I94B 1L8QA 4ON9A 3ZVMA 1TQDA 3VZPA 2W0SA 2ZRNA 3EQ8A 5HIMA 1FIUA 1FJHA 2C77A 2WJ4A 1HOTA 3CTPA 4KH0A 5JXIA 4KMOA 1ATIA 3KJGA 3KSZO 3MELA 3RE1A 1IZ0A 1TVMA 3C0KA 5EC8A 1JSCA 3AUFA 3FGZA 2LDBA 4AJOA 2C31A 1KSJA 1K8ZB 2QGZA 3MMPA 1TLFA 3F7OA 3A26A 1C1HA 1SKUA 2ARKA 3I2JA 2QD5A 2WF8A 4LY3A 4EUEA 2G67A 2PX4A 1RHKA 5GGYA 3TOZA 2RD2A 3ADBA 3PNOA 4DA4A 4PX9A 3IAS6 4UE3S 4JGBA 2IT1A 2NU8A 3N6VA 4PC7A 4UVGA 5DI3B 4U3JB 3X1DA 5JNUA 1BX0A 2NUAA 3ZTTA 2J0QA 2DMRA 2XMSA 3LDFA 7AT1A 4V0SA 2EW1A 5JASA 2CZGA 4YPFA 1YJQA 2FUG6 1FLDA 1IHYA 5I7AA 1O87A 3EIUA 2QTMA 4YRCA 2DULA 2RE8A 4HT3B 2YMQA 2BFWA 3N5KA 2VT7A 3ZWAA 4BKPA 1BDHA 1IXRC 2A78A 1ONPA 3DWIA 3KQWA 3KSRA 5CR9A 5TV2A 5LP6B 3T7AA 5DCYA 1NF8A 1LSOA 5JXGA 4Q47A 2GRUA 1O97D 4P82A 5LLSA 2IWRA 3NHKA 4LJ8A 1PSZA 2Y4NA 4N3BA 2AV6A 3PNYA 4RHXA 3T5DA 4Q3AA 5JJKA 5C51B 5BSMA 2WABA 3TOVA 3DZGA 1P8AA 3ZE1B 4NU5A 2AN9A 2FEMA 3CH6A 4MW7A 5CPFA 1QHNA 2P67A 1NZFA 1OD6A 2JIPA 1MFPA 2QQFA 3H8WA 3OSUA 4MVJH 3D6FA 4UM9D 4QUJA 5D00A 4B7CA 5FLYA 5BN4B 4E2WA 3OQOA 2UXBB 1TTQB 3HR8A 3RV3A 3WYCA 5E6UB 1G20A 1VPTA 5AM5A 4KNYA 1SXJD 2R6GA 3VU3A 4EH1A 2CXQA 1P1CA 4U2CA 3A0UA 1OBFO 6YASA 1EM8B 4RXTA 3FYHA 4HTAA 4PYLA 4GPAA 2GAJA 4HQNA 3D2AA 3V9AA 5BVHA 4R0NA 2FQXA 1DEKA 2YXPX 2FR0A 3CZAA 3ROGA 1OPXA 2WHEA 1V3UA 1NAIA 1YVEI 4ZALA 1Q0ZA 2I7VA 4M86A 4O4LA 4BKRA 4ZO4A 4YRJA 3S7ZA 3W1WA 3ESQA 2FW8A 2ZIFA 3DEIA 5K0NA 3GT7A 4L8YA 3DAOA 3QFFA 4M8KA 1F14A 1I10A 3RCBA 4F86A 5LP1A 3ER8A 1R4MA 3CURA 3HN6A 2ZWPA 4L0MA 2ILTA 3GGDA 3R76A 1T9ZA 4CMHA 5MGNA 2QGFA 2PRJA 3VR6D 1MEEA 3ZWPA 2V03A 2WPDA 5J4VA 1ZX1A 2JHCA 4FYKA 1UAAA 4E14A 4S1NA 3NDIA 1WPXA 1MG0A 2ZULA 2O2JA 5TRTA 4FOPA 4BX8A 4FMCB 5LXTF 2CUZA 2GZRA 4DUZB 4C4TA 2AGVA 4ZRDA 1DJPA 1E9CA 4KQJA 1T36A 2NO6A 5LBTA 3SLKA 4TKUB 2XEDA 3PDIA 3COSA 3SF0A 3SPXA 5I3ZA 3BE4A 3W8EA 4I0WB 2OZPA 3WRWA 1OFGA 5JO0A 1GPNA 1I9GA 1CJVC 4MRMA 2JZNA 5DLDA 1G0NA 1P5RA 2PTHA 2Q9AA 4U6SA 3ASVA 5SZJA 3JQ6A 4AKSA 1EJBA 3BBPA 1GQQA 4MS3B 3RFVA 5JSUA 4PO8A 3ZU5A 2J3MA 2VDOB 2RK4A 1VIVA 3HZRA 1HDYA 3BXHA 2EARA 4MWCA 1U0LA 1NR7A 1DXHA 2IUFA 1L5HB 3Q9LA 4FVTA 3TZQA 5BSVA 4CQLA 3RR2A 3O03A 3PNKA 4REOA 2AJLI 3ROQA 2ORYA 2WVJA 3GLHA 2HLPA 5A3JA 3FI9A 1O1YA 4HNHA 5ICGA 4TT3A 4OUKX 1COWA 5EEGA 2Q1UA 4TTIA 4YCNA 3O4GA 2WU0A 3QFHA 2XMPA 3EIWA 5H9WA 4IL5A 2E2WA 1LS1A 2BKUA 2GASA 2J9ZB 2PYZA 2QVLA 3L4BC 1A95A 5FTWA 3RSSA 4YR7A 2QVGA 2NV6A 1HNWB 1HA3A 2VDWB 2H7CA 3FI0A 3NM5A 4MP8A 4DADA 1YCFA 3I2GA 3K32A 1YI8A 3MBIA 4XWYA 5CYPA 1PP4A 1Z26A 3RSLA 3UXYA 3TSYA 1ONSA 2DFNA 3UV7A 3RRXA 2X13A 5SYNA 1C14A 3BMOB 1KYTA 5HGXA 1A5TA 5A4DA 4LQCA 3VH4A 5HOEA 4X00A 2AR9A 2V98A 4M60A 5ALWA 1J0BA 2OKGA 1N2HA 2VJDA 4H7EA 2ZT5A 4U6QA 2YV1A 3TLZA 3CMCO 3K0SA 5CJ2A 1E2EA 2IRWA 3ZZNA 4Y2TA 2GXQA 5K0SA 3JWJA 3WGMA 2GTIA 3TWOA 2YINC 3HHEA 5AVRA 2YWRA 1XN4A 1XMVA 1PUIA 3BDIA 4LRWA 4G23A 4WQMA 3RABA 4EHNA 1V41E 1TCVA 5HM8A 1ISJA 3N1UA 2AW5A 3MTJA 4OKNA 3FOZA 2D27A 1KO8A 2H3HA 4GR9A 1CLUA 1GGNA 2ZRGA 3OQ6A 1SBQA 4A6XA 4CGZA 3LX8A 4GGMX 2OQIA 5F1OA 3HBMA 2UVDA 3AR4A 2XYGA 1CZLA 3VU1A 1DG3A 3GLVA 4KNWA 4HNQA 4QSHA 1J9ZA 1I1OA 3PQEA 5HEKA 3S68A 3WBKA 1TO1E 3WYBA 1MAWA 3SIPA 1NNSA 5JAQA 3IBTA 1EE9A 4RW0A 1TYAE 2QTGA 2C1EA 4WH0A 2ZRFA 4EVSA 3DF7A 4LF7B 2PLFA 2R7KA 1EUCB 3QYJA 4IIDA 4AWAA 3AUJB 5K45A 1ZM4A 3D81A 3NRCA 4CCAA 4LFCB 5B55A 1AU9A 2W90A 4UHJA 3A1VA 3RSGA 1LPNA 4AO7A 2RI1A 3N59A 4JVOA 5AM1A 2IJGX 1XL1A 1X8LA 4D8YA 4A6PA 4WK4B 2H85A 2G36A 2WKWA 3OWXA 5CGQB 3EVAA 1JI3A 4KGDA 2PK3A 3RKUA 2VAPA 4DVGA 3W77A 1DOAA 1SNYA 1Z5UA 1CQIB 4B34A 3DB1A 3GFQA 3AEQA 1M7HA 1XDDA 1BQ3A 4NZ9A 4UAJA 5ESRA 3TXAA 3RYTC 4WBNF 2HA7A 4EYEA 1P0CA 3RC8A 2PLNA 