1Z4IA

Structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with deoxyribouridine 5'-monophosphate
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 5'(3')-deoxyribonucleotidase
publication title Structural basis for substrate specificity of the human mitochondrial deoxyribonucleotidase
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1z4iA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4iA01
5ALYA 2O9JA 3U13A 1L8OA 4RETA 4Y2XA 1RQNA 2I33A 5AI9A 3AR5A 4HGQA 2I54A 2CFSA 4Y2JA 1RMQA 1ZD4A 4UMVA 5ALXA 1RDFA 1RLTA 2WM8A 3WGVA 3AR2A 5AW5A 4L6CA 1QQ5A 3AR8A 3SKXA 1S8OA 3M1YA 5AM0A 3OCYA 3J7TA 3W5AA 1WPGA 2ZBEA 4KYTA 5AKJA 3HLTA 4C4TA 3PCTA 4J2TA 2WHEA 1U2SA 1Z4OA 4IFTA 2HHLA 1RRCA 2HSZA 4CF5A 4NFLA 1SU4A 4FE3A 3WKCA 3ZTYA 2G08A 4XOUA 4L6AA 3QYPA 1ZRMA 1YMQA 2PKEA 2YJ6A 4XPZA 2FUCA 1RC8A 5ALUA 3VAYA 1NF2A 2QLTA 3N28A 4B6JA 4Y2TA 3RFUA 1O08A 1RLMA 3FPBA 5AICA 3B8EA 3NRJA 5ALMA 5AVUA 1Z4IA 5A3SA 5AM1A 3E8MA 4BEVA 3KZXA 4UATA 1ZJJA 2NYVA 1X42A 3SMVA 3WK6A 1N8NA 2EAUA 1ZD3A 3E58A 3HYCA 4Y2YA 4HGPA 5AW3A 2YN4A 1LVHA 5AVRA 5FP0A 3N8GA 5AIAA 4CF3A 1RQLA 1TA0A 2HOQA 4KN8A 3TLMA 1CQZA 2B0CA 4CNQA 2HDOA 5JJBA 1Z4JA 2ZOSA 1ZRNA 4UAVA 5AK5A 5ALSA 2Q4RA 4KNVA 2P9JA 4PNHA 4MUMA 5IT0A 1RKVA 2C8LA 5AW9A 5AW8A 4H1WA 3QGMA 2P11A 3SLRA 4Y3UA 4HAIA 2G0AA 3QX7A 2WF8A 3QLEA 2JGAA 3MMZA 4QJBA 4XE5A 1ZD5A 4BX0A 4O8CA 1Z5UA 3ZWKA 3L1VA 2W4MA 3FPSA 4OHFA 1N9KA 4EX7A 3IB6A 2YMQA 5AKZA 4HYTA 3I28A 3L7YA 3KDPA 4EX6A 4YH1A 4FFDA 1J8DA 2VKQA 2W11A 3OTQA 4UW9A 3QUQA 4YCLA 2YY6A 3KC2A 4YGYA 3L0YA 3L0BA 5IT4A 3ZX5A 2YFYA 3PGVA 5T41A 4BBJA 2OYCA 2WF7A 4Y2UA 5ALJA 3N1UA 2G06A 1WR8A 4JB3A 1K1EA 1L8LA 3AR7A 4UU0A 3WK5A 5AIBA 5AW7A 2JAOA 5ALRA 4HGRA 1Z4PX 3BWVA 1VJ5A 2JAUA 3QU7A 2Q4TA 3N5KA 3MPOA 5ALLA 3L8HA 4F72A 3QUBA 2GHTA 2AMYA 3A1EA 3DNPA 5ALPA 4BKMA 4UARA 5AVSA 1NNLA 5AK3A 2I34A 4E88A 1YJ5A 5AK4A 2B1QA 2WF6A 3AR9A 1VFPA 3EWIA 1L7MA 3UMBA 2GHQA 3I76A 4EEKA 2FUEA 4CF4A 3M9LA 2I6XA 3NASA 4OFZA 2RARA 3OCUA 5AKLA 2FI1A 2HX1A 3U26A 1YDFA 1TJ4A 2PQ0A 2QYHA 1L7OA 2CN1A 3SKYA 4IG4A 2YJ3A 4C4RA 3U7EB 3ZUPA 2FPXA 1SWWA 4I9GA 2G1AA 3R4CA 4L57A 1Z4KA 3IRUA 5AVWA 2IOHA 2G09A 3QUCA 2GMWA 2X4DA 2YBDA 3ZTWA 2FEAA 3CNHA 5ALIA 1T5SA 1SWVA 2JAWA 3UM9A 3WKAA 2NO5A 1S2OA 3QU2A 5AW1A 3RF6A 2YMLA 2DQSA 2HCFA 2ZBGA 3PGLA 5AM5A 5AVTA 3NUQA 3NIWA 1Y8AA 1FEZA 1ZOLA 4BNDB 5AW2A 1Q91A 3GYGA 3L5KA 5ALOA 4EENA 2W43A 2FPUA 1QQ7A 4G9BA 2YJ4A 2GFHA 4F71A 3K1ZA 5ALDA 1MH9A 4UU1A 5AKXA 3OCZA 2YMMA 4AS3A 5AI6A 4YCMA 3WGUA 2ZBFA 1L7NA 5AVZA 1Z4MA 2FDRA 5ALTA 1JUDA 4AP9A 1EK2A 5ALKA 3AR6A 3DDHA 2WF9A 3S6JA 1O03A 1LTQA 3ESQA 2O2XA 1U7PA 5ALZA 4Y2PA 1RKQA 4MWOA 4G63A 3R09A 3ONNA 1Q92A 2FPWA 1L7PA 1U7OA 3QU4A 1QH9A 5AW0A 1Z4LA 3ZX4A 3E81A 5A3RA 1TJ5A 1XVIA 1U02A 4NV0A 3WK4A 3ESRA 3L8GA 3FM9A 5ALHA 3QUTA 5AKGA 4XQ0A 2WF5A 3A1DA 4RESA 3ZVLA 4JDPA 1EK1A 4UMDA 4Y2SA 1WVIA 1F5SA 3EPRA 4BX3A 3L8FA 2P69A 2AUTA 1RMTA 1Z88A 5AM2A 2C4NA 3FVVA 2RBKA 3AR4A 2C88A 1PW5A 2IOFA 3MC1A 4QQFA 5AVQA 3IJ5A 3AR3A 3D6JA 4NWIA 3OCWA 3U7GA 3PDWA 2HI0A 4OCZA 2B82A 5AKKA 2BDUA 4EZEA 3L8EA 5AVVA 2R8ZA 4UMFA 3B9RA 4BYGA 2WFAA 5A3QA 5AK6A 1RMYA 3WKBA 3I1YA 3MN1A 3KOOA 1QYIA 4NABA 4GXTA 2C9MA 3UMGA 3OCXA 4CE6A 4GIBA 3ZW7A 5AESA 4DWOA 3U7HB 2BDEA 2Q5EA 3NANA 1TJ3A 4UM7A 1YV9A 3SHQA 1AQ6A 3R9KA 1J97A 2IYEA 2B30A 3QNMA 1Z4QA 5ALEA 3A3YA 4DFDA 2CFRA 3UMCA 2IOFK 2C8KA 3EF1A 2ODAA 4NAVA 1L6RA 2R8EA 3WK8A 2B1RA 2MU1A 3QXGA 2B8EA 4HGOA 5AI8A 2OM6A 2P27A 3F9RA 2HF2A 2BY4A 4ZEVA 2IA5A 4YIKA 4AS2A 2HO4A 2JARA 3CZ4A 3I6BA 4BNDA 4KX3A 2PR7A 5AKEA 3W5DA 4ZEXA 5IS2A 1RKUA 5ALGA 4EELA 3WK9A 5AKHA 4YCNA 2B8JA 3FZQA 3SF0A 3SD7A 1XP5A 3OPXA 3B9BA 3FGOA 3DAOA 1QQ6A 3ZI4A 3U7FB 2R8XA 3ZVMA 1TE2A 3DV9A 3N07A 3WKEA 3OCVA 3QU9A 4KNWA 3U19A 1YNSA 5AM4A 1WZCA 2ZXEA 3ET4A 5ALFA 2ZG6A 4OD0A 2I55A 3WK7A 2MSNA 2RAVA 4FYPA 2EARA 3L0CA 2YJ5A 1RLOA 4Y2VA 1NRWA 2YMPA 3W5CA 3NAMA 3ED5A 5AW6A 5AVYA 2HEGA 4BX2A 3BA6A 2AGVA 4HGNA 2I7DA 4Y2QA 1RPZA 1CR6A 3E84A 2OA0A 3WKDA 5AKIA 5ALVA 4ZEWA 5AI4A 5ALWA 2FPRA 2HF7A 4BEWA 1KYTA 4I9FA 4DCCA 5AW4A 2G07A 3KBBA 3ZU6A 5AVXA 1ZD2P 3KD3A 3QU5A 3L1UA 2RB5A 3A1CA 2CFTA 3ZVNA 2AH5A 2EATA 2GO7A 2ZBDA 4C4SA 3EF0A 4UASA 4J03A 5AI0A 1T9ZA 2D2VA 3P96A 5AHXA 4UAUA 3ET5A 1Z5GA 2G80A 4DW8A 5AI5A 3NALA 1VJRA 1U2TA 2OBBA 5E0OA 4Y2RA 1IWOA 1T5TA 4KX5A 3W5BA 5AM3A 1YS9A 2NO4A 3ZWDA 1XPJA 2FPSA 4UM5A 5AKYA 5ALQA 5ALNA 1ZS9A 4YIHA 1Z4NA 4UMEA 2R8YA
chains in the Genus database with same CATH superfamily
