1Z4IA

Structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with deoxyribouridine 5'-monophosphate
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate specificity of the human mitochondrial deoxyribonucleotidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords 5'(3')-deoxyribonucleotidase
total genus 64
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1z4iA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4iA01
5AIAA 5ALYA 2YN4A 1Z88A 2C88A 4RESA 5JJBA 2OBBA 2WF8A 2BDEA 3SD7A 1RKUA 4MUMA 3AR9A 3OTQA 4Y2SA 5AM2A 3QNMA 3WKDA 2HF2A 2ZOSA 4HAIA 3QGMA 5ALNA 2G09A 1QQ5A 2YFYA 3E84A 4MWOA 5ALZA 2B30A 1N8NA 1Z4JA 4H1WA 4UMDA 4L6AA 4YGYA 2VKQA 4CF5A 2Q4TA 3N5KA 4GXTA 3UM9A 1L7OA 4JB3A 4CE6A 5AI9A 2P11A 5AW4A 2W11A 2HEGA 4OD0A 4KYTA 1Z4OA 3HLTA 2C4NA 3WK8A 5AK4A 2AMYA 3U7EB 1JUDA 2C8KA 1S8OA 3OPXA 4EEKA 3ET4A 5AKHA 2OM6A 3N07A 5AW5A 2HO4A 3BA6A 3I28A 1ZD4A 1FEZA 2B8EA 3HYCA 2P69A 4Y2TA 5ALSA 4UMFA 3NIWA 4BX2A 3SKXA 2HDOA 2G06A 2FEAA 3M9LA 3WGUA 3EF1A 1TJ4A 3ET5A 4C4RA 3MN1A 4NV0A 4QQFA 1TJ3A 2I6XA 4ZEWA 5ALEA 1J8DA 2JAWA 1RQLA 2YBDA 2WFAA 4NFLA 4UATA 5AW9A 1Z4IA 3L8GA 5AW7A 3ZX4A 4UM5A 2IOFA 3KOOA 5AM3A 3S6JA 4DFDA 3NASA 5AW1A 4BNDA 5AKYA 3L1VA 3OCXA 3OCWA 3B9RA 3WK5A 3FPSA 3CZ4A 4HGPA 1ZJJA 1Z4PX 2FUEA 1S2OA 3NAMA 4L57A 4FFDA 5ALRA 3WK9A 2RARA 3A1EA 2DQSA 4AP9A 1NNLA 2P27A 1NRWA 4E88A 4YCMA 5A3SA 4NABA 2CFRA 3EF0A 3CNHA 3DNPA 2WHEA 3U26A 1IWOA 1L7PA 2HHLA 3QU9A 2I33A 3ESRA 4AS2A 3RF6A 3QYPA 4HGRA 3ZVNA 5IT0A 4XQ0A 1CR6A 3ONNA 2O2XA 4L6CA 2MSNA 3IJ5A 4C4TA 2FI1A 4Y2XA 4HGNA 3FM9A 3E58A 3EWIA 3IRUA 2EATA 2HX1A 1N9KA 1RKVA 1Z4LA 3PGLA 4UARA 3WKCA 1VJ5A 3NALA 2I54A 2YMPA 5ALMA 5AVTA 5ALFA 1Y8AA 1YV9A 3J7TA 5AVWA 4IG4A 4O8CA 4XPZA 4BEWA 2WF6A 3AR5A 2JAUA 1CQZA 3U13A 1SU4A 5AVQA 3QUCA 5AVVA 2YJ3A 2JAOA 1J97A 2AGVA 2NO4A 3U7FB 4OFZA 2X4DA 2ZBFA 3L5KA 2AH5A 3ZVLA 4AS3A 1YDFA 1QYIA 2RB5A 1SWWA 2I55A 3N1UA 5E0OA 3E8MA 1TJ5A 5ALUA 2YJ4A 3OCUA 1L7MA 1RPZA 2ZBEA 4NAVA 2GMWA 4NWIA 2R8EA 3L8FA 1F5SA 1YJ5A 1RMYA 2G0AA 4IFTA 2YY6A 1LTQA 1ZD2P 2ZXEA 1X42A 2ODAA 3N8GA 2B8JA 3KZXA 2BY4A 3L0CA 3W5BA 1Q91A 3QU7A 1YS9A 5AKEA 3DAOA 1U2TA 3D6JA 4FE3A 1XVIA 1EK2A 2QYHA 3NUQA 3MMZA 4CF3A 1QH9A 3UMCA 1YMQA 3AR6A 5AVRA 5AW2A 3WKAA 2HI0A 2R8XA 3R4CA 2G80A 3ZWKA 4EELA 1Z5GA 5T41A 1RKQA 2EAUA 3L7YA 3QU2A 4B6JA 1SWVA 1QQ7A 3WGVA 5ALOA 2AUTA 2C8LA 3FPBA 3ZUPA 2NYVA 3NRJA 1RDFA 1WVIA 1WR8A 5AI5A 4DCCA 1Z5UA 4F71A 2ZBGA 4FYPA 1U02A 5AESA 3I6BA 4C4SA 2RBKA 2EARA 1Z4MA 5AW6A 3PDWA 4EX6A 2WF7A 3KDPA 2FPRA 2FUCA 3E81A 4Y2RA 5AKGA 4YIKA 1RMTA 3L8EA 3SF0A 5AW0A 2CFTA 3ESQA 1L8OA 3SLRA 1U7PA 3WK6A 5AVYA 3I1YA 3MC1A 4QJBA 1TA0A 4UM7A 3L8HA 5ALKA 3ZW7A 3WKEA 4HYTA 2PQ0A 2R8YA 3EPRA 3F9RA 2IA5A 3ZVMA 5AKJA 1Z4KA 5AM4A 3M1YA 3ED5A 3QU5A 4XOUA 3WKBA 3DV9A 2YMMA 1YNSA 3SMVA 3VAYA 5AK5A 2FDRA 2R8ZA 1O08A 3AR3A 5AM0A 3ZTYA 4EX7A 4Y2VA 1VFPA 3ZTWA 4BBJA 5ALHA 5ALGA 4I9GA 2B82A 3WK4A 4J03A 4HGQA 4EZEA 4DWOA 1O03A 3I76A 4CNQA 1XPJA 2O9JA 2IOHA 1ZD5A 1NF2A 2OYCA 5AW3A 4KX5A 3A1DA 5AVZA 3GYGA 3R09A 4ZEXA 4BX0A 4YCLA 2YJ5A 5ALJA 5AI4A 3L0YA 2WF5A 2MU1A 2ZBDA 2I7DA 3L0BA 1ZRMA 1MH9A 2JGAA 1RLOA 3MPOA 1EK1A 5AK3A 2WM8A 2B1RA 4J2TA 4Y2PA 4BNDB 4YCNA 5AHXA 3P96A 3AR4A 4UMEA 5ALDA 4RETA 1Z4NA 5AW8A 1Q92A 1VJRA 1XP5A 3FVVA 2HF7A 5A3RA 2CFSA 3PGVA 3QX7A 1AQ6A 1RC8A 2IYEA 2JARA 2RAVA 1ZD3A 5AKXA 5AKKA 3DDHA 2FPXA 4PNHA 2G08A 3L1UA 4G9BA 2FPUA 4ZEVA 4UAVA 5ALXA 2G1AA 4UASA 1L8LA 3W5AA 1U7OA 5ALVA 3WK7A 2P9JA 5AVXA 1ZS9A 2YMLA 5AKIA 3U19A 3QUQA 2FPSA 1Z4QA 3QUBA 4OCZA 3QUTA 5ALWA 1K1EA 5FP0A 5AK6A 3ZX5A 5AVUA 5AIBA 4UU1A 2GHQA 3KC2A 4KX3A 4OHFA 4CF4A 5AM1A 2FPWA 4BX3A 3U7GA 4JDPA 5A3QA 3A3YA 3IB6A 2HSZA 2WF9A 3KBBA 4KNVA 4UW9A 4HGOA 2C9MA 3SKYA 5ALIA 4YIHA 1ZOLA 5AM5A 3U7HB 1T5SA 4DW8A 3N28A 1QQ6A 3B8EA 2D2VA 2HOQA 2I34A 2NO5A 5AKLA 3ZI4A 5AVSA 5AI0A 4Y3UA 3OCZA 2W43A 1RRCA 2B0CA 2YJ6A 3QU4A 5AICA 1WPGA 2PR7A 5ALPA 2PKEA 3OCYA 4XE5A 2G07A 3KD3A 5IT4A 3FGOA 1ZRNA 3RFUA 3AR8A 2Q5EA 1WZCA 1RLTA 3UMGA 2CN1A 3W5DA 1L6RA 2QLTA 1T5TA 3B9BA 4BKMA 4G63A 2OA0A 4EENA 5AI8A 3PCTA 3R9KA 1U2SA 5ALTA 4YH1A 4F72A 1RMQA 1RLMA 2ZG6A 3OCVA 1KYTA 3ZU6A 2GHTA 2B1QA 3NANA 4Y2UA 3QXGA 4I9FA 4UU0A 2BDUA 1LVHA 4Y2QA 4KN8A 4UMVA 3BWVA 4KNWA 4UAUA 3QLEA 4GIBA 1PW5A 2HCFA 2W4MA 3TLMA 5IS2A 4BYGA 2IOFK 2YMQA 3AR2A 3FZQA 1TE2A 2Q4RA 4Y2YA 1L7NA 3K1ZA 3ZWDA 2GO7A 5AI6A 3SHQA 5ALLA 5AKZA 3A1CA 3UMBA 4BEVA 4Y2JA 3W5CA 2GFHA 5ALQA 3AR7A 1RQNA 1T9ZA
chains in the Genus database with same CATH superfamily