4GX1A 1A8UA 1HDIA 4MP6A 3VYRB 2B1JA 5F2KA 2VBFA 1C1XB 3CRQA 1NDHA 3D0OA 4JU9A 1FXWA 4BHTA 4X84A 1AS2A 3O1JC 1XZPA 3AHHA 1TRKA 1YFZA 3DNPA 3PIIA 1R6VA 4IUDS 3TKAA 4ZJUA 2C5HA 3IEIA 1Y4SA 1KC1A 3IAS1 4KSCA 4ZCSA 2O7NA 2XT9A 1EBBA 1JFTA 2EVWX 2A14A 4ZZ0A 3CVJA 4UCQA 3RRNA 1Y89A 1MTOA 4F4CA 1J8DA 2WPDD 4US2R 4JL8A 1SR8A 1UT8A 2EQAA 2R2AA 5C8VA 1F3LA 1BHSA 4PLWA 4RIFA 3AM1A 4NTZA 5KREA 4AIIA 3HO1A 1D4OA 2FUG1 1QYXA 2HNAA 1WE2A 1P75A 3GA0A 1TRHA 3MMSA 4OSPA 4UHEA 3WBFA 5KTMA 3K0EA 3HDHA 2M6RA 2O2ZA 4K0KB 4CEJB 3QPBA 2CE2X 4QXQA 3AERA 3SYMA 4IDHA 4M49A 5LDDC 1YH3A 3QMMA 5HE9A 5BRNA 4JI2B 3KPJA 3MK31 1XZBA 2BAGA 5LD2C 3OLQA 1GKUB 4KI0A 3B1FA 3G0GA 3PDJA 2PQMA 1YE5A 4OMFG 4LRXA 4V0NA 5G3YA 3K70B 3MJRA 2HHCA 1DADA 1KKUA 5CFPA 3PGKA 4HDAA 4Q6WA 1ORDA 3K15A 4OB7A 4RA9A 5TPWB 3JAMA 1S1CA 1L8AA 3EQ6A 4FNGA 1GNPA 2IEYA 1ZMOA 3D8RA 5JJIA 3OLCX 2C98A 4PGMA 1G9XA 5LLTA 4NPCA 2NYUA 4Q3LA 2PBLA 2MYPA 2WMNB 2WJAA 3NWOA 4TT3D 4UATA 4UVIA 4MEJA 1COWD 2K4MA 4OLHA 5EMHA 5AW2A 3EG5A 3GEGA 5MDHA 1X14A 1RKQA 2GQ0A 4QA9A 3SR3A 1YR3A 3FDIA 4KR2A 2A0XA 2QMEA 4EO4A 3UMVA 1ADGA 5BXYA 4YMSA 8ABPA 1LGYA 3RTAA 1GCGA 1RPTA 3IIKA 5LBIA 3V2HA 5GONF 3HLKA 3PZRA 1F51E 1QG2A 3RK1A 2H3EA 4JB8A 1KO5A 2G7ZA 1DDGA 2J5BA 1NVUQ 1HTWA 1SH7A 2OY0A 3H18A 4WFQA 3SN6A 3HUFA 1NM5C 4LJ5A 1FSPA 2H4JA 2C5AA 4YT2A 1MDBA 1GRCA 3BT7A 4LTDA 5COBA 1U0EA 4C3OB 1ECFA 1Q3TA 2H1OA 2QAGA 2R8XA 3OIUA 4E5MA 5BN3B 4L6AA 1JJAA 2Q6OA 4HF7A 5JS1A 1X1DA 2XMCA 3UHPA 2WJJA 4M3NA 3UFBA 2X6RA 3Q7PA 4TQUS 1U16A 3OHMA 1CJTC 3PDCA 3EXAA 1FDSA 2DWQA 2BY4A 2GZHA 4MQLA 2B3DA 4QQRA 4U9HS 3WDKA 3ZVLA 1IY8A 1NXSA 4II3A 3ZW8A 3WSTA 4EAQA 3LX6A 1Q6ZA 2NXEA 1KRWA 2CWDA 2CMHA 1ZITA 4KXWA 3VX4A 3PPVA 3D8SA 2FUCA 1GLGA 4UBMA 2ONZA 1T5DX 1UODA 3RUCA 2O1SA 3W2EA 1DOFA 1RBYA 2GYWA 4DA7A 1IZZA 2XV1A 1XQ6A 1XELA 1Z2CA 3FZNA 1DQZA 1MR3F 5EE5B 4DMHA 5FI1B 3PDWA 1ENZA 2B30A 1DB3A 3L7NA 1MX9A 5HPYB 4B8WA 1QYIA 2FPGB 3CO0S 2XHZA 3E2MA 4B2PA 4XTCS 1CB7A 4KXUA 1ORWA 4LHSA 1ODTC 3WWYA 3QGMA 3WLLA 4BJHB 2ZUBA 1RQLA 2Q4OA 4PEVA 2CB9A 3WL3A 2VJKA 1XTZA 2V9ZA 5EJ6A 1VZ3A 2H1WA 3BJEA 1RIFA 4HSGA 2V7BA 5DHPA 2FW1A 4YRBA 5AVWA 4OA5A 4LBZA 2J08A 2OBYA 3B3JA 2DVMA 2PH1A 3DP9A 4I4LA 2G5GX 1RXUA 4DBVO 5SYMA 5SY9A 4X3OA 3F8WA 4KFUA 4QOEA 1SAYA 3WB9A 3ZXXA 1VHJA 1YR9A 3HWSA 1TAGA 5CUQA 1N9GB 4ETMA 3AI7A 4KBFA 3MSCA 1L8XA 1Y34E 5AK0A 3R4VA 5IW8A 1UBRS 2VP6A 3HCCA 4LJ7A 1SULA 1YB5A 5BQFA 3M6FA 1GAWA 2DFTA 1NN5A 4Y6SA 1J7JA 4UMVA 3RUPA 3QYPA 1AB5A 2GO1A 3G2PA 3GR6A 3ZR4B 2A59A 2FN7A 1BG6A 1ZU4A 4IIXA 1EFKA 2FR8A 1G5FA 2Q2QA 4PN7A 2F8MA 2GKGA 2YXEA 3R3JA 4W1RA 4HGZA 2BEKA 4B9EA 1ND6A 4OI0A 3ELYA 3MJHA 2HMWA 7REQB 5M5BA 3F0TA 5ICCA 3N53A 1A4IA 5MFPA 1JSRA 1YHNA 3HLTA 2EKPA 4GKJB 3EVGA 4E70A 4PPYA 4BQNA 2QQGA 2KYRA 3IALA 3JPYA 5D87A 4KGXA 3VV2A 4QPNA 4BBAA 1QWOA 1NW9B 5EE3A 1TW2A 3ZDAA 4M22A 3N0TA 1AKVA 2YYZA 3AVXA 4JU8A 4JYAB 2QUKA 4TWAA 1F6DA 1DBWA 2I4NA 1GTJ1 3O31A 3EODA 2O06A 5ALHA 3W6ZA 3LSYA 5GVSA 2HQRA 1SQ6A 5DHSA 4DDVA 2LXNA 1A0OA 1QHXA 3MOIA 2NV0A 3D02A 3VKHA 4CV1A 3UJ9A 2QTZA 2E5FA 3Q7RA 4EJFA 3ADPA 3X1XA 2VP0A 4CJXA 1H0RA 1OGIA 1P0FA 2WM8A 1G59A 2ATVA 2QN8A 2IHUA 3E1KA 4YALA 1RXWA 1TZMA 5GIOE 3KUCA 3IP1A 4BTLA 1Y3CE 3O90A 4GOLD 3T41A 3W4KA 2P41A 2HV9A 4DANA 4GBED 3CF0A 1KDPA 2XMGA 4UE2A 3FPFA 3BDVA 2FZCA 3FJYA 2UAGA 1U7PA 4JC0A 4CMIA 2HT6A 1Z34A 2RDMA 3AM4A 2FF5A 3JQRA 4Q3DA 4IV5A 5EMMA 4EGCB 2H1LA 4BFSA 4I55A 2X0NA 1BWQA 1ML4A 1WP9A 4FLFA 4QOHA 3FMVA 3RD8A 1RRFA 2F9MA 4Y7CA 2H2HA 1JBEA 1T0JB 3F49S 3IT2A 2WAMA 5DGXA 2VQDA 3T7IA 4KQKA 4ESHA 1IHOA 2DC1A 3KLNA 2XDWA 5FX2A 1CYDA 3BQ9A 1ULAA 1VPEA 5THQA 5DMHA 4PS1A 2ZRLA 5AW4A 1ZHFA 