4G0YA 2PGDA 1KDVA 3AVUA 1M7HA 2GJ9A 2P2DA 3D3WB 4GI1A 4MWEA 4Y2XA 2C20A 3D4BA 1YFEA 4H4EA 1KVQA 2Z6QA 2JVJA 1R6UA 3CJRA 3IOCA 3OEHA 2OPHA 5DH9A 1OLXB 2Z9BA 3PF8A 2CF5A 3TIGA 4MI1A 2IPMA 4LF9B 3WQSB 2Q46A 1G98A 2EX0A 2IPAB 3CO5A 4UHEA 5CDUA 1EUCA 3CTMA 4X62B 1V41E 3IAFA 3S5JA 5KS2A 1BWQA 1L5HA 2H5LA 2YUIA 3QBVA 5IULC 2VBIA 3KZOA 1JMYA 1NHWA 4H7DA 3MEQA 1PUIA 4DLLA 1KDOA 3SKXA 1C8LA 3W8DA 1XHFA 3WOVA 2PS9A 2RAPA 1GUFA 2VT6A 4MV7A 2RJOA 5KDLA 1IC6A 2D8MA 2QRZA 3SK0A 2I1LA 1GPAA 1CZNA 2R87A 3FETA 3PFKA 5FUWA 1GTSA 1Q0ZA 1KVTA 5IUNC 3DCIA 5G02A 1D2MA 2HHLA 3Q40A 4WW0A 4RTQA 2GFQA 4UOZA 1GFWA 4JUDX 3HB5X 3GMDA 4UVDA 5DW0A 2RK6A 3MAGA 3SVTA 4EKIA 4L6AA 1RRPA 2DQ4A 2AJDA 1VZ3A 2FXIA 1D09A 3VNSA 4TVSA 4WKPA 2J4DA 1VBNA 2XTJA 1ZXBA 3QTBA 3THXB 4ZHQA 3JD2A 4QBFA 4X9XA 5BXQC 2Y1DA 4C1BA 3V8NA 3L0OA 4H7KA 1JBEA 2RC5A 2R8BA 2DFDA 2J41A 1K0FA 3OICA 5ERYA 2N1BA 4RHEA 2VYVD 1MTOA 5K4GA 3I5AA 1N5IA 1CZKA 3QK7A 4NOKA 4Q47A 3ITNA 3V80A 3JTEA 2A8YA 2CVOA 2HM7A 4RLFA 4RVGA 5EKTA 5A3SA 3SLGA 5AM1A 2JLXA 4N76A 3TIIA 5CEJA 3TEJA 3BZWA 1CUGA 1XXHE 1AO3A 4M7WA 2R44A 2VPIA 1JPNA 4RPHA 5CIQA 2YHSA 2QX7A 3T7JA 2R8RA 2C8JA 4Y2YA 4QASA 3F5QA 1W1IA 4ZT6A 4B7CA 2CJYA 2GI4A 4G2NA 4EB6A 2ZE7A 1I1HA 4CMBA 1USVA 2H8GA 4W1RA 1SCBA 3NVMB 3RUPA 2CF6A 4B6QA 3K8YA 2PA0A 2XWBF 3ML1A 4CF3A 3U4QB 2LV8A 4J7CA 1EAMA 1RXEA 2HDWA 3VR1A 3OZCA 4R2MA 4C0JA 5F5XA 3E8XA 5DBOA 1OFUA 1FYFA 1Z18A 4I6JA 2H1HA 4RFSA 3M6LA 4JC5A 2GRAA 4EG7A 3DBLB 2MSDB 1O57A 1T3GA 1UBEA 2I6GA 4MRPA 4RTLA 1FUEA 4FT4A 3VR2D 3HJAA 3HKBB 4CIVA 5HP4A 3NO4A 2IP1A 2LKDA 3QGMA 1P60A 4YONB 2WNSA 4JSYA 4GLFA 5JH7B 5FBRB 1P0FA 2PRYA 4L9SA 5CVEA 3SEQA 2D06A 1EE2A 3DDCA 5G1PA 1OWMA 1GL6A 5C2JB 1WBDA 1XVVA 4K9KA 1EESA 3EASA 4D3ZA 5C18A 2HFJA 2H9YA 2QNIA 3K8QA 4IR7A 1SH7A 2EWVA 3M2PA 3RASA 4AMUA 3C6MA 2JD2A 4BX8A 3A1UA 1V8FA 3LXRA 1N9KA 16PKA 1TJ7A 2FQ1A 2QR3A 4HH1A 4OYLA 5DNWA 3ZXSA 5DT2A 1UJ2A 3KDPA 1BXGB 2WUFA 4YACA 2RI1A 3HU3A 3OD1A 1I0ZA 1OWNA 4FFDA 4UD6A 3SR3A 2PQ2A 2FSVC 4F3NA 4LRXA 7MHTA 1GCAA 5IJ0B 3IO3A 1CVRA 4D9FA 1URPA 2R8PA 2HWXA 1VBFA 4YFVA 5JDIC 4KCGA 2VYND 3AM4A 3E3LA 4FNGA 5KNCD 3H5LA 4RM3A 1NONA 4IS2A 4LZWA 4M3NA 4QTUB 4ZVPA 2XNDA 1LPOA 3NBYC 4IUCS 3RS4A 5I4KA 3BK1A 2VHUA 4OTZA 4X7PA 3L7KA 3V00A 4C22A 3DZJA 3JQ7B 4H7HA 1W34A 5HZGA 2NXNA 2W2LD 5KNBD 4GQAA 3VHRA 3TJZA 3X1JA 5IF3A 5TGZA 1WCWA 2V8OA 4JB3A 1VP9A 1GZ6A 1KS9A 2QV7A 3ON5A 4I1RA 5F2EA 3TX6A 4AVYA 4CTJA 2I6SA 2O8VA 4YT4A 5HPYB 4EGCB 2O2DA 3GEHA 1GZDA 4JZKA 1KI1A 2ZJ3A 3RU9A 4BLQA 5IPFA 2OV4A 1XBTA 3FTQA 1VG9B 1WABA 1WULS 1B6RA 1K8QA 2PBRA 5K45A 3JWGA 2WAXA 1T9HA 5M34A 2WD8A 1DIGA 4EKEA 3TZKA 1TVCA 2OM2A 4U3JA 2C4KA 2J5BA 3M5WA 1ESMA 3OE7D 3FLMA 3MPOA 2O2HA 2R25B 3EXEA 1KORA 1KC3A 3N5KA 4HBZA 4CDGA 3WLTA 5FD8A 3FNEA 1A2KC 1U65A 4MWDA 1GGFA 2PFGA 3KWLA 1YJ5A 3FYTA 5AK4A 4E6PA 3TLGB 3AR9A 2CZGA 1KMMA 4IKEA 3IVRA 1R37A 3QOXA 2FOLA 1ZI6A 4CTKA 2V54A 3HH8A 3NU1A 4EKGA 1Z63A 1KEUA 2COKA 4OHPA 4RS3A 1HM5A 1PEAA 3P9CA 2K7ZA 3AOEC 1T13A 1U2GC 3RVMA 4NU5A 5GIPE 1HY0A 1XZIA 1MCZA 3P4UA 2O0MA 1CDEA 3U26A 4EK9A 4RD4A 4INOA 3VZRA 2QRVB 5K3BA 2XF8A 3U3JA 4HDSB 2MHCA 5AVOA 3I6YA 1U9ZA 2VXCA 1WETA 3ICEA 2PGLA 1LF0A 4RVCA 2BFNA 4P84A 1JJFA 3T7TA 4ARIA 1FLNA 4YRTA 3ITDA 3WLFA 1FMTA 4YP9A 1LV7A 6Q21A 1Y9JA 3U4AA 2DR3A 2WQZA 4J49A 3I2GA 2G0TA 5IMBA 2RBEA 4P58A 4Q9NA 4OVKA 3GR6A 1QKKA 4M83A 1CZUA 4W82A 1FPMA 2BFFB 2YBDA 5FV7A 2L19A 1D04A 1QVZA 3GRPA 3RVPA 1GWNA 2A9OA 5H3LA 1RM4A 4HN9A 4QG3A 3KQSA 2B25A 5TQ2A 3AP2A 3BJRA 4YJ2A 1E1LA 4FZ5A 3UM9A 1YVEI 3UK7A 4EABA 4UCFA 3R7WB 1PVOA 1GTVA 2ZS7A 3NPMA 5AJVB 5T8KC 4UM9B 1D0SA 1A8HA 5FA5A 5GJVC 3AI3A 1C1DB 3HCDA 1U8UA 3KELA 4KI7A 5EGNA 7ADHA 1YT5A 3JAKB 3QXSA 1ADFA 3QPUA 1V7ZA 4M0LA 3ZKWA 2FV8A 2L69A 1KPHA 5AJHA 1I80A 2XOKA 1DEOA 1A96A 5KB3A 2R2GA 4P7JA 5G40A 1RYZA 1EFPB 4Y9SA 2RIPA 2HU2A 1J5PA 1XZQA 3KJZA 3OQHA 4CMIB 3FDXA 3S2EA 1R5BA 1JAIA 4D45A 3I2IA 5SV2A 1NG9A 3A6DA 4WZBA 5ER6A 3MFYA 4A36A 1LX7A 4GP7A 2QB5A 4CLXA 4WGGA 1U5BB 4TTQA 3MTIA 1IJEA 3M4YA 4KE9A 3IEVA 4JYZA 4MEJA 5G4KA 4EJ6A 1D07A 1TL7C 2Q2WA 4UHJA 4S1NA 3VR6H 2QLMA 1VMDA 3JWJA 2HJWA 5EL0A 1ZD1A 2JH9A 4PGMA 2A9QA 3ZXYA 4QL3A 1RZVA 1XFDA 3GA0A 4CTOA 4IQ8A 4FOSA 2QXUA 3PG5A 1Y37A 4N0DA 1RWPA 5IC5A 1C9DB 5A9SB 4AL4A 5JYDA 4YJ2F 3PITA 2A86A 1CR1A 4OQYA 1K7EB 1OFGA 2DFNA 3ELWA 3JQDA 2ODPA 2JIBA 3O03A 2CBZA 1SBYA 5KNBH 4B3CA 4L16A 4B7UA 4MTLA 3JARB 2IX3A 4W99A 1SZJG 3UGTA 3TRFA 5KKNB 4ZXFA 3ZYCA 4MA4A 3F9CA 3K8OE 3FUVA 4AK9A 3FUCA 4RNCA 4F97A 4P3XA 5CDSA 2NM0A 4CUZA 5KHAA 4OATA 2PWAA 3SXPA 3FN4A 2X4LA 3MLAA 3VTZA 4F04A 2HLHA 2QTVB 4YRAA 4G5FA 4BVHA 5ICGA 4MQLA 1JDTA 1RMTA 2QGNA 3NG1A 2PX6A 2C4NA 2INGX 4G8JA 1QCZA 3IHTA 2X0FA 3O73A 5IMSA 4MW2A 3ZU4A 4Z6KA 5KNDA 3LBFA 3CHYA 4N82A 3MWGA 4V0QA 4URUR 4CKZA 1TYAE 3AEUB 1U04A 3CF0A 1K6EA 1M2HA 2B82A 1W0KA 2P7IA 4EEZA 3GGDA 2XE7A 2QAGB 2PXAA 4CMEA 3ME5A 4DM3A 4OYRA 5B2EA 5L3VA 3DKRA 2J6IA 2Q5LA 4NDZA 1V43A 4R8SA 4DVJA 1XAGA 4HNUA 1A5ZA 3THRA 4PSAA 4AJEA 5AESA 1SAYA 2CUKA 2WT9A 3DM5A 5AOCA 4DWOA 3AIMA 4GLLA 3NIBA 4ZAGA 3IS3A 2Q5EA 2HQSA 1XA0A 3KEFA 3PX2A 1VMEA 4K9DA 2JI9A 1C3EA 3KVRA 4X63A 5FFFA 3SHQA 1GDTA 1SK9A 1PKEA 1VGVA 1X13A 4OI4A 4ACBA 2IS6A 3LFTA 1MRSA 3PIIA 4N5DA 4C0LA 1M2NA 2QG9A 4EUFA 2C3OA 1ZH8A 2RK3A 1YJBA 2Z09A 1E1NA 2NG1A 4WRRA 4D4GA 1TU4A 2C2MA 2WPDD 4MYUA 1EGVB 3VPCA 4R0MA 5E9AA 3X1MA 4WEOA 5BORA 2BKXA 2WPNA 3E82A 2NT4A 1K98A 4IDPA 3VR3A 3WTBA 2Z4SA 2R4TA 3DBIA 1U94A 3EVDA 4M9QA 4XI9A 4EA6A 2BTQB 3AZOA 4NZOA 4EG0A 2RJNA 3LLSA 3JPWA 4IH1A 2QX6A 1W4ZA 3FPGA 4BP8A 4DLWA 4DQ0A 4EY6A 5C5EA 4WOJA 4QWMA 3B3QA 