1VSUA 1QYVA 3QYJA 3DVQX 1WZEA 2P2CA 3DOFA 1IXSB 1VXOA 2JAPA 4AYXA 4MUMA 1CUWA 3BE4A 3OTQA 2O8VA 4GXQA 4L95C 1U7DA 3NJ4A 4WNAA 3BB1A 5LBUA 3LRTA 4WZBA 2FPIA 3L43A 3ITNA 4B85A 1VL1A 2AWNA 2VSNA 1X7ZB 4A15A 3BHIA 3FBWA 1DC8A 4CV1A 2YHAA 5JCZA 4EPWA 2Z56A 4TMFA 1MAWA 4DIUA 4ZI3A 3I6IA 2BFPA 3L4BA 5BRAA 5JC1A 2VHWA 2ZROA 2ZAMA 2QW0X 3OJFA 5CFMA 3QFHA 3S0JA 2YKGA 4KQKA 1NMXA 1QHSA 1CNMA 2KBEA 1B00A 1GCAA 3FUTA 4NMMA 4OXYA 1JVBA 3PB3A 1OB5A 4X6YA 1PF7E 4GXTA 3ZWAA 1HZZA 3S2FA 2H1IA 2WYWA 4JFAA 2P2SA 4HN9A 3SEZA 1ZYUA 1F0YA 1P9RA 1U28C 1YI8A 2ZJ8A 1HFJA 4KYTA 1NG1A 1QH8A 4JB2A 2VT7A 3V3TA 4O2AF 1C1DB 4Z4IA 2ZFUA 4N5IX 2P41A 3HLTA 1N4AA 4F4FA 2BMAA 4X5OA 1N36B 2CLLB 3G13A 3NPMA 4KFUA 2WWXA 1GT6A 4ARSA 5LQNA 3ER9A 1P29A 2ZJ7A 1ZUNB 3PF9A 2ZT7A 4MUBA 3KU4A 4WLOA 4DV2B 1FUPA 1LDGA 2Q29A 2ZUSA 4ZHQA 4EPVA 2CBZA 3ESAA 4PO3X 3V4SA 4JBNA 3RT7A 1CEYA 2KYRA 3BA6A 2DH5A 4EJSB 3C4VA 2Z9BA 1KDOA 1W9HA 1R27A 4IOKA 2VR1A 4OMUA 3ROEA 4EJ0A 1EFPA 4ND8A 1P0MA 3IT3A 3IDFA 4KYIB 3FY4A 3R3UA 4O4HB 1TQ2A 1EWVA 4C21A 2NU8A 3OJEA 2X15A 1RAEA 4Q82A 1EMDA 3VKFA 5B5SA 3AESB 3GAZA 2RJ3A 3MN1A 2H57A 4Z9FA 3VAAA 4DG9A 4EUFA 1FE8A 1SBZA 2VUTA 5B7QA 3HDHA 3K70D 4YRJA 3S2GA 1IXZA 1KY2A 1CKEA 3F8WA 3UCFA 2FZ5A 1SHUX 4LJ7A 1N0IA 1MTZA 3TL2A 4BNZA 5IKEA 1HDGO 3QKRA 4NFLA 2NXEA 1NN0A 1VHTA 3DA8A 4D0SA 5KYGA 4EY3A 4AECA 1DRWA 1PR0A 2G5CA 3EG9A 5AW7A 3WL7A 3H5WA 3KSRA 5CDSA 1ZL0A 4UBOA 3RWOA 4L02A 1Y6FA 1DKRA 2P8JA 1DC5A 1LX6A 4C7OB 2UXDB 3IXQA 3DMDA 1I10A 3P19A 4XEUA 3WI7A 3GLUA 4RKYA 3U9SA 4E5VA 1KDVA 3L4EA 3SHVA 1EXWA 3L05A 3ODPA 1DHRA 2O6LA 3N6RA 2XQFA 1N2XA 4MDEA 1WLSA 1O4VA 2B20A 5LJLA 4G6ZA 1EK6A 1Z6GA 4HNAB 4FFBB 3FNIA 4V24A 4CDRA 3MTJA 1U3VA 3GW8A 3NNNA 3UHOA 3HCOA 4OU4A 3BIFA 3ZI0A 4PX9A 1U3DA 4BFUA 3BSYA 1MO6A 3ZWBA 3UT5B 2FFQA 5FLXA 2R87A 2M6KA 3ZWXA 2P5UA 1W48A 1ZICA 3GH1A 4FLFA 2IDMA 1BQEA 2WIGA 2RHBA 3H04A 1R6TA 4EJSC 4TN1A 1A9TA 4QU5A 5TF0A 4LF8B 1N1EA 2H7CA 4I19A 4IJVA 4ZYLA 5LBIA 1I30A 4Y1RB 4C4TA 3UB3A 2V4UA 4IIUA 4EA9A 3KT8A 2I6FA 5JCXA 2GEFA 3E58A 3PXCX 4R1MA 2V6GA 3PTLA 4Q01A 1I2CA 1EB9A 4L72A 3RVNA 2QRJA 5FBZA 2B4TO 1OLXB 4NULA 1R6BX 4S1OA 4YJGB 1GQ2A 1JU9A 3RRYA 3T3NA 4MI9A 2CNWA 4L3WA 3GLHB 3IURA 2JVIA 1G5QA 1FTYA 1PHRA 4G4IA 3N74A 4IO1A 3H83A 1KOFA 1AN9A 3MEQA 2FPPA 2JLXA 4YAOA 3QP9A 2VTDA 1V95A 5IABA 3HM2A 4NE9A 1ECJA 4GOOD 3KALA 1K7WA 1CNEA 4Z3DA 2W2PA 4LQLA 2BFEA 4NARA 1W5TA 2YWBA 3C6XA 1JS1X 3P4YA 4MLDA 4BNVA 4JAVC 2QUJA 3NHZA 1O96B 3P2KA 5IKOA 2IC5A 2HADA 1EK5A 1KAOA 1EGVB 4X45A 2D74A 4R98A 3ZWYA 7YASA 1KEKA 3TTVA 4EFMA 4PXAA 4PEVA 3LPLA 3W7AA 2PN1A 1WXHA 1I6WA 4LCJA 1OH8A 3RTAA 1ZIOA 3DV0A 2X2FA 2JHGA 4LOHA 4MPJA 3HMKA 1SOUA 2A2ZA 4F21A 5SY9A 1DAKA 4KR3A 4OSEA 4LW8A 2ERCA 1JJIA 1QO0D 4L0CA 4ZV7A 4WSOA 5J5CA 4HB0A 3TSCA 1NBMD 4WI1A 4N9WA 4ZT6A 2JGFA 5CXSA 3TRIA 3PNOA 4DQUA 4NCKA 5JS1A 3WLHA 2QBYA 2H2GA 4D8VA 1ONPA 4LHZA 1Z35A 1V9SA 1PFUA 2GAOA 4QBGB 2GCNA 5FLKA 5K3CA 3O0DA 2WJVA 4NMXB 3H3JA 3KZXA 3NYWA 4BJ6A 3ABSB 3BZUA 2ZI4A 3A6DA 3DO8A 4LJ8A 2OESA 5DNWA 3SQNA 3OQVA 2V7BA 1ZD8A 3W5BA 3DXZA 2JFGA 5LKAA 3SJ7A 1PR5A 3FYHA 5JWRA 4D8TA 2QP3A 3FB1A 4TKUB 1JXOA 1DFGA 4I8DA 4EEIA 4HOYA 2A33A 2Y4NA 2C82A 3B3JA 1MR3F 1XAIA 2GPSA 3E1GA 4TMVA 5CB6A 2X1LA 3OP4A 2Y9MB 1YMQA 1D5WA 2IY9A 2VSFA 3WS7A 1R9NA 3TD2A 3L79A 4ER5A 5L3ZA 3WIBA 1KS9A 2ONYA 4QFCA 4ZARA 3WL5A 3ORYA 4EHIA 1MJFA 2IHVA 5DI9A 2QSJA 4EYGA 3EIFA 2Q1WA 2VDJA 4IS2A 4ZC8A 1XYVA 3I62A 3PEUA 2R1TB 3KOYA 3Q9UA 2QQ5A 2C8LA 2QG6A 4ISBA 2RG1A 3COZA 4FOOA 2UZAA 3EDQA 4DV5B 5JCJD 2R84A 3PUJA 1C80A 5KIAA 4X7BA 5C37A 2L42A 2ZTVA 3GVHA 3T7IA 3DEYX 4ALLA 2B94A 4B4OA 1SXJA 4DEXA 3K35A 3VR2A 3WWDA 5LP6A 3Q0IA 3THRA 4M1WA 1E1KA 7ADHA 5AESA 1LFDB 4RADA 1UWLA 3FPAA 4HC4A 4M98A 2RBKA 2C3UA 1Z4MA 1T5BA 4QDUA 2OCXA 1L5LA 3ZWMA 3V32A 3ABOB 3GYBA 3KDPA 2I4MA 3WNVA 2E9SA 2EF0A 3AW8A 3L8YA 3L77A 2G8LA 3TLAA 1L9KA 2PIDA 4TV8F 2CFTA 3ESQA 3PT9A 4JODA 3S1AB 3W9YA 1LDEA 1OWMA 2H4FA 1Y7TA 2JFOA 3M49A 4FZJA 4LNHA 3MSXA 1N6RA 3CB4A 2GD2A 3IT2A 3WG9A 3OIGA 2PUGA 2RBGA 2VWPA 3HXPA 3I9JA 1HY0A 5AVKA 5J1TB 2YINC 4V0LA 3DLCA 3QPVA 3RH0A 2AX3A 3BWDD 3WZ2A 4EHFA 5TEVA 1D9ZA 4U5XA 5C5DA 1ARZA 1VI5A 2QLLA 3D1VA 3PQDA 2BEUB 5HIIA 4MWZA 1TDJA 1JHVA 1R0KA 1ZK4A 2PJZA 3CZAA 3CUTA 5MN5A 1O57A 3TEJA 5JAHA 1USWA 4R1TA 1H2RS 3PITA 5HKLA 3IPRA 4MIEA 3KRTA 4FGSA 1XQ1A 1QC5B 1KDZA 4EO4A 4Z4CA 4H7JA 2O48X 3NIFB 1DJQA 1TUIA 3WLKX 1QCYA 3G2PA 4OTZA 5JATA 1H9CA 3DKIA 4BDTA 5BVHB 4I9GA 4JOSA 3DNFA 3IBCA 3PXGA 1SVUA 4OBWA 2X13A 3S28A 4FHGA 4ENVA 1TEXA 3SBOA 4LTDA 2QAGB 1A9QA 4D6YA 4D97A 1U6IA 2MYUA 3EIOA 5JZ9A 4RTOA 5JZBA 3DFIA 1Q3HA 2AG0A 1NNUA 1XG5A 2F9FA 3TJMA 3OJWA 2IOQA 4JITA 3A04A 3OQIB 2EQ5A 2GO1A 2QN6A 3A9UA 3JAKB 5AVZA 4MMYB 3MAJA 4TWJA 2NVBA 5EZ6B 4AK9A 4W5JA 1ZGJA 3KLPX 3F4KA 4OP1A 1GPKA 3F6PA 5KJEA 3GRUA 5DBGA 3VJRA 2FPKA 2MU1A 4Q4HA 1N34B 4ZYUA 2ZI9A 1U9CA 3KJXA 2QRNA 3OIDA 3C3EA 2ACKA 3QBJA 4CZ2A 2PT9A 2WTAA 2XYRA 4Z1MD 5BP7A 3ZCPA 2RH4A 2QIPA 3FTNA 4J94A 2P40A 3WQBA 4LHSA 2W6CX 4K6OA 1Y37A 2Z6VA 4IRUB 4V02A 2X14A 5B55A 3IVMA 1M83A 4D0RA 2OGUA 3VDQA 3DVAB 2FKNA 3OIWA 1CW2B 2GZRA 4OXNA 4RHFA 3RBVA 3TIVA 3WB2A 3O1JC 1HE8B 4D9CA 1CUFA 2W2QA 3GD5A 2VYND 3GP3A 4MVJM 3N2EA 1WUKS 5JYCA 1LGYA 4XLZA 2JGRA 4YLGA 5HJ7A 1U2QA 2C84A 3C45A 3VHXB 4D02A 5KYYB 2I4TA 3PQFA 5JNSA 5D85A 4PNHA 2YS6A 3DUFB 3PPIA 1UT5A 1PEYA 4KQWA 4E13A 3RG8A 3WGHA 4FOPA 5JJCA 2G71A 4WZBB 3WRXC 2UU9B 4UAVA 4BVAA 3DOEA 4OB7A 1DDIA 4DYDA 1S89A 1DUSA 1OYVA 4WD3A 2BZ1A 3FGPA 4PFQA 421PA 4F45A 4F11A 1EFKA 1ZI8A 5AKIA 4CM3A 1BXGA 2IE8A 2WWFA 4AJJA 5F77A 2ZTSA 