4EF4A 4TYYA 2CEAA 9ABPA 1RE1A 2W9XA 3FZGA 2RSLA 5K6AA 2HFKA 1IBCA 3CRW1 2YCBA 4TXMA 3CX7A 4LHZA 1TTTA 3IV9A 2WF9A 1KARA 2REQB 4ODIA 3AVTA 3QENA 3KWLA 4NK5A 3RSFA 4DIUA 4LRSB 3G17A 1E6WA 1SCBA 2F67A 3O91A 3OUTA 5JR3A 3WYNA 4O02B 2UUPA 3SVZA 4KCGA 1O95C 5JAMA 1IPHA 5A71A 4RAQA 1MLDA 3AXTA 1U81A 3GZJA 3CPHA 2ZI6A 4H0CA 1QFYA 2B36A 2WIFA 4RD6A 2YXLA 1G42A 3KFLA 4TSRA 1FSZA 2HWUA 3F6PA 4NHEA 1Z06A 2FPLA 5ALVA 4ND8B 1V7PC 1O0SA 1OY1A 2B0CA 3CCFA 4ITUA 4KUEA 5JVDB 2G88A 5K4AA 2EV9A 3BIJA 1QIFA 3D54D 2BHTA 3FMGA 3G2QA 3KOXA 1U1GA 1OH7A 4OL9A 1VHLA 5K8TA 3OQPA 1D2HA 2H4WA 5EJMA 3WFJA 1QH9A 9LDBA 5JZMA 3G2OA 4DL9A 1JYSA 4RK6A 5EQDA 1ZINA 3MJVA 3DYIA 4II2A 4ARVA 2CN1A 1W52X 2GB4A 2HZ7A 2NUTB 5I7UA 4RTOA 2XRZA 3GLGB 3PBKA 3TKYA 3H9JA 1WSBA 2BBWA 5C7YA 2O8EB 3PC6A 1XPRA 2FMTA 3I4FA 4YRSA 4AQDA 1Q57A 3BWEA 5AK4A 5H80A 1M83A 1Q1ZA 3OA0A 3E9MA 2GF2A 3FD8A 3ILYA 4IIVA 5AOBA 2PN1A 3WADA 1GUFA 5I7SA 3B12A 4FZRA 4YMGA 5KHLB 1E7QA 2J0UA 4X7BA 5FOQA 5JXWA 1QH0A 3MEQA 5KNDH 3IUYA 2OCDA 1K3UB 2VSXA 1V3VA 4X20B 4Z0TA 2O8FB 1B74A 3TMAA 4A03A 4H60A 4TTSA 4YFVA 4JQZA 4AFNA 1PJ3A 1WBJB 3SSAA 4YP0A 3S6JA 1VE7A 2A8YA 5JAIA 1TM4E 2DEUA 2R86A 4QELA 5REQB 1P29A 1JDBC 4Q7JB 2PX3A 2X0FA 3MBOA 5EJ5A 1IJEA 1FXUA 5LLDA 1UK8A 4LC9A 1P33A 3QVTA 2FPMA 2FEKA 3SFVA 1TTPB 4NZYA 2WWWA 4CIVA 5IKEA 4UM7A 3UJPA 3OTOB 1Z4PX 3OZCA 1IXYA 2IXFA 1IN6A 2J07A 1CUFA 1G3RA 4PX3A 1D8TA 3OEYA 4PQEA 1JHOA 2KX7A 4U2GA 1PHRA 1Q1GA 2GBLA 1S3SA 1XYGA 2YDXA 2ZXUA 3B52X 1L7NA 1XKTA 2DY0A 1QGUA 3B36A 1SFRA 3LUCA 1Q44A 3MPUA 4J0JA 4R16A 4RTLA 4YHHB 3OPYA 1HY1A 3SCZA 1IOZA 2WYHA 3I1FA 4GGOA 4FT2A 4E2XA 3K0HA 4BEVA 1RR6A 1CP2A 3UW1A 2XOXA 3GGCA 4D79A 4ZU6X 1JFFB 3N2IA 5D7BA 1ADCA 1DC4A 3HJBA 1VMIA 2BHNA 1QH1A 3IO3A 4S2EA 2XE6A 1XJWA 2EGHA 5FO1A 1U7OA 4CDNA 5L95A 4LGVA 3MGAA 1V8PA 2O3SA 3R9XA 5FPQA 3D7NA 1A2KC 3OZEA 1BN7A 4RZ2A 1CQZA 3MCAA 1GQRA 1CUGA 4EYSA 3QBTA 5KMGA 2Q62A 5TVGA 1N4DA 4D43A 2WHQA 1Z82A 2BGIA 5DP2A 1HNXB 1UZAA 4L5JA 4WFIA 2O8CB 3EUEA 1H8HA 4PYJA 1K7EB 1SUEA 5BNWA 4QAQA 2YN4A 3NORA 4JJEA 2O54A 1Q92A 3G2HA 4W4TA 3WBBA 2GEVA 3B6JA 4BQFA 1PE0A 2UVQA 4B3SB 1SVNA 2WKSA 2WZQA 4JOSA 4WIAA 1HURA 2J8ZA 4OJYA 3OZ7A 3B8HA 4RA6B 3R0VA 4RV4A 4XB6B 4ZZ2A 4L6IA 5ECWA 2QSZA 5IM5A 4C6HA 5ADVA 4IJKA 5BSWA 1E66A 2H8KA 4INJA 4NI5A 3O2SB 2PH7A 3C4JA 2F64A 4QJBA 4F72A 2NUPB 4OL0A 4BKQA 2VDVE 1E5VA 3UWOA 3WNQA 4KJZA 3K8ZA 3SC2A 2NP6A 1MXHA 3PJEA 1UJCA 3E84A 1GZ4A 5A0FA 4B3DA 1OLXB 2VJOA 2DFVA 1BS2A 4MROA 5K20A 5KI6A 2HIMA 4Q4JA 3GFTA 1GSAA 3DDHA 3N2GB 2I6SA 3EPLA 4Z8YA 2E9FA 4YRRA 3RS5A 4DS3A 2ZAIA 4OKIA 1P2TA 5ABPA 2D8AA 4J1SA 5F4BA 4BFLA 1XEWY 1BW9A 2EWMA 1V4VA 1XT6A 5LMZA 1D09A 1RQPA 2PT7A 1W5AA 1Q7RA 3WSWA 5AESA 1I4EB 1M66A 4RZ3A 3EZ6A 3EIFA 1T6ZA 1S0UA 3INRA 4Q05A 3OCYA 4S0ZA 5K1ZA 1LDEA 1AK2A 1SZDA 1WSAA 4RHUA 2F3TA 2QR3A 4IMIB 4XRRA 1V1JA 5EPUA 2QE7A 2WF5A 5HKOA 1T5SA 4L5CA 1TEZA 4IUCS 2H08A 1UJ4A 1MHTA 4AQ7A 2W43A 4H27A 5EXTA 2WIGA 3H2JA 2EBHX 3WZLA 3TPZA 4B8YA 4DAEA 3EN0A 3B2EA 1XVAA 1V43A 2NYVA 4FHFA 3UO8B 4Y18A 1RP7A 2CNNA 2JIOA 1EU1A 5LQKA 4A8JB 4FMPA 1QAQA 1PJTA 2JHGA 4HS4A 3M33A 4M55A 2BZSA 2D6FA 1C30A 1R00A 3HRHA 3NWPA 3EDCA 2JAQA 3GROA 2A58A 3JD2A 4TWIA 3BMCA 4U2DA 3B6MA 5EXXA 4BFWA 2NV2B 3H2ZA 4RTSA 2WSMA 3GO4A 1JR6A 4HKTA 1U7DA 3NHWA 5EWJA 4MP3A 4U9IS 3WC4A 2G77B 1CUSA 1R66A 3R6GA 3PCRB 5ILGA 2AD1A 3RM3A 4TV8A 2UZ1B 1NVVR 3DS8A 3JR7A 5DWVA 1SUBA 3HA3A 3S3TA 2TMYA 3NHYA 2ZI5A 3AHJA 4CI9A 3OT1A 4W5JA 5KWIA 5GV7A 5BT9A 4YP9A 4EI7A 2BR5A 3GFBA 3EISA 4NICA 4NCKA 4B0PA 3DXZA 3OFNA 2HEGA 4TTQA 5LQSA 1ZBDA 5H82A 1M7GA 1R0LA 4MINA 2IEZA 4P9NA 5HTOA 1KO1A 4FZVA 1SBYA 3HB7A 1LC0A 3S1AB 3PIDA 