2PSFA 4FKBA 2LCFA 3ZDYB 2IA5A 3LGSA 2FMKA 5KCZA 5KX5B 3JR7A 1ZJ5A 4EHHA 1F6BA 1Z13A 3I6BA 3KETA 2OV6A 1V5IA 3AO0B 2G9VA 1PG0A 2PKWA 4G4SO 5BN4B 1NF8A 4J1TC 1BS9A 2BM8A 1EFCA 2HPVA 5E6UA 3ESXA 1MABA 1B0PA 1NJ1A 3EXIB 4MAMA 3URMA 1RCFA 3EYWA 4KVAA 4OP1A 4A8JA 3QLVA 3Q11A 2GTPA 2YWHA 3CINA 1GRNA 3OJWA 3R6LA 1P81A 5I7HA 1QGOA 1TNDA 2VJLA 2NAFA 1A9XB 3HZHA 5KOHB 1XNJA 2QVCA 1KI6A 1L4BA 2YHBA 1KYXA 2X4GA 3QV1A 4GWKA 4I81A 4KIJA 1G42A 3V7YA 1I1OA 1V5GA 3IMEA 3C4JA 1AE1A 4DYVA 1E3SA 2ZSBA 1KRXA 1DBPA 3SU8A 1AF4A 3C85A 3KPWA 3EMBA 4MW6A 1J33A 5CLQA 1BDMA 1AZWA 1ORIA 3NQ41 4YUWA 1JILA 4UQPA 3IKVA 5GONB 3HDGA 2Y66A 4KI0A 2O20A 3GJRA 4KYVA 4Q7JB 4YMWA 3FJOA 5FWYB 4XH9B 2EU8A 3P9ZA 1SVKA 3DCNA 1U7ZA 1EA5A 4RW0A 3WXMA 2JFHA 1UWKA 5JZ9A 4P0TA 1V7PC 4QVGA 2Y9MB 2FXVA 2PCLA 2Y0CA 3V3TA 4TKVA 1JIXA 3LC1O 1MPXA 3QEOA 3VU1A 3DV2A 3MGBA 1NN5A 4Q7EA 5CGZA 3H3XA 3VYVA 1LPAB 5I51A 1RLJA 1GV1A 1GVHA 1CIVA 3AONB 3AVWA 5EIOA 3EE6A 4XEUA 2FQWA 4QECA 3D6VA 4MVJG 1CT9A 4OG2A 3E7PA 1A8QA 4RY8A 1NL3A 5DEIA 3P19A 5A5FA 4E5DA 2EERA 1IVYA 3FJ1A 4R6XA 1V6AA 1M1XB 1Z6TA 4CKEA 4LJSA 1SXGA 3L7DA 5D6BA 1L7AA 1RM0A 1OFHA 5EIXA 2LP4Y 5C34B 4AAYA 1ZIOA 3L9XA 5BNZA 1RWWA 2CV2A 5JAZA 3M7IA 3RTDA 1PT7A 2OHVA 3PNVA 5B58C 3N7TA 3PNKA 3RU3A 2WA1A 1ZRSA 1WP9A 4PX5A 1U8ZA 3NUGA 2TMDA 4IOMA 2V7EA 3BTSA 3TSYA 3QNUA 5E9JA 5K0JA 2EWMA 1PL7A 4A1OA 3KLNA 1EB8A 5EPEA 2BEWA 2F43B 3R1IA 5THKA 1W36B 3TTUA 1IAVA 2ZKIA 3CR7A 2C9ZA 2Z2JA 3ECAA 1NNUA 8ADHA 3VH1A 4LJLA 2GO7A 5LQUA 1YULA 3UCEA 4YWHA 1YHNA 2DPMA 2HXGA 1G8JA 3ET5A 3LUBA 2W2MA 4M8IA 5JFOA 1L7EA 4P4TA 5DSXA 4WXHA 1U1EA 2EKQA 2RHMA 4ZMRA 3DAGA 1I0LA 1H0RA 4MS4B 3QYAA 5HF8A 1PZHA 4LVNA 2RGRA 3K9HA 1DQSA 3BH7A 3UA4A 1WB9A 1VJGA 1W4RA 3NTOA 1WXGA 5KREA 2CCGA 3GWZA 3KKZA 3FLAA 3BGVA 4KO1S 2VSQA 3COZA 1PTJA 2NXWA 3CW8X 3RJ9A 2EW8A 1E9FA 1HLDA 1Q2UA 1MEJA 2PMKA 3L4SO 3N6XA 1L8OA 2JEOA 4WFJA 1TYEB 4HVAA 4PGHA 2CLEB 2ODTX 3ZDRA 1N77A 4OJYA 4FZRA 4ON9A 2HC9A 1U9CA 1Z3IX 2C0CA 2XDQA 3CUSA 4RPJA 4XWYA 4UTNA 4ZVMA 2WKRA 5FOVA 1CNFA 2QMHA 3HYRA 3QVUA 4NPHA 3VU8A 2MYNA 3SDBA 3PT9A 3QOFA 4RLSA 4C0QC 4DE5A 3K96A 3C4QA 1JA0A 1RXVA 3RV4A 2Q4OA 1Y1SA 2ZWOA 1SUDA 3E9YA 4UUAA 1E3LA 4PC2A 1GA4A 2XECA 2JRLA 4JP8A 2J1LA 4PYRA 3GELA 4LGYA 3OOYA 2QTLA 3H11A 4Q15A 4AMYA 1EX6A 5DYNA 3UA3A 2C7PA 1QAQA 4MA5A 5HIIA 1O8BA 2OV8A 2LDXA 2O2CA 2R7MA 3LIIA 3KSDO 4L95C 3TCXB 1ML4A 3UOGA 2C77A 3ULKA 3EZ7A 2C0PA 1CEYA 1TVKA 1U9JA 1VPEA 1JFTA 3F8TA 1VB5A 1DV2A 4BCCA 5GP1A 4RVFA 3C41J 1Y3FE 4L1KA 2OAEA 4N0EA 3ZQUA 4XOUA 3E9RA 2E48A 2RKBA 3QYPA 5DN9A 4ZYLA 4XVHA 5A3JA 4KLAA 4XPZA 4KH1A 1OV6A 3KM0A 1Q3KA 2O7QA 1KA9H 4XOIA 3ZJ5A 4KR7A 2VSXA 1EX7A 1QLHA 1T6BY 5H3CA 5LM3A 3VAYA 1VFNA 4YMLA 1H3FA 2QLTA 5F2OA 4AN1A 2HL6A 4ZT5A 1MGOA 8OHMA 2Q7DA 1JDVA 4JV5B 3ZU5A 1O08A 4X1YA 4R7GA 4C0XA 5JAPA 1R6TA 3CVXA 1LQ2A 5CVCA 2OVFA 4YO7A 4O33A 5LB2A 1D2EA 4YRLA 4ZQHA 2EEZA 3S44A 1OX4B 3Q6NA 2YV5A 2CNBA 1I7NA 1DHTA 2DETA 4S0XA 2EKPA 2PXXA 4X1KA 4CN9A 1BKSB 4TSFD 2QJTA 3RC9A 2QJRA 3IVCA 3J7AC 3SMVA 3K0AA 2PA3A 2I9PA 3B1VA 1TYCA 3QE3A 4HADA 4N9WA 4CZ2A 5LQJA 1NUHA 1ORWA 3JD0A 2QUZA 3DL2A 5A6SA 4KODA 3N6RA 1AV6A 4PZYA 5DHQA 1SQ5A 2GCIA 1M7BA 1JX6A 4L08A 3BJIC 3FDJA 2QVLA 2B0CA 4HRXA 4BFXA 4PRLA 1KI2A 3A2LA 2YHIB 3TSWA 2WUVA 2FW1A 3ELBA 4JI5B 1GXSB 1R8JA 3H2YA 4ZYUA 3PFGA 3UOAB 2QRLA 3E5NA 2XKAA 4RIIA 1FC0A 3H2HA 1CBUA 4WJLA 2JA2A 4OQMA 4BU1A 5I5EA 3DC7A 2P9JA 3DXFA 5FKJA 4Q3CA 2QZPA 2OORA 4YMHA 3AY7A 1RPAA 5HKOA 2ATEA 4JMPA 2C5LA 1A9YA 1A69A 2V7QA 2BRUC 4HVLA 1G7SA 4CLRB 3EGCA 3G2IA 4LRUA 2ZS9A 2WF8A 1KP3A 2GPTA 3MMZA 3MWEA 1Z6GA 1OOEA 1JT2A 1V1RB 2PKQO 3IAM1 2J5XA 2DQZA 2H4ZA 1VECA 3AXSA 1M2KA 1MC1A 1R15A 3EFOB 2EX4A 4FZVA 5K3DA 3LCUA 4E1BA 3CLSD 3O3CA 2QLBA 4HEQA 4HYTA 3I28A 2PX2A 3RS7A 4RTRA 3JAWA 1YFLA 5GJBA 1NN0A 4QBTA 5ISMA 1FMJA 1Z8NA 3UTCA 1UOPA 1DZIA 2V6GA 1CQIB 2AA3A 4YCDA 1NMXA 1LC0A 3PDHA 3ESAA 4BU0A 2XY4A 3O8QB 1CETA 4ZVLA 3RAJA 3LVBA 4BO6A 4LXTA 4DMCA 1W85A 3DWFA 4XA8A 5DK6A 5B6PA 1CUSA 2D1QA 5CU7A 1P1HA 2O0LA 3QJYA 2HMVA 2LTAA 5JMWA 4NLEA 5L7TA 3JATB 1ZITA 3CLTD 3STHA 1ZEMA 4LYHA 2NACA 4OAPA 4RQTA 3Q7QA 4P4LA 5D7NA 3E4DA 1JIKA 2MSLA 2YZMA 2H1RA 5D87A 4ZU1X 1BJTA 1MJGA 3O21A 4NMMA 3UYKA 2GEBA 2OYRA 4D9NA 1AHPA 4PG7A 2VXYA 5I4IA 3N05A 4QPCA 1AC5A 1PR3A 3IJPA 3S2GA 2QQ0A 2MIIA 4E32A 4ZVUA 3RRFA 2P6MA 3L8HA 1XRPA 4N6NA 2JC3A 1U8XX 4R84A 5AVSA 4H7FA 3EA5A 2PEZA 4RNDB 3MQFA 3PPXA 4IHKA 4LXGA 3AU9A 4NZMA 1MO2A 1O9GA 1VFPA 4Z49A 3RVSA 1VE6A 1VZ2A 5TF4A 3DBRA 1W9HA 3SYMA 1NF3A 2OZLA 3IPYA 3CCBA 3HCPA 5DT9A 5E3HA 3EH2A 1CWUA 4CG3A 1P17A 5JS8A 2DRIA 2HA4A 3RJZA 4ASUA 4UZSA 2CL5A 1R66A 4US2R 1M1YA 2CNKA 4W9RA 2P78A 4C01A 1M6WA 1OTHA 4F4HA 4QVKA 1JWBB 1XAHA 2EZ8A 4KP7A 4TM8A 2CT8A 1EWKA 2QUAA 1NAHA 3R76A 3U3XA 4UEQA 1JQEA 4MAAA 3VPSA 2ZJ4A 1NNI1 3O8OB 5FPPA 3VUEA 2JI7A 1F14A 4UTZA 3UF0A 2C3YA 2I8AA 4Z53A 2DUUA 1ISJA 2JIOA 2GESA 3MQ4A 5C4GB 5T3UA 4ATNA 4DY4A 1OU0A 1XTBA 4A3SA 2ZBQA 3OA0A 4CEJB 3U7EB 4DTIA 3WNDA 4MLCA 2OBLA 1J0EA 2AC2A 2FW6A 4NCAA 2QAGC 2XNSA 1IXRC 3FZEA 3PENA 