3EGVA 1NIJA 4OI2A 2GS9A 3WIVA 1BXKA 3A14A 2A9KA 3BB4A 3IQWA 4EQ6A 3A6FA 1PR6A 4PN3A 4R3NA 5ITZB 3U09A 4D8YA 2DBZA 1SXJE 3HTXA 4RKRA 2J8ZA 2EP8A 3FZEA 2FWBA 1F8UA 2C9YA 2R2GA 4OKIA 3EOZA 3DP9A 1Q1EA 2CKDA 4ALNA 2OFPA 3QE4A 3W9BA 5JW6A 1G20B 3MTQA 4P2BA 5AM1A 1UQTA 3C5WP 3LXRA 3DSRA 3RDPA 2BBWA 3M9XA 2H51A 4TLAA 4C0XA 1GKYA 1JG4A 3NHSA 3A3YA 2PZEA 3A36A 1D04A 2ODNA 2WF9A 3GLIA 3M0EA 1CSEE 1Z8HA 3SKYA 3DF9A 4NL4H 1P33A 3BGIA 4BVGA 2ZB8A 3T1VA 3KWFA 3DOCA 1YK1A 2I80A 4I5GA 1ISFA 3FFAA 3O90A 4HDRB 5GZ6A 2HPVA 1R8YA 1M3SA 2FPOA 3N8DA 4KQMA 4Q4JB 3F2VA 3RVRA 4LOKA 4YT4A 4Q4LA 4JLWA 1H66A 4P5DA 4X0EA 2QMQA 2ZSAA 2EV9A 2WKRA 4FYYA 4PPYA 4V0ME 5HK8A 3H3XA 3K0BA 1ZRNA 5LLDA 5F35A 1NAIA 5DN9A 2NU8B 2OGZA 2C7PA 2X0RA 4C0SA 4EUHA 1M2VA 1VZ3A 4ZJUA 3THXA 1FUQA 1V5FA 1CY2A 4MGKR 4BRSA 2WDPA 1N7GA 3EXEA 2ZUVA 2ECQA 2V8OA 4PC7A 5LZ2A 4RTMA 1KEWA 1QG0A 4XD7A 2HCJB 5HP4A 4K6MA 1FU7A 2DE0X 4W9NC 1ND5A 3E3OA 3N2LA 5I9NA 2PH7A 3KYBA 5FB3A 1OREA 2VVTA 3N0WA 3QMWA 4GMKA 4LGVA 1SBNE 2I5PO 1L4BA 1Y5NA 3EEYA 2C9ZA 3KJZA 5H0IA 3DTVA 2J9GA 5B37A 3EXIA 1E5QA 4KXYA 1X8JA 4UU0A 2O2GA 2BHLA 2XAUA 5K20A 1A69A 4XDYA 4TZ0A 1DJMA 3JQRA 3P4XA 1F4PA 2JIZA 4MYDA 4M6WA 3ECSA 2F3PA 3NQ41 4QXMA 3RWBA 1J22A 4O2LA 4WQMA 2X19A 1W5AA 5D6BA 2A4KA 1EYZA 2CVFA 2Q3FA 4PQFA 4BC0A 4J1TA 3DE4X 3NWEA 2Q1TA 4HEJA 4KE6A 3QLTA 4QXAA 3GGCA 5AJHA 4Y0NA 2HJWA 4ID3A 1PO7A 5E9JA 1POXA 2ZWOA 3Q15C 4G81A 1TYCA 5JWOA 3PHGA 1QIIA 1A8HA 2IPXA 2A5DA 3VC1A 1PR9A 4DIBA 3M6IA 1Z0SA 2JIQA 4F9TA 4F3RA 4MGIR 5IJ9B 4I55F 2Q8PA 1ILWA 1OXVA 1OE0A 1XDWA 2GEKA 1UDBA 2NTVA 3SLGA 3YASA 4ED9A 3AR7A 1WBBA 2PX4A 1XCMA 3LUPA 2IUFA 2D1TA 4FSHA 1WUTA 3RVJA 4JP1A 3L0DA 2J4CA 2LUOA 1U0TA 3ZIUA 5TVKA 1HT1E 3DMTC 5HQTA 3AERA 3W4JA 4YRNA 1GTL1 3SWWA 1A5AB 2HGZA 2J0SA 2J5RA 1KZYC 2V7TA 3O91A 2IX9A 4HAIA 4CQNA 3NYQA 1D6NA 1QYDA 3E70C 4QJ3A 4BKOA 3AU9A 2FPPB 2XH8A 4JL6A 4JKIA 1AHPA 3NC1C 1Q1ZA 2Y0EA 4N3GA 3A1NA 1WD5A 1EP3B 4BO4A 1DQYA 3MBOA 4CEJB 2BFEB 3QI7A 5EJMA 3TOZA 3HR8A 3VNSA 121PA 4K86A 3KE8A 3KELA 2QGZA 4L6AA 3CUSA 4HGZA 4HLNA 4JR1A 3A2KA 1D2MA 3G0HA 4K6FA 4NTZA 1CC1S 3EBPA 2ID7A 1GQQA 2PGIA 3EUEA 4CIDA 1SUFA 2J3LA 2VP5A 2PS9A 5CLHA 3AQIA 4DQ0A 1E6LA 1Z56C 1PR3A 2GF0A 5C8YA 4RENA 1Y4SA 1DOZA 3R3XA 4YP6A 3SJUA 1K6JA 1V16A 3TQQA 3IVGA 1SZDA 2QM8A 4Q4JA 1Z4OA 1FU4A 2IHKA 4XGKA 5FTMA 2P3QA 1PJCA 3I3OA 3N5CA 4RMIA 3ZBPA 4NX2A 3SBDA 2PANA 4EABA 4CCSA 3I9V1 1WP4A 1RYDA 4DJJA 1J20A 1QFMA 2CMDA 2P2GA 2QD3A 3S55A 1JFTA 4BUJA 1S8OA 4HQFA 1YB1A 4TUYB 4DUGD 1Y0BA 5C8XA 4N76A 3ES9A 4OX9Y 4IIJB 4UQOA 1XYYA 1PQPA 2E6UX 3FUCA 1KH3A 3M1LA 4MX8A 2HO4A 5AW5A 1G8PA 1P1HA 1QPGA 4ER0A 2HDNB 5CNKA 3DLTA 1L7BA 3N75A 2R4UA 5T4FA 1NFRA 2OYRA 2QRGA 1X3LA 3WLLA 5JWHA 4C1NA 1WSDA 4G09A 4F5DA 2R79A 4KHPB 1DIBA 3FOEC 4BX2A 2GWHA 4D9FA 3JVDA 3K9CA 4DHWA 4RZ2A 1T4MA 3WGUA 1XCJA 1ZJ6A 2FSVC 1AUXA 4LRYA 5H70A 1R10A 4PYJA 3T6KA 3V4PB 3KSUA 4I4LA 1I1QB 2JIPA 2I66A 2Z9CA 2OBMA 2QLBA 3UH0A 1LCIA 4E14A 5F4ZA 2HCRA 1E3EA 1QE3A 3N86A 1UMDB 3OEHA 5AW9A 1OSNA 4KR0A 2Q7DA 1OI3A 3ETNA 1Z4IA 1WS6A 2FFJA 1BH6A 1YR1A 2OXEA 3IUBA 1JKJA 1Q0RA 3A4YA 4NJEA 2P2NA 4QT0A 4DJEC 4TVSA 3KV3O 2I76A 3X1MA 5BMVB 5LQCA 4ZVKA 3EQZA 1SMKA 1H2FA 1Z8FA 2B9VA 1PTJA 1U3GA 1JQ3A 2XXBA 4R7ZA 3OCWA 1YFLA 2AKAB 1UDWA 1G8GA 3BRCA 3D4IA 1MGOA 3DVLA 4HVCA 2HLNA 2IBTA 1OJLA 3VQTA 4JQYA 2J3MA 1XEWX 3DEAA 4L57A 2QMUA 2O0LA 4OFWA 5FFFA 3TZQA 2E3JA 4C78A 4TWAA 4CMEA 4S0XA 3L4KA 4QHYA 1AJEA 1UJ2A 2GJ9A 2O3SA 3PI6A 3H2IA 2GT1A 4E88A 3CB2A 3M4YA 4YEDA 1AKVA 4C07A 4QLBA 4C2BA 1IBSA 1LFAA 2HA6A 3AC0A 3LX4A 1G3UA 1USVA 2PMFA 3OA2A 1JKFA 3PC6A 4M1KA 5FT9A 4EBBA 1MG0A 4XCXA 1MD9A 3B1JA 2ZRIA 3AERB 3UK1A 4BP9A 1T9HA 2K7FA 2OSBA 2H6EA 2QDKA 3SICE 2V7EA 4HGRA 4Q39A 3EH2A 4WA8A 4TKVA 3LMKA 5BMOA 1EAMA 2HF8A 3CZ5A 2DM6A 5DF1A 2NUPB 5AMXA 5LB4A 3KQNA 1W29A 5C3UA 4BNIA 1KK2A 1S9DA 1U0LA 4MKGA 4QWMA 2Q6TA 2ES4A 5K0NA 1FRZA 3R5KA 1I33A 4BJ3A 2HXGA 2IPAB 1EK0A 5MGBA 3UAYA 1Y3IA 1SG0A 2EKQA 1WMDA 1V5EA 3DZKA 3HA3A 4DLYA 4YV1A 1IG0A 4GT1A 4C0AC 3V8RA 1N9KA 2IBSA 5CVUA 3TNDA 4BMXA 4UEKA 4XVUA 4LDZA 5JRDS 2CHVA 3CEMA 5FHRA 4FGZA 4Y9TA 1OH5A 1TEVA 3HZOA 3FUWA 1DT5A 2RAUA 1HDEA 5K4GA 4DB2A 1JIUA 1PGNA 6LDHA 3PU6A 4R2JA 3W5JA 2X0JA 3F5SA 1WETA 2D06A 4CM4B 1DKUA 6REQB 3L1HA 3G8DA 3UPUA 4FP9A 1FLNA 1G8YA 4MP8A 4O8CA 3MGAA 2WF6A 4XYGA 1KQOA 1NXXA 1THZA 4UUQA 5A9TA 1R3DA 4EO9A 4Q3OA 4MGHA 4PIVA 3H18A 2RMKA 4KCGA 5AHOA 1Y4AE 3OIUA 3ETJA 3AVQA 4TRMA 3ANNA 3GA7A 4IQGA 2NU6B 1QDLB 1DNPA 3L5KA 3M3DA 3D8UA 3PE3A 2VK1A 3GGSA 2EGHA 3OPQA 4F8JA 4Q4CA 1XJ5A 3JARB 1YDFA 2MR6A 2A88A 2OT3B 2FMFA 2OPHA 3BUSA 3NVKI 2ZE8A 4LOIA 1SZPA 2ECKA 4LBVA 5E0OA 5TR9A 3P9YA 2WKSA 3E8MA 5CCEA 3T3GA 3KZMA 2OWEA 1XAGA 2C07A 4AMVA 3W2GA 2D5BA 4IOMA 1MNAA 5E9QA 2JBAA 2IYSA 1ZNWA 3OBBA 1YRLA 2XNCA 3SP1A 5EQJB 4KAFA 2DG2A 2GTIA 3AGQA 2EZ9A 4JSTA 2BC9A 3AUSA 4EHDA 1XQ9A 4YRIA 3GUCA 3FNFA 5BW8A 2P30A 4FC6A 2VDUE 2CFOA 4GHWA 1Y5LA 2ZU6A 3I32A 3BTVA 4Q3DA 2VBGA 3I9OA 3B2NA 1Z73A 5HXAA 1ZMXA 3E9NA 4RFLA 1Z74A 4MUJA 1GN9A 1RQGA 3TRHA 5JQGA 3SYNA 5F92A 