1MH9A

Crystal structure analysis of deoxyribonucleotidase
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
RALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords deoxyribonucleotidase
publication title Crystal structure of a human mitochondrial deoxyribonucleotidase.
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2002-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1mh9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1mh9A01
4Y2UA 3SKXA 1MH9A 2D2VA 2FPWA 5AIBA 5AM3A 5AVYA 1S8OA 2WF7A 1TA0A 2R8YA 2RARA 1T9ZA 2QYHA 3FM9A 3DV9A 2JAWA 3R4CA 5AIAA 2GHQA 3ED5A 5ALUA 4OCZA 2HSZA 4DCCA 3U7FB 1LVHA 3M9LA 4BX2A 4HGNA 5AVXA 1PW5A 2OYCA 1ZD3A 2RB5A 4NWIA 3R9KA 3WK6A 2CFRA 2HF2A 4UMDA 4UM7A 2RBKA 3GYGA 1L8LA 4YH1A 1QQ6A 2G80A 3R09A 3B8EA 3EWIA 1LTQA 3MN1A 2B1QA 3QUQA 3MC1A 1Z4NA 3OCVA 3PDWA 3NIWA 4Y2VA 2AH5A 2Q4RA 4B6JA 3WK8A 1Z5UA 2G07A 1Q91A 2JAUA 3OCUA 2PKEA 5AICA 1L8OA 3WKAA 1IWOA 3WGVA 3QUTA 1L7NA 3ZTWA 1U7OA 3HLTA 3W5AA 3E8MA 2O9JA 2HHLA 3ZWKA 1YJ5A 1TJ5A 1XVIA 5A3RA 5AKGA 1QH9A 4MWOA 5IS2A 5AKZA 5ALDA 4UASA 4HGPA 3ZVLA 2O2XA 3OTQA 2C9MA 2W4MA 1U2SA 3L1UA 5AW2A 4F71A 3BA6A 3AR4A 3SHQA 4GIBA 3M1YA 1NF2A 3DNPA 1Z4KA 5ALXA 3A1DA 2PQ0A 2C8KA 5AI9A 1SU4A 3N8GA 1TE2A 3PGVA 3AR8A 4BYGA 5AM1A 2G06A 3B9RA 1YS9A 1U2TA 4H1WA 3QLEA 4C4RA 5ALTA 2NO4A 1SWVA 3L8HA 3ESRA 1EK2A 5JJBA 1CQZA 5AESA 1RLOA 1RKQA 3QU4A 2YJ3A 5T41A 1RLMA 2HX1A 4BEWA 5FP0A 1RC8A 5AW8A 2R8EA 2WF9A 2P27A 2MSNA 3U7HB 3A1CA 2FUCA 3WKEA 1L7PA 3I28A 2IOFA 3U7EB 1S2OA 4AS3A 4L57A 3ONNA 3ESQA 5ALGA 4ZEXA 3MPOA 1O03A 3NASA 3J7TA 2B1RA 1N8NA 1Z4OA 3ZTYA 5AW0A 5AW5A 4FE3A 2ZG6A 3EF0A 1NNLA 3BWVA 1K1EA 3OPXA 5AKEA 2ODAA 4C4SA 4YCLA 3SD7A 2FEAA 3ZUPA 4CF5A 4YCMA 1WR8A 5IT0A 2I55A 4UU1A 3KDPA 4XPZA 4G63A 5AKJA 3FZQA 4JDPA 3IB6A 2C88A 2YY6A 5AHXA 4NABA 4DFDA 4JB3A 3NAMA 3DAOA 1RMQA 4XE5A 3RF6A 2WF5A 4G9BA 4CE6A 3QU2A 3F9RA 4UATA 4O8CA 3AR9A 1VJRA 4PNHA 3KZXA 5AK6A 3KOOA 1Q92A 3OCWA 2EATA 5AVRA 2ZXEA 2ZOSA 3N5KA 4ZEVA 4HGOA 2IA5A 5E0OA 5AI5A 1Z4LA 1XP5A 2AUTA 2FDRA 1U02A 4UW9A 5ALFA 1ZRNA 2B82A 3ZW7A 3WK7A 1WVIA 2YJ5A 4Y2RA 5ALPA 3QXGA 2VKQA 2IYEA 3MMZA 4J03A 5ALRA 4F72A 2HI0A 3QU7A 3N07A 3WKCA 2NO5A 3L0YA 5AI8A 1RQLA 1YV9A 2CFTA 1NRWA 2WHEA 3U19A 4IFTA 1FEZA 3QU9A 3PCTA 3SLRA 2B8EA 4DW8A 3W5CA 4UMFA 3AR3A 2CFSA 3ZWDA 5ALWA 2B0CA 3QUBA 3UMCA 5ALKA 2YJ6A 4NV0A 4Y2QA 3WK5A 2OM6A 2WF8A 4UU0A 4YCNA 3FVVA 3L5KA 2HOQA 2CN1A 2EARA 2HF7A 2PR7A 5ALOA 1U7PA 5AVTA 3KC2A 2AMYA 3I1YA 4ZEWA 3QX7A 5AW6A 3N28A 4NFLA 2FPSA 2HO4A 3FPSA 2HDOA 5AK4A 1SWWA 1WPGA 1Z4JA 5IT4A 2DQSA 4UMEA 1ZD5A 4OD0A 3ZVNA 3ZU6A 4DWOA 4UAVA 5A3SA 3QNMA 4Y2XA 2B30A 3WGUA 4UAUA 3WK4A 5AW9A 5ALHA 3IRUA 3KBBA 3N1UA 1RQNA 5AVQA 3ET5A 3U26A 5AI6A 3ZX5A 2YMQA 1ZRMA 3AR6A 2W11A 3EPRA 3AR7A 3NANA 3L8GA 3UMBA 4KNWA 2IOFK 5ALYA 4J2TA 4XOUA 3E81A 3FPBA 3A3YA 3KD3A 3HYCA 5AM2A 2G0AA 2I33A 4I9GA 1JUDA 3CZ4A 4BX0A 5ALZA 4RESA 4HGQA 4EZEA 4MUMA 5AVWA 2JARA 2P9JA 2FPRA 2ZBFA 5AI4A 2R8XA 3L7YA 1RPZA 4L6CA 2FPUA 4I9FA 5AVZA 1T5SA 4YIKA 3AR2A 1L6RA 2IOHA 1N9KA 3E58A 1O08A 2FI1A 4EELA 2BDUA 2WM8A 5AW1A 5ALQA 2JAOA 1WZCA 3QUCA 4EX6A 1QQ7A 1Z5GA 4OHFA 5AKIA 4EX7A 1VFPA 3UM9A 5ALJA 1YDFA 2GMWA 3L0CA 2OBBA 1Y8AA 2YBDA 2ZBDA 4NAVA 2HEGA 2GHTA 1QYIA 4BEVA 2YJ4A 1RKVA 5AK3A 2P11A 3AR5A 1RRCA 1Z4IA 1Z88A 2BDEA 4Y2PA 1EK1A 2NYVA 3I6BA 2FUEA 3FGOA 3RFUA 3EF1A 5AKXA 1QQ5A 1Z4PX 2FPXA 4QQFA 3UMGA 4OFZA 2Q4TA 3B9BA 2BY4A 1J8DA 2HCFA 1RDFA 4L6AA 5AW7A 2GFHA 2I34A 3L1VA 3U13A 4UM5A 4YGYA 4KNVA 5AVUA 3D6JA 3K1ZA 3NALA 4Y2YA 4CF4A 5ALNA 4FFDA 5A3QA 2WF6A 3W5BA 4KX3A 3U7GA 5AW4A 2G08A 3ET4A 3L8EA 4KN8A 4Y2JA 4BBJA 4CF3A 2JGAA 