3HLYA 3GCDA 1QHHB 2AXPA 2C9MA 2W7TA 5C8XA 3ADCA 1EA7A 3QBPA 4GUAA 4LPSA 2WUFA 5IHXA 3WRXA 5EIBD 1U2GC 4N6OA 4TX1A 5FWXB 3HMKA 3J81k 4AF7A 4C6TA 1TJ5A 2J31A 3EF1A 4JENA 3ZWMA 4B4OA 3ZVRA 3KSAC 2EHDA 2NO4A 3KR2A 4ZIRA 2YW2A 1A96A 3DONA 3GHHA 2W2NA 2J3KA 5ES3A 1PRYA 1D04A 2M6KA 5L4LA 5FH9A 2FSIA 2PTGA 2XR1A 3CZCA 3GPBA 1ES9A 3C97A 3B89A 1TF2A 1XL0A 2J3EA 5I48A 5KQLA 1TYDE 4TS3A 1PR4A 4AZ0B 5AXDA 1W5FA 1LSJA 4I4TB 4AULA 3WRYC 2FWAA 4N6GA 2BGTA 4XZ3A 3V1TC 1R27A 1NUAA 3V97A 1L7QA 4NFLA 4X6UA 5HMLA 1UZUA 1H8HD 2NTNA 1CJMA 4EGJA 3L0IB 3PIRA 4K40A 1RAAA 1YQ9A 2XUFA 3F46A 1VI5A 1HKHA 3CZQA 5K3CA 4U2EA 3RW9A 4DIBA 2FW6A 4GQAA 4A0SA 3N2NA 3DMNA 3AR7A 1V1RA 5CFQA 1KMMA 4FWIB 1QYCA 2JI6A 4OJMX 1IC6A 1SHZA 4BVFA 2QG4A 3CH7A 5BRJA 1ISGA 5DM0A 2EKZA 2GVDC 1QGAA 2YNMC 1OIXA 3BF8A 1H2BA 2DH6A 2GWRA 2YYAA 1GSHA 2IZ6A 2XB9A 2YZMA 4O4HA 5LCXA 1W75A 2JA1A 1P62B 3FTPA 5C53B 2HJHA 2ZTUA 1LW7A 1LVUA 4GKBA 1JGTA 4MCHA 2P9CA 1P6QA 1UPUA 1E6UA 1W1UA 2C2OA 2I2XB 2Q5CA 1NULA 2RGYA 3QXGA 4QBTA 3V6MA 4P92A 3ZHXA 2AC2A 3V33A 4EO9A 3L79A 3UHOA 3ITEA 4LFBB 1ZJ4A 1X1CA 2OQ2A 3IQHX 4R71A 5CNIA 5AK5A 3HSYA 1RLIA 2VHTA 4HLUA 2QLNA 4Q1DA 5LA6B 4IHJF 2UYGA 2WFLB 3B3AA 3MHTA 1ABEA 2DAPA 2OUIA 2V8BA 2XNKA 3I01A 4KSYA 4CIBA 1KJ8A 3AFHA 1YS6A 4R8LA 3MAJA 1OMOA 2HIHA 1NF9A 3NYWA 4J03A 4QOIA 1GAJA 4YJ2B 5E9WA 3TMYA 5HW2A 5A06A 1ZZEA 3L0PA 4NE2A 1C8KA 3F78A 1VPDA 3VKVA 3PC4A 1XPUA 3FHJA 2QE7D 3GW8A 4BAGA 2VSNA 4CW7A 1OAAA 1CFZA 1F2TB 3LQ4A 2C0CA 3F4KA 4NKRA 1XA3A 3C6XA 3GLGE 3WYFA 1MIOB 1AKRA 3U49A 1GU0A 3KQVA 3TVYA 1X7ZA 1VYVA 3Q12A 5KYUA 5J9FA 1WVGA 1K62A 1JLRA 1EK1A 2YS7A 1CDZA 5KWEA 4TWBA 4EVRA 5HDBB 3D3WB 4IIJA 4TXLA 1NMEA 3ZZUA 3U40A 3JD0A 2BGMA 1A5SB 4UHFA 3TZHA 3I4LA 2TS1A 4I50B 1TKBA 4FR0A 2BGNA 4AU1A 4QDTA 1JZTA 1LF5A 2DHRA 3N2YA 4ZZIA 2AG0A 5E7JA 4X66B 3R9IA 3AL3A 3LOUA 4BAUA 4EEXA 2G25A 2E7ZA 3KS9A 2SKEA 1E3QA 3E0XA 1Y37A 5EMJA 4BFXA 3F47A 2HSGA 4HDOB 5BOSA 3VGPA 2NTVA 1TMKA 4V0RA 3T5TA 4F60A 1N78A 4GMKA 1OFTA 3WNZA 2LIVA 1CUZA 3LA6A 5TNXA 4V3BA 4IX9A 2CJWA 2ORWA 2BBSA 3ZG6A 1SHLA 3QLTA 5I4CA 3OFND 4TLCA 1JR3E 2CZQA 4XDYA 2XQVA 5CH5A 3BA1A 3LQKA 1QTIA 4GE0A 3BORA 1M34B 1QYRA 1TXGA 3JQGA 4GMXA 4KDCA 4FONA 5A62A 4D4IA 2C00A 1XAJA 1OJLA 2HBRA 3EDYA 1U2DC 1JA9A 1MG5A 1NUSA 4E30A 4UJ3A 1POWA 1H4QA 2CYBA 4PTLA 4MCAA 1QFZA 3QMPA 4HJRA 1SQ0A 2JIZA 1VYUA 1X7DA 2AOUB 2IGTA 2QRKA 1FU7A 1LPBB 3I8XA 2NSDA 4MWTA 5DYGA 1DFHA 1C7JA 1J42A 2FG7C 2PZAA 3WHPA 4FOTA 1L3CA 4RK5A 2ZJOA 1XEXB 4K9SA 2WA2A 5ALPA 1ESCA 4X3PA 3MOSA 3QE4A 4MV7A 4M1OA 3C1UA 3SICE 1MUUA 4ZYVA 2LKDA 2BOVA 1I33A 2Y1GA 1ORIA 2VZ0A 3GJSA 3MRVA 4U7JA 2QL5A 1X38A 4BU0A 3C70A 3WYDA 3LQ1A 1C8VB 4GOOD 5AH0A 3M2TA 5K05A 1GTRA 2PCLA 4MMYB 5LVAA 3ZHYA 4J2TA 2H31A 1KJJA 3PXCX 3QV2A 1OI4A 1MZPA 1I1QB 5GWXA 1KMCA 2QLMA 2IYOA 3V4VB 4L50A 4C0LA 2DECA 5J23A 2G17A 3DOUA 1EQAA 4LRUA 1UPFA 2B5OA 1Q0UA 4HBZA 1VGRA 3DPUA 1GTL1 2H59A 3ENZA 1O57A 2WK1A 3K70C 1GCAA 3SS9X 1R5OA 3A4VA 1RBMA 4D5EA 1Y5MA 2PS3A 3P5BA 1GEGA 1MD9A 3OZIA 4DY4A 4QTUB 3L3BA 2GERA 3H1FA 2IWHA 5CDUA 2GD6A 1JA0A 3OOHA 4EM6A 4YCMA 4NZZA 1YDMA 1VJ5A 2H4FA 3BMNB 3LGSA 3NHMA 4EJSC 5CP8A 1SKMA 4Q9LA 2N1BA 5TB5A 2ZSHA 1TU4A 1JLLA 3ZCTA 3EJ6A 4AKHA 1LPOA 1VJ0A 1JL3A 2O9JA 1F8XA 3OE4A 4WN3A 1OAOA 3VO1A 3QUAA 1HE2A 3K73O 2EBFX 4G85A 4OP1A 1XNHA 5I4BA 3C6MA 1XIVA 2DQ4A 1T6YA 2WPNA 4X64B 3HCRA 5ALXA 1ISFA 4MVYA 3LFHA 5C4MA 1UEIA 4HX5A 1JEDA 2WWVD 1ETUA 4GVXA 4H2DA 4K9QA 5IFKA 3AKDA 3U4IA 3A11A 4PZZA 5FTNA 3RVQA 4LVUA 1NRJB 4ZI5A 4HZGA 2AJTA 3NBAA 1FJ2A 4Q93A 3TSAA 4F3TA 1KPHA 1IG3A 4GR5A 2PO7A 2WU8A 3O92A 4QGAA 3L0BA 1YA8A 3W4JA 2VYQA 3QBDA 4FDMA 4PO3X 4OA8A 2D0IA 