5GMOA 5CAEA 2OG1A 2DWCA 2OAP1 4HTFB 1I8TA 1MZVA 3OT5A 4JSYA 4EHJA 2OHGA 3H42B 1QH9A 3FRJA 3KTOA 4IEEA 4NMWA 1U1IA 3TCNA 1XCOA 3OZBA 4I1VA 1RRVA 2XXJA 3KQQA 2C4UA 3G6KA 1U15A 2XXAA 5JZVA 3R4CA 4TQ9A 2OUKA 1DEHA 3JVIA 1KE1A 4JGBA 5HBRA 5H7XA 2ONKA 1J0BA 4LE1A 4ZCRA 3I0NA 2NN3C 1V7QA 2CJWB 4FEYA 4ER7A 3AI2A 1E6EA 1BCRB 4HN4B 4PYIA 4OI0A 2NYVA 4BLVA 1WZUA 4ZT3A 4JU9A 4F6RA 3QF4B 1WR8A 5AI5A 4RVDA 4GH5A 4KAAA 5HF8A 4E3WA 3QLUC 2V4MA 3GGPA 3AIKA 5DOZA 3VR3A 4AG5A 2RB4A 1BN6A 2XDYA 5FNVF 5H3HA 3H16A 2AFHE 4IZIA 1FBNA 3E3NA 1A9ZA 1EDZA 5TV2A 4RGYA 5E9WA 1U28A 2EF1A 2QP9X 2CNOA 2WFZA 4RPLA 5FPSA 5LQSA 1DIOB 1RMTA 3GEIA 4OG2A 5DW3A 3PNLA 4HFMA 3QJYA 1QS0B 2VI5A 2XOEA 3GO4A 3BEOA 1U7PA 3WK6A 1HOXA 2DPXA 2I0FA 2OCIA 2OD2A 2G8NA 3ONFA 4D4IA 5IYZA 3ZWOA 1YVPA 4XVQA 4HLUC 2GDZA 2HIHA 4KI0A 5KDOA 3KKZA 1YB4A 16PKA 3HL4A 3D7MA 5J4KA 1FC0A 4LRQA 2L2QA 4ER3A 5IARA 3TDMA 3DT6A 1BWRA 1A2KC 2PLWA 3QFSA 4BZPA 3I73A 3MRXA 2VHXA 1ZJWA 3H9CA 4Y6GB 3SDZA 5LXTA 3W1WA 2IXTA 3AEUB 4YMUA 1EINA 1GCOA 3NBXX 4L5AA 1BFUA 4YTEA 5DGXA 1VM6A 5KPDA 3LDUA 4EZIA 3P26A 5KVQA 3ADBA 3HDJA 2D28C 3OEEA 1O54A 3FDZA 3G82C 4AJ1A 4D96A 5IVKA 1Z6AA 5CB4F 2IP2A 1E1YA 4I66A 5D01A 3W5HA 2AQKA 2HDWA 4US2R 2WFMA 3IPCA 3U60B 5CA1A 1KP2A 3ETEA 5AM0A 4TTQA 3ZTYA 1KVUA 3RT1A 5L4LA 1VECA 3TNLA 1XZ8A 3E7PA 1A4RA 5ALGA 1SVLA 4M86A 3W2FA 3RUPA 1N25A 4ZU3A 3E4CA 4MEBA 4FSDA 3F4LA 2NIPA 4TWRA 3K4PA 3DTVB 4N12A 4O1HA 1XV5A 5DYNA 2CMHA 1YONA 5HBGA 2C1ZA 5H9WA 2VJBA 5HK9A 4S12A 3D1LA 4RXTA 5BQ3A 2QQEA 2YHBA 1SCUB 1NXVA 4MKZA 4U02A 3HVHA 2DUMA 3UKDA 1DKOA 1UBCA 4QEDA 3WFIA 4ZI2A 5JPDA 5JO0A 2PUTA 4HLDA 1L4NA 2ZE5A 3A1DA 5K8TA 1TLLA 1W88A 2EX0A 2J41A 2C4KA 2LD4A 3FTFA 2C3MA 3C98A 3R09A 4DNQA 3OESA 1U8YA 4BX0A 3KSBC 3ZC3A 2Y1LA 2WF5A 3SJCA 4HH0A 2WOJA 3FCOA 2YTZA 1ZM2A 3K5HA 3KKOA 3L0BA 2WAAA 4G1UC 4H6VA 2HBYA 4XCVA 2J6BA 3NI2A 4XR9A 4I1YA 3ZH2A 4ZZ1A 1JYEA 3G88A 3JSXA 2VPIA 3ZDFA 1BA2A 2A9QA 5IBCA 2QX9A 4F9EA 1IE3A 1ZM4A 3FH0A 1AC5A 2CNKA 4LX8A 4RTQA 3PPYA 3ZVKA 4I3GA 2IXEA 1TJYA 3JYOA 5DTRA 3T8YA 4I14A 4I8XA 5IAGA 3ZJ4A 4UPEA 2GNPA 3NWBA 4ZAZA 2CJWA 2W37A 3KB2A 1E2KA 1ZISA 2O7QA 3TGWA 4JIGA 3R7WA 4MVJG 4DA0A 1I80A 2XYVA 1N92A 4XJSA 3C8UA 4FSXA 3LLCA 3RAEC 2BGIA 4F6RB 3L1UA 2ZSUA 3TDKA 2C2OA 3UC5A 2BFCB 3ENQA 3QBEA 2XGGA 2VTBB 1WMFA 2FGJA 3QPDA 3AHHA 3I04A 5D5PA 3F8TA 4BUZA 1AUQA 2XCIA 4K03A 4JQZA 1P77A 1YCFA 2XUAA 1XD9A 1PNOA 3LD9A 5IAEA 1JPVA 2EW8A 4R1PA 1S1CA 1Z4QA 4JXKA 5CJ2A 3NIBA 1JAZA 1IN7A 1QXSA 2XMQA 4PRKA 4NAHA 9GPBA 5M7EA 2OHOA 2I1WA 5MFZA 2YJGA 2ZYTX 4Q18A 1FUIA 3EVDA 4D4LA 2NZXA 4I6GA 1W2HA 5DNEA 1XROA 1KI2A 1VLQA 4NNJA 2IHJA 5K05A 4MIOA 5F9FA 2PBRA 5EXSA 3UXEA 4D8XA 1K0FA 2JVJA 3EVGA 3M6XA 4Q7JB 3BDVA 4LWQA 2FOIA 1VMIA 4BWVA 4MVJP 4EKIA 2QJTA 2QRZA 1JFRA 1RWBA 1JEOA 4BU0A 1ZBQA 2W4IA 1A7UA 1GLVA 4HUTA 1B0PA 3GXBA 2I7CA 3KXIA 3FMIA 3X1ZA 1N32B 4DN6A 4U9UA 3SNHA 1MDFA 3RM3A 4ZV4A 1B76A 1QQ6A 3UHPA 4E7PA 1TCAA 2GVDC 3G0OA 3TPZA 1V39A 4WXHA 4CRWB 2GETA 2VS1A 4FN4A 5A5EA 1FS6A 5M2QA 3HXOA 2FZVA 4KK4A 1IY9A 4Y3UA 3UOAB 2W43A 4N0EA 1IEXA 3EXHC 3T3OA 3U1BA 3JASA 2HYDA 1O58A 3SEAA 1BH2A 1O95C 3RGGA 3CX6A 4I81A 2CWWA 4ETMA 1MRSA 4MW1A 3GZHA 3KIPA 4RF3A 4JI4B 4ZVTA 1O9HA 4B6QA 1DGQA 3MUFA 1P45A 1MFZA 2H5IA 2QLTA 3W5SA 4NP6A 1BD3A 2FG7C 5J2TA 2J3JA 1NW9B 1LBQA 4QAJA 2F43B 1ODJA 4U1RA 2F00A 1OF1A 3JV7A 4G1FA 1Q74A 1U8FO 4ZT7A 1HYHA 2J7PD 4B17A 4JYAB 4AI6A 3JPWA 1VKNA 5C80A 3A4TA 4ZOEA 4BO7A 5BUCA 1W88B 3WJAA 1EA7A 4V0KA 3KTDA 2HA3A 3EIUA 4C5BA 3OCVA 1AHHA 1C9NA 1WXFA 4S2EA 1JEYA 1FIUA 1U0JA 2PQMA 3KUCA 1QVRA 1VHWA 3WDMA 3WL3A 4F5YA 2IDZA 3A25A 4A16A 4P84A 4RIHA 1P7VA 1YR9A 1Q0PA 1P44A 2E4ZA 3QKWA 4Y9UA 5FPTA 1SM4A 3WWOA 4F84A 3ZY2A 1H2AS 5K9ZA 5EIXA 1B3BA 1GAWA 1JQ5A 5GAJA 1YKSA 3CW2A 3ZY5A 3MJEA 4DTIA 4LZPA 5F7JA 5HFNA 2BTOA 3HABA 4A0RA 1Z83A 1R4MA 1XJWA 1M2KA 4EARA 1QHXA 3FFBA 5FYQA 1QKKA 1NC3A 3RRJA 2Q28A 3SCZA 4EM6A 5B58C 1GZVA 4FLEA 2AN5A 2VDRB 4B74A 1OZHA 4Q3EA 2QGAB 1NN5A 4CG0A 1FFGA 1BDBA 1OTYA 4DDMA 5GVRA 2WJWA 2XZDA 4CGZA 4FFBA 1FBTA 2QI9F 1ENYA 4NI5A 3MLEA 1K6MA 4XLLA 4YXWD 1N9ZA 2AZXA 1LVGA 2G67A 2O0MA 4NR0A 3R8XA 1EFAA 4P31A 2Y99A 5CD9A 1QV7A 5AJXA 3I30X 4ZZ0A 4YQFA 4XM1A 4RDCA 1Q5NA 1P60A 2JS7A 3ENNA 3BULA 1P7PA 6GPBA 1JQDA 2GPTA 3BJZA 3CT4A 4GL4A 4BMOB 3CPEA 4IIHA 4FKZA 4OH1A 4R6XA 4CG2A 2G76A 2QJOA 1E9FA 3BE6A 2WT4A 2QQFA 3DBRB 2UYYA 4H6WA 1O97D 2CFIA 1MVOA 1P61B 2J85A 3EY4A 5AOVA 1AUOA 1GPWB 2XCQA 2Z6AA 1DXHA 4EVIA 2WJGA 3QBTA 3D7RA 4ZTUB 1N8TA 1GIAA 5FOXA 4FX2A 4R8MA 3ZTTA 2O8EA 1I3OA 3V55A 4GGOA 3WGYA 4HH1A 1X19A 5ALNA 4AW9A 1UBSB 4KH1A 2C5BA 1TRHA 3IAS6 3R8FA 1XMJA 1Y8QA 3P5BA 2J67A 3IX7A 1WF3A 1H23A 1VIDA 2XADA 4UTRA 2WE8A 2NSDA 4CTNA 3TRDA 5BRJA 5BR8B 3DOUA 5TRTA 1XMSA 1CS0B 5C4IA 1D4ZA 3JQGB 2BFBB 4YJFB 3TLKA 1FFEA 1KU0A 5BWMA 2CXSA 3KOMA 2QYOA 1NIPA 2PVSA 2IXDA 1ADCA 3KUUA 4ZDIA 2OHHA 4O5AA 5KQRA 2HCTA 4RY8A 4B32A 4CM8A 3OCJA 1G2QA 1L7DA 1HL7A 4JB3A 1FJHA 5BOSA 3KETA 1SXIA 3OO1A 1L4KA 5BV0A 4QPCA 2O8NA 3VR5A 1Y6ZA 2BL4A 3HC7A 4P6VF 1S1MA 2JZCA 3CEJA 3QFCA 