4RETA 5AKLA 2ZBGA 5AKKA 2YMLA 1TJ4A 1RMYA 1T5TA 2R8ZA 1Z4MA 4FYPA 4XQ0A 4BNDB 5AK5A 1CR6A 2AGVA 2EAUA 5AM0A 3ZI4A 4AP9A 1L7MA 2G09A 1YMQA 1TJ3A 2YMPA 3WKDA 3VAYA 5AVSA 4EENA 3ZVMA 3IJ5A 1ZS9A 5AW3A 4E88A 3P96A 3QGMA 5AVVA 1ZD4A 3OCYA 1RKUA 4BNDA 4GXTA 1XPJA 1KYTA 2ZBEA 2G1AA 3CNHA 4QJBA 4AS2A 2P69A 5AI0A 1VJ5A 4BX3A 1F5SA 2Q5EA 4HGRA 4EEKA 1ZD2P 2C8LA 5ALEA 4HAIA 2RAVA 1AQ6A 5ALLA 3WKBA 1ZOLA 3E84A 5AM4A 3QU5A 2YN4A 4C4TA 4Y3UA 1YNSA 4HYTA 5AKHA 2MU1A 2I7DA 3L8FA 4IG4A 3NUQA 1RMTA 5AM5A 5ALVA 4KYTA 3PGLA 3I76A 3NRJA 3DDHA 1ZJJA 3SF0A 3QYPA 2B8JA 3ZX4A 3SKYA 3L0BA 4KX5A 1RLTA 3SMVA 1Z4QA 4YIHA 2YFYA 3WK9A 4UMVA 2I6XA 2C4NA 1J97A 3TLMA 3A1EA 1X42A 4BKMA 2YMMA 2WFAA 3S6JA 5ALIA 3OCXA 5ALSA 2OA0A 4CNQA 2X4DA 2QLTA 5AKYA 4Y2SA 3W5DA 3OCZA 4UARA 2I54A 2W43A 2GO7A 1L7OA 4Y2TA 5ALMA
chains in the Genus database with same CATH superfamily
3ZY3A 3DLHA 4JLAA 2IWHA 3S1AB 4RABA 4XWOA 4RD0A 2FMHA 4F4UA 2RGXA 3NHFA 1JF8A 2NU7A 2VDWA 3BMNB 1VXOA 3D31A 3GEIA 3T1NA 1S2GA 1YBFA 2NSDA 1NVDA 3MT0A 2HGSA 1TA0A 3DBHA 3QM1A 4IGIA 3HB9A 1OI7A 4N0PA 3VHQA 4AKGA 3OJ0A 2NX2A 2JAWA 5FA6A 1KOGA 1CUWA 2IC5A 2LIPA 4RDIA 4WVLA 3LHKA 1OGJA 2GHQA 4B31A 4OCZA 2WLSA 2V4ZA 4PXYA 2OKGA 3JSXA 4MITA 4PZZA 2GPAA 5FFMA 5CBPB 3A3PA 3BE4A 4FMCF 4IINA 4N54A 4DUYB 5FPHA 2CYAA 3HM2A 2XGMA 1ZK1A 3IX7A 1LI7A 1VMKA 2RC6A 3UJ3X 5CDHA 1QRUA 1E2HA 1NP6A 2OYCA 4Z7QB 3NX4A 2M9MA 2V6MA 3D3QA 3MJ4A 3I64A 2BFCB 2CFRA 2EW1A 5CEFA 3BL5A 3C8DA 4DZTA 1YRWA 3O47A 5L3ZA 4CDNA 1RIFA 1KRHA 4ENVA 4DA0A 2RBKA 2GD6A 2GRUA 1QQTA 2IH4A 2V0CA 3LXMA 3ESAA 4B45A 1JU9A 1XKQA 3B8EA 3EWIA 1ID8A 1IK4A 2CLOB 4HEA1 1CQIB 4X8LA 5EJGA 2EHDA 2V9ZA 2AYZA 1THZA 2D4AA 3NHYA 4GMGA 4H31A 2QHXA 5M7EA 3DVSX 4F2DA 1W4CA 1EH5A 1YD7A 3RIMA 2D2FA 4B2YA 1HURA 2ZSDA 3PD0A 2FMTA 3ZE0B 3JRNA 2DPGA 1FRVA 3N75A 3T5AA 3PF9A 3V9PA 2H4FA 2EOAA 4I5DA 5FI5A 3U1BA 4OJYA 4GM4A 1GGFA 2HHLA 3C6QA 2G4VA 4RZIA 5KTOA 5DGXA 3LZ6A 1K86A 5HR5A 1USVA 2RHLA 4MB6A 4C2BA 1TKCA 1I0LA 1WEHA 5DXAA 4GOKA 5LQNA 3SYRA 3C8HA 3LQYA 1SK8A 3AETA 4KTTE 3LC0A 3ZGYA 1PZMA 1TU3A 4MV9A 3KQUA 3L7BA 3L2OB 1XMVA 4BV3A 2XBUA 3RRBA 3T7AA 3LVQE 3EXAA 1USIA 5ANRB 5EPEA 1P9RA 3K1TA 3S2IA 3R75A 3M83A 4KDEA 2XGSA 4RADA 4V39A 2CMFA 4EG6A 1U8EA 3MOIA 1W0KA 3C6MA 2H3HA 1EFTA 2DCUA 2CXOA 1TVKA 3GW8A 4JYMA 4GBMA 3ZDCA 3PKZA 4ZO9A 1OBHA 3KKLA 1T4CB 3K72B 5BWNA 3WRWA 1F7VA 2F3RA 4FU0A 1JILA 1J20A 3JATA 1CRQA 3SYLA 2Z95A 4RZ2A 3B9PA 3ZE6A 3GGSA 4R81A 2Y92A 2FP4B 2ZUTA 4M9CA 3CW8X 3AF4A 5IJ9A 5JAOA 1MB2A 4EGCB 1XXHB 2AXQA 1SHTX 4APBA 4BO4A 3WGIA 2D3TA 4DJTA 4L8LA 3LNTA 4C4OA 1J21A 1ZW1A 1S2IA 2MIIA 5EQJB 1NN1A 1S7GA 1X39A 3ZKAA 4NOJA 3EXIA 3BXHA 2OK7A 3PDHA 2DG2A 5EWMA 4ETMA 4GSYA 3S2GA 2A88A 4TVBA 1EDEA 4MS1A 3WFJA 3LG2A 3BORA 1BS2A 3MLAA 4HXGA 4WZ6A 1D1PA 1T5BA 2NU9B 3MMPA 3RUCA 1DFGA 1KFKB 5AJVB 2BISA 3K8ZA 1D6JA 3JCZA 1JT2A 1T36B 4QHSA 2HBQA 3FWHA 1XU4A 1BCRA 2RMKA 3GDWA 1VLQA 4AO6A 3PNQA 2CD7A 2GVNA 1GWNA 1FXSA 1NF3A 1QGZA 3LXUX 3BE6A 1V9SA 2OXEA 2QRGA 3T9CA 2PVSA 4YRCA 1HDCA 1W52X 2OCAA 3M1LA 3UWDA 1KIAA 3CB4A 1CUGA 4ZOCA 1P1JA 4U7GA 2PUDA 1XELA 1EBFA 4ZVSA 4XEHA 1OFGA 3K96A 4ZK2A 5CA1F 3T7CA 16PKA 4QOJA 2HMTA 1GV1A 3R7BA 2V7PA 3I2KA 3BMCA 3KTOA 4ACBA 4PHCA 1II0A 4X0EA 1S1CA 1PZXA 2AR0A 3KU4A 3KOYA 3V4PB 3DF7A 1I3NA 1BOFA 2YIMA 3FZQA 4HNAB 4JDPA 4KQ9A 4Z8YA 4G0OA 3SIPA 3X1JA 1C9NA 1GU0A 1MC8A 4I6JA 2PWAA 4PONA 2O07A 2Q2VA 4NABA 3A10A 1DDGA 2OENG 4I8DA 1CQJB 4OJNA 3VOAA 4ARUA 5JRJA 2I3AA 3K0FA 2X2EA 4UNPA 3RF6A 1DDOA 2RB4A 3VVLA 2ZR9A 4MUGA 1PEKE 1YFZA 4ZPXA 4DS3A 3LSYA 3AV3A 4DGQA 3EA0A 3MJRA 4DILA 2PX2A 1GZ6A 3HBLA 3M6MD 4L2IA 2BFPA 5C32A 2CNWD 4FGUA 