3PXDA 5TJHA 3W05A 3ODGA 1UQUA 2P4HX 4O2AB 3NONA 2ACVA 5EUCA 5MN4A 1MZPA 1GRQA 4G65A 1FVHA 3GUHA 4FZJA 3LC7O 4HDRA 1S2NA 3ZZ0A 5FUMA 3F74A 4HYQA 3WHLA 1E98A 4NHEA 2HREA 2F1OA 3BWCA 1M6EX 1GT91 3UWDA 1P18A 1KBZA 4E13A 5L4SA 1WHTB 2ZI4A 1SKAA 2NSYA 2NYUA 4CLDA 1H2FA 3AI2A 1UZAA 1Y8AA 2IXGA 1FEZA 3HN7A 4BNDB 1Q91A 3B85A 1MGPA 3AKZA 1XELA 3KB8A 3ITEA 4BMSA 3P4YA 3K0KA 3PJGA 4EFDA 1JIJA 1WOMA 2DH6A 5LB4A 1OAOA 3BULA 3LVQE 2A9RA 3H18A 3LX6A 3ZIAD 5FFNA 5HIKA 3NAQA 3S2UA 3MUEA 1QHXA 2LZ0A 2PFKA 3QVVA 5IM5A 1G3RA 5EIBC 3EG9A 2MYUA 3WAGA 3T34A 1PGJA 2JGNA 1P1FA 3JWEA 5GTDA 2YZNA 3IIMA 1G3MA 3NV9A 4ZVQA 3C6YA 4QHTA 2HH9A 3PR2B 3NM6B 4FXOA 1X2BA 3QG1A 1EP2B 1PJLA 5HILA 3GK3A 1BX0A 1UIRA 3RT1A 4C0KA 1W0CA 4AJ9A 2HYDA 4ZYTA 1TFRA 2E55A 1WNFA 1KK1A 2H2DA 4JBYA 2EYQA 1RFLA 4N7BA 5E7JA 1OQAA 4EY7A 2PZJA 1K8ZB 2WJWA 5DI3A 1QRSA 4HX9A 3EULA 1ESEA 4YDSA 2GYUA 3AGQA 1CS4C 4UCWA 2FSFA 3H8VA 1RKBA 1G7RA 3QU4A 4I4IA 4EHJA 2ZSDA 4TT8A 1HTBA 5LOVA 1TXGA 3O2QB 4K6OA 1MTZA 1N5DA 2Y2UA 3NKLA 3E81A 3AF1A 4ZQIA 4M1ZA 3L0IB 1XNHA 4FYIA 2G88A 3A6HA 2GZ3A 4M1QA 5CFPA 1EJBA 1EWYA 3DPUA 1KVSA 4TV8A 3WO1A 1GPWB 5T4HA 2OP0A 5CNKA 1G1AA 2BSXA 4D25A 3ZW8A 3ZD7A 1U3VA 3FPJA 4BX3A 4YRIA 4UEWA 2VDKB 2FW0A 3UZUA 4CMJA 2ZVPX 1JR6A 3KIPA 1BIFA 1M2WA 4UCQA 3B6EA 3KEOA 3ZUGA 1HDIA 4NNJA 1CUJA 3G0CA 4TTSA 5JNVA 1E79A 1SC9A 4LNAA 2OGZA 1GCIA 3OEED 5I8PA 1PO7A 4U5XA 3K5IA 3CCFA 2JRCA 1JF8A 3W3AA 5LN1A 1GPKA 1EVEA 5JG7A 3P71T 2YWGA 4MVCA 1X94A 2XPCA 3D2AA 4Y6OA 1KR2A 2X8JA 4KMRA 3RIXA 1K7YA 4EG8A 1QIJA 3WKBA 2DULA 1G38A 2AIRA 2DFPA 2Y4NA 3PTZA 5LOVF 5FWAA 1LNZA 4I3HA 1QYIA 3F6PA 3QLTA 4RE5A 3CX4A 2C83A 4Q93A 2BGMA 5A03A 1ISHA 4K05A 1DQNA 2FPKA 2BT4A 1YZGA 3L92A 4FOOA 2HXSA 4I8XA 4EUNA 4TV8F 4CTMA 4Q7LA 3L7JA 2UU9B 2F1RA 4TQUS 3WGYA 2JFNA 2PPVA 3ED1A 2AN9A 1G4HA 5BMVA 4CKBA 1XF9A 1FFBA 1KO1A 3AJAA 4NV3A 2G8NA 1DIHA 4ENUA 3TGPA 4QUGA 4G1CA 4JGIA 4MWZA 1V6CA 1GPNA 5DNCA 2B35A 1LK5A 3N0XA 2B8EA 4WMLA 1W36C 4BE4A 3I42A 1NDHA 3T1QA 1RAGA 4PCAA 1L1QA 2P9EA 5AYVA 4G8CA 4WNAB 3TQQA 3DT6A 2HF2A 4GDMA 3IXLA 5JPIA 1NVWQ 2IXTA 3TOSA 4WNCA 3P2MA 5AWFC 1C4OA 1V3QE 3H5NA 2FPGA 3H1FA 3HMQA 5KAMA 3FFTA 3LWBA 2NU8B 3CQ9A 1H69A 3KRTA 3ZEIA 2PUHA 3DOUA 4XWAA 1BFKA 1ZUD1 2PR7A 5EEGA 4CHTA 1S7GA 4JVNA 1K06A 1NBEA 3CSSA 1LUAA 2IYLD 2PLWA 4UBMA 4X3PA 5FBHA 2HCBA 4BMPB 3IAS1 5HJ5A 1LDEA 1E5LA 3WISA 4QT4A 4KXUA 1C1HA 5DTQA 3OJ0A 3VFDA 3IEMA 2XLBA 3ORSA 1K4YA 1QFZA 1KY3A 2IYQA 3K5HA 4XX0A 4IVNA 5TSDA 1YRLA 5KSPA 1Z8FA 3ZJUA 5BMVF 3TIFA 1KK3A 1LC3A 3AUJB 4DDUA 4BLVA 3SQXA 4JIMA 1QO7A 4C7MA 4M36A 1FNBA 3NEAA 1CY4A 4H31A 1YS2X 4LXUA 4KNWA 1V8PA 4UTPA 1A7AA 4I5DA 1TF2A 5CJ2A 4HH0A 2PHZA 2VQFB 1H05A 3ILYA 1T1IA 2AJBA 2FA9A 3R5KA 3U80A 1HKUA 3GY0A 1GM5A 1FP2A 1I0AA 2PGAA 3W90A 4L27A 1PSDA 1DG1G 5FNZA 3UENA 3EDMA 3ER9A 1KHHA 5FO0A 4EW6A 4DQDA 4L07A 2DPGA 3KUXA 4QUDA 2NO0A 2EARA 2H00A 3OX4A 2ZBUA 1EHIA 4HF7A 4OBXA 4TWRA 1G4UR 1F0NA 4B46A 5HIAA 3MNFA 3M4JA 3E18A 2YJ5A 5K8LA 3VJKA 2J7PA 1IM2A 3SF8A 1NRWA 1DKNA 2AFRA 2AG6A 3LNTA 3S5UA 5F91A 1PWYE 5IAGA 2XSZA 2QEQA 3PDIA 3HRIA 4ARBA 3PC2A 3PVZA 1F5NA 2WHRA 3PC8C 5FTNA 2JKVA 4K7JA 3O4HA 3I6MA 5J4VA 2HPAA 4M60A 3OUZA 1YBMA 3P0JA 1XD2B 2C7BA 2JGDB 2OA0A 3D6MA 1W96A 1LQUA 4LYYA 1UEXC 2Z8YA 3H9QA 4L9WA 2O54A 1P4RA 3Q15C 1JLKA 3CUWA 1VOTA 2W22A 4FONA 4MP8A 4ZRDA 3BXGA 2IHBA 2HK6A 3I9OA 4QSHA 2AHRA 1KYTA 1P4GA 5DU2A 5L7WA 1N9GA 3I9V1 1WQ1R 3EZXA 4IIEA 2QW1A 4UAGA 2FEPA 1NBWB 3RKSA 4IX1A 2HTFA 3CX7A 2AMFA 3D6AA 2HWYA 3NVDA 3UVEA 2CHFA 3RS0A 1U1FA 1PV4A 6YASA 2PUAA 5BNWA 4V2UA 4DBLC 1E1RA 1V3VA 1B4DA 1R0RE 2A1TR 3OZWA 3VKHA 2AH5A 1BJKA 5IDVA 5JQGA 3DBHB 4JLUA 4DC9A 3Q0EA 4BRWA 1CY8A 2XNJA 1YZHA 4GMGA 4BLOA 4B80A 5EHZA 3ERCA 4JASB 4JOQA 2EFGA 1T3LA 4IXNA 2VPPA 1CEQA 1LGYA 1U2TA 2V55B 3MBKA 1OBCA 1ZC4A 4MZDA 5TEVA 5FEUA 1O6FA 5FJIA 4YDRA 2IUUA 1A1SA 4P2BA 3X1XA 5CVJA 2GPJA 4XKJA 1TK3A 3X1KA 2IPXA 3OU2A 4PHCA 3D8BA 1SOAA 1Z4NA 1WM1A 2WZCA 4IAOA 4ILKA 4U9IS 2R8YA 4UVHA 2FR0A 1GN8A 1AA9A 2O9JA 3ENQA 3OECA 1Z6PA 3V42A 5AI9A 2F3SA 2FG7C 2Z08A 4CM9D 2C5FA 5EWMA 1YQEA 3KVYA 1DCNA 4IIDA 3CRNA 4UMVA 3AY0A 1K66A 5HDQA 4DC1A 5LXTA 2HD4A 3DB2A 3T1TA 4B9AA 2WM8A 5KKAA 1QB7A 5AW5A 3V1TC 5L3SA 2VRBA 3CH5A 3R9XA 2V3WA 3Q3EA 1XXHB 3A6FA 5ILQA 2OXEA 3SHOA 3A6ZA 3KLOA 3SICE 3V8EA 4IRUB 3S7ZA 1TC2A 2EIXA 3K0FA 4MPPA 1CVIA 1QIKA 2YXDA 3X1DA 3OC6A 3R5TA 4EI9A 1PQWA 1QV6A 1GDDA 2AZDA 3FF1A 2GCNA 1P3JA 3QKSB 4PLZA 3HZZA 2HSJA 2GNAA 4M1KA 2RHRA 3AG5A 4FLEA 4QTZA 4WXEA 2PVPA 4K9LA 3T9AA 1W581 2XMQA 2HQRA 4DIEA 3DVSX 1G3UA 4XZ3A 4BKQA 3HRHA 1PUJA 2OBXA 4K9MA 5C1BA 2JHGA 1QE3A 1T35A 4QFMA 1OJLA 3A31A 2V7GA 4DHEA 1J4AA 3LUFA 3T4XA 3EVFA 3SN6A 3LH5A 4YALA 1AO0A 4HEA6 1NGSA 5LXTF 2I4IA 2RCYA 3DE3X 3FNIA 3T9CA 4ZV9A 5C7IO 1GKUB 4UNNA 3K6KA 3DL7A 4RV9A 1NJ8A 1N9ZA 4LJYA 3C8HA 1I6LA 2IX9A 3ROPA 1Z4IA 4GKBA 2GTHA 2CMHA 3HYLA 3L4BC 1RWMA 2GF0A 5K3EA 1Z6AA 2Q8QA 4UATA 4G5RA 4JA0A 4JP3A 3EZNA 3IODA 3ZE0B 2X77A 4IFIA 4V2IA 1J07A 1LTHR 1S8AA 3SHTA 4BN0A 2HIHA 3KKQA 1U8EA 2Y6VA 5BR1A 4A73A 4HGPA 5AW3A 