5IN5A 4KEAA 1SCBA 3JASB 5CM8B 4OKNA 1ORTA 4Y18A 4J4HA 2HEIA 4MX2A 2A30A 2B4AA 2OQIA 4NZPA 4PNPA 4DZTA 3DV0B 3U7EB 2I91A 4RA9B 1S2MA 2WTXA 3QVGA 1JVNA 1HRDA 2RAPA 3V4OA 4B79A 4BQIA 5J2TB 3NEAA 4EKYA 4N3CA 3GFQA 3M4JA 1Z0KA 3IQDB 5BR4A 3N07A 3MBIA 3OZWA 5A0VA 5BSHA 3CZ9A 2FPMA 1TCBA 3FMVA 2DCMA 3ZWNA 2YRXA 1SXJC 3GT4A 3PQ2A 5LP6C 3QE2A 4Y67A 3SQLA 4ARAA 2HY7A 1IN1A 2JF0A 4RVOA 5D7BA 4B6PA 3EVAA 4I4NA 3WTBA 1N57A 1RAIA 1ZVMA 2XJ4A 4K88A 2IZ1A 4QYTA 4RVHA 4DAOA 1U0NA 3CUUA 3ZS8A 4A8HA 5CAEB 3VSCA 5CDHA 1K4KA 2WU4A 3CX3A 3HBLA 1PL7A 3OA0A 1VJ0A 4N8SA 4R9SA 3K8QA 3DBHB 2BSQA 2DY1A 5MFPA 3BXFA 1KHHA 4ZEWA 2VYFA 3N7UA 3P32A 1BRMA 1XFDA 4JI1B 3G49A 4IX1A 3NBFA 3RJTA 2PUHA 3H0CA 5DCWA 1ZSVA 5JJIA 3Q4GA 4LRSB 1MIOB 2XNKA 4XM2A 1SKYE 4RY9A 3RNOA 4MLZA 5EZQA 1GAEO 2AVNA 3FSJX 4ETIA 1DAGA 1P5JA 5BWOA 1Y82A 1K3UB 3HNPA 3VSEA 5AXBA 1XNQB 2NT4A 2CXRA 1K06A 2GK4A 3HXMA 2FUEA 1VBNA 3LY9A 5JJKA 4XVHA 1CUBA 2F67A 4JY7A 2FSPA 2W2VA 5EJ9A 4K8RB 3CVVA 1FP7A 1BHSA 1U90A 3LHDA 5ALRA 3A1UA 1JEQB 1XTUA 4L9SA 4JB8A 5BSFA 5JSQA 4IKEA 3PEYA 1KH1A 4HB2A 4FCWA 1H8HD 3HB9A 4DIOA 4G23A 2JGIA 5KAMA 3MJFA 3RSQA 3TINA 3VYVA 5CLGA 1NQTA 1H4VB 1PQ4A 4E12A 5DWVA 5CRIA 2WHEA 2G5PA 3COSA 3Q7IA 3IYLW 3AILA 3T1OA 4L75A 3L4JA 1O95A 2I33A 2OGTA 1DV2A 4N65A 1AGPA 5TPZA 3HU2A 1SHZA 3NVMB 2Z5FA 5ITWA 2XCSB 2YXDA 1C50A 1AGXA 4B6OA 5SZKB 3Q6IA 1R12A 4U00A 4L6CA 4ZODA 2C2KA 2HWXA 2JIMA 1J2RA 2WMDA 4KFSA 3UG7A 1XYGA 3B85A 3WLSA 3EMKA 4RVNA 4GLJA 1P7CA 4NLLA 4WEQA 3W3AD 1CFJA 1HG1A 2VHZA 2VXOA 1IUKA 1U2PA 3WYFA 4A0HA 4F2DA 1AQJA 4UM9D 3V00A 1B4DA 1T5DX 1AQNA 1Z7YA 2SKCA 4ZYXA 2JEZA 3HEAA 1VJ5A 4ZT2A 1JDUA 5DTMA 4I99A 1L5HA 8ADHA 1X77A 3ZS9A 2WUVA 2HIGA 4KSCA 3DFKA 4TYYA 4TGLA 1G98A 8OHMA 1L0BA 3IDZA 3SC2A 4R7GA 3GCDA 2L18A 3D4NA 1FDRA 1QC5A 1RZUA 3W5VA 1I0LA 1V8OA 1L5YA 5FTWA 4XPZA 1DXQA 4JOBA 1GITA 1ZP6A 3DMRA 4N0DA 3TN7A 4KXQA 5KOHA 1VIVA 3IE1A 5JAIA 1KO8A 1CK4A 3DONA 4QL3A 3U17A 5EFOA 2OGSA 3HB1A 4WK2B 5DM2A 5LOVF 1KOLA 3AHDA 1L5WA 4DV4B 1YOVB 1U16A 5FUVA 1EFPB 4AWAA 3RQSA 5I7EA 1SGWA 2WSIA 2GD1O 1CB7A 4DGSA 4HT3B 3I61A 2J9RA 5DMHA 3HCAA 3ZZUA 4XPIB 1FFXA 1Y1PA 2ZSIA 1NQ5A 3DHWC 4LF4B 4FZ3A 4CR7A 4GOND 2I3AA 3CH7A 2JCBA 2ZRAA 3HO6A 1FVFA 3OQIA 2C0PA 3PNPA 1D2EA 1T1SA 1XRPA 3FNRA 1YJQA 3B53X 3D59A 1W4CA 3JAKA 4J1TC 4R1LA 4TQUS 1QQAA 3QKRB 3HBMA 5K0EA 1T2CA 1U1GA 3IHLA 3HLYA 3E9ZA 3D3JA 4CI0B 3NMUF 4FS8A 1E2DA 1CCWA 5AOBA 5A5VA 1GZ4A 3PQEA 1Z5WA 3WZMA 2ZPUA 3P5SA 3VPFA 4GKJB 5I4KA 4A2PA 2B98A 3ELUA 2BUBA 1T3GA 1TKBA 2G1JA 5EKTA 4P7JA 3U3DA 1FF9A 1Q5PA 2O3UA 1EJ6A 1UFQA 4QC2A 3E9YA 2HNKA 1NVVQ 1ZO8A 4YP1A 1D4OA 5CPBA 2OBYA 3DDNA 5ENDA 4YMHA 1NPYA 2HMYB 1YZFA 2ZQZA 2DXIA 2P9YA 1E1RD 1XA3A 2BKVA 2I67A 2OMEA 1MA0A 2Y67A 1R8QA 3HS3A 4G4JA 5D3KA 3UV7A 1ESNA 4DNFA 3HB0A 4Y9DA 3IEXA 2IYVA 1M1YE 2AYYA 2XCOA 2R8XA 4K5QA 1T6BY 2B92A 4P3OA 2PWYA 2XMPA 1JSCA 1ZBDA 3U7IA 2K4MA 2JJ1D 3OMWA 1B2RA 4GPZA 1CFZA 2D8MA 1V6SA 5CLFA 3Q11A 4K1LA 1Z26A 3O8NA 4CDMA 4BL5A 3OLCX 1JZTA 1TZBA 3N2GA 3Q1LA 2XF2A 3K0KA 4IJKA 3RIYA 4I9HA 1N2CA 3WIUA 1RDFA 1C81A 3ZZ0A 1SC3A 5KC8A 2J7PA 3K9NA 4B8YA 4NHOA 3PF8A 1OBCA 2CXTA 1E2MA 4DF3A 1HURA 3SYKA 1COWA 4HWOA 3VU9A 2P2LA 1NURA 1I5RA 1RAAA 4HMQA 2IE0A 2H00A 2YBEA 1SCJA 4KQHA 5A0FA 3GLHA 1H2EA 1QCZA 3V80A 4G0WA 4QSMA 2XCUA 4CMIB 3VKHA 3SF0A 4KO1S 1T25A 1IU9A 1U3CA 2UVQA 1NWCA 1XMXA 2QB5A 2PE5A 3TBFA 1DOAA 1U04A 1G2IA 4MUIA 4FYHA 2IS6A 1TA0A 3I05A 2O6HA 2D00A 2UUOA 1TRKA 2FQXA 2X9GA 1PBTA 3DT9A 4DEYA 3I2KA 2P77A 3KQYA 4WECA 2VZLA 3ENZA 3FPHA 1M6HA 1HLDA 4FW8A 4P3XA 3SHTA 1ADGA 1KVQA 4R8LA 4PAOA 2FZCA 1WW2A 2XOKA 1ZN2A 4REOA 4H9GA 3WGLA 3ZY4A 4AYTA 1QRSA 1C7FA 2A1UB 1JI0A 2LDXA 2ZBRA 2VF8A 3MRSA 1V1JA 5EP2A 4BFWA 2WSYB 3ZE9A 1SUAA 2VBIA 2KHZA 2DWQA 3Q6MA 4XVRA 4DA8A 2YIJA 1GGFA 3CEHA 1KTIA 2GRAA 2YW2A 5DM1A 4BCCA 2NU9B 3MWLA 3REFA 3RRBA 4YRFA 1SUEA 5D51S 1R9JA 4BBJA 2DZDA 4PW0A 3TZBA 2N46A 2GLUA 3EOBI 4MA4A 4AIIA 5HX7A 4DPMA 4J03A 4EWLA 4I5DA 1P4JA 1X1EA 3L3BA 4FNMA 1HDOA 1OVMA 3EUFA 5CTAA 4ZJPA 2ORIA 3ESBA 3I76A 1UOPA 3LLSA 3D7NA 1ONSA 3P9ZA 3QM1A 1IZ9A 4IVPA 4BX9A 3L7IA 4FWBA 4GMDA 4GPAA 3ZR4B 4B4WA 5BXQC 5LWQA 1S8FA 1W85A 2W93A 2FOXA 1ZW6A 2AOXA 2ZVQX 3FX2A 3MLAA 4ZPXA 3T41A 1LJUA 2IWRA 2E37A 3WLRA 4D42A 1G55A 4UVIA 3Q3GE 2ANBA 1KMMA 2WHPA 1KSHA 3P27A 2FN3A 3O84A 4GPD1 3HVKA 1ZD9A 3QTLA 4I9UA 4M8NE 4WUTA 1QNFA 4IUYA 4TM7A 4L9AA 4WKPA 4X3CA 4M6WB 1JHAA 3W6NA 3P0FA 4NXNB 3I52A 3DCJA 3OX3A 4S2UA 1GVHA 5F9MA 5DGIA 1ADYA 1KEVA 1U4NA 4J90A 1EK1A 1SQFA 4ZREA 3U0BA 3WADA 4BP3A 3BMXA 4FHFA 3N70A 5ALDA 3FGNA 2XUIA 3P0RA 5G3YA 3SFZA 5JH7F 3FZNA 1G20E 2C8VA 2W6JD 3BERA 3K31A 3CMMA 5LDGA 3ZBQA 3W4KA 3JQPA 3MJRA 2BMJA 2Z8ZA 3LUAA 2H4XA 4E1VA 4MTCA 4C0WA 5IJ9A 1N1GA 3HJAA 3NEPX 3CJRA 1IC6A 4OHCA 4N3NA 4ITRC 3RYIB 2W6MA 3TR6A 5FPKA 2CC2A 4BVLA 3CO5A 5A4IS 1Y7PA 3KJHA 1EPUA 1BW9A 4PONA 5CW2A 2WFLA 3PEEA 1GGNA 4OB8A 1AD2A 1HQYE 4W7HA 4XWOA 2FPUA 4AKGA 3UFXB 2FEKA 3RQIA 3VU9B 5HDQA 1FZQA 1Q1NA 4ZQCB 3AUJB 5AVXA 2PL5A 2DR3A 4I55B 2FMKA 2G3YA 2P3OA 3KX2A 3CLUC 1HYBA 4PX2A 1EM8B 