3R74A 3D8UA 3DTYA 5LXTB 3PRKE 3WHPA 5E6SB 3OTGA 3N59A 4BWFB 4F21A 4TYWA 4GYJA 3EIXA 4HXFB 2QM0A 4WSOA 1V5EA 3STYA 4CMKA 4MWEA 3TRIA 3C3PA 4LHEA 2FG7C 4F5YA 4IDFA 2FW0A 5BRAA 5C5DA 2IA5A 2JAPA 1KKMA 4MAFA 1E60A 1JLKA 1GU1A 3ROKA 3VTAA 2W2KB 4H1VA 4DDHA 1NN5A 4JS0A 3FW1A 3QLVA 5FPYA 2C97A 2DQ4A 4ZREA 3CVXA 4NS1A 4IOMA 1A9QA 2J87A 2OFFA 4PFJA 5DWQA 5L51A 2CCKA 3IHTA 5H4HA 2E5WA 4OQYA 1DSSG 1EKXA 4EBFA 3QXGA 1RWKA 4LYYA 1E0SA 1G0NA 1QE0A 1A4XA 1W6RA 3RWOA 1DAOA 4FSXA 5D01A 4I50B 1HEUA 1II8B 1P7CA 1SUCA 1YOVB 2OOKA 3I9MA 3O73A 3QTTA 1Y1PA 4CM3A 2BYTA 3KB6A 1QYVA 4QOGA 5EWJA 1QVAA 2C5SA 4I6GA 2WSBA 4XFDA 5C1DA 4R6XA 3DMRA 4GL4A 2M6SA 2QF7A 4G5QA 2IXGA 4RL6A 2RC5A 4MKFA 3MCVA 1K75A 1SG9A 3TM5A 1I10A 1NQ5A 2GVDC 1FEZA 3JZFA 4E12A 2WV9A 4LA4A 4G25A 4EW3A 4I99A 4C04A 4IDAA 4UBJA 4YRIA 4LQ4A 2RGRA 1N5MA 1Y3HA 2GEUA 3IXLA 2WHYA 2TMGA 4HYEA 1JQ5A 1FDVA 3N87A 4EY3A 3GELA 4X00A 4OI1A 1DC6A 1Q7TA 1LI4A 2ZWPA 5BR4A 1UMDB 3HJTA 1B1AA 1PT9A 1IAVA 3DV0A 2OZLA 4FQ5A 2H2DA 3KYBA 3WGHA 2V7GA 3T12A 1J1ZA 3ZLTA 1H8ED 1PJ2A 4ZTZB 4XOIA 5K0NA 1EI9A 3A3OA 4OSOA 1G2PA 1GKKA 1AV6A 3C3WA 2O14A 3R6WA 4LXXA 3F8SA 1T25A 3LY7A 1QGED 4N3BA 1FTQA 1NJSA 1TB4A 1Z13A 2DGDA 2HA3A 2OV2A 3D02A 3B53X 3GGDA 3NP9A 4HG2A 5BSTA 1OGYA 4ECAA 1NUTA 2PFGA 1N8TA 2Q9UA 5IARA 4OH1A 4EMTA 2IU6A 1OYVA 2MSLA 3KKZA 2AW5A 2I7XA 3FYUA 4F96A 3OZAA 1ONOA 2E49A 2EBHX 1LVUA 2ZUVA 3PJFA 1ZD5A 2VYQA 4JFAA 1PJ4A 3KLMX 4EQ6B 1UDBA 1VL6A 2FLWA 4Z4FA 1BWSA 4M0DA 1UKAA 1DO0A 1K2WA 2AD5A 1KH3A 1W88B 3L06A 2FPLA 4Y2XA 1KEVA 4INJA 3CGWA 2OP0A 3WGUA 5CT9A 3M4ZA 2ILTA 4IJVA 1YUBA 3QA9A 4XUDA 2JATA 3BWEA 4EGSA 4JHLA 4CGYA 2JLSA 5GJBA 2Q50A 3GIWA 2ZB2A 4AUKA 1TT5A 2H92A 3WJAA 1BDIA 1MOZA 4EYEA 1B6SA 1N9GA 3ROFA 4PAOA 1ZN7A 4KUGA 2GLTA 3K5PA 3A4IA 2YMQA 1SXJA 1Y7LA 2X6TA 2W11A 3NC0C 2BFEB 2WY2D 1M7HA 1SC3A 1U99A 5DK6A 2JZCA 3IO5A 1T24A 5TT0A 3OEYA 1TGYA 1NBWB 1QUFA 1MT3A 3AP1A 5LIPA 1JFFA 1M5TA 1P6UA 3LZDA 5CNIA 1NSFA 1Q1NA 3K1AA 4IW3B 4B3GA 5G0VA 1CJSA 1E9SA 4WEQA 3KLNA 3QF7A 4DQKA 2VVTA 5ERXA 2IHKA 3F9CA 5ALZA 5B1YA 2QUAA 1P0IA 4M98A 1I4TD 3WIDA 3BXGA 2WAOA 1PQUA 4JC4A 5DYGA 1N32B 5H81A 4JKOA 1KWGA 3A9VA 2WTEA 4PC3A 2CZQA 1Z3CA 2WUVA 5IAOA 1W8DA 3HM9A 3VZSA 1U90A 3DMYA 3D6NB 5ESDA 1U7DA 6PFKA 2D5AA 1ZI9A 5KTSA 2MHCA 3WMWA 3FNGA 2QW1A 3IJPA 4OM8A 1C9JA 1W7AA 3W7VA 2CFCA 1UJ6A 2PGNA 4RVCA 4F6RA 1WZCA 1G19A 4QDXA 2R44A 1Q83A 4MR9A 5IZCA 3ZCTA 3O38A 1N2JA 2H4YA 2IEZA 2RAFA 4QYWA 2LVBA 2FPKA 1O8BA 4EJSC 2CHGA 1RWOA 3HA5A 5HF8A 4GPAA 1UAGA 4OM7A 1C7JA 3M81A 1VBFA 2F67A 2BCEA 4JA2A 1H2XA 3CRRA 1NF9A 3USZA 1K6EA 1XCLA 4LZLA 4BEVA 4Q3LA 2Z98A 4MX2A 3C45A 4TVSA 5DN6D 2NYVA 1R0WA 2JF0A 1WUHS 2FUEA 3OOJA 3OOYA 3EF1A 3X44A 1BRTA 3V1TC 1UOEA 1JB1A 3PL5A 1GG9A 4TKLA 3IUMA 2Y0CA 1GXSB 4KXQA 4WRRA 4ZP1A 2O0KA 1MXHA 4CG2A 4O2AA 2CVQA 1P80A 4GEGA 3NQ41 5EHIA 1RDFA 4MA4A 3V7FA 1NBMA 2CHVA 1ZZGA 2ODNA 1OX5A 2RGEA 2XDQB 4TRRA 4WKCA 3Q2KA 3SZLA 3WGGA 3OQMA 2O50A 2C58A 3PXGA 5HKKD 1EVZA 2WWTA 4JEUA 5LVAA 4UCQA 1QE5A 4C0QC 3B78A 4RZHA 3UVEA 1JA0A 3UAZA 4DXAA 1QHFA 4F9EA 3J81k 5D6NA 1EP3B 1AK2A 4KZPA 3M0EA 2GUGA 4CI9A 3KVRA 5I7FA 1X1RA 2B9VA 5IABA 4RJLA 1OUMA 1X7WB 3E3AA 4NFSA 5JC1A 4MYRA 4EL5A 3TVDA 3QWIA 4YUVA 4DANA 2JGAA 4YV0A 1P7VA 1W5EA 5KNDD 2KS6A 4WLEA 1T3HA 2GM9A 4QDOA 4JXZA 1LJUA 3C39A 3OURA 1T6ZA 1WPRA 4YJHB 4KWIA 2PH7A 3OFND 5F64A 5KSOA 2PJRA 4PGHA 5FTLA 2H07A 3QVUA 3RUPA 2QAJA 3SHFA 4RLHA 3VKFA 4D4JA 3IAXA 1QRSA 4MQEA 2R4TA 1XEXB 3PYLA 2AI1A 2O2JA 4NBTA 2ZQYA 1W75A 1EK5A 2FX3A 1PLLA 1DQNA 1YVDA 1NYRA 1TM3E 1M1UA 1RYDA 1IY0A 2PJUA 3W8RA 5FLEX 4HWTA 3L02A 2HN9A 2A1TS 3DE2X 3TIXB 3EZFA 2XECA 3OMLA 4A6XA 