2LW7A 5TPZA 3RAJA 3SYKA 2V0GA 2ZROA 5C34B 1P0IA 1F6WA 3WNCA 2WE8A 1DMSA 5LQRA 4FLMA 1XTJA 3FYUB 5AP9A 4DA6A 2AT1A 4I46A 1NVXQ 2VSYA 2WOJA 3JQBA 2BELA 1K7SN 1KMHB 4LVOA 5TGDA 4AY6A 1Z5NA 2YYSA 2YQZA 1A8IA 4DYHA 1QFSA 3NWJA 3D6AA 3F71A 4PQRA 4ZREA 1QDEA 3A3NA 4O3FA 1MRNA 3GEIA 2OHFA 4HD8A 4B33A 2BJVA 3AVVA 5BV0A 3QELA 4HN2A 1AQIA 1KI6A 5A3VA 4P4NA 3PL1A 4YAEA 4YAIA 2Q4DA 3RODA 2EJVA 3LIPA 4KIWA 4HOYA 3O8CA 1W4ZA 3TSWA 1NNI1 1M3SA 3BXXA 1NE7A 1QR6A 4HADA 1MBZA 4HNAB 4HP8A 4WUTA 3WXBA 1WUJS 2WKQA 1YJXA 2VIIA 1Q0RA 1C9EA 1DIBA 2OG2A 1YL7A 1CUJA 2HA6A 2OHHA 4PICA 2GS9A 2HSJA 4DT1A 3GJRA 3JQAB 5A6SA 2FSFA 4BNZA 5IDQA 2G5TA 4QT0A 2C97A 1U0FA 2XDAA 3F3MA 4CMGA 4JJ7A 4N01A 3JARB 3EGVA 1DJNA 3K30A 1KA9H 1FTGA 3K3PA 4MPTA 4MIEA 3VH2A 3DMGA 4ZMRA 4Q9IA 4HDNB 4AVYA 4GC5A 1FMCA 5BR7A 3IB3A 5K4HA 1PZNA 2E85A 4MEBA 4ZFNA 1VBFA 1VFNA 2PBZA 2ZRDA 3H16A 3WK4A 1ZMXA 4J1QA 4R1OA 2VNKA 4O2AB 3I6IA 3NVKI 3ZGZA 5GJCA 1SG6A 1I4TD 4K9KA 4YMWA 4JKOA 2NPIA 2ZXEA 4KXMA 5ETJA 4AJ9A 3VOSA 3WISA 1AJEA 4ENUA 4XUGB 1A2OA 2BDTA 2JIZD 2ECQA 2NO5A 2JHAA 3B9RA 3NP7A 4ENRA 4CKWA 1IN8A 2AZXA 3CLRD 1HE1C 4CM8B 1HH4A 1PBNA 1T5TA 3CXUA 4RIHA 1UDCA 4YCAA 1H6DA 2ZIXB 4YR9A 5F52A 3BEDA 1YZTA 2MT9A 3U26A 5LKAA 5CXSA 2X1LA 2RK3A 3QKRA 5CLLA 2VA8A 4A1OA 1P31A 2LKCA 3VTFA 1IBRA 3LI2A 2XEXA 4EUNA 1UWLA 2VHEA 1D7OA 3BSWA 1DX4A 4V38A 4F96A 5ERYA 4D0NA 1H2RS 3I9KA 1J09A 5DEOA 5K8IA 1E3IA 1ELOA 2Z2KA 2Q3BA 2XCUA 3UJHA 2ETXA 1I36A 1FUIA 2FVYA 1JDUA 4G1FA 4N3NA 5KIAA 2OB2A 1U0HC 3EXEA 4FFLA 1CCWA 2DPXA 2FH5B 2C9ZA 2W8ZA 4MX2A 1YU6A 2B37A 4HYQA 4GYKA 4KO8A 4L7QA 4PCUA 2KQUA 4R01A 1SHJA 1YVPA 3PT9A 3LT5A 4BPRA 2H9IA 1Z07A 5CCDA 5CVDA 3P2EA 5E6SB 4FS8A 4IG9A 2BHRA 3T4XA 2IS6A 2DTXA 4JXZA 3ND9A 5CT8A 4L0QA 3KXKA 1UEXC 5KS2A 4UBKA 3JYQA 2V7GA 2ETVA 1B8OA 2R00C 1VDMA 2R6CA 3HEAA 3NHZA 4WLNA 4X93A 1NP7A 1P45A 2CHVA 3ETLA 4PXSA 1BYIA 1TU0A 4U7FA 4CODB 2PTQA 2D0PB 2D5LA 1G2QA 3BGSA 4HYTA 1R0SA 2FLWA 4MKRA 3UQZA 3W1EA 3MJ4A 4ALJA 1PL7A 5AM2A 1JFVA 1T6BY 4HSEA 3AHIA 1QX3A 3DZCA 3N0WA 4XH9B 4M6WA 5TGTA 3MTGA 2ACWA 4YAUA 2BGKA 2CXTA 2Y8EA 3OF5A 1VI6A 3KAPA 4GM4A 4JFRA 1K27A 1CF2O 5JBIA 1Z68A 4IJUA 3I1YA 3WAGA 2IC5A 4QXRA 2Z08A 5LQUA 2FZEA 4IQ4A 1OVMA 3CR8A 2ZG6A 4F3YA 3FSJX 2E5LB 2VZ8A 1RBQA 4F5YA 1ZJWA 2E18A 2QL9A 1ISPA 3L84A 2PNJA 1OZGA 5TPZD 4WTOA 4DV1B 3CRNA 1TFUA 3SVLA 3ZH2A 1MZVA 1DAHA 3NCTA 4J2OA 4DKJA 3K1YA 4KYTA 3JATA 1GKIA 1X7WA 5FL7A 1N25A 3ZCVA 1W36C 1B2LA 1KAMA 2JH9A 4JSRA 3HB4X 3OVMA 4K87A 3WMXA 4R2HA 4TVBA 4HQFA 1C3VA 3A3KA 1FYFA 3RVNA 4UQLA 2IX3A 4DDMA 3NBMA 4KHZA 4ZU1X 4Q4AB 1KDZA 2DQSA 1QTQA 4CZ2A 4DJFC 2I7CA 3DLHA 1XRSB 1G18A 1ZUIA 1N2CB 2HU7A 2QW1A 3EYAA 3KTOA 3VISA 1KI7A 4LAFA 1OAKA 1RMQA 3B5EA 4KAXA 4UDOA 2JCVA 3IQGX 3NYIA 1EJ0A 1ZHOA 2FFJA 4OV6B 3UT5A 2X2PA 2ZWIA 3G9QA 3D2BA 3OESA 1U2EA 4OREX 3B1JA 3B7PA 1I6MA 1N1DA 2O6HA 3PQ7A 3W79A 3ZE2B 1A77A 4ALKA 1Q2UA 2EBUA 2X58A 3FPAA 1DRJA 1WV0A 3C6KA 2JLBA 4A0HA 3R2JA 5FYQA 1CG6A 3V8VA 5AUPB 4BNDA 1JYEA 2OUKA 2WICA 3L93A 3WMWA 5HCUA 3TNFA 4AF6A 4FWBA 3IDFA 1VHDA 1XFAA 4ZO7A 4JLVA 1B2RA 3GC6A 3THWB 3EULA 1T2DA 1L1RA 1NI4A 4MRPA 2YVLA 3MRXA 5G0VA 5CFLA 2OCGA 5FFMA 1RWWA 4Q3NA 4KIUA 3S2EA 5IEBA 5JECA 5FULA 1JP7A 1M34E 1FDRA 2MINA 3H5NA 4KE9A 1XLVA 2P1RA 4CCYB 4DV3B 3WI7A 1BFKA 1XV5A 2IX9A 3ESBA 3PE6A 2WFMA 2FPIA 1MCZA 3NRJA 3KOOA 4E08A 1GYRA 3N74A 1RP1A 2VPQA 4MYTA 3S8EA 4TTTS 3DOFA 2PH5A 4FCTA 3K6SA 5HSGA 4GXQA 3WL5A 3ABSB 1G1MA 2R8PA 2ESRA 1JVBA 4LXUA 3BILA 1U2QA 3DDZX 1DEXA 3CLUD 5JCJA 1V3QE 1WQ1R 1NG1A 4OK5A 3SKXA 3NLLA 5CW1A 1JILA 3OH8A 3ZDYB 1KJ9A 2C94A 3V4OA 4MIKA 2I66A 5TT0A 3HNRA 2WIAA 1GNTA 2FUKA 2HQBA 1TYEB 2Q99A 