1S7GA 5JAOA 5CNIA 1JA1A 4D6PA 3QUTA 3LSYA 1J2JA 2WW8A 2D0DA 4XQ9A 1JNXX 3AHGA 3CISA 4CT0A 4TSRA 3GRAA 1SBYA 4RD3A 1NMEA 2HU7A 3AH8A 4EKGA 2A57A 1YC5A 1DRVA 4MYSA 4ZOAA 3H2KA 1G21E 3FLEA 4CM8B 4BLTA 3C6YA 1M8PA 1X2EA 2EJUA 3IS3A 5DP1A 3W6PA 3WGOA 5KI6A 4D3FA 2DERA 5TMPA 2CVHA 4OAQA 2DPYA 4DBVO 1SKBA 2FPWA 1RKBA 3ULKA 5ADWA 1QF7A 4DADA 3HKBB 2QU7A 4EF4A 4GP9A 2Z43A 4CTJA 3WISA 5J5AA 2I6SA 3ML1A 3CR8A 5CR9A 4XQEA 4DLKA 1HDZA 3KBBA 1UPFA 3CXUA 2HV8A 4ARCA 1RS0A 1Q2UA 2AJLI 2EKZA 3FBGA 3ITKA 1N0WA 4Q3AA 1Z29A 3FDIA 5CM2Z 2NSJA 2YS7A 4E15A 1BC5A 1G4HA 3DPUA 2AMLA 3B8EA 4BNNA 2D2VA 1D2AA 3AJDA 3FZYA 4MVJF 6PFKA 2JKYA 3ZKWA 5DN6D 2O4UX 5BT8A 2ZWVA 4BMPB 1H0SA 2HJ9A 4LJLA 2QAGA 4LVNA 4HDOB 1OYOA 2HCBA 4HPWA 4JLKA 1RRCA 2OHIA 2YJ6A 3QW2A 4NSLA 3FHCB 2RHMA 5ALPA 4US1R 5IF9A 3SDBA 1KNXA 4DLRA 4ZXPA 1CZHA 4OHPA 4PY2A 1RWPA 2VDOB 1I32A 1PN3A 1RWXA 1KJ9A 3E3AA 4JENA 2NU7A 3S8MA 1I4WA 4Q4AB 3UQYS 2A5JA 4WESA 5EJ8A 3A7DA 3Q87B 1HTBA 2XE8A 5FH9A 3ZNNA 1JFLA 4JL5A 2ZT6A 2BM0A 3ND5A 3GN2A 1J70A 5C3MA 4GDFA 4R3WA 4B34A 2UVDA 4B2LA 3GT7A 3DMHA 1JHOA 2BI8A 1EWQA 1F8XA 2GZ1A 3NKVA 1FSPA 1DEOA 1V2GA 3ON5A 2XUKA 3IOYA 2R7MA 3IAHA 4NDZA 4CQJA 1H5UA 1BWPA 2R97A 1V3TA 3GIWA 3GUVA 4QGGA 4Y2UA 4ZAVA 3O4FA 4GLFA 3TX6A 1PJLA 4K05A 1C3OB 3UJBA 2I1LA 1AMOA 1LVHA 5TQ0B 5I7FA 1S2NA 4HMOA 4I1SA 5I45A 4KNWA 3MD0A 2GXUA 1XAHA 2FSGA 2PWZA 4M0FA 4BFSA 2W4MA 2WU1A 2ORED 3E22A 2I2FA 1XA4A 5HIMA 3HI6A 4MQ4A 1RKXA 2F1IA 3ZGZA 2D2FA 3BL8A 3U4MA 1L3CA 2WUGA 4MPPA 3O82A 4BBZA 3FZQA 2G5GX 1CS4C 1JDJA 2HIMA 4HYYA 3K9FC 2G17A 3D1JA 3G5LA 4X92A 3W79A 1Y3CE 1BW9B 3OF3A 3MILA 3KFXA 1XVVA 3TLXA 5SYMA 1QHHB 2F1RA 3AKCA 1UJNA 4RDHA 4ZXFA 1DEKA 1PFYA 4BEVA 1YAJA 3QEBZ 2W7TA 3GDGA 1DBIA 3OSUA 2IKSA 5IKPA 4IF6A 4WAUA 4FGJA 4DLTA 3DP7A 2BI4A 1N6PA 4ZT4A 4P4SB 5LUAA 3EHDA 1ECFA 2C9OA 2OBBA 4FYJA 5I7HA 4AMUA 1RXIA 2VXBA 1TTHA 4ZMSA 5K8JB 2ZZNA 1H6CA 3VYTB 1TKRA 4DC1A 3BH6A 2ZUDA 1ND6A 4KACA 4HVAA 1ORHA 2HF2A 3VZSA 4E2XA 1CX9B 1GUAA 3QVXA 3U80A 3WC4A 1COWD 3LS2A 2F3UA 4AKTA 4CLOA 5JCPA 2NYRA 1YZYA 4LK2A 2OPBA 4JC5A 4BJ5A 4EMUA 4L73A 1KKLA 4F7WA 3EEQA 3EJWA 3HKBA 3H8JA 1J33A 3JCZA 2V0CA 1JSWA 1AMNA 1HWYA 1XE3A 5HKKD 4LKRA 4IMRA 1YFEA 1T0IA 1T3HA 5KVVA 2RH8A 2EKBA 4IV5A 3HUEA 5MDHA 3D3WB 1AO3A 5D1NA 3KSZO 1P7YA 2NUTA 2QN7A 4PBRA 2JKZA 3K09A 2B9EA 1Y9DA 2MT9A 1U5AA 1RI4A 4KQJA 3P9XA 3VH3A 1G18A 4EA6A 3JVUA 1MOPA 2PK3A 1RPNA 4MVXA 4QPJC 4RHYA 1XEXA 3PFCA 1E4YA 3PSHA 4C3UA 5A4DA 3U6KA 2WR8A 2XSZA 2MHCA 4AMZA 1GPMA 3NS7A 3L46A 2QV0A 4MR9B 2R60A 5AUPB 1AKYA 2AUMA 4NNPA 2AMYA 4JS0A 4UTPA 1QTIA 1RP7A 2AZDA 5CXUA 1WMSA 1HQDA 2MYPA 2RHCA 4HWRA 4M89A 4QGHA 1P1BA 1GSIA 2NP7A 4CVNA 3I9NA 1C4WA 4H31A 2GN0A 3OZFA 2WILA 1NASA 2PCLA 4RSMA 5T8KA 3EXIB 1HTWA 1W4LA 1B8VA 1NN3A 4G5YA 4DSAA 1U2DC 2I2CA 2P9ZA 3ASVA 3BCSA 2PM8A 4H3VA 5T57A 1Z6XA 4J43A 1WW3A 1XL1A 4QUJA 1NUTA 3U9TA 1UXGA 5ECWA 2HDOA 5BWLA 1PZNA 3JZIA 4HNUA 1OC2A 4D4MA 2ORVA 4QXOA 2SCUB 2FMUA 4PO9A 4CU5A 4EKNB 3A4LA 2AN1A 3LJKA 3NAGA 4OXRA 2EFEB 4C4RA 3KSAC 3F7OA 4QQFA 4ESVA 1EFCA 2D54A 1GNQA 3GRCA 5TPWB 2V6FA 1ZEMA 2AFIB 4PAGA 5KHOC 4IINA 2AI3A 2FF7A 3EY9A 1T29A 2JD2A 1TGVA 1W87A 1O6CA 4JI2B 2VPYA 1LU9A 1Y34E 5C8DA 2ONJA 1AQUA 1T8WA 3IGFA 1JMKC 1NLYA 5LZ8A 2ZATA 1PWXA 4GX5A 4F3NA 2XXAB 1ICEA 1GRCA 3K9GA 3N2GB 2P5SA 2FSFA 4IH1A 1R74A 4ZYTA 2HF9A 4XIJA 4B8ZA 4WEOA 2B2CA 3FSRA 5E6SA 2D2XA 2WTUA 4S3MA 1C1YA 2HNBA 2Q3DA 5BV8A 3BWYA 3AHEA 3BHNA 4EYEA 1T6YA 4FYXA 1AUPA 2WD7A 4FHEA 4PV7A 2JFYA 3DM5A 4EQZA 4UOZA 1N6OA 3Q3EA 4TV9B 1RWVA 4RPHA 1V1RA 2AN9A 5CHYA 1NLMA 3W1VA 3EF0A 1APBA 4ZCLA 1MIHA 2J1LA 4PC1A 4HEHA 2DUUA 1SZJG 3OVMA 1PP4A 3ZHRA 3LWZA 1GNSA 3N2KA 2IYPA 2C2XA 2OV1A 2CCGA 3P9CA 3RJ9A 3HXQA 3Q88A 4B44A 1X87A 1XRSB 4MS1B 2G6BA 2GK3A 3DXXA 3I45A 5AH0A 1E2NA 4HATA 2WYUA 4U2FA 5U4QA 2NPFA 5JBQA 4HV4A 4J4BA 2P5YA 4H7EA 5K6TA 2MSNA 2Z2JA 4EW6A 1M7GA 2A5LA 1VKOA 3QIVA 1HDRA 4UD6A 3WWYA 4ZI7B 1RWWA 1A76A 5IWAB 3MMPA 3P4UA 4KFRA 5EIAA 5FLEX 1GRRA 2QTVA 4FHCA 2IHYA 3LT1A 5DFAA 1XP8A 4BN0A 4NONA 4C4ZA 3QXXA 2BFAA 3C3PA 3LUDA 3OZRA 2QGNA 4F2HA 4WK0B 1JQBA 1U2GA 5D2CA 1RC1A 5HJ5A 1H22A 3JRWA 2CJXA 5IVHA 4HYQA 1T3TA 5M34A 4HB4A 1JQLB 1QGYA 5D1HA 3GAMA 3C1TA 2B4KA 3PIRA 4HNRA 5ECGC 5JE8A 3T9DA 3W9UA 3W2TA 5KYXA 5KX5A 1R0WA 1XEXB 1DLIA 1AKUA 2P5TB 4O0MA 4TUYA 6NULA 3KNZA 2RIPA 4H35A 4MRRA 1C9YA 4KGVA 4LHWA 5DSXA 3BL6A 2JAUA 4FTWA 1GFWA 1IAQA 1KJQA 5FUXA 2C5HA 2FE4A 1ZIYA 4DBLE 1ES9A 2L0XA 1BFKA 3BTUA 3GBVA 3IIEA 4O4LA 5L4SA 3TFOA 1LPOA 3SIPA 2PD3A 6Q21A 2I8CA 1U0FA 3OCFA 1FRFS 1WVMA 2FR0A 5EZYA 3KB8A 4IWNA 1HE5A 1L1FA 3FCYA 3D5EA 3KUXA 2CLEB 1OASA 4UNQA 3BKWA 5B1EA 2IUTA 1EP2B 1KY5A 2Y8EA 3TZLA 4RQAA 2ZRLA 2G9UA 5AXDA 1DAPA 2YQ5A 4K9OA 3MFYA 4AY2A 2Y1FA 4TVKA 1RI3A 2WIJA 3K20A 1EFLA 3OM1A 4TTVA 3KJGA 1AVTA 3GZNA 4ENQA 5EIOA 1GQFA 2OUIA 1XL0A 1Q21A 1PYDA 1AKQA 2JH8A 1GILA 1MB3A 1NRXA 2ZT5A 2OB2A 1C7JA 4EAAA 3RSFA 1C14A 2HK7A 3IMFA 3T9BA 4UXIA 1K8YB 3JWIA 3QV2A 4IGFA 1JNYA 2PU7A 4NYJQ 1KYWA 2RAFA 2HSGA 1DQSA 4J8PA 4Z9XA 3W6ZA 3QU7A 1B15A 2X9NA 3N8NA 