3ZCRA 2VDQB 3GT4A 3ZS8A 4MHSA 1P9OA 3CZRA 4LVOA 3OHMA 1UBHS 1YMVA 4IHAA 4HN9A 5REQA 1XMOB 1Y9JA 3RRMA 1OE0A 4UNNA 4B3JA 1MVNA 2Z5LA 5DTMA 3L6DA 3V2IA 8MHTA 3C3DA 1CT9A 3LVRE 1I7DA 2Q2QA 4G56A 2CVPA 5DIZA 1RC0A 1ZXLA 2GAOA 2NUAB 1JG3A 3T06B 3X43A 2W4QA 2HCRA 2XVMA 5AXAA 4RMJA 2IW1A 2QTVB 3VPFA 5K9ZA 4OYRA 2A0XA 1Y3CE 3WJ1A 1F4LA 3CH6A 5FULA 4ZYWA 3O0TA 2UUPA 3UAVA 1RWNA 2C3UA 1Z0AA 4LRYA 4WV3A 3RU2A 2JASA 5BR8B 1A1SA 1EJBA 4BNTA 1W4RA 4OB7A 4ILEA 4GXQA 4WI1A 2IHNA 3VH3A 1NMYA 5LMCA 1Y5IA 3BFXA 1XTBA 2HIHA 1M0WA 4MPPA 1PL8A 3SKYA 3L0BA 3SR0A 3VDXA 2KJQA 1RLTA 2FE1A 4R5HA 3Q0EA 4BO9A 3WBBA 4Z1OA 3HR4A 4JI6B 5LYYA 1V0JA 1DOFA 3MUOA 1XPUA 3DE3X 1ZH6A 5TDHA 3EDQA 5EHZA 3PHIA 5T6BA 2O6HA 5C8YA 1A9ZA 1YFJA 1QAMA 1BDJA 1TYCA 2Q2NA 5EXEA 1GPH1 2X4DA 2AC2A 4FZRA 4H7KA 3STTA 1P9NA 4F8EA 2KBEA 3UK1A 4QUHA 1GFIA 1TAHA 5K0JA 3AVTA 2CLEB 2HYDA 2QT9A 1VHTA 2FWNA 3N7UA 2D8AA 3OHPA 2ZWVA 5B2EA 4UHCA 3VSEA 3H2YA 4CMEC 3AKEA 1QLWA 3CX3A 4L7QA 1SZPA 2PTQA 5JW6A 1QTNA 1O77A 2RHMA 3N58A 3R5FA 1S2DA 4AYTA 1WMFA 3I30X 4CCYB 5GIOE 5EJ4A 4WH0A 4ZT2A 2EVWX 3AHDA 3KKKA 1PP4A 2AEMA 1SKQA 3L7DA 2YHAA 3U4MA 3DFFA 4C22A 3OZBA 4AURA 3JARA 1DKPA 3ETDA 221PA 4MPJA 5LU9A 1SR8A 5JZBA 2W6ID 1JJFA 3EDYA 4JR2A 1M7BA 1TQ2A 3LYLA 3OLYA 4FYYA 4MVCA 4HGNA 4S3MA 1MRZA 2X41A 4Z86A 3H2JA 4NTZA 1TAGA 1MF7A 2AYYA 4K40A 4AUMA 4FYMA 2Z30A 4UCFA 3HBJA 3VA7A 2TRSB 4DR7B 4GPBA 1FRNA 3R9KA 1U80A 1KRWA 1CS0A 3P1JA 2QJTA 4RELA 1JLRA 4ED9A 2R3SA 3F6BX 4L4UA 3URKA 4B0OA 4F5WA 3HSYA 4GEKA 5BQ3A 1ORWA 4R4JA 1EESA 3PDWA 1T0JB 1G291 2G9UA 4TKVA 4AY2A 1OX4A 4R2LA 5FR2A 3V8PA 4O2BF 1LX7A 4LI0A 1F8FA 5KC8A 3RS3A 2HHJA 2PKEA 1YQGA 2ODTX 4WY5A 2ZGVA 4WY8A 1IUKA 2W6OA 3AETB 2ZTVA 3GRKA 4ZU3A 3TQRA 5BMOA 4CMGA 1I6MA 4WX2B 2QZSA 2P4EA 2O7RA 1F9AA 1XF1A 5ECGC 1IWPB 3QJGA 2G76A 4K46A 4Q3KA 2RGDA 4ZVUA 5A0TA 5TT1A 4CKBA 5I47A 1XMIA 5A3RA 1WW8A 3A6FA 1GGJA 2QQGA 2J3JA 1CIJA 2PKCA 2XQKA 5DFAA 3WWEA 5HIKA 4HATA 4MWOA 2FZKA 1F4VA 4DV3B 1Q0HA 1NE7A 1TVKB 1QIDA 1UFKA 4FHEA 4CMHA 1IN4A 1RCTE 3GRZA 4P4SB 4G26A 3PNLA 4XIYA 2A9FA 4LHVA 1ZSYA 2D4HA 1KTIA 3B3QA 3AR4A 3ID6C 2JFOA 1AGRA 1FNSA 1KI3A 2X1MA 3MERA 4H4DA 1XTIA 2GASA 4ZRMA 2JJ8A 4M3NA 1O95D 1DS6A 5IJ9B 4JLOA 4IFBA 2GJ4A 2OV4A 3U61B 1UZNA 1CFZA 1XAIA 2VP0A 3G5UA 3N6VA 4G97A 3TLXA 3W2HA 4HGVA 1C2TA 2QENA 3LOUA 3MTGA 4B84A 4QOHA 5HG0A 3GLHB 3R6GA 4NC9A 3EXIB 2B6HA 1C3OA 5EWMB 2DYKA 3IAM6 5JJBA 4MS1B 3KIPA 1RLOA 1YA8A 3Q85A 2HWUA 4O1IA 3RQIA 3DYVA 3MRTA 4IX9A 3RTCA 1RKQA 1JTEA 5EPUA 4LJ4A 1LBTA 3L7IA 1ZIOA 2RHCA 3S2SA 2ZT7A 5I9MA 3P8ZA 1BCRB 3EK2A 4IRXA 1POXA 3EW7A 2W6JA 5DYYA 2E89A 4BVEA 3QHPA 2O48X 3LCJA 1F3OA 2HIAA 5LZ8A 1E6MA 4G67A 3OQ6A 1HNZB 2CXSA 2YVLA 1LZKA 2DKFA 1RJDA 1DKOA 1LBIA 4NCIA 3EEIA 3TR6A 1VXRA 1XR3A 4BYMA 4JSRA 1NI4A 1R0BA 3AB7A 3L0PA 5ALGA 4KACA 4Q4AA 1I7SB 2BTOA 2C2BA 1FQOA 4EK9A 3OOSA 2LE0A 3RYHA 3U17A 2XTMA 2AXEA 4G5FA 3S5UA 4YRSA 3FJOA 4IUYA 1E8MA 2PUJA 1RYBA 2W6PA 4OOFA 3ECAA 2P2ZA 4H16A 1IY1A 3ZTYA 5I45A 1SUEA 2H52A 2LUOA 4G24A 4FE3A 2IZ1A 3BJZA 4O4IA 1E2JA 3GQBA 2CLKB 3WMGA 2VTBA 3KNZA 4GPZA 1JEDA 1KERA 4DMLA 1BCSA 3HRIA 4QDZA 3TSYA 2ODAA 2XUIA 3RAJA 4QDTA 3C1AA 4HDNA 4HY3A 5LMUB 4CLRA 1PYOA 3EBLA 4L2IB 1WQ4A 3TW4A 3PYXA 1GHTA 4KQMA 4MV0A 3K8QA 2X9LA 2C88A 2YY6A 3OIDA 1O94C 2BCGY 3VNUA 3FOWA 4I6EA 3KZVA 5AVOA 2BGTA 5CFRA 3ECSA 3H4MA 3SC2A 2QTHA 4GECA 1R5JA 4K6HA 4OHWA 1GR1A 3SU8A 4KHPB 2SKEA 4PWZA 3HCCA 5C31A 3JTMA 4X8MA 2C2WA 3EISA 4HUQA 4DLAA 5TLSA 1NJ2A 4BXOB 1DIGA 4UATA 3LRPA 4M88A 4AF7A 4CEHA 1W2HA 4MKIA 4IQ0A 1DAPA 3AUAA 3TLZA 4EG5A 4B7AA 1PTJA 2GBIA 4F04A 1LVGA 1YRAA 5CAEA 3DE4X 3KOWA 1SOMA 1GNLA 4NCXA 3V4FA 