4S12A 3J81k 4NJMA 5AVRA 2UZ0A 1K5GA 2W4IA 1ND6A 4OMDA 5IXYA 3VAAA 1OREA 4ME6A 2X9NA 1UBCA 3V4SA 1CQZA 2BGRA 4MYTA 2HDOA 2PN1A 4X64B 3NBAA 4QJ3A 5F1OA 5I9TA 4DCUA 2V0GA 2XD9A 1FIUA 1B74A 3DOFA 5CXXA 5DE3A 1ATIA 5EJMA 2J9FA 3TBKA 1T8UA 2W90A 2AF3C 3DT8A 3N2GB 3OFNA 1XDBA 4ZZ2A 3DMTA 1NOIA 1SHKA 2D13A 3GRYA 4Y1EA 1T9GR 1D4ZA 4WKBA 4A03A 2C1ZA 3EG5A 2PMDA 4HXYA 2A0YA 5MFZA 4BVLA 4JOCA 4D9IA 2GVZC 1KAOA 2B2NA 3CXRA 1X15A 3JAMA 3DCJA 5C3MA 3KQMA 5BWLA 4JNKA 4C3UA 2B3DA 1N2OA 4X20A 4D99A 1T25A 2IE8A 3BAZA 1IN5A 3DZDA 1MX3A 2OO3A 4PAWA 1RJGA 3ELYA 5IBQA 2PFSA 1YASA 3ZI4A 2BFCA 3GJXC 4G56A 3QE4A 1GARA 4J2HA 1IY1A 5ICCA 3O95A 4RLHA 2DFKB 1ZM9A 3FYDA 1QSGA 1Z56C 4WN9A 4O29A 4R1LA 3R74A 4O3MA 2ZRLA 4IEIA 3PNQA 4W63A 4D42A 2W11A 3K5WA 2YZ2A 3D4PA 4RY0A 4S1VA 3UXEA 3B2QA 2Q2NA 4CODB 1W5EA 1D4FA 3ROGA 3AUAA 4U9HS 2D28C 1N0HA 5JUWA 1KH1A 4A15A 2VK1A 3I9LA 2GEFA 3GEGA 4HR7A 2YFYA 4MRNA 2Z5GA 5HM8A 4L9AA 1WLSA 1Z39A 2BUBA 4HPWA 5FORA 3IBFA 4JQOA 1SBTA 4CL8A 2GKGA 4KV9A 4BNGA 5BW6B 1NVFA 1U9IA 3UMFA 5C4IA 2YXEA 2V4MA 5SICE 4ZGGA 1TQ6A 3GFFA 1DKQA 2DQKA 5KWSA 4DADA 2NUPB 3VKUA 3WQQA 3NHSA 4BFSA 3PKZA 4BO1A 4KQMA 1YQWA 1E4OA 1VCNA 2VJBA 3DZBA 3F97A 4KQ2A 4WKOA 3RRMA 3JQCA 2A1TS 2XJ4A 2Z4RA 1B6SA 4ND8B 1M6VA 3QU7A 1S3SA 1U0NA 2P9GA 3PPYA 1WKCA 1CUHA 2FX3A 2VYNA 3ZHBA 4CQJA 2F8SA 4ARZB 2HW8A 1JHRA 4M98A 2A33A 2ONZA 1V25A 3GBVA 2JCYA 5CR9A 5ENDA 4D80A 4A6EA 2PH5A 3KXDA 4MDEA 1E2DA 2VHZA 3S2IA 3R8FA 2JDIA 3HB1A 2Z95A 3NYIA 2CEKA 4REMA 3I0MA 5HUHA 1TPZA 3DPSA 5LMZA 2PUDA 4D0RA 4JB8A 2PV0A 4PXYA 1GPJA 1B1CA 3G0BA 3HDHA 3NAZA 1ZMTA 5CW2A 1JLMA 2FZ4A 3GRZA 5H1YA 1IDOA 4GX1A 4BATA 4PYQA 3IBCA 1XCBA 3TQIA 1LLQA 1KXJA 2I3ZA 3AHHA 5I4CA 2HHCA 3S2ZA 4B6OA 4DLUA 4C6TA 5AKLA 4LSMA 4G0WA 3FOBA 4HFMA 1XKLA 3LO5A 4F46A 2IYUA 1OYVA 1V11B 4TKZA 3OE7A 2XXAA 2JAHA 2GF2A 1NKVA 4MI6A 2QF7A 4ZHSA 5AUOB 1NMZA 2JJMA 2XKJE 2ADOA 4WCFA 1RI3A 3HO6A 4HP8A 1TFUA 2TS1A 3HO8A 1JSXA 4KZKA 2QL5A 1WA5A 2ZLBA 5IH7A 1TEZA 4CV1A 1F8FA 5E9WA 4RTSA 1IQRA 4M7PA 1XCJA 3VPDA 3X0DA 3L84A 2XWQA 4EVRA 4YREA 5B7GA 1EUCB 1RC1A 1X86B 3DZCA 3GGGA 1XWFA 3H2IA 4J91A 4URXR 1XNRB 2WWWA 1YBHA 2R751 3ZY5A 3D6HA 2G04A 2QVYX 2R1UA 4EYKA 3PHCA 2YMLA 3K1TA 1N5MA 1R9JA 2DQSA 3I9NA 2I4MA 4JLKA 3FY4A 2I2BA 4FBLA 4BMCA 4LF6B 2YQZA 3DKIA 3VH4A 3TAHA 2VNIA 5KYXA 3ETDA 1QBKC 3FSEA 1KMNA 1EH5A 1RYDA 4PXAA 4LXHA 1NWHA 2C4VA 2DMRA 2QNRA 2UZ1A 2GAOA 4FNMA 2J8ZA 2W43A 4LWPA 5EIWA 3JD3A 4ZVVA 4CMCA 1YUNA 2RHLA 2VJPA 1F2TA 2YJ4A 5D1HA 2R00C 5ALDA 1XOIA 2QZ9A 1GA1A 2P2ZA 3JSXA 4B2LA 3DDOA 1ZXXA 3DEAA 3KR0A 2DUMA 5AKXA 3WGHA 4PGFA 1VTKA 2HA2A 4IJ6A 3EQ2A 1FJHA 2D5BA 2EFYA 4Q9DA 3E9MA 3W79A 2ZTMA 4QE3A 3DUFA 3RRXA 5FWNA 3S1LA 1EK2A 5HUQA 1YGPA 3M9WA 4LG1A 5B3AA 4JH0A 5FA6A 3ETHA 4LSZA 3NDBB 3DZKA 4KH0A 2UUPA 3TKLA 3ESQA 1UKCA 4IZOA 1QHFA 3K32A 3ILVA 5K7SA 4OHKA 3ZWMA 1B1AA 4D4IA 1OH5A 1VLJA 3VR5A 1JEQB 5K0BA 1DB3A 4UNSA 3CG0A 4HPXB 1O0SA 2A4KA 3OJCA 4GSKA 2FPWA 1XCOA 2R6FA 4QNNA 4RD2A 4Q9HA 1B16A 4AF7A 3B3GA 5DTRA 2G7MC 3BWMA 5J5AA 4E5SA 4F60A 1SBCA 1JE0A 2OUKA 1Z2EA 1T2VA 3F46A 2MMGA 4G1EB 1YF3A 3DKVA 1F4LA 2RGNC 4H3VA 2C29D 1XMPA 2ZBPA 5J5VA 3CX3A 3FNGA 3FVRA 4JWTA 4TLCA 4CV3A 2XD4A 1XDSA 1J2UA 1JP7A 4IWYA 4ZZ3A 4AP5A 2IU3A 2Z0MA 2GM4A 1YI0A 1AQIA 1HOTA 3L6CA 4IW3B 4RFSB 1P9RA 2JGLA 4JYCA 4HNAA 1YTLA 4NX2A 1L4GA 1P80A 1WD5A 2NU9A 4YJGA 3V1KA 3ZGXA 4N47A 4LF5B 4J76A 3FSGD 4LFCB 1UF9A 5LKRA 4MCIA 4OX9Y 2TSYB 5BSEA 3GD7A 1YQUA 3EQZA 3MC1A 1L1FA 1THZA 1F2VA 2W98A 3RRYA 3RVKA 3LBYA 4HWTA 3R3ZA 1F8GA 2IVFA 1S2DA 4AJOA 5M5BA 4Q1BA 3EXFA 3FZNA 3JYOA 2G4CA 4I6GA 2Y0DA 1UFKA 4KQXA 2OTCA 4OCZA 4YLEA 3RSOA 4DV0B 1DC8A 1QK4A 3L8EA 3WHIA 5HTKA 4ALNA 4F3CA 1I4EB 2WFAA 1I5OA 1T91A 1R6XA 4PONA 2PAAA 2C95A 5BOSB 1Z8DA 4EQZA 2HJVA 5CDFA 4YXFA 2RH5A 1I2MA 1T5OA 3ROEA 4KQWA 5D01A 3UHFA 3NTUA 2HB6A 4UM9D 1ATZA 2Z8XA 4MWCA 1TECE 3IV7A 5F9HA 1H3EA 1X0XA 3OP1A 4WQMA 5E3IA 1WLYA 2J4CA 2VJMB 3SCZA 5A4AA 3KOUA 2G1PA 4DMHA 1P2FA 1N0UA 1SHUX 2P2SA 3OEYA 3VHLB 2IOFK 3G8DA 1I3CA 1YDMA 2NO1A 5B2ZA 1ZONA 1AGNA 5CLIA 4LY0A 1G9SA 4RTJA 4QATA 2K2QB 1UKZA 1PJQA 5ICFA 3NH9A 3U0VA 1ZK3A 4FJ1A 5B7PA 1ZI9A 2RONA 2YFKA 1OGJA 1AXEA 1XJWA 4GZLA 1V3TA 3G2OA 3OSZA 3UW1A 3QX3A 2UXBB 1Z0IA 3DD5A 4P86A 4ZJUA 3RGGA 3U1VA 2DJIA 1R6BX 3W5SA 2Q41A 4U3JB 4HX5A 2I65A 3DTVA 3HEBA 2J3KA 4FSDA 2R86A 4L7VA 3EXEB 5ECWA 5LQAA 3FHTA 3TLYA 1YXMA 2O2EA 4Y2HA 1SD5A 4RVUA 3CUVA 1VJTA 1E8DA 3ECCA 3R0XA 3V7FA 3HN2A 2AOUA 2I67A 2X5NA 3FMPB 3FLEA 4E5NA 2KE5A 1OD6A 5FPTA 1FFAA 1YMVA 2F64A 2I71A 5BR7A 4EELA 1UZLA 4LZZA 3WK9A 1ZDMA 1YHYA 1XIVA 3FZQA 3MBIA 3HV0A 5JE8A 2OENG 3RHZA 1SC3A 2X9QA 3A4NA 1KI9A 3HA7A 3SD7A 5AQ1A 5FX2A 5MN5A 4MUNA 4Y6LA 1S3GA 1RCUA 4H77A 3QEMA 3V4PB 1YJXA 3UJCA 3X2EA 4Q24A 3TCNA 1PJ2A 2R1VA 4RD3A 1CDDA 3FPFA 2Q1WA 3DV9A 3KB2A 1NOKA 3NBQA 5FV4A 5C53B 3GAAA 4HZUA 4WVFA 1FP6A 3HXLA 1DBVO 1EXVA 3V5NA 2JLAA 3FOAA 3PLNA 2C4UA 3R2JA 4OHZA 4NBTA 5H4GA 1G6KA 2VDRB 4EQ6A 1BHJA 4IP0A 5AM4A 3ZHRA 1VE9A 3UC5A 3RC7A 2X13A 2I9KA 4MZXA 3ZY3A 2XJ9A 4HDNB 4C76A 4GPIB 3M2TA 