3M6FA 2GERA 2IODA 3FTDA 5AWFC 4CUJA 4GDMA 1L5SA 1H1DA 3F2IA 1YHNA 7MDHA 3B20A 2CNLA 5EMJA 1O0BA 1DSSG 2GRJA 2V0NA 5A6SB 2G9QA 2VHYA 3LQFA 5FOWA 4E03A 3DC2A 3R74A 2C57A 2A8YA 2XQVA 5C2JB 1XTKA 4P35A 1DCMA 3RKSA 1R0RE 1ZGBA 3AV3A 5DYTA 2BKXA 221PA 1RKQA 5FL7D 4CT5A 1Z82A 3QEOA 2UVPB 3JD3A 4BIMA 4FUQA 4TX1A 3BCRA 3LE8A 4NBVA 3L02A 1F9AA 3VR5H 4J76A 2ZWIA 2FUG1 2INGX 2VTBA 3UBTA 2DLCX 4V0NA 1UZNA 5B1HA 1DO0A 3NBYC 5SV2A 2V54A 3I01M 4FCCA 1T2VA 1V7CA 2XNHA 3O9MA 3QQPA 1UPTA 1GSOA 4L0DA 3L01A 2G1KA 3S8YA 1A88A 3H9EO 4J1SA 1U2DA 4S0ZA 5A9SB 1SVOA 4BZQA 5BY2A 4P0PB 3REOA 2C5AA 1Z0DA 3OC0A 5AUOB 4WN9B 2B6NA 2Z2KA 3QUAA 3R7AA 5AO9A 1UWKA 4B75A 4ZI7A 4XGRA 1VCHA 4NJMB 1E3TA 3FAKA 4YXFA 5KS2A 4RM2A 3H5AA 1XQYA 4XCQA 1URPA 1CG6A 2FPRA 3CPSA 2AK3A 2IY8A 3TZKA 4GRAA 1DKQA 1QYXA 1UFKA 1P6QA 2R1VA 3BWEA 3C5HA 4GRIA 1G7SA 3CV3A 2PR2A 3CONA 1K3TA 2EHDA 1IBRA 1WL8A 5KSOA 3WAGA 1PGOA 1G8KA 1ST3A 3NLLA 1P72A 4IX9A 1M0TA 2GNOA 1UC8A 3LX8A 5I3ZA 1Q1GA 3U4QA 3FFWA 4UM7A 2DQ4A 2PLRA 3WBKA 2DQZA 1GDDA 5BMVF 3R3JA 1J9GA 1IONA 1BCSB 4BB9A 5KYXB 1NBHA 4Y9SA 4MULA 3S1SA 1UMCA 4GYWA 5CDUA 1O7JA 3TRKA 3H5VA 1ZW1A 3LIPA 3F4SA 4WBNA 2O54A 4G1CA 3X1WA 3ZJYA 4GE0A 3TW0A 1K4MA 3KPVA 3WKBA 1OYYA 2VAWA 5LM3A 3EPPA 1W5EA 4U0JA 2YMMA 1YNSA 4BE4A 2F55A 3ZXUB 2UXCB 1EVEA 1ECCA 5AK5A 3TNYA 3VR6A 1D6JA 3TLBA 3KSDO 4KQXA 2WHRA 3IMGA 2QK4A 4IIDA 4BATA 3QVOA 3DMTA 1J3UA 2QUIA 3CGWA 2W42A 3I72A 1A04A 1L7EA 1TT5A 2J0VA 2QM3A 3OQBA 4NCHA 3TTWA 3NHYA 5IH7A 4ZKDA 1E0SA 1KDYA 3BILA 4JI8B 3C6KA 2Z6UA 1SD1A 4V39A 5EMMA 4H60A 3C2QA 3MTBA 4GZ6A 2HC9A 3WK4A 3H97A 3X0DA 3V1LA 5LA6F 3TMKA 4B4DA 3FDFA 2JLQA 2IF0A 3L06A 4RZUA 2WJAA 1JR2A 4Q7LA 4UBLA 3PUYA 3LSTA 4K9QA 4AP6A 1L7QA 4JKYA 5H83A 1TMOA 3ZVRA 3ADCA 1IPEA 3SC4A 3HXTA 2WJHA 2PH3A 4FPXA 1WQ3A 4KIJA 1MENA 2ZS9A 1VJDA 3O8DA 2ZE7A 3Q3JB 4HTFA 1UBKS 2JKVA 5HDBB 2IYNA 2WKWA 3IDAA 3LY8A 2GPBA 4MP6A 4KQ6A 2NV2B 1SJ9A 4HN2A 4NDAA 4YCLA 3ILHA 1IZYA 4GMXA 3RKRA 5EY5B 3PYMA 5H59A 3UGTA 2J08A 3RLFA 5K8LA 1VG0B 4RHEA 1M34A 4WBXC 5J2UB 1Z18A 4G26A 3SQMA 4JJ7A 1TZJA 1DIHA 4BVEA 1YDEA 4QPNA 3SXUA 3H7IA 3WDLA 1C5KA 4MI1A 2I2BA 5HE9A 4BAUA 2FV8A 3LUHA 1ML3A 2FR1A 2F3RA 1DZIA 3FPCA 3FJOA 3NIDB 3PC3A 3U1VA 3V8BA 5LMUB 4L28A 1O94D 4CMBA 3OP1A 2IY7A 5K4HA 2PMEA 2PS3A 2FHPA 2QQ0A 4U6NA 3E7FA 1K0UA 1QV6A 3ZD9A 3K2BA 2ODTX 1YJBA 3OZXA 3SZGA 2CYBA 5AKKA 4JR0A 1LRLA 1HLFA 3K94A 2SNIE 2V7UA 3ND6A 3OQHA 1GQRA 4F6LA 1TI7A 3GRFA 4H4DA 1ZKMA 1GZ6A 2PTHA 5JAPA 1QYWA 4UASA 1DBQA 1YZQA 2C2WA 4JT4A 5EP1A 3URMA 3I09A 4IFIA 3WMXA 3WLFA 3N9IA 3JD2A 2EP5A 4UBKA 4X6UA 5ENVA 2C8JA 3VYRB 4Y6OA 1EHYA 1QS0A 4BV3A 1DDGA 3U19A 1YE3A 3H1PA 4JROA 3QUQA 4WLEA 5ALWA 3KJFA 4W5TA 4R1SA 1EVKA 1C9MA 4YJKA 2BSXA 4MH0R 5FPHA 2LKDA 3DQZA 1EGQA 1ILEA 2V7VA 5I7UA 2DH6A 2BBSA 4OU5A 1FLDA 1TZMA 1TK3A 5JV5A 1M1ZA 1MRZA 2V7PA 1GKIA 4DQDA 2BI7A 3AFGA 3H9GA 2GN1A 3D3NA 3DEHA 5ILQA 2XT6A 3JZDA 7REQB 3U7GA 4E4YA 3FDZB 1WDKA 2CDBA 3GFPA 3AL3A 1M6WA 2VDWB 3BFKA 3H99A 1B8PA 4FJ1A 4QXRA 4B3DA 4DIDA 4N41A 1ZI6A 1R00A 3Q9SA 4UEJA 3INYA 3PEFA 1P2TA 3D2LA 5ALIA 5FOQA 3QENA 1Z6YA 1XDDA 4R2MA 4TT3A 3S2UA 5AM5A 1JKXA 4DW8A 4IDFA 3ADDA 3L9WA 2VDPB 2VJAA 3O93A 2PSEA 3OECA 4RVGA 2ASEA 2EHJA 5EE0A 5I7VA 4JFRA 5A7FA 2XNDD 5FUMA 5JFTA 3EIEA 2O50A 2PX8A 1IQ0A 4REQB 5BW6B 2GBPA 3QVGB 3G2QA 3F1KA 1YIAA 3QU4A 4HF7A 4CKCA 2LVBA 5I9BA 1OFTA 2Q5OA 5CBKA 4AZSA 2PAFA 1SCUA 1A96A 1I6MA 2H2DA 3MELA 2OAQ1 1P0FA 3MS4A 3OM9A 5DT9A 1VLMA 4RF5A 3L2OB 4WBSA 1P2SA 1SD2A 4IJWA 3G8YA 5CVCA 1QIKA 3K2IA 4GP6A 3AEKA 5HRAA 2AR7A 3B9BA 1JEJA 1RACA 1EGMB 1I51A 2F2TA 2ZKIA 5TPWA 2OA0A 3NCHA 3NT2A 3CLVA 1FK8A 3NT4A 1CJUC 4YLEA 5DMXA 3V4VB 3ZNPA 1BHQ1 4HJXA 4BN5A 4BBPA 4M7PA 2B7LA 1K66A 2I71A 5ISMA 1RMQA 1TZ2A 4E5NA 2DFKB 3IOEA 5BSEA 2QRKA 4OUKX 1FNBA 3D2AA 2QVLA 3IA7A 3BF8A 4WK4B 5BYJA 4HADA 4A91A 2EFDB 4ERXA 2XA2A 1ZHFA 2IW3A 3EGWA 1Q7GA 5KTRA 2XA9A 5T7BA 1BMFA 2X0NA 1P2DA 8MHTA 4OJNA 3LC7O 1FZTA 1GDHA 3KFLA 2Z1NA 2V74B 2VJPA 2YVLA 4N3AA 4CTOA 2E55A 1NSYA 4OQNA 5KDDA 1U94A 2AD5A 1L7VC 4IKPA 3EQ6A 2VYNA 3I6YA 1PW5A 5K0ZA 3RBZA 1JFFB 4FILA 4KOEC 2Z3WA 5E7JA 3DOIA 1MORA 2YC4C 2IOFK 1H2ZA 1F17A 3C85A 2R0QC 1GZSA 2P6UA 1LWOA 2DPMA 2NTNA 3PA6A 2D3TA 4BU1A 1HL3A 1PCXA 4QU9A 1V4NA 1XXLA 3F3KA 4EFDA 2PUEA 3AVUA 4FDMA 3CBQA 2XB4A 1ZPDA 4RPKA 5IVDA 1IDOA 4IGEA 5KNDH 1M5UA 5JSZB 5TQ0A 1NUQA 1QP8A 3EB9A 3KHKA 3SYLA 5AFSA 3WQQA 1H42A 1TPYA 3LLUA 5H81A 1K8ZB 1LQTA 1PJZA 3RK4A 4C7MA 1P1CA 4UREA 4Y2JA 3GLGA 1CETA 4WZ6A 3IBGA 1ADBA 2NV0A 3HL0A 4LRXA 5TEWA 4LHYA 1TCVA 1GZ7A 2NSLA 4G41A 1QO0A 1Y7HA 3A1VA 3EA5A 4YI5A 4HX9A 1OROA 3V7YA 4CT4B 1SVKA 3PIDA 2HA5A 3ASZA 7AT1A 5KNCD 4PQEA 1NT4A 2Q41A 3ONDA 5H3LA 1F0KA 1PZGA 2IZ0A 1HV8A 3TVTA 1FRNA 1IHUA 1NPTO 4GX0A 5KJ6A 3KR9A 5JS2A 4I5IA 1FFAA 4HNVA 2CVPA 3JYNA 4MS4B 1V4BA 4ME6A 4UNRA 4YRAA 4E6PA 2P9HA 2E4VA 4C0BA 4ZVSA 4CFSA 2RHOA 3BMQB 1RHJA 1YASA 3EWAA 3H1AA 2VDWA 9ATCA 4JP8A 4HMPA 3B6IA 1I3LA 4KLRA 4CL8A 5IZCA 5DZSA 4B0OA 2IHUA 4CF5A 3CVOA 3LOQA 3N5KA 4H7KA 1Z12A 2VQDA 4MR7B 3VV3A 5DPMA 2ZCVA 4TXHA 