3ZE7A 1FJGB 3GHYA 1X80B 1ZGAA 2GSDA 4URVR 1IK6A 4RVOA 5T8KC 1N92A 3MQ4A 2VK1A 4LISA 2FFJA 2Z04A 4JB8A 4L8VA 3ZC3A 4ERNA 2R87A 2BI8A 1PG5A 1N3BA 1RR6A 2Z6VA 5EWJB 5FOUA 1T13A 4ZJUA 1XDWA 1FSSA 4KRGA 4NPAA 3TD9A 1U02A 3PR2B 5E2BA 3TPZA 3ZW7A 3ZV7A 2B36A 2CUZA 2GX6A 4L5JA 3ZE1B 3GJQA 4F38A 2GTPA 2XNKA 4H77A 1OOEA 1QGYA 1EE1A 1VB5A 3L05A 1AXEA 3TLBA 1XAHA 2WWXA 1A8UA 1U0RA 3ZWBA 5AI8A 4S1PA 4JLWA 5AD1A 1DIBA 1DKRA 4R1TA 3LCUA 4YUWA 4I7EA 1H66A 1C41A 3RJ5A 1FP2A 3FKSD 3O8CA 1BX3A 1GARA 3OQIB 4N76A 2NU8A 1QTRA 1WTAA 1YQTA 3DMDA 4HP8A 3OBBA 1NOJA 4KXWA 2VWHA 1E7SA 3OKFA 1IXSB 4IY1A 4CKYA 2CZGA 5LQAA 2QZJA 3PQCA 2F3PA 4OL9A 1PD1A 3HE3A 5CXXA 3V5NA 5FV4A 4WLVA 2DFVA 2FU5C 2PWZA 2C0QA 3KWLA 3VDRA 1XROA 2NV0A 4DQVA 3BRCA 2Y1WA 1NDUA 4NQZA 1N6RA 1REQA 2IH5A 2H2AA 1MOSA 4D42A 5KINB 4AW9A 2XZPA 3U5ZB 2AFRA 1CNEA 4RK7A 3BH6A 4KSYA 1JEEA 1ULZA 1DV2A 2HLDD 3CINA 1EEXB 3BBPA 4O29A 4DNXA 1UPFA 2PH3A 1II9A 1UC5B 5CT5A 4BFUA 4X7MA 4QM6A 4LJ9A 2ZIFA 1HX7A 3EY4A 4G4IA 2IF0A 4H7PA 3QX7A 2OQVA 3AFGA 2OWDA 5TPZD 4FEEA 1XE3A 1NC1A 1NW4A 2CF5A 2PLNA 3I4LA 5H59A 3RODA 1SKMA 1W48A 4IP0A 4ZT7A 2GZMA 2V0NA 1GZDA 1TT5B 3HC7A 4GNKA 2CHUA 4MWBA 5DCWA 1GPJA 2LD4A 2WPDA 4D5EA 1N9GB 4I1UA 3GZTB 4AG6A 1SXJB 3B1KA 3RO7A 1I2CA 3CGGA 4UBIA 3TKLA 1KXZA 4OA5A 1VMEA 3ZCQA 1MIOA 4EDFA 4ZHQB 2J9YB 2D1RA 3VR2A 1VOTA 3EDMA 1KC1A 2QT1A 1CZOA 1FFWA 1JFFB 1G8JA 1PR5A 3O84A 4NU8X 5BQOA 4Z4HA 2ESRA 1X19A 4LXQA 3GAAA 3UOGA 1YZUA 1Q1EA 3DVLA 2ABWA 4X1OA 1VIMA 3AC0A 3CZMA 4AZ3A 2GFIA 3T4XA 1DJOA 3RYTC 1GDTA 3CPJB 2OBLA 3E3LA 2Q5IA 2IYQA 4OK3A 3V80A 3HRHA 2HADA 1CUIA 2N47A 2GR9A 3HBFA 4N7MA 2CJWA 5BN1A 5LKRA 1RJ9A 4ZKDA 1EB8A 1GZ3A 3GMTA 2XEDA 3EJWA 4QFCA 4TMWA 2HDHA 3IP5A 3NG1A 4AG5A 3ZLVA 4H4EA 3ASVA 3E8SA 5KNCH 5FL7A 3HS3A 1UF9A 2OGSA 3OP1A 3QENA 4MP8A 5E0KB 3WHLA 1SKBA 5JU6A 2E7ZA 3C8UA 3GWZA 3G17A 3SQNA 4Q39A 1C4OA 3F4BA 1T26A 4PBSA 4LK2A 2GEKA 3M49A 5E8RA 2XUDA 2FX5A 2ZR8A 4F6RB 4BFCA 3FI9A 5AVWA 2QD5A 3LAWA 4MR9B 5CT6A 3AW8A 1ZGZA 5T3YA 1DEXA 1V8FA 3S5JA 3WIVA 3INRA 4DM7A 1CUZA 2NSJA 2QB5A 2JI6A 5KWJA 1O8CA 1JIKA 4Y2HA 2ZZNA 5BW8A 2P9TA 3QV1A 3NTVA 3HXOA 2IODA 4OATA 2W70A 4UPDA 1VL1A 1ZR4A 1JVNA 1RRKA 3H83A 4K87A 4WOBA 3V32A 5H02A 4O4LF 4R0NA 3EQZA 4DMRA 2W2LA 1VQ1A 2RKOA 1I1QB 1EBBA 3I5UA 2YFKA 3LGSA 1AE1A 5CNMA 3UM9A 1U4OA 4O2AB 4N3AA 1N5RA 3VHLB 1DPFA 3NDPA 1OPXA 3DHEA 1GSOA 3O93A 1PV1A 4IQ4A 3JD4A 1K63A 1G6KA 2E48A 3OUUA 4RMNA 2VWPA 5JJLA 1D5CA 4IHJB 3UWOA 4CDRA 1JLLA 1FNCA 3IQXA 1YJAA 5CJ2A 4XGIA 1Z5WA 2XTJA 1A8PA 4OFZA 5DU2A 2XUGA 3BUSA 2FDXA 5EEHA 2IE8A 4GZ6A 1J2TA 4NDAA 1S89A 2HRZA 2WTNA 1S2MA 3SE7A 1QS0B 4I81A 1Z35A 4QOIA 1E9AA 4H7IA 3QBDA 2H1WA 2NYUA 1UPAA 4GX2A 3UT6A 1QZ3A 1IHPA 4ZGBA 1QGUA 1UKVY 4XWGA 4JEHA 3RTAA 2HSJA 1OH8A 1RXIA 2A1UA 1NHGA 4MUEA 3RU7A 1SOWA 4HDAA 4JX9A 1HDRA 2FSVC 5E9QA 5DP1A 1ST3A 2IXTA 2NTVA 2OCKA 2ZWIA 2OLEA 2UAGA 1KYVA 3H9JA 2I7TA 5EESA 4OFBA 2A9PA 2V5UA 3VVCA 1ZINA 4RFSB 3AFHA 4YDQA 1IEQA 2RI1A 3FFBA 1KL7A 2R4UA 3AO0B 4MRSA 4MHOA 3NCHA 4MQEB 3PZBA 4Y3UA 4HN2A 4ATNA 1LNZA 4N41A 3E7DA 1ZR2A 3UJ7A 1P5RA 3DYBA 4HNTA 1NF8A 5HJ2A 2JIZD 3KJFA 1K27A 1VBKA 5I8WA 1AX9A 5JZSA 3A27A 1XEWY 4XIGS 4BDSA 4OUKX 1DX4A 1A7JA 1PQ4A 3ILHA 2ECQA 3HQ4O 5AK5A 4Z1MA 3H0EA 2J6CA 1X2BA 4Q00A 5T4HA 3ZGOA 1X70A 2IYWA 2H7YA 1Q21A 2HBRA 3B6ZA 3QMPA 5AHOA 4FNGA 2OCDA 1JHXA 5JPIA 2MSEB 3K92A 1SY7A 4RAOA 3NYRA 2F3TA 2CLSA 5K1ZA 2HM7A 5G0UA 2H51A 4R2WA 2XWBF 3LWNA 4GQAA 3RS9A 1D2GA 3SICE 4KNYA 3P96A 3F9IA 3EQ9A 1OLUB 4QTYA 1XLVA 1TKAA 3VJRA 3H5WA 2ZYDA 1T2AA 1UJCA 1C50A 1V7PC 2IHUA 2IQ5A 2X15A 2HMYB 5DW3A 3RASA 5GZ1A 4YHHB 4DMMA 1USUA 3NBKA 3R5HA 3E7FA 3TNDA 