2XIQA 4RZHA 5BYJA 1WXHA 3RWMB 4BP9A 3HJNA 1MAHA 2P6RA 3UICA 1PU2A 1GY8A 3RBZA 3H9GA 3LMKA 4RK4A 3UANA 1J00A 1BEEA 2X7XA 3LY9A 4PR0A 3HO1A 4NCKA 4YUZA 2I4OA 1H1TA 4ND7A 5TQ2B 4DNXA 4YJ2B 3OFVA 3VVBA 4X66B 1S1CA 3NAMA 1U3FA 2PKXA 4X6XA 3Q8LA 3Q1LA 4WJZA 1WEKA 3CI0K 1CLEA 2ZB8A 4AULA 4EAAA 3I9KA 1JVBA 1TK2A 2B69A 5EPUA 4DGSA 3RSHA 5REQA 5J23A 3ZD9A 5BSWA 2IH2A 1OI4A 4GPD1 1T5IA 3WKDA 1Z0JA 4JYPA 3A7DA 1X87A 4NYIR 4LHVA 2IYNA 4RV4A 3HV2A 2NTYC 1HV8A 3GX1A 1J56A 3O74A 1JI0A 4V03A 2BGWA 5HR5A 1RNLA 3C1TA 1U1DA 1U1CA 2HLPA 3I4FA 4Y1RA 1O4VA 2X3YA 2QN2A 2G07A 3N8DA 5HMLA 4WDRA 1EVQA 2V65A 2HMYB 4BP1A 3HJFA 1XDUA 4FWIB 4U7JA 5AVXA 1Q3HA 4Q9JA 4WAUA 2QLJA 2IBMA 3HJRA 4RAQA 5G4KB 4DXDA 3ZDFA 3LM8A 3LUPA 3R24A 4NI5A 4BUJA 5B3JC 5JJKA 2NYRA 2GA9A 2WJAA 3T4PA 3QFHA 1DELA 4IDAA 1C0EA 2AX3A 2OB1A 4NK4A 4C4OA 1RYMA 1QTQA 1UK7A 5EIBD 1A7JA 1VQ1A 1ZVJA 5EAIA 1ECLA 5HX7A 3W4IA 1KGDA 4JVLA 1ENPA 5E7IA 1QO0D 2WM2A 4XUDA 3AQ4A 5AI5A 2OXIA 1UPAA 4RMNA 3OAAD 3OU7A 4OUDA 1XF1A 3K8ZA 1C9NA 2OBBA 4L9RA 1XQYA 3O7WA 2ZUTA 4B8ZA 1H2WA 1KI7A 1PE0A 2FN8A 1TJPB 2WUWE 1U15A 4H6PA 4C20A 1Q84A 4XW2A 1WMDA 4CI0B 1D6JA 3ZLJA 3PKJA 3NT2A 3R8XA 1N92A 2FN7A 1E7QA 5ALQA 1LLCA 3GLUA 4F8JA 3P2EA 4MKRA 5F78A 4PLTA 3EPLA 2NO6A 1PRYA 1XTSA 3TPCA 2Q6KA 2RGBA 1VM6A 4RACA 3PXEA 3ZWVA 3B6IA 3NHJA 3N8NA 3PD1A 1OVGA 1QCYA 3AR5A 1XZBA 3WL4A 1X7WA 4HGQA 3RTEA 3T8YA 4I55A 1MAVA 2MSEB 3UXYA 4E2FA 3ZCTA 1NW4A 3OG9A 3URKA 4XQGA 2A35A 2BJHA 2HMAA 3QMVA 4AKHA 4PSDA 3VKVA 2VQEB 1SULA 4WK0B 2FPLA 2JVKA 4H2DA 1X8JA 4OQQA 1EFTA 1IFXA 2VEOA 4EYGA 5JAHA 2Q6LA 2O8EA 4L6CA 4HEJA 4MQFA 5A62A 1NC1A 3FAZA 1K89A 1JVNA 2L82A 3GJQA 3WZLA 4RCYA 2Y92A 4Z9YA 1NUSA 3VXKA 3AFNA 3ECSA 1E8MA 1Y7PA 2ZXFA 4OU4A 4BZWA 3FPLA 3DGEC 4XVRA 5KNLA 5AKJA 2PRSA 2HA5A 4EB0A 3V32A 4NOMA 2G1JA 3UK2A 2PD4A 3W5VA 2UYGA 3KQKA 5KVSA 2FKNA 2EG5A 3CLVA 3ISVA 3GLFE 3EB9A 4N0QA 3LIPA 5JROA 3LD9A 2O8BA 1SVSA 1XCLA 1SKMA 3GFVA 2Q0QA 1VJ0A 4FDVA 1JV2B 2PKEA 3EVBA 2NSDA 3PQ7A 1XPOA 5IZCC 3GZNA 1C0PA 3KVOA 1JR4A 3LVFO 3R3YA 4QNMA 1U7XA 4PZCA 1AUXA 3D6FA 3GPBA 4LUCA 1Z0DA 3T9EA 2MT9A 1TA9A 2VSFA 1CY6A 3Q2KA 1B41A 4IDOA 5FBQB 4DILA 1Z33A 4I55F 3RFUA 3V7WA 1N1DA 5CH8A 5KSZA 2WFMA 2C57A 3L8YA 5KJFA 5FOTA 1PN3A 2AR9A 4PLFA 4IEFB 4Q6BA 1OC2A 2W6ID 3F3MA 2QUHA 2FOXA 2QYOA 1P4JA 4J0GA 2VOEA 4RIEA 3IT3A 1GRCA 1V8BA 3T3IA 4PF1A 4WEQA 3ZLVA 4NEQA 2YWRA 4K6HA 5LMUB 1H2YA 4JROA 1G5FA 2W2QA 3BCHA 4Q5IA 4DEXA 1RJWA 5EP3A 3AI1A 4J4BA 2XMSA 2ID9A 4KU4A 1CS0B 2IDMA 4A10A 4C9BA 5TEWA 4XIFA 3WK6A 2F1HA 4PAOA 2XMBA 5IW8A 1W36D 3QYJA 4OK5A 4RADA 5CTAA 3VPFA 1GOTA 3HKEA 4BMXA 4G1BA 5LQCA 5MN6A 1G41A 4HJRA 4K5QA 5FP0A 2MJLA 3K35A 4MW1A 2QN7A 5TC4A 3G9QA 4JLNA 1QOZA 2DKOA 2VDUE 4YAKA 1UXJA 1O97C 2QY9A 2XUFA 5E6UB 3LJKA 5B1SA 1MABB 4IIXA 1B43A 3OETA 2GN4A 5K0NA 3HKDA 2XA9A 4A8JB 5CDFE 1U0SY 5DNDA 1EM8A 1IU9A 1K86A 3FYCA 5EMKA 3B5JA 1Z2AA 4PR3A 4HH4A 3ZGLA 4RZ3A 2I7XA 3EQ8A 3MTJA 2XV1A 3N53A 1AB6A 1D2GA 1VMIA 2Q2VA 1DWOA 4FGSA 2NVWA 1KI6B 2OOKA 5EIHA 4V39A 5AW9A 4ABYA 2PZEA 1QQAA 1T8TA 1FE8A 2Q8PA 3NHWA 4QDZA 1WQ4A 1ODTC 4WA7A 1ZSVA 5AD1A 3MINA 1U0TA 4H1UA 1AKTA 2ZJ5A 3NVAA 2JPDA 3K5PA 1FS6A 2DSNA 2OPBA 5IDXA 3TSOA 4RK6A 4IIVA 4KO8A 2GUWA 1X1TA 2VZ9A 1UKAA 2BGTA 4URZR 3UAYA 1COWD 1SURA 2P9HA 3H2KA 2QD3A 4KPUA 2Z56A 5FI5A 1H0KA 3FROA 2IK8A 4L75A 4G23A 1OKKA 2GDJA 4V0MA 3SX4A 2QX9A 1KJ9A 3ND8A 4Y9UA 5IKOA 1FDUA 5KYTA 2NU7A 5C8YB 4CWAA 2CXRA 2HA3A 1XYVA 3AFIA 4FUQA 1OWLA 1DS6A 1ZW1A 3KKNA 4NV1A 3CUYA 3O90A 4OLFA 4TKVB 4ZOLA 1A2QA 2IHJA 3ZGYA 3T3GA 4BVGA 4C04A 2HF8A 3QZUA 4DEVA 1C29B 1ODLA 2WOOA 3D7LA 4QU8A 5GOTA 3MWFA 4HNTA 3J81A 2A67A 2VCEA 4QWWA 5HF9A 5I5GA 4X65B 3ZX5A 5AUPB 3I1FA 1ZHFA 1CUDA 1NLMA 4H16A 1RJDA 1FU7A 3ZS9A 2HMWA 2YINC 4ZEOA 1HFWA 2VCHA 3EIUA 2QL7A 3TECE 4OO3A 1T3TA 4HQOA 3WWDA 3PC4A 1KYIA 3CVUA 5L6MB 1UDXA 3TDNA 5KOYA 5A6VA 4E33A 1CXZA 2DHCA 4CKEB 1B8VA 3HCCA 1QHNA 2WHPA 3F4BA 4UU0A 2CV1A 2V9ZA 2PNJA 1RABA 1KBOA 3TTSA 3CYFA 5ALRA 4CL0A 3KQHA 3IVAA 3OP4A 4A23A 1GZHB 3H5TA 3LVRE 5E2AA 3TOXA 1UMBA 2JFOA 2CMKA 4IDQA 5FBVB 4YC7A 2JAUA 1QP7A 2NPOA 1FSPA 1WQ3A 2JFGA 3FPCA 3GARA 1U3GA 3N3BC 2EJCA 4MLPA 3JCZA 4FN4A 3SC4A 5JSZA 3COJA 4WERA 3IVGA 2EFEB 2OL4A 4E0BA 4OQ4A 1PL0A 2BEWB 3QFFA 3GN1A 4J0DA 4TQGA 1Y8ZA 1FUIA 5JHGB 2HK7A 1RD4A 4YNBA 4XGKA 4ZOLF 2B1QA 5L8VA 3GLKA 2W6MA 2G5TA 1U3TA 3UMBA 1OFIA 1ZWKA 3LPNA 3WL7A 3F6SA 2O2YA 2H1WA 4MR7A 2G28A 5K3AA 3M9LA 2HWWA 2Z9DA 4N40A 3SSNA 3R0IA 2NIPA 3F67A 2J9RA 5EINA 1AQUA 1TCVA 3LT2A 4NYJR 1MVNA 3GNSA 5KTTA 1F0PA 2H0AA 3ENVA 1J9ZA 1ETUA 5KJ1A 4MQUA 1YR6A 4PNPA 4LBYA 3EIHA 3BMQB 2PQ0A 5A05A 3WL6A 3ZPXA 2QYHA 2D5CA 3ZIDA 1O94C 1PQUA 3U3DA 3KKMA 3LQKA 2XWPA 3WGGA 5JXHA 4BNNA 4IG4A 1GUDA 3ADBA 2NQ2C 3WLSA 1GG5A 3RUCA 1T0HB 1V0JA 2FPXA 5AVKA 2P7HA 2XDQB 3LHIA 2BUCA 2WFLA 1DO0A 3GLQA 2PUBA 2QDXA 4WXYB 5AVWA 2YXPX 3BIJA 3V6MA 4R7TA 4U8GA 3ZTWA 2C3PA 1I4WA 2QAJA 1ZXLA 4H7JA 1YRHA 4ZAFA 3W7BA 1J21A 1K9VF 4OJTA 4YB8A 1WB5A 4EUKA 1F3OA 1F9EA 1ULSA 4QLOA 5DXFA 1WW3A 3LSYA 5DASA 3H11B 2XMZA 1T24A 4YI5A 1I5EA 