2R7AA 3UM9A 1E2GA 3ISTA 2OXRA 2PKRA 4CE6A 4C4AA 1AZWA 2VJMA 5H4HA 3BGVA 5AW4A 3RABA 4D81A 1RBQA 3I2YX 4EKEA 3MMXA 4AQ7A 4WDQA 5FTNA 4BNUA 3H2SA 4DWJA 3LX5A 3D6AA 3A9SA 4TS3A 1JHQA 1X1CA 4LSMA 5KWVA 1AZLA 4BFCA 4FHZA 2E6KA 3L8MA 5AQ1A 1E8NA 4I3FA 3EGXB 2GHIA 2RKWA 2D4HA 1C8BA 1F2TB 5B1DA 5E38A 3P2YA 5I4CA 4M4SA 4NS1A 4MEAA 4YI3A 5BYAA 3WNCA 2PUBA 4L5JA 4QFBA 4MO2A 5AJZA 5GOTA 2QLNA 1G9SA 3C7CB 3C7KA 1T1IA 1EUCA 3FAZA 2DFPA 3MS2A 5BUQA 5BWBA 1II0A 2AHRA 2YQZA 3MIZA 1QIMA 3M6WA 1HETA 4LVOA 3ZZNA 4Z8YA 4AMBA 4AG3A 2HWWA 1IHOA 3LRPA 2GH1A 5MN6A 3RTDA 4F06A 1G2PA 1C1XB 2PHZA 1OH6A 4WRRA 1WABA 5TMDA 1BX1A 3PDHA 3SS8A 4LY6A 4PSVA 1H6BA 4UQLA 3AUYA 1NL3A 4TTAA 4NK4A 4NZMA 2B2NA 4P80A 1U1FA 5IXSA 4J0KA 4MVYA 1O6GA 2NGRA 1TW2A 2C3OA 2ZRPA 1UIMA 3RVSA 5TMEA 5FWNA 1U2RA 2GDJA 3MYYA 4MV9A 4DILA 3H4IA 4DM3A 3L8GA 1LDNA 4KVGA 3I2HA 2J3HA 3AYZB 3KOOA 1U9IA 4RIGA 2Z98A 3S6JA 3ONVA 1TIBA 1JWLA 5AW1A 5EXDA 4DWWA 3STVA 1ID1A 3L1VA 3OCXA 3OT1B 4RSRA 1BWQA 4WACA 1A7JA 1I3MA 1O87A 2NO9A 1Y4ZA 1ONOA 3BDIA 3H5TA 4FFPA 4M99A 5T64A 3ZV5A 4DDKA 1YJCA 1GTSA 3RVBA 2HO5A 5HIJA 2XMRA 3DBRA 1Y89A 2X8JB 3OO0A 2X3FA 1G8HA 2RHGB 1GZHB 1I36A 1KYYA 2O0HA 2XQIA 3UEOA 3A1EA 3RYTC 4PVDA 4C6RA 4KIUA 4YCMA 2AB0A 3HJHA 1MF7A 2OK8A 1TIKA 1N7JA 2WWIA 4JC8A 5ERXA 1GR1A 4RACA 4ASUA 1Z37A 4KO2S 3DNPA 1P1IA 2C0QA 5EWMA 3GEGA 4XIYA 4CN9A 4G0YA 2O52A 1G5HA 2FK8A 3K1YA 3FPJA 1PJ4A 2ETXA 1WXIA 3ESRA 3QU9A 1G3QA 1UM8A 5LB2A 3ICEA 3PJRA 4M1MA 5MGNA 2BFBA 3PJDA 4YJFA 1ORWA 5F9HA 1TA4A 2C94A 4WL0A 4L7VA 1BCSA 4QQNA 3ROFA 3SM3A 1CUJA 4UPDA 1ZJ5A 5LOVB 4D99A 3QEMB 3HDQA 2DGDA 4Y2XA 1K7CA 1J90A 1TC1A 1UQUA 1MC5A 4B3TB 3JQ7A 4BC1A 5C81A 2QY9A 2XYPA 2IQ5A 2VF7A 3ZCQA 1YB5A 4XRRA 2CDCA 4RIFA 1KFJB 1SB9A 1EI9A 1CVLA 2MSEB 3QNUA 1NY6A 1E4VA 3NG1A 4A6PA 2OBLA 4Z3OA 3ZE7A 2FSHA 2BGTA 4B3HA 2DEUA 4ML3A 2TECE 5KJCA 2X6TA 4A26A 3CVYA 3JQ6A 4X65B 1JDZA 4M1ZA 1Q3KA 3F97A 4QOFA 4U3JA 4DCUA 3IEUA 1BQ4A 3REQA 5IF3A 2PFGA 4AUNA 3FWHA 3S4YA 1LNQA 5HIKA 3HA7A 5KKAA 5CYPA 3G3EA 3IR7A 4HQKA 3M6UA 1OB2A 1X7WA 5HR5A 1CR1A 4ZVRA 4ND5A 3MXTA 2BONA 2N3ZA 4KR6A 4HDKA 3TSYA 4ERNA 3M81A 1DBSA 4CFZA 3RYHA 3CRMA 4IRMA 3IA2A 3ZYCA 2GCPA 2AH5A 2JGKA 3Q6NA 5KYUB 1POWA 3D0RA 3V4RA 1E8MA 3KBOA 621PA 4C06A 1Z2AA 4N01A 2I2XB 1S2DA 3GVXA 3ELBA 2O8BA 3GDFA 2Q3HA 4D4GA 4D9BA 1PW7A 1SQGA 3QHQA 1L7MA 1Z5PA 2VNIA 3ZIAA 1VB3A 2DFVA 2O2ZA 3EZ6A 5AVOA 3Q1KA 1KMHB 2H2AA 1LS1A 3VR3D 1UK6A 3ZH9B 4A27A 1JVSA 3EUAA 4S1WA 1QZUA 4RO0A 2H1RA 4NAUA 5BSVA 3PKJA 1CY6A 4XB1A 5JZOA 4ISCA 1YIOA 2AOUB 2JB9A 3B8HA 3RAGA 1C29B 1E1CB 1T15A 2XUGA 3G0GA 2G4VA 4L6IA 4ENSA 1ENOA 1QVVA 3N59A 1A5SB 1IDN1 5LUBA 5JY1A 3DTVD 4UHCA 4WOCA 4DMKA 2QL7A 1DFIA 3TE6A 1LWNA 5JEEA 3OT1A 3VU3A 1ABEA 5LNK6 4JCOA 4PCAA 3WA7A 3MJTA 2FFBA 3T06B 4CF3A 1N2IA 3UN1A 4DXAA 4XVCA 2FVXA 3GNTA 3CWQA 3ETCA 3INGA 2X8JA 1VQ1A 4N3BA 4QBHA 3JXEA 5T41A 5F33A 4MUKA 2QD4A 3IUJA 2VUHB 3QU2A 5KMGA 1TC2A 3HB7A 4UZFA 3BAFA 5DKFA 5ALOA 2VC2B 3OT4A 1NW5A 3KR2A 3U5TA 3KQKA 1G6OA 3QTBA 1RTKA 2V3WA 3WA6A 2VDLB 5KUTA 2O1EA 1KA9H 5EWMB 4II7A 2WSSA 1LJ8A 3TKYA 3U61B 2O1WA 3NRJA 1QRDA 4UTOA 4A4DA 1FFSA 3OZUA 4BMCA 3QF7A 2FFAA 3OQJA 3CWCA 4ZI7F 3ND8A 3NATA 1UK7A 2HNAA 3M6MD 4L4YA 4L8FA 4C4SA 1K7EB 3HU5A 4IJ5A 3O1IC 3VR1A 3GGGA 3TFQA 3HR4A 1T9GS 4LV8B 3BE8A 4LYJA 4L2IB 3S2IA 2WZQA 4YDQA 1UMBA 3FLMA 3HRHA 3JWHA 4Y2RA 4YIKA 3M9WA 3QVKA 4AZ3B 3ILSA 4RA6A 2OE2A 4PYLA 1P4RA 1E3MA 1U0OC 5ITSA 3MQFA 2XRFA 1RLIA 1IY1A 2TRSB 4OKSA 1TM3E 1AX9A 1CVIA 1XD2B 3W05A 3AF6A 1GHTA 3IVCA 4L4XA 1K86A 2PQ2A 3L0OA 5K51A 1MQSA 3O75A 1RWQA 3PWZA 4PVCA 4E2WA 1YQUA 1Z0IA 3FYCA 2YXNA 5DEIA 1LV8A 1NW3A 1KEPA 1SN7A 3DXYA 3Q7RA 4MKRA 4Y2HA 1OC4A 3RUDA 4E94A 4JJIA 4NCBA 3BMNB 1UBLS 1DCKA 1IJFA 3R7BA 2OO3A 2ZJ4A 1EZ1A 4MRSA 4P7GA 4BBAA 5DOVA 3OZ7A 4BQEA 2QZSA 1MAHA 1YJXA 1ACMA 4O4JF 1LK7A 1EVJA 3FOFC 1R8XA 1DRUA 1SULA 1FMCA 4L74A 4DG8A 5ADUS 3NWJA 3S8EA 4DLAA 3PUZA 2B1IA 4KH0A 2D1RA 1R37A 4DIMA 3ZIDA 1HM5A 3AZPA 4L9WA 4EX7A 2IEYA 1QHIA 2RI1A 3K6KA 1DJLA 1JDBC 2NU7B 1IVNA 4NE7A 4PSCA 3W2IA 4HLQB 3ZE6A 1YL5A 3ZTWA 4CLDA 2ZJBA 3KYDA 3MWEA 4ND7A 4RE5A 4N47A 3QLVC 3BKXA 5FTLA 1R0SA 4HP8A 2R47A 5GQSA 2ZP1A 4I3HA 4KGZA 2OKCA 1K98A 3AHFA 5H5JA 1MAVA 1Y1KE 2ZR9A 5CD1A 1FDOA 3C7AA 3SYMA 4UTNA 1NBME 3A37A 4V03A 3EDMA 3BGOS 3UH1A 3TLZA 3NRCA 5CFZA 1SC6A 3OZGA 3DLAA 3K72B 4IFEA 4PFKA 1P31A 5AW3A 4AN4A 4W5RA 4G9EA 5HZGA 1JWAB 1FS4A 3I42A 3T1NA 3RHZA 3HCDA 1Y6QA 3TVYA 1E1CA 5MHTA 4F12A 5CLQA 5AI4A 5B1SA 1VE7A 1P2UA 4KIFA 4DRXB 1UBRS 4PZ9A 4HFNA 2NAPA 4UBNA 2RGGA 2NVUB 4BAZA 4ES6A 1CRWG 1L4EA 2JGAA 3FPLA 5BN5B 4FVTA 4OLHA 3BWBA 5KSPA 2CYAA 4KJXA 1RXUA 2B1RA 3IHWA 5SICE 4A8JA 1Z2OX 2UAGA 3F8SA 3H8VA 3OPYA 4OQPA 5FAXA 5JDCC 1SHTX 1PJTA 1H2WA 1HKHA 5F12A 1N2HA 1NATA 3N87A 5AW8A 1FTQA 3EDRA 5CB4A 1JBKA 2Z2ZA 3TMAA 1JAIA 1NVTA 2H92A 3QOYA 2RGNA 2WAXA 1ZVJA 2XWBF 1Y98A 2VCYA 3FW1A 5A3RA 5KDLA 4D43A 4BTEA 2HQ1A 1AQ6A 1GTVA 1KMNA 2R48A 1E64A 2ZR7A 3FF1A 1ZD3A 3BBLA 3HFGA 3L1IA 2XSZD 4LMPA 5EXTA 1E3JA 5EPOA 2AFVA 1QAMA 4OSOA 4RVCA 1PJ8A 4GQAA 4JLSA