1Y1QA 3WX0A 4B6GA 2YBEA 4FFWA 1E1QA 5IAKA 1EA5A 1M75A 2P9EA 4NK5A 3V4OA 1T0PA 2DQYA 2PLAA 2FWBA 4MROA 4OMCA 4PO3X 3W7AA 4ZEMA 5TMPA 4CXMA 1SIUA 5BV8A 1KYQA 3V1MA 1A5ZA 3NFRA 1NYTA 2E4AA 1IAQA 2C3PA 2QNIA 2QLMA 4JP3A 3UQYS 3KQWA 5B1IA 1IVNA 4DUGA 2DFTA 3ZLJA 3GPIA 4OJTA 8ABPA 1UBTS 2ET6A 3FSGA 3JQPA 5DM60 1N1DA 1UBCA 5TY0A 4MVJM 1JWBB 3O1LA 1UDXA 1YAJA 3NUQA 2OLKA 4UEQA 3WB1A 4XLLA 3NDIA 1XD8A 2IPAB 4KI7A 5C8YB 1E0DA 4ZO7A 2O8FA 3AHHA 1V6SA 1BN7A 3HA3A 4PC6A 4FWIB 2Q46A 3VR6D 1U7WA 2YYSA 4C9BA 4E4YA 3AHJA 1PS9A 3PHBE 1PGPA 3H4TA 4G5SA 4XEUA 1WDMA 1CZKA 4UE2A 4YACA 5C1IA 3VDMA 7ABPA 3H2BA 2IYNA 4F4IA 3H8VA 1QG2A 5D3ZA 4NG4A 3H05A 5KYUA 1A3CA 3WYCA 1MJFA 1X42A 3H5IA 3JALB 1ODSA 2AG5A 2BZSA 2R6R1 1K3TA 2OV8A 3QVGA 4R1NA 4BRWA 3FYTA 3SM3A 4DNFA 4NBVA 3OT4A 3W9SA 1KORA 3ZWQA 1ADBA 3ANYB 4Y98A 4ZZ1A 1WLSA 1RYHA 1U4NA 4LK3A 5A7GA 3WDLA 4KMSA 2BSAA 3LQQA 4R71A 4IMJB 5HVNA 4DV6B 4UARA 2WQZA 3S99A 3UAOA 1FLDA 3AEUB 3RGWS 4AYXA 4P83A 1YKFA 4DCTA 5F91A 4A2WA 3VR4H 2A94A 4A2PA 5FBLB 5CIYA 1XDDA 3AY3A 1XOIA 3EASA 4J4TA 2PGJA 1L7EA 1UPCA 4LVNA 1XZCA 3BXZA 2RGBA 4PR0A 5BNTA 1DB3A 2V6FA 1UH5A 5SZKB 1FU8A 1PK7A 1QP4A 3IQGX 3ROQA 4UTOA 4Q3CA 5AIBA 1E3WA 3KR2A 3OF5A 4MRRA 5JRDS 1Q7CA 2ANBA 1S8OA 1G21E 2ACKA 2YICA 4H0CA 4BP1A 5EWLB 2WABA 2O23A 3E27A 1CS0B 3UB3A 5C8DA 3E5RA 3HDHA 3R4CA 3OOEA 3T3NA 4AKTA 2ZR7A 3ROMA 3G0BA 3ES9A 3QG1A 3KB2A 2RI0A 3OJWA 3UAGA 5J2UA 1QO7A 3CUYA 1Z36A 4IJ5A 4TKVB 1OX4B 3TRKA 1N6HA 3HUUA 1HGXA 1XALA 3M5PA 1QMPA 2PUEA 2BVNA 4OMFG 4IILA 3TUZC 1NVXQ 1O97D 1ZD3A 2F8LA 4WK4B 1JKXA 4RKEA 4YRQA 2I2WA 4PHFA 4L7VA 4RH3A 1L8LA 4G5XA 3DQZA 1CUCA 2B78A 3RTEA 1G7SA 3UXHA 4C0XA 1ENPA 2K7ZA 4GW3A 1E1RD 5KREA 1ATIA 3LPAA 2BR3A 4P9NA 3UK2A 2WVJA 3L8MA 3PICA 5HTOA 4WERA 5LKAA 2R1TA 4TWBA 1ULSA 2R0QC 3SJBA 2OGZA 3KV3O 4PG7A 2Z6QA 1AS2A 1ZJ5A 3GFBA 4BIIA 2DHDA 4YT5A 2J4DA 1KAEA 3EHEA 1KQGA 4RTSA 3V33A 1H93A 3P0HA 2G25A 2YNMA 1HQKA 4KGVA 3DVQX 5D00A 1WXHA 1J0EA 4DCNA 5DNDA 1WBJB 3KEQA 4OHKA 3R20A 1KO7A 2WW8A 1OWMA 1K4YA 3ESCA 4R68A 4WUTA 1AMUA 5I7SA 2GM5A 3IA7A 5HNKA 1WMSA 5B4TA 4CIVA 4YX9A 1DFIA 1MHPA 3X1WA 4NU5A 1VI2A 4IZ6A 5JSQA 5IBQA 3I1FA 2B8NA 3SHWA 3CWQA 1H6BA 5CMLA 1I3CA 2ZWMA 4ZCRA 3OIVA 3O8NA 5T64A 3I2FA 3JWIA 4KLRA 4WT7A 4YTEA 1BMTA 3LGAA 3KOUA 2RGCA 4LOHA 4YXWD 1YS2X 4F12A 2VTKA 4BE4A 4PZ0A 4PIVA 1GZ7A 4B3MB 1JIQA 1HZZC 1XN4A 3BRQA 1NXOA 4JI5B 3S1SA 3WXBA 2A4MA 1SU4A 3O91A 4FZJA 3AR8A 2IYVA 2C2MA 5FWXB 1LV7A 4KGZA 5BY2A 1CUEA 4HAZA 3QEMB 4MP6A 4RJKA 2QU7A 4ZODA 2G28A 4ARSA 1U2TA 2XVAA 2VLBA 1K7XB 2X4GA 1OXXK 3BWCA 1ES9A 5CFOA 1HTBA 3PQFA 3ZI0A 3S8EA 1JVBA 3BICA 3M89A 2NO4A 4LFBB 1I1HA 3GJYA 4UNIA 4JASB 4YAJA 1P7ZA 3OUTA 2IYXA 4LQDA 4NK4A 5B1DA 5L4SA 1DQSA 3HCOA 4BMZA 2NSLA 1Z9BA 2WC1A 3EE6A 3G49A 3GPBA 3L6RA 1Q0LA 1N77A 1HNWB 1NI4B 1BFKA 4Q7JB 4FHZA 4Q4AB 1TECE 1YQUA 6Q21A 3G0CA 3IKLA 3I04A 3K31A 3RYHB 1JR6A 4OQPA 2GF2A 2X0JA 4BNIA 4MQBA 3OIYA 1RZRD 3WOHA 3KQHA 1BW9A 3DBIA 3JYHA 4HRVA 4U7TB 4CMBA 3PC8C 1SC6A 5LXTF 5BV2P 2BGLA 3DOIA 3DGEC 1SBZA 5IW8A 4CETA 4JKYA 2IY7A 4O4IB 1RHUA 2VTBB 1HQCA 4Z0NA 3FB4A 4AS3A 4PPQA 1D4FA 1CE8A 4CGZA 1Q95A 3ESQA 3GJ5A 4MWCA 4KYVA 1RE5A 3AQ4A 4Q0MA 2FEOA 1G3RA 1VSUA 3CXRA 1L4KA 4LXUA 1X7ZA 3FPEA 2JNWA 3SFTA 2IIQA 1BKYA 3OC6A 3PBKA 4NF2A 4Q16A 1CK4A 1NI3A 2BEWA 3RR2A 4BTEA 2LBPA 5ETJA 3P7MA 3S3TA 2GPYA 2ZRPA 3B12A 3EF0A 3DZBA 3QPUA 1P29A 4NICA 4OKIA 3WB9A 4AN1A 5JLJA 5KJ1A 1W36D 3GK3A 2QE7A 2VOEA 3OI7A 4GI3A 2ZRLA 3EVGA 5IC5A 3RT9A 3U81A 4YUAA 5K0BA 3A0RB 1QNFA 2HRDA 4UJ3A 4BN4A 4OXKA 4TWIA 2NVWA 1JHMA 4MVJF 2GHRA 2C5FA 4RQTA 3C4QA 4XA8A 3ENKA 3TTTA 3ZXSA 2E4VA 4D0GA 4XGRA 3A4NA 3IUSA 