1MORA 2PSDA 5J5CA 4IYRA 2NUAA 2X5OA 1Y1RA 3W0LB 2VDOB 4RF4A 4F8YA 5HHTA 3ZY6A 2QP3A 1AX9A 3EXHA 4Y6PA 1G5QA 4A27A 1RQRA 3TPFA 3ZGNA 1GO2A 1TVKB 3LA8A 4ROSA 1MZVA 2HK9A 3UJDA 3DE0X 1SUCA 2D4HA 4IJVA 3MS7A 1NBMD 4XM1A 2GJ4A 3PSHA 3TB6A 4C7KA 3C8ZA 1JEYB 3H05A 4Q66C 4DLSA 1GPH1 3GDFA 3MA0A 4AN4A 1IJBA 2AVNA 3EBOA 4OHMA 1DFIA 2DUWA 3AHEA 3CKMA 1XZ8A 3HY4A 1L7NA 2CVZA 4AS1A 2GLXA 1Y3AA 3E1KA 3I6QA 5ARCA 4JJFA 4X1YB 3WFJA 4H7EA 2CLKB 4ML3A 3DDHA 3H7AA 1S7CA 1DT5A 1K8XB 2OGTA 3PYLA 4IRMA 3TWOA 5I7VA 1FNNA 2OFOA 1FK8A 4DSOA 1KWGA 3IIIA 1U0JA 1GR1A 1A9RA 1Q74A 2WB2A 2O2XA 3V4VB 5KVAA 1N78A 2C0QA 4JL6A 2O7NA 1W2WB 1T2UA 1GEEA 3RLFA 4CN8A 4F3RA 4ALLA 5ITSA 1UDCA 2ZI6A 3COPA 1UOQA 5CHYA 3K0AB 5H59A 1QIMA 1FMLA 2O6LA 5K8TA 5A6SB 1IG0A 5I7EA 2V98A 4HB0A 1QRAA 2VHQA 4YRMA 1YSCA 4RY9A 2JJQA 1PJTA 4F7WA 4WLNA 4A0GA 3VYWA 3GXOA 3IKTA 5FXMA 3FPKA 4TLMB 2G9QA 2P2GA 3H4TA 3WFIA 1CKEA 5BVHB 3A1DA 4TZ0A 2XRMA 2P6NA 1EK1A 3KQTA 1P1JA 3UUGA 3COYA 2BFBA 4AZ0A 6REQA 821PA 1DOFA 3EPRA 3FTNA 5EWJA 4DIDA 3RS9A 4EG3A 4MR8A 1E63A 1XC7A 2HJGA 4QOEA 3BM5A 1F6DA 4BO7A 2JFUA 3ELDA 4A0SA 2P9FA 3MJDA 5JANA 2RBKA 3BMCA 4EFCA 3LWDA 1T4CA 1THTA 3ZBQA 4WXRA 2AG0A 4FFWA 1ZGAA 1PJCA 1RYHA 4RH0A 1RAHA 4NWIA 4AW9A 2F67A 3MWEB 4HLUA 1NN3A 2X2EA 4LF7B 1LBTA 1T36A 1JQJC 3TZLA 5LZ2A 3RWBA 4ARAA 3HXMA 2AFIA 2BDUA 2GZ2A 2OV1A 2QL9A 4FYXA 4S24A 5DN6A 3SJAA 4KC0A 5B6JA 1HA3A 3E3NA 2PY6A 4DSUA 4UEKA 5AK6A 3T5BA 4BAGA 1NDUA 4HQRA 3TVYA 1X9IA 2FSSA 4LRTB 4FS8A 4H59A 2JI6A 3KOOA 4JI2B 3QNWA 4QA9A 3B3JA 2XMPA 5D2CA 1SRRA 1TMOA 2Z4TA 3ANMA 2WYOA 1MQSA 5BN5A 1XRRA 4ZDJA 2FDCA 3ZGZA 1E8NA 1YV9A 4NBNA 3H65A 2IXAA 4NE7A 3GJ6A 3OEEA 3ANSA 3OX1A 3TOZA 1W85B 4M9CA 2CCKA 3GAFA 3UBMA 1K5HA 2HDHA 4ZCQA 1BXZA 1Y9DA 3SGLA 2CFRA 3STUA 3T99A 2PUCA 3MCAA 4I4TA 2FHSA 1UKVY 3BD9A 1OZHA 2PO5A 4N03A 3IV6A 3HQ4O 3FBGA 2ZIVB 3EAQA 1UP7A 1ZJ6A 2XQGA 4GWGA 1FRNA 1LB1B 2IYPA 5DWQA 4QGSA 2O8DA 2CDBA 1Q3TA 4XWGA 1LRKA 4PN7A 1TTPB 5BQOA 1EG7A 3NXSA 2ECQA 3D02A 3WGNA 1XU4A 2C2ZA 4LKRA 2AEJA 1AU9A 5TDHA 2BE9A 2HT6A 4DV1B 2P6OA 2WG0A 3VDRA 1XDWA 3A4MA 4GGMX 2ODEA 3CZRA 3OF3A 5E9QA 2CUTA 3H7IA 3RSCA 3HVRA 1GGHA 1YZUA 2BL4A 4I5GA 4WFQA 4C88A 2FSVA 2NVUA 5C80A 2FGJA 3LSTA 4V0ME 1WPXA 1T15A 1B0ZA 4ES6A 3AIKA 1N2JA 3AKYA 2LIPA 1WXWA 5ALGA 1SEPA 5AKHA 3QFRA 3I04M 3DBRB 2X76A 4L4XA 4K2HA 3V8VA 4US1R 1O9BA 2H51A 2OZLB 3O1JC 4FOPA 3OLQA 4BKOA 5ELLA 1RRFA 3U4IA 3W6UA 3K05A 5ER9A 1DP4A 1M1YB 1VL5A 1TUBB 4TYWA 4I4TF 4Q05A 4KOAA 3LCMA 1E3WA 4JQYA 4LYJA 1BW9A 3GRCA 4ZU6X 5JTTA 2FEMA 1TO2E 2VT2A 3DTTA 3RC3A 4OB7A 3GPCA 1MENA 4G9EA 1C14A 2KPOA 3IYLW 4D96A 1DG3A 3OPQA 2C84A 3QITA 4N6OA 1J90A 1PJ4A 1N2BA 2O3QA 2PWZA 2QN6A 3B60A 4MJ3A 4OD0A 4QOJA 3RABA 4XARA 3T4UA 3VKWA 3RK0A 2DQYA 1CQJA 1P44A 4KFTA 4WZZA 4CMEC 3OHPA 3PGXA 4A8HA 3GGOA 1SZDA 4BNHA 2W6CX 1HNXB 1FJGB 5T5QA 4XUGB 3L0CA 2JIRA 4HDRB 5EKDA 2ZJ2A 2G72A 3K9BA 4XEHA 1G8SA 2B4TO 2HHJA 4XVCA 4DMLA 1NI4B 4EF4A 4CFYA 1QR6A 1JYSA 4INJA 4IXDA 4H6VA 2BHLA 3C70A 3IA7A 4XSVA 3QWBA 5DGIA 4AZVA 3H4IA 3QMPA 5E4TA 3AOEA 2RHJA 2PTRA 3RH0A 5J4YA 3HBJA 1KH2A 4TPKA 1Z7YA 3FTDA 4IMRA 4LCJA 4F9GA 1PGPA 3EEQA 4AJ4A 1G6HA 3RYTC 4PRKA 3OWXA 1ECGA 1P2VA 1Q0SA 2B5VA 4I14A 4NE2A 4Y2QA 5DV9A 1JFRA 3E84A 3MAAC 4L8VA 3V6LA 1ZO8A 1DNPA 2VTEA 3U2QA 4DCJA 2JJ2A 2YRFA 2VZ8A 1VYTA 1NVTA 1FX0A 4LYAA 1RWNA 5AI4A 5TVKA 1UJ4A 3G02A 3R41A 1ZSYA 3QBPA 2VJYA 1B7GO 4BEWA 4EZBA 5AW4A 2G83A 3E3MA 2RHDA 3EG9B 2CMDA 1MT3A 2FRVA 4RDCA 5IJ9A 1TEVA 3H2JA 2P1RA 4QRIA 1BXRA 5K4HA 2ZI7A 5C0OE 4FGLA 4PYMA 1I1NA 1BVYF 1A9OA 2H5EA 2B7CA 2HBRA 3DQZA 4PFJA 4QBKA 1AB5A 5UKDA 3AKEA 4F6LA 5K8UA 2ZE8A 4E5KA 1HETA 1GYPA 4X8OA 3RC8A 1FVFA 3NW9A 3HR4A 2A9JA 5AI0A 5DI3B 5FBZA 4OIMA 3RS5A 3LY8A 1P9NA 3PXCX 3ZCVA 2GN9A 5LP1A 2ATCA 4B3BA 2CXHA 3M0EA 2ZQZA 3NHLA 1PGQA 3O0DA 4F5YA 2VUUA 2LCIA 1KJWA 2FMFA 5LOVB 1DCKA 1WB4A 4AX4A 5CNIA 1CNMA 4MB2A 3I01A 3TRDA 1NUQA 3AX6A 2Z2XA 4I99A 3WLIA 5A02A 1PBTA 4ZICA 2VDVE 4JA2A 2D5IA 4H3HB 5AKYA 1ECPA 1SCKA 4KDEA 1MOPA 5AH0A 3T3DA 4YIHA 2IPLA 3D0QA 4R7ZA 3C24A 4TV8B 4C4ZA 3GT4A 2B6HA 3WV5A 6ABPA 2W8ZA 2AKAB 2M32A 2Y9PB 4ZODA 3PI7A 3HCAA 5IEJA 1KERA 4TTIA 4Q34A 3DE6X 3TOVA 2OECA 4YBRA 1CR4A 2N46A 3EZLA 3FUWA 1O5OA 1VKRA 3KT8A 4GX5A 4BQIA 2HNKA 4RK7A 1AHHA 3ZBUA 2QIOA 3KTAA 3TXXA 2QRGA 2ZBRA 2YVKA 1RRVA 1KY4A 2WWXA 4RGQA 1G19A 4APBA 1NVMB 4K9NA 3JALB 2HU7A 4C4YA 4F91B 2ENUA 2EL7A 2PZFA 4TTPA 5CXSA 5GVRA 1X80A 3TM4A 3H3JA 5IAKA 2IHUA 4ZOEA 2C96A 5HJ7A 4JXZA 4D0LB 1HE8B 1T9AA 1LSOA 4C2AA 3IFSA 1J7JA 1CIJA 5B4UA 3F6BX 2H2GA 2DAPA 2J46A 2PBZA 2X8JB 3DEZA 4O63O 3I5YA 2QG4A 2QQEA 2QY6A 1H4TA 4HMOA 1HL7A 5H70A 4M7OA 3GGPA 1MAAA 1RVV1 4CM9A 1ULZA 1RRCA 3GLGA 3LQ2A 1N33B 2J59A 1E5DA 1D9XA 1JR2A 1SU4A 2QD5A 2RHOA 3M5PA 4TL9A 3WKCA 4RTNA 4JBLA 2MSWA 3G49A 5F4ZA 1FZTA 3X3HA 1YMQA 1PVDA 3W3ZB 4LCEA 3CNEA 3IALA 2VF8A 2LWIA 3IP5A 4AY2A 2FWRA 4BJ5A 3LUCA 1LVUA 1NF2A 4LDJA 2JH8A 3DP9A 5BMVB 1AK1A 3BILA 3OOHA 5B36A 4TYPA 3IAEA 2PX5A 4FLFA 4PRYA 4Y2TA 3WB9A 5H16A 3PDUA 5P8WA 5I7SA 3R44A 3H3FA 1G66A 2IV3A 1JQ5A 