2R47A 4AWXA 3BE6A 4CDMA 4DLLA 4MMXB 5CNKA 1Y5RA 4WN9A 1RI3A 2ZSAA 4G1UC 3IQDB 2HUNA 5DO9A 1AKMA 5EOVA 2WJVA 2VT3A 3ZIDA 1DT3A 1EE1A 2BFFA 4CTOA 1XR3A 3T15A 3TW0A 1PG0A 2XUZA 5IC5A 2WSBA 3J80A 4MQEA 2VJQA 1M6NA 5F9HA 3W05A 2C3MA 4CR8A 1E5TA 3K6KA 1RWOA 3H05A 4W7SA 1VTKA 5A4KA 1T1JA 2ZR8A 3AIKA 3R1IA 4RTMA 1JKXA 3P0RA 4IG4A 3MUNA 5JJ5A 5KKNB 1Z5ZA 1T5IA 3B1VA 2YMMA 1JFSA 2V5AA 3ZKWA 4QRIA 2WSLA 1V0JA 1FFCA 1EP1B 3O3MB 1NXPA 2UVPB 2A9KA 3AHFA 4FKBA 4M1QA 4XX0B 2JARA 1T9KA 5EI5A 3HXLA 4B7XA 3C5WP 3ANXA 3JYNA 4B45A 5FUBA 3MFYA 3QBJA 1PVOA 2HZBA 5EJ2A 4XGIA 2JBAA 4BRWA 2L0XA 1ZN7A 3C98A 5C7OO 4I1PA 4L5IA 2GPAA 4OU5A 4O1IA 2CLLB 4YPVA 3UN1A 1HG0A 1FLNA 3HP4A 3BFJA 4CIAA 1Y7TA 1LLFA 2ZSUA 3WDMA 1W73A 4XYMA 4BGUA 4BS9A 2Z1MA 1Y3BE 1U99A 2QRLA 4IO1A 5T6BA 3PFGA 3GDWA 3UKOA 1J3UA 1X2BA 1Y1LA 2JI7A 2VT2A 2YWDA 3RAFC 4UEQA 2Y0CA 3ZLVA 1R0RE 3AEXA 3CEPB 3ETGA 3F1LA 4TLLB 4M7WA 1OKKA 2GJ9A 1E69A 1BVRA 4C30A 1Q0QA 4BTVA 3H04A 4GZLA 4I3HA 4XYEA 2J85A 5FL7D 2G0AA 2CJFA 3IR7A 5DTEA 3O38A 2J7KA 1GJRA 1Q7TA 1X7YA 4I1UA 4UCFA 5C80A 3O8RA 3HY3A 3UMCA 2XNHA 3BD6A 4NMXB 2HLDA 2I3AA 3MZ0A 3OIDA 3AJ9A 4MPJA 4HTFA 3UA3A 3AW8A 2RAPA 1AURA 4JIMA 4C0QC 5AYVA 3KLOA 3BIFA 3DMDA 2R25B 1IWOA 4HVCA 4GPZA 1Y9ZA 3WNDA 2R1VB 5JPCA 2GA9A 2QB5A 3L0ZA 4BE7B 2OVBA 1ZJ6A 1IN5A 2ZXFA 4NDNE 3FF1A 2CNWA 5C7LO 1TJNA 3CF4G 2Z2IA 1Q5NA 5EQFA 1B6SA 3PHLA 2V5VA 4BN5A 4KR6A 4TYWA 2RGNC 4S04A 3EPJA 2IYWA 4BWVA 4WKOA 2OAQ1 1R6UA 3FNIA 5E0KB 1ZICA 1Q2XA 1WG8A 2PX8A 4BX9A 3C3AA 4KE6A 2P9ZA 1VL0A 1S2DA 2CL0X 3C5VA 3PUXA 3DCYA 4IYRA 5ICSA 3UPTA 1UEJA 3MMZA 3UV3A 3DYBA 1N36B 2F4NA 3DTYA 4EFCA 4ILEA 4DSZA 3HXTA 4EW2A 4B87A 1E8MA 2P6OA 2QQ0A 5FNVA 4D9GA 1PG2A 4MUKA 4ZVMA 1RRMA 5BXQC 2R4QA 1P1FA 1GTSA 1NVWQ 3U4AA 3EDOA 3GLIA 4D0RA 5HR5A 3PRKE 3WLAA 3UW3A 1IVNA 2J0SA 1BGWA 2P2NA 3ENVA 4IH1A 3IMCA 3P71T 1PW7A 1R6XA 4HNSA 4UMEA 8MHTA 3NGLA 3RVLA 4A0RA 1OW3B 3NOVA 5H3HA 1GPMA 4X63A 5JLJA 2IS2A 3RS0A 2YWJA 1EH5A 3Q88A 1Z25A 5KTRA 3NDBB 1BROA 4NG4A 4XGKA 1ZCZA 4B2YA 2R8RA 3KEOA 2FMFA 2CXRA 1L4NA 1T91A 1URPA 2VBCA 5JCJD 4TMYA 3P26A 4GOND 4JJGA 1KMIY 1GQOA 2Z0MA 4LJ4A 3EBPA 5B3AA 3CPSA 3I39X 1XEAA 2IBSA 1Y8QB 3DD1A 4Q37A 4L07A 3BWDD 4PY2A 1SCJA 2J3IA 4HPJB 1K6MA 4KDRA 4X91A 5B5SA 3FFTA 1KI2A 5B7PA 4LKRA 5KSOA 2Z2JA 2QM7A 4KHPB 4OHPA 4AXBA 5LZ7A 2X8BA 1QDLB 2AX3A 4M9UA 4FGSA 3OG9A 2WIBA 3URKA 2PD4A 4KLCA 3F6RA 4NEQA 3STWA 1Q7GA 3NVAA 2DPMA 3FPBA 4UD6A 1VL5A 3BG5A 4KQ9A 4NYJQ 3PDHA 3WA7A 3O0DA 4RSMA 1HSOA 1ZSVA 2P4QA 4M1SA 5FP0A 5B12A 3PLRA 4ZOLF 3CVVA 3LHSA 5LMNB 1OXUA 2TYSB 3MD0A 1RKXA 3GRPA 1G5HA 3OIVA 1M2HA 3U39A 5LP6C 1UQUA 3I0NA 3PD1A 2XD9A 3KSDO 2IU4A 3W90A 3U17A 3ZTYA 3EMDA 3I0MA 1BMFA 2EKQA 3P2OA 4OKSA 2Y05A 4DM7A 5KQPA 1OJ7A 1Y3IA 1W87A 1MV8A 4PLPA 2QP4A 1FQJA 2UUOA 4K9PA 2RGBA 5EMKA 2IOFA 4PLHA 4WW0A 4FC6A 4UNIA 1J0DA 2CDBA 1C4OA 4O4LF 3LLUA 5AW9A 5GINE 5GJVC 4PSAA 3TJMA 3IMFA 3L6CA 3FNFA 2HADA 2FSVC 3A6JA 2PRIA 2Y2VA 2JNWA 1Y81A 2FQ1A 3FPJA 1EE2A 1WA5A 5CAEA 3AF3A 3I5AA 3SBDA 1Z2OX 4M9CA 3W5SA 2P6NA 2HF8A 3HEBA 2AIRA 3L02A 4KFRA 4TZ6A 2RONA 2C3YA 2CD7A 3RYIA 3KPWA 1NN0A 4M1ZA 5F1YA 3U4QA 2JGFA 2EFYA 4N39A 4HNRA 1NPDA 3SS8A 3KUDA 4P33A 3EMVA 1V71A 2ZI9A 2Z5FA 5HW0A 1KFKB 2Q50A 2OHJA 2RC6A 4V02A 2DM6A 1M1ZA 1OKKD 3KLMX 4RD2A 4G0WA 1J9EA 2DG2A 4V0MA 2E6UX 1C9YA 5J2TB 1P7PA 2P4EA 5AJZA 5AKGA 1UPXA 4AS1A 5IKOA 1GZHB 3RI3A 1SCDA 3ENNA 2W6IA 1G7CA 2HLDD 3U37A 3I30X 4FEYA 5KVAA 4L9AA 3ROXA 4BB5A 3OLYA 2Q28A 5HK9A 5AW5A 1N2CE 1CZKA 1L4UA 1EHCA 3NGXA 4WNYA 3U7QB 1H6BA 3CR3C 3ISVA 1NW7A 2PSHA 3MCZA 2IDMA 4TRRA 3RU3A 4V1CB 2PEZA 4UVDA 3DAFA 4EHJA 1MT0A 1JLSA 4WDRA 5JLAA 1UKEA 3A32A 1JJVA 2CNWD 