4KQ6A 1JAYA 1R0LA 3W8FA 3ONWA 2FWJA 1UBNA 2ZM6B 3HK2A 2OCGA 2D7CA 4WCFC 4YI5A 5ADHA 4W7IA 2BCJQ 5EUQB 5KWSA 1DCTA 3FR7A 4MJ7A 4CTMA 1XWFA 1RFGE 2ZJ2A 4LY0A 5MN6A 5K0TA 3CJRA 3KQNA 2FPGA 4CEIB 4Z53A 1OAOA 3F46A 4IJMA 2YZNA 1YCGA 3QFFA 2BGMA 4RF2A 4XE5A 3R8XA 4PTYA 3PUIA 1KY2A 1ORVA 4XSHA 2OZVA 5FOVA 3QU2A 3VBEA 1N57A 3W34A 3PIIA 4S0XA 3JZIA 4V1CI 2AQKA 3V9AA 3GYBA 4MZDA 1YF3A 4IKOA 2BKVA 2D2EA 4RHEA 1E4EA 5D84A 5E7QA 5KHOC 2AK3A 1XDSA 2O8NA 2ZOSA 3N5KA 4FVTA 2PMKA 4YCDA 3BSYA 1RTKA 3WLQA 2UUBB 3AGQA 2DEUA 1B3BA 3OU6A 4DCPA 4S1WA 2VRBA 2NSHA 3PC4A 3FRJA 1V3QE 4KEAA 1Z4LA 1P0CA 3I1IA 1XP5A 2GZSA 2Z4TA 3PE3A 4G07A 2XDYA 3EUWA 3TQSA 4MQ5A 5A5EA 1XNRB 2GK3A 3NUZA 4WXMA 1DP4A 3KHUA 1DXOA 4RZUA 4YI3A 5CB0A 3PP8A 3KJGA 4J4HA 1WQ1R 3DZGA 4KDFA 2M2IA 3QPBA 1R5NA 1YFMA 4ND7A 4QECA 5ED0A 5A3JA 5JUWA 3EVTA 1JR2A 3KD2A 4F92B 4J03A 1AF4A 1AU9A 2JFQA 1IIBA 2VSYA 3HI4A 3RBAA 2C9DA 2X5JO 4F72A 5IKEA 1W9HA 1IQRA 4WNIA 3V3TA 1PNOA 3WKCA 4CHTA 1XNQB 1F12A 1L8XA 4M86A 4MYDA 1WZEA 3H9CA 3Q3VA 1OILA 4EHNA 3STUA 1E63A 1XV5A 3EPPA 5AXBA 1M8FA 3GEMA 4F3YA 4F86A 1E1CA 1REQB 5G3YA 2OECA 3LXXA 3U31A 2ZCVA 1Q0ZA 4MW5A 4RSMA 5JH7B 4MV8A 2Q5LA 1F2VA 1G8MA 1MLDA 4X7BA 3VPCA 4D9HA 2Q4EA 2XY4A 3G9ZA 3HY3A 4JJ4A 3WP1B 4F7WA 1UXJA 3N86A 3A26A 2R85A 4JJ7A 5PNTA 3I61A 1QDLB 2KX7A 3ZWNA 4K2HA 2IY8A 3DXZA 1C3VA 3IUPA 5L3SA 2R96A 4GZLA 2DHCA 5JDIC 1KP9A 3B5IA 4JMLA 4F93B 3TG8A 3QUBA 2I22A 4APAA 1QF9A 1Y6ZA 1MU0A 1ULAA 3E9EA 4E7OA 3IKJA 7AT1A 1PDVA 2G36A 2ZJBA 3KL2A 2OM6A 4UVDA 1FNBA 5ECDA 5F7JA 4WKNA 1L4YA 1YE3A 4ZDJA 4WXYB 5BSRA 2XKKA 4RPGA 2EARA 2HF7A 4G89A 1MTZA 3UWMA 5JWOA 1JG4A 5A2QA 2P5SA 3T4EA 3N28A 4U7PB 1CDZA 4CW7A 5IWAB 2X0IA 4C3UA 2XT0A 3IQZA 5JAQA 4BNGA 2VZ8A 4G65A 3SS9X 2FN8A 1XCBA 4AZ3B 4CQMA 1ZCJA 2NQTA 3GLKA 5IG2A 2HB6A 1IZ0A 2XIQA 1Q0PA 2Y9PB 4UAVA 1DAGA 1ZNZA 3AG5A 5I4CA 3QVLA 4L27A 4PYNA 4HT3B 1FMCA 3CONA 1U6KA 2CJWB 1YE8A 4BQRA 2BC9A 3V34A 1U7HA 2D06A 2VJKA 4J8PA 4FFLA 1NUPA 1BXKA 1TJYA 4DPMA 5JQWA 1O2DA 2G40A 3C7KA 3EULA 2DXIA 1IEWA 1JR3E 1X14A 2PTHA 3OQOA 3N1UA 4A8JC 2O7SA 1LLCA 1NY5A 2YV4A 1R66A 4OUDA 2YZKA 5HX7A 1PS8A 1OA0A 1EBUA 5BWBA 5J1SB 1SU8A 4I4CA 1YASA 2HU7A 2PPVA 1YDMA 4YJGA 5FNVB 4E4TA 5C9ZA 3ZPXA 5JYBA 5F1PA 2PZKA 3DFKA 3ZN2A 3LC1O 1M6WA 4C21A 4DGSA 4H1TA 1YT5A 3ZLBA 1JQLB 3V1NA 4I9GA 3EPLA 5YASA 1W47A 2JIQA 1D6NA 5KTPA 3OTIA 2F55A 1Q0QA 3FMOB 2O59A 4RGBA 3OZDA 1W0KD 1NBOA 1SOVA 2ZAIA 2FOLA 1LRKA 1F2UA 2F9MA 2OYSA 4TSRA 4YRTA 3SWWA 4B44A 4ON9A 4ARBA 4LC9A 1NQVA 2WUDA 3RKRA 2ID4A 1L5QA 2VHZA 1U8FO 4K6MA 1U5BA 4PGAA 3T3DA 3MINA 1MC5A 5G2OA 3D3NA 2CHFA 4BFLA 3ZUGA 5EP4A 5DMXA 2CVHA 1PFKA 1MO4A 3L4EA 4CLDA 1CB0A 3HCBA 2Q5HA 3IKTA 3ZHSA 3VJKA 1QQ7A 1TF5A 5DLDA 2IU0A 1JLLB 3F6PA 3OF3A 4J7CA 1SKAA 4BU0A 1SXPA 1OVMA 4RXTA 4TSFA 3ZQJA 5FBRB 1FSGA 3G8CA 1GYQA 3QE9Y 4JH0A 5EHGA 4C0AC 1YACA 2J0EA 2CL0X 3II6X 3L0CA 4NY1A 3UKDA 4DBVO 4ID3A 2HEGA 3GV0A 4KE9A 1A9PA 1JB9A 1PGJA 4P7GA 1QGUB 3A9TA 4X3OA 1RI3A 1Z38A 4EHHA 1KI7A 4U39A 4M1OA 2P11A 3TNLA 1U9CA 3RFXA 3SS7X 3RADC 1NLYA 3ETGA 3OPVA 2QQ5A 3WZMA 1BHQ1 1FC0A 4DMKA 4E3ZA 2WIDA 4JQZA 2BKUA 3P45A 1QQ5A 4IICA 4OK6A 2OC9A 3ITNA 4M9QA 1ITZA 4WY2A 1NUAA 5BMVA 1GPYA 3EXHA 1EM6A 1GDHA 1PHRA 2ECFA 5DTRA 4XDZA 2CXTA 3CVUA 4R31A 4FYXA 1TVEA 1IHDA 2VF7A 4IX1A 3SGLA 5IJZA 1JG1A 3BMOA 5K8TA 5FFFA 1M2VA 2XAAA 3U13A 3EFOB 1NQAO 3W1WA 1E7WA 2WM3A 5AUQA 3MWLA 1FYXA 5ITVA 1C0EA 4C89A 3B60A 4OHZA 4Y6SA 2ZJ4A 4TT8A 1IG3A 1K06A 3E35A 1QIFA 5EKSA 4DNQA 1DC7A 3A05A 4MGYR 4CN9A 2WF6A 2CSUA 2N3ZA 5CTJA 1DBRA 3NWEA 4OLHA 4YUXA 2ZSFA 5DBIA 4ZV9A 1O95C 4XAQA 2GRAA 2BKXA 3RUAA 4CF3A 1OJLA 3DH0A 3D1JA 4JJGA 