2PYDA 3MOSA 4YJFA 2ZPAA 3YASA 1YH3A 1AK2A 1XGKA 3AM5A 4R41A 2B1GA 5DHAA 1T4MA 3EARA 4M2LA 5JALA 4HFNA 1GNLA 3FGNA 2CLCX 1UXHA 3ASZA 3DH0A 1DBWA 2FE1A 2X1LA 4DQVA 4M9RA 5JNWA 2WV9A 3TGLA 3VHXA 2OGWA 2WIDA 4NR0A 3BXOA 1Z7EA 3ASYA 4PZDA 1Y1LA 3D2BA 3PVCA 1LVHA 4KHZA 4AZTA 2XBLA 3IAUA 2GCEA 2JLCA 4O4IA 3VGPA 3JPYA 3MILA 1E61A 3WVNA 4ND3A 3ZQ4A 2CSUA 2ROQA 1LBSA 2C5BA 2FWMX 1YAJA 4YMIA 3W4KA 4CNQA 2W6JD 2ZAGA 3E8SA 1Y48E 4D9KA 7GPBA 1OR8A 1PTJC 2WIFA 2OHXA 3PE6A 1SR8A 5DBEX 1Z2NX 3UK0A 1KEEA 1CZLA 3U44A 3THYB 5HE9A 1Y5NA 2PMCA 2V6JA 4MMYB 3SBEA 2RKOA 3KR1A 4FGWA 4UOEA 4XX0B 5DCYA 3SQNA 4QXRA 3PE3A 3BC1A 1LFDB 3KLMX 1DBRA 5CLHA 3U0BA 1KO4A 1KIFA 2WVGA 1V16A 3H83A 1ST3A 2QBYA 1KIMA 1R9NA 2M98A 2G0AA 1WXEA 3DXXA 3DR5A 1RIIA 4XE5A 3EC1A 3T0GA 1PT8A 4JAVC 1KQNA 5HE8A 3IJEB 3OTOB 1QOQB 2ZSEA 1SUFA 3LF1A 1Z8HA 2V0NA 4JIGA 4ZVTA 3W6ZA 5HRCA 1W0JA 5D6NA 5IKMA 4RTMA 1J24A 4OHFA 2X1MA 3HFGA 4TXHA 1VL6A 1MA3A 1GQOA 3ZJTA 1XROA 4HSEA 4MOWA 4QM7A 5ADWA 3RHFA 4GX2A 3ZCQA 4DAOA 2NZJA 3K9QO 2I99A 2A1IA 3OTQA 5BUCA 3QX9A 2ZFUA 1HPLA 2VP3A 4J1TA 2BFDA 1D1PA 1KZ7B 4BMVA 3PHJA 2BFWA 2REQA 3L0YA 3N6VA 5THXA 5LQKA 2JEZA 2XQJA 5GZ1A 3PA6A 4L4SA 3E9EA 4NCIA 5F7ZA 4ZDWA 4Z1MD 1S8NA 3DL0A 4OJMX 3TLBA 1UODA 3D3WA 2Y3IA 3PDIB 2HEIA 3O1HB 4JLOA 2CDAA 2CJFA 1ZNQO 4Z9BA 4BBJA 1R6AA 4WBXC 1OV4A 3EISA 1CUEA 1R74A 3KHTA 4FSHA 4PV7A 4TWIA 1WDMA 5FTWA 3FPEA 1OLXA 1UIMA 5EUMA 2NVBA 1GTG1 2QRNA 1EUZA 5KU1A 5AXDA 2BH9A 3UY4A 1MOQA 3N74A 2QRMA 2Z2ZA 1E9AA 3HBFA 3WK5A 4NE9A 2O4UX 3ZDQA 4RC9A 3HLYA 3KVNA 1S4QA 3KG2A 3L41A 1KEZA 2ZUBA 3OT4A 1P4HA 1KR5A 4MJ7A 1Z4PX 1N9GB 1NFRA 3WNBA 4B6GA 1PFQA 4EAQA 4HRYA 2A84A 2A6PA 4FMDF 1X38A 2V6MA 4F72A 2R6CA 2ZK7A 5HCUA 1U0FA 3AJRA 3CR3C 1ZU4A 3GLSA 4LV8B 1DRUA 5P21A 1AUQA 2DH5A 1AS2A 4XSHA 1VE1A 4GI7A 1GFSA 4UXHA 3U40A 1ZL0A 2GSWA 2XUPA 2FUEA 4XYEA 3OIYA 4N3CA 4MIKA 3FKJA 3D59A 4A8PA 2ZYGA 4DA0A 4RTPA 1JWLA 4B82A 4A2CA 3WIDA 4ZI2A 3SC3A 1X8XA 1OIWA 4Y67A 2UVPA 1SNYA 3PHBE 2OORC 1Z6ZA 3B3FA 1L4MA 1DOAA 1TJ4A 3LHFA 1M73E 4TVBA 5KYVA 1MV8A 1BX1A 3N2IA 4L0CA 1GKLA 2HWKA 3QVWA 4MIYA 3QP9A 3EBPA 4QAJA 3W77A 1VSUA 1L5QA 4CU2A 4BNYA 4BASA 2LNDA 3SP1A 1PGOA 2Q3HA 4ZT3A 3GPLA 3H1AA 1R5JA 4LE1A 4D6YA 4LJ5A 5CJJA 4O5AA 4XFDA 2H3HA 1T0UA 3O26A 4G85A 1HTTA 2Z58A 3BE4A 4I9GA 2D5AA 4DUYB 5HW2A 2O1EA 5IDYA 2E6KA 1KQ3A 5EXTA 3RVOA 4QGGA 1T43A 4FDLA 2YBEA 4GYWA 5LXTB 4KWHA 5FR1A 2JHAA 1KJ8A 1J0CA 2A30A 2ISCA 2IZZA 2QPAA 1FSSA 1H8ED 1N57A 3W8NA 1ZLXA 3CVOA 5L3SB 4Q02A 3U4QA 4PLYA 3R9XB 4B33A 3MIIA 3DCYA 4URYR 2XEDA 1VPLA 1NXSA 2BPOA 3A6GA 4Q1EA 4NJOA 3U7QB 1JLRA 3K0FB 4D8YA 2WDZA 3GDGA 2DWPA 3QEKA 3GN2A 4E3WA 2WLSA 1E9RA 1ZQ9A 3OCEA 2Q5HA 3LQFA 3R23A 3DC2A 4LDPA 4EY8A 3GOQA 4YLYA 3E7DA 2QMQA 4OK6A 2GD2A 1FU8A 2P0YA 4EY5A 5LBUA 2BZ1A 3PEEA 1K8RA 1X7HA 3K0BA 1ZSNA 3ZV4A 1SC6A 5CH3A 4F71A 4TYMA 4D4JA 3E9QA 1EHCA 4UU1A 5I9MA 4QJ5A 3SC2B 1ENYA 1UBMS 3BB4A 3Q1KA 4UE6A 4F21A 3ZWCA 3CUUA 4F85A 5GAJA 1XEXA 1C3VA 1W4BA 2G71A 4C4AA 3GJSA 1TQ2A 2P9CA 4S2EA 5B37A 1H9AA 3A14A 1A4RA 3AFGA 3QY9A 4NEHB 3CWZA 4BQPA 2XHZA 5LDGA 3I6ZA 1EWRA 2GN2A 3DQQA 3NWBA 3SXJA 5BSUA 4CM4A 3JVEA 4UHKA 4D1YA 2IEYA 5D3ZA 1A1VA 1CJTC 4JMLA 1U7PA 2PJZA 5B12A 1SKYB 2B3TA 2X0KA 2X1HA 1J49A 1C2TA 5FO1A 1KQOA 3O1IC 5F2NA 1H5QA 4XTRA 4PINA 4IJ5A 1FFYA 1Q15A 2X0DA 2GZSA 5KWJA 4EKDA 4RSRA 5A5EA 1M72A 4NJMB 3KAJA 4X3CA 3JD1A 3IL2A 3LKVA 3QY0A 1E5XA 4EM6A 1QORA 3L8GA 2IOYA 3FM9A 4AUEA 1JHDA 3ETCA 3TQCA 1NUUA 3KOXA 3NWJA 4NZNA 4QYMA 1HRDA 1UBGA 3GZ4A 2BM0A 4RESA 5DM2A 1XWOA 5D5PA 4C4XA 5CFMA 4KR6A 1Q17A 2VTKA 2OLKA 3M5CA 1YU9A 2P69A 1O97D 3NAGA 3RSZA 1AF7A 1Y6JA 3ZEAA 3BSFA 4BLPA 1VPWA 2Y1EA 3I9FA 3GVXA 2VXOA 3R5XA 4BLWA 2VNHA 1P3DA 4G8DA 1B2RA 2DBRA 3ELUA 3BF8A 4J16A 4XYBA 1IVNA 4FCWA 5JSKA 1Y7IA 2BV3A 3I8SA 1D7AA 2FVYA 1RC0A 1X3LA 2HA0A 3DMRA 4NMXB 1HY3A 4X20B 5E0KB 5SYAA 2HBQA 4ZC8A 4LV6A 3OEHD 3IILA 3H17A 2HI0A 3TLGA 1CP3A 5C5DA 1QFXA 3KNZA 3KQWA 4X45A 2Q49A 4HB2A 1P62B 1ZINA 2OXRA 4HKTA 2BFCB 3INGA 4XB2A 1DEKA 3R7FA 1TJWA 1AUPA 1ZJWA 3DLBA 1CF2O 1JHPA 1RW4A 3GB9A 1J0DA 3JVVA 1EAYA 1T10A 1RP1A 2IW1A 2C5SA 1FFXA 4H1HA 2FZKA 4WN9B 5DISB 5F1PA 4AWXA 1DX6A 2FW8A 2NZYA 3RSGA 1EZZA 1GRVA 2QRVA 4GIBA 3VNUA 3RAPR 1NFFA 4LAFA 4R3WA 2JK1A 3SQMA 4EY4A 3PXXA 3QEBZ 3P4XA 3RJTA 1L4FA 1MPTA 3C97A 4OAOA 3T9BA 3S81A 4D7AA 3IP8A 5ADHA 1EFDN 2EP7A 1ADGA 1CQPA 1JXOA 4PX2A 4YYEA 4BGUA 4DJJA 1KQGA 1TGVA 5ALEA 4BMNA 4BNUA 1G6OA 1HEYA 5KOJA 1Y98A 3WS7A 3FKSD 4G86A 3ZV7A 2BRUA 1F4PA 4QQNA 3FA2A 4GBJA 3PPVA 4LYFA 1W5AA 1LY1A 2MU1A 2PS3A 4LRQA 2BFFA 2FQQA 3OKAA 3H8JA 2OK8A 13PKA 3VR4H 1E1YA 1OFTA 1SKUA 2VVTA 4MQ6A 3FZGA 5JMPA 3OVMA 3UJBA 3W6PA 4NG5A 3VVCA 1QPBA 4GMHA 4LJ7A 1C1DA 2G4VA 2GPWA 4RF5A 3D3EA 4RM2A 1T9KA 4UTXA 3VOTA 1DPGA 1NKSA 4M1OA 4AF8A 3KOMA 1NMEA 4RHXA 5L6LB 2PGNA 3MCUA 3MS4A 3OEWA 2GZDA 3IC5A 2ZI3A 3DUWA 1SJ9A 3AFMA 5CG1A 4QUJA 5EHXA 4EIWA 1EFPA 2RHTA 1NA5A 1KGSA 3I1IA 2AD5A 2UYOA 1T8RA 5E2BA 1B8OA 4RMIA 2EXXA 1OFVA 3N2NA 2WJIA 4TUYA 2BF4A 1G4AE 1UT5A 3CM0A 2OO5C 1XP5A 2AKEA 2GERA 1MAUA 1QDEA