1XCJA 3P9CA 4HYYA 2IH5A 2DERA 1MQAA 1G38A 4G5XA 4DMUB 4HV4A 5T8KA 3A4MA 4LYYA 1BE6A 1CEEA 4DUGA 2VP5A 5JHGB 4BOYA 2JD1A 1JDSA 3NEJA 2Y1EA 3VTKA 4PRZA 4I3GA 1JZSA 1M8KA 3D6VA 4CLRA 5DTJA 3V8QA 2Q3FA 3FN4A 2O3UA 3MWKA 1MVOA 3H2HA 2W2MA 5JDCA 5I4IA 1YFKA 3G1WA 2A5YB 2UZ0A 2DETA 1Z3IX 4AMZA 3DEYX 2MDTA 3GCXA 2O3JA 4YJFA 3CB4A 3CLVA 5IDVA 4H1TA 1MO4A 4UXHA 4BWGA 2WVHA 1FNNA 4BYMA 5B58C 3S0JA 2OCKA 3P9ZA 1RRKA 4HZUA 4PG8A 1J1UA 2JASA 5T3YA 3HKDA 3HXPA 3IQXA 2JD2A 721PA 4O8CA 3O2NA 2H52A 2FUEA 1GG8A 2B8NA 2HPHA 2V9CA 4JQSA 2DF8A 2LNDA 2XA2A 4I14A 4LZLA 3D5QA 1VJGA 3M89A 2FWPA 2A7QA 2B7BA 5L7YA 4AN0A 3DVLA 3U13A 4E5YA 3O7WA 1Z4JA 4P34A 3T7TA 4LYEA 4BKOA 1OT3A 3CZ9A 2NQTA 2QPTA 3KKMA 2WHYA 1JXOA 4F2PA 2GAAA 4Z86A 3G49A 1ZIOA 3JALA 3EUWA 5TSDA 2WHPB 3HNOA 2IV7A 4ATNA 1C1DA 2UYHA 4NMHA 3E9QA 3OCZA 4TL7A 1U9ZA 3JZAA 2J46A 4P8RA 4R1MA 4LNUA 5D6OA 5G1OA 3SQLA 5G4KB 2RGDA 5JOQA 3GJXC 3CGGA 3ADKA 1CEXA 1P4AA 3EEYA 2Q5QA 5CA1A 5IBQA 4Q4HA 4BLWA 3H1PA 4FSHA 4TMKA 4U7PB 3RRFA 1YACA 4JR0A 4OXNA 2CV2A 1QU3A 1PCXA 2D7CA 1X2EA 3DT6A 4G0OA 4JI3B 3JQ7B 4J7XA 4XVUA 2IPXA 3NFYA 3LUKA 2R5NA 3UUWA 1I7PA 3KV3O 3AJAA 1KE1A 1XG5A 4L3VA 1O5OA 3ZI4A 4ZO9A 4D9BA 4P53A 5AJTA 4M2LA 4QDOA 1TYCA 4GMDA 3DFZA 3FUVA 4CIXA 1T0HB 5J47A 1YC2A 1VOTA 1XTVA 3M82A 1ACJA 2HWYA 1BMFD 2CXSA 5D51S 3KQOA 4UUQA 5DI9A 3FVRA 2C4HA 1J33A 2P2DA 2W6PA 2VHUA 4US1R 1KSFX 2ZRQA 3OZBA 1REQA 2G76A 1FUOA 1LF0A 1TI7A 1RM3A 1HDCA 3AP2A 3PNLA 4WWHA 1HETA 4NCHA 4ZYXA 4CLDA 1I9CA 1ORRA 1D2AA 3F97A 3PEUA 5AVXA 1THGA 3FOWA 2ZYVX 1YSCA 3UB3A 2CHQA 1FXWF 4C20A 4M9ZA 2RHGB 1VM6A 4DG5A 2MMCA 3RTCA 2OLJA 3W2TA 2B78A 3HM9A 6Q21A 4Q39A 3DDOA 3ZBTA 3LBYA 4EY5A 1KJZA 3OETA 1W5BA 4DLKA 4MYDA 3NC4A 3OQIB 2W00A 2VXBA 3CGWA 3IBCA 4FFSA 4C0BA 1LV7A 1QGZA 1QC5A 3AOEA 2NU6A 3M83A 4LIPD 4N12A 1UBKS 5BR8B 1RQ7A 3CSUA 4E6EA 1SHUX 3L0CA 5EP1A 4V24A 1CRLA 1QCYA 1WPQA 2DRIA 2YIMA 3L7JA 4YYEA 4ZCMA 3DMTA 1X1AA 1T4CA 1NKVA 1NX9A 1IRIA 4C2BA 3LGXA 4JROA 4J3JA 2ZUVA 3KXLA 3AL2A 4MQUA 4NARA 4N8EA 5BSGA 2FK8A 1FX1A 2W6ID 4M0FA 1PLLA 4HXGA 4R0MA 2EGUA 1QYWA 2ZQYA 1ZNQO 5DLEA 1KY3A 4J7CA 1XZAA 4XVRA 2R85A 3FXAA 4YDSA 1N8NA 3DG9A 2VG8A 2OCLA 3BRQA 3HZOA 4BFVA 1YQQA 5B1DA 1TKAA 4YJKA 2H57A 2GFHA 1QQBA 3FLEA 1VG1A 3AVQA 2RJOA 5FQNA 3UJAA 2IOHA 2HXYA 4IFTA 4BGVA 2BCJQ 1Y6QA 3KYBA 4TLDA 1W2WB 2DU8A 1U28C 2MOKA 3ETDA 4V0LA 3RS3A 4DUGD 5BUZA 1TPZA 1SHTX 3DE6X 4UHBA 2YVAA 2RG1A 4CKCA 4ZOBA 1VJRA 2VDUE 5K3OA 1A9XB 1IEVA 2PU7A 3FLMA 3NUZA 4Z1MA 2QOEA 3GLFB 5GM2A 3GRKA 3OBBA 5ERGB 5IS2A 1N0HA 4AYWA 3GGOA 1FRVA 1JEQA 2EWVA 2IYTA 3ZC3A 1H2EA 1YDWA 3M2PA 3OJLA 2ZDQA 1Y8CA 4GSKA 3RUFA 1IRXA 4IP0A 5BW5A 5KSWB 2EP7A 2Y3IA 1F0YA 1T2AA 3GUYA 2BJWA 4P32A 2VAXA 1N3IA 4EKDA 1D2EA 4MWSA 1D1SA 3P0JA 1U9IA 1P91A 1ZD1A 1QONA 3K0FB 1F7UA 1FQOA 1O6CA 4E3WA 3MMNA 1Y3DE 3WY9A 1KQ3A 3NHJA 3KUUA 3ZYCA 3QWIA 3WR5A 3BFPA 3HVHA 1P7WA 4YK7A 5JJBA 1DP4A 1YDGA 2O0LA 2CFCA 2LD4A 5B6JA 2J0VA 2X2EA 4JUCA 2DQKA 1CUDA 1E4EB 4LSGA 1D9ZA 3EVBA 1SXJE 1YZHA 2BEVB 3ZWYA 1FVXA 1Q0LA 2RGRA 1A2QA 6CHYA 1MP0A 5TIIA 2FG6C 4FZJA 2FJ0A 5I7EA 2CFIA 3H0KA 1NKTA 2BTOA 1K7XB 1RYZA 4IJWA 1TM5E 5LYJA 3RT7A 3PXGA 4CMAA 2IY9A 1P4GA 4Q9NA 5I8WA 4UC0A 5AI0A 2CV1A 1JKJA 4FFRA 4CWAA 1EDDA 5CCXA 1YOVB 5EKDA 1THZA 2BRUC 3K5IA 4HB3A 2CKMA 4PPQA 4LYAA 1DCMA 5SZKB 1FFWA 4YMVA 2C7RA 2D2XA 2XOEA 4Q24A 1DAMA 1QK4A 2IA5A 3HPRA 3PD0A 2YZGA 4R98A 5J4YA 2HXGA 1ADFA 2NSLA 1PFVA 1YD7A 4F5EA 1GPAA 2R5WA 4BUZA 3BKWA 4UCWA 1BWPA 4FQ7A 2GPSA 3NAMA 5DLQC 5ESWA 5FFFA 1N34B 2QYSA 4K9NA 1OX6A 1TO2E 2P8SA 2WW8A 3IAAA 3IAHA 2OGUA 2H4ZA 2ZYTX 3WB1A 2C7VA 1EUDA 2CUTA 4GDMA 4NPAA 4XQCA 2A3RA 3EVEA 4DR2B 4MWBA 3O21A 1ZVVA 3T3EA 1PQPA 1TVCA 2N47A 3B2NA 4DAOA 5GQSA 2BP7A 4REQA 5I7OA 1TQHA 4DV5B 4XEUA 3GLSA 3KYCB 3F4LA 2X14A 4WXEA 5I7HA 2CXHA 3EQ2A 3KB1A 3F6CA 3G13A 4KW7A 4LVNA 4NE9A 5DGHA 1WLYA 1SUIA 1V5GA 2RCNA 1ZMTA 1RAFA 3C41J 3E9ZA 4N9QA 3S2SA 1T3HA 1OASA 1HPLA 1IHPA 1UZLA 3H11A 4CHGA 4L27A 2V9PA 2QSJA 2XQJA 1P4HA 4I36A 3OPVA 1H85A 4H08A 2Y67A 3TSOA 4R2JA 1YB4A 5JEDA 2GA8A 3L5OA 1ID8A 4HN9A 3GPLA 1P4SA 4DB4A 4MGKR 1XDZA 3HG7A 2MYNA 1ODKA 2ZYAA 4Y1RA 5PNTA 3M8KA 4LXGA 4ZAYA 3DJFA 3TLKA 4C0SA 3N76A 1V9CA 3TAHA 3A4NA 3PXDA 3SXPA 2IOFK 3NKFA 4XIFA 1Y5NA 1PQYA 4Y6GB 1LNZA 5EE1A 2H29A 3MPOA 3BWCA 1JI0A 3VR5H 3DE7X 3FMPB 2COUA 2YVUA 3H2GA 3NW9A 4CIDA 4F9GA 4G0VA 3BB1A 4MVCA 4CUKA 4MW2A 4MJ7A 5HFAA 1BXRB 3PU6A 5KNBA 3TECE 4JL5A 1KDVA 3EXFA 1IQPA 1L5QA 2P9EA 3VYWA 4IOLA 5HF5A 1RQXA 3QFCA 3RT9A 1G2OA 3SJCA 5TT1A 4TYPA 3QPDA 1BO6A 4AF8A 4AO8A 5P8WA 5FTKA 1AXEA 2GYVA 3KJFA 5BURA 5TQ2A 3QE9Y 3D3NA 2PMKA 4IGIA 4A0GA 1PZGA 4ZI7B 3PGJA 3IIEA 4DMGA 2FN8A 3CLKA 1E1QA 1I8TA 5F5XA 4E21A 4LJYA 4MDFA 1P1JA 3QVWA 1RVV1 5TGZA 4G8JA 3MGKA 3REQB 5EJEA 4JGIA 5LFAA 1KZ1A 1G5RA 1MW9X 3VNBA 3STVA 1FP2A 1JJIA 1HO3A 3IHTA 3RG8A 2C1XA 5CM8B 4E32A 5JI3E 1XCMA 3IVAA 1VCMA 3BFVA 4EGAA 3I2KA 1XRMA 4I55F 1J2TA 3JQ8B 4X24A 5AVKA 3UGJA 3DBOB 1Z7EA 2NACA 4MKGA 2PGJA 4G0XA 3PICA 4B6EA 4Z1MD 3CW8X 1CC1S 3QUQA 3QUTA 4DQDA 1H4SA 2FGJA 3LQQA 4NENA 5DBFA 4G2NA 3VTAA 1AS0A 3IYLW 1CHDA 5LNK6 3INYA 1UQRA 2AC7A 1CZNA 4F6RA 1TGVA 3VX3A 4DMMA 1PK8A 4BEJA 1MO5A 4F1WA 1Y8AA 4ZI3A 1N8TA 4MAFA 4KZPA 2FMUA 3BRWA 4G0QA 3PD7A 1PJSA 2G1UA 2WTNA 3D4OA 4RVUA 3GYGA 1F2DA 1T9GS 1U6KA 1G8KA 3VH1A 1WPRA 3BHMA 4OHBA 4UTZA 3VU8A 2K2QB 5JSHA 2C96A 1APBA 2HK7A 3TSCA 2ZBGA 2YC4C 2QR2A 1VKNA 2AS0A 3U3ZA 3UMFA 2Q2OA 4LV5B 2EFGA 3A36A 5ELXA 1E4OA 5BNFA 2DB3A 1CY8A 1EUYA 4C2AA 4H1HA 4ZKEA 1NNLA 1GNQA 3IULA 1Z45A 3KLPX 4MDHA 1EMDA 1B3BA 1SO8A 3IMEA 1PWYE 3SDBA 4CHTA 3UUGA 4DLPA 2OSBA 2F59A 3ENQA 5ECGC 1ZN8A 1GTZA 2QM3A 1PWHA 2GCEA 2RI6A 4XARA 1MF7A 2HJWA 2JI8A 3EEBA 2ADOA 1OI2A 2JS7A 4GYWA 5E8RA 1IDN1 1DIGA 2IYFA 2QBYB 4LMPA 4J9UE 1U1CA 3OBIA 3QNMA 3UFXA 3I3OA 3I9FA 5TR9A 3RNLA 1ACMA 4KLNA 4Y98A 2B4YA 1EFHA 1NQTA 2IE8A 3GVPA 4RVNA 4CMEA 5A4IS 3A7EA 3SM3A 4AT1A 4YCSA 4CEIA 1QVZA 2DBZA 1U7UA 2VNAA 1DC5A 2WYUA 4DLYA 3PGLA 5EHIA 3WWZA 4F8EA 3A10A 3FM9A 2VTBA 2V4UA 5ICMA 3PEFA 3NHRA 1LI4A 2RGAA 5BSRA 2EKDA 4G36A 5L3RA 2BIFA 4E5NA 3TVTA 3GVCA 4JELA 3GN2A 4LJSA 1A9OA 3HKCA 1QP0A 4D4KA 2MYTA 3AETA 2QTRA 3KUXA 2J48A 3C6ZA 4I5EA 4KVFA 3ZLTA 2G6TA 4MZXA 3ZHOA 4ND4A 2VRBA 1WEKA 1RQRA 1M6WA 2JFPA 1YVUA 4KKXB 4PSKA 1EZ1A 2PS1A 4J8PA 4QBFA 1NC1A 2XWSA 4JJZA 3SJUA 3HJFA 4KAJA 2H2AA 1NSYA 1YR7A 4X94A 4HB0A 3UYLA 2RK6A 1MJFA 1NJ5A 1TQ8A 1ZLXA 1MH9A 1XK7A 2PM8A 1SRRA 4U1RA 4W5OA 3R5HA 4ISCA 3H84A 1Y1TA 1Y9JA 3AKEA 2RBKA 4EYQA 2ZCUA 2I54A 1DCTA 4CQJA 4CLOB 3Q3CA 4OMCA 3I34X 5HG0A 4CLHA 4H3SA 1MN6A 3VNSA 1WCXA 2FWNA 3KKZA 5CBPA 3HC7A 3DVRX 3G85A 1QFMA 2CLCX 2AFIA 2P6MA 3PA6A 4TL8A 2HWXA 4JBIA 4OI1A 4BVGA 3FOEC 3VXKA 1V8ZA 3NUQA 1TNDA 3E3AA 4G86A 4JR1A 4LZNA 4NIMA 5CX1A 2W98A 5BNTA 1ADYA 1DKOA 5KNBD 1DBQA 2J5RA 2EU8A 4OVKA 1I6KA 2R8EA 3UAGA 1QIJA 5DDIP 4BV8A 1S96A 1LVGA 1KNQA 3Q98A 3DZFA 3ZHCA 1NBHA 1L4BA 4OK6A 4LGCA 3X1MA 1TT5B 1HOXA 1B8PA 1H1LA 2B4RO 1N2EA 2SCUA 1RCFA 3AG6A 4C0KA 1U9YA 3Q11A 2HFJA 3BJZA 3KIPA 3TL3A 1GZ6A 1A9ZA 1E1QD 3V7YA 5MN6A 1FQWA 4OGWA 1R9NA 4G9GA 4OLJA 2X5OA 5EVJA 1RT9A 1W59A 1FUPA 5CT5A 4XWOA 3DWFA 1O96B 2AOXA 1USIA 2ZSIA 2VQ6A 2PPVA 4MS1A 4UNPA 3E8XA 3EIXA 5GY7A 3E3LA 4BNMA 1Z2PX 3OI7A 4MB0A 1GRRA 2GZSA 3QKWA 3QTBA 1CU1A 4O5OA 3PPXA 4QNRA 3RFCA 4AJLA 4DQUA 1DRUA 4HB4A 3ILHA 1D1QA 1GT6A 1ZW1A 3MINA