4P4TA 1JDBB 1PZGA 2B7BA 1F1JA 5LOVF 1AZSC 1EZ4A 3B51X 3IR6A 3PI7A 4G41A 1M10A 2HJVA 4K05A 1YGPA 1TJ4A 4QTTB 4BBAA 3V4LA 2OXCA 2OTCA 3E22A 5K4HA 1F1BA 3ZI4A 3NYWA 5E38A 4LDPA 3M4XA 2NPFA 2ICAA 2XXAB 1L4BA 4RXMA 2C4VA 2H65A 3HEBA 3BT7A 1NUSA 3FVQA 3OICA 4PSAA 3Q2OA 4G0NA 3AEKA 5I8ZA 3SX4A 1UJBA 3TUJC 3KKEA 4FGWA 5IN5A 4EENA 3BA1A 3RVRA 1LLFA 2FVYA 3KZCA 3B1FA 2Y2VA 1J8YF 2WE7A 1M2KA 4ZAVA 2O2DA 1Q11A 3OCYA 4BVLA 3K2IA 3MD0A 4EB6B 1M0EA 3CZPA 1DJPA 1V71A 1RKUA 3L7AA 1RXCA 3TKAA 3MLBA 4ZARA 8GPBA 1SOAA 2XITA 2G1AA 4DCVA 4JITA 1ZUIA 4XB6B 2GXAA 1BX1A 1EXNA 5CB4A 3UJ8A 1UJNA 3RHFA 1NLMA 1PR6A 5AJYA 1OV4A 1JI0A 3DOHA 3FLAA 4BO3A 4KH1A 3L07A 4PHGA 1W46A 1RM0A 2EKZA 4BLOA 2O8FB 4LMRA 3FNEA 4ACAA 1GTMA 5JFOA 4YRAA 2O1XA 3WLFA 5KVVA 3AF6A 2QTAA 4ZYYA 3DHNA 3H2GA 1UBOS 3UJAA 3JAWA 5LB4A 1BA2A 2OCLA 3HJGA 1Z0FA 4ZAWA 3PSHA 2Y9MB 5ITWA 3SQWA 1E3EA 4WAUA 1XRLA 1DO8A 4XIIA 3PQ2A 3BCHA 4D4GA 1R5BA 3ETCA 6ADHA 1IBLB 5ADVA 4BKRA 1H4VB 2J07A 1CU1A 2HK7A 1FJ2A 2P2NA 3RE1A 4DLXA 2CV0A 4Q3BA 3OZRA 3QVGB 4D6PA 3PHHA 3QBEA 4YAEA 1JAIA 4B40A 4AJOA 2DFKB 3VOBA 2YXBA 1J09A 1HLPA 1XHFA 2DTEA 3HHPA 3OM9A 4Y6PA 1GN8A 1K5DA 1F3LA 2IUYA 3FBGA 3HO1A 1UEXC 4MW2A 1H2HA 4A26A 1Y6GA 4LHWA 2EGHA 4CMAA 2PD6A 4YIHA 3AY6A 1R0CA 2DWUA 1JXMA 3KSMA 3L0OA 3MCAA 4NEGA 4DDVA 4KR6A 4YRMA 2ADFA 1JEYA 3JQBC 5TS2A 5GONA 4AC9A 5COQA 1ECCA 1MNAA 1QZZA 4BO5A 1E3WB 4ZQHA 2PT7A 2Q8QA 2QLTA 3C8ZA 3SXJA 5DNAA 1DKMA 3AF3A 2ETVA 3UC5A 1H6AA 1V41E 4BQIA 5KWIA 3ESXA 1P8AA 3BB1A 2C4KA 3MMXA 4WLNA 4CBVA 4TTSA 4P80A 5HF5A 1XXHE 5J2UB 5DBOA 2PYDA 2XA2A 3FDFA 1UJMA 1XA0A 2YWCA 4KP7A 1DEOA 1E0JA 1PK8A 4DR1B 3WA7A 4U4AA 4JP1A 1KYWA 1MW9X 5BYBA 3ZBQA 1HBJA 1O96A 2X7JA 4UTVA 1H8HA 1T9ZA 2QYHA 3SZUA 2I9PA 1HL3A 2PEZA 1JZSA 4E51A 1O9BA 4F85A 5JNLA 1V6CA 4B32A 4ES6A 4K2AA 2W48A 5IJ0A 1E94E 4JQYA 1P2VA 2JAQA 1UOQA 4GL2A 2DERA 1GCAA 1NXWA 1SXJD 1FFHA 2AEEA 2ZJ8A 3OLWA 3PQDA 1V7ZA 1N4AA 4DLTA 5CDTA 1CYDA 1EGMB 1I0ZA 4GOOD 2R1TB 3C7CB 4H6VA 2F4VB 1JG2A 2VAXA 4OVKA 1V8BA 4MQMA 5G1OA 1Z6QA 4JJAA 2VF5X 1DADA 2NN3C 4UMDA 4NCKA 4UM7A 1GNRA 1DKLA 4Q6BA 1IE3A 4HZGA 2QRHA 3F3MA 1UWLA 3WQSB 5KOHA 1B6RA 2A5DA 1D2NA 2TMKA 1KMHA 3DOEA 3MJEA 3Q3GE 1VI5A 4EITA 1WXQA 5KSZA 3CSSA 1XVUA 3ZVRA 4B6JA 3WK8A 3TZKA 1QCZA 2NTJA 4EJMA 5I3CA 1QV7A 2I7CA 3P9QA 3FTEA 1JQEA 2Y1LA 5CK5A 1N8KA 1H4SA 2OD2A 1PNVA 2CNBA 3F6EX 3HY6A 4OGFA 1ONSA 5K3CA 3NV9A 3SN6A 1N6LA 5B4UA 2VR1A 1C7IA 1WD7A 2ONZA 3TCNA 1L5HB 2B94A 1Z37A 7GPBA 1KK3A 1TX4B 2QLFA 5JAZA 3IHWA 2XOKA 3TH5A 1WMDA 1PJBA 2GLUA 2Y1GA 4HDKA 4IVNA 4D8TA 4QHTA 1TZMA 4LE0A 5AKZA 3F3YA 3I37X 6REQB 4WEOA 5IT0A 2XDAA 1KO4A 4TMXA 4DMGA 1V5FA 4A91A 2O2XA 1VP9A 1H85A 4L8YA 4DMUB 4EP1A 1YONA 4I1YA 4Y1EA 2ZCJA 5F92A 4X45A 1IPEA 4YMSA 4EGAA 4F71A 5DNYB 4HH1A 1QZXA 1Q1AA 2G9VA 2W2VA 1AK9A 4MRMA 5G0WA 5HCUA 3W8NA 1I6WA 3TLYA 3N2EA 5DHFA 2FWIA 3UAXA 4BFYA 4CHGA 1HE5A 3WMRA 4DQDA 3Q0TA 1TJNA 1V11A 3BB4A 5LDDC 1NPDA 1SZJG 2XT9A 1E5DA 1U28C 1BW9B 2HA4A 3X2EA 3KPUA 4PVDA 5C4GB 1WBDA 1MABB 4RY8A 3IVRA 3L8HA 3MTDA 1QF7A 3GEHA 4C0HA 4Q7QA 1A76A 1NBMD 3WZ2A 1EMDA 4AJKA 5AESA 1LW6E 2Q6OA 1FYVA 3C3JA 4MWZA 4Y9DA 1CE8B 1XPOA 4GLOA 2E21A 2I65A 1Q7EA 3IVXA 1FUPA 3WQBA 2BFDA 3IT0A 4AZ0A 2I6FA 1N6KA 3DZCA 3SHTA 4Z2AA 3PC2A 5AHRA 4DR4B 1GCIA 1X7ZB 3F8WA 2H2WA 4IH1A 4JU9A 2HX1A 3HYTA 4AI6A 2FSPA 1JECA 1RXYA 2FPPB 2J45A 4UE6A 2ZRMA 1AG9A 2X75A 1GLVA 1WO8A 2I2BA 2R8EA 1E1KA 2ZS8A 3C7DB 1QYDA 5EQDA 2PLFA 1CUFA 4MV7A 3SC3A 2LW7A 1RWBA 4ZZ3A 2WTMA 2YH2A 3MZ0A 1KR5A 4BLSA 2OHGA 3SEQA 2ZPAA 4PX9A 2X1HA 1BGXT 4IEIA 2I8CA 1ZVQA 1KZ7B 4OKSA 4UAGA 1D9ZA 3L40A 5G02A 3FF1A 2FSUA 1SCNE 2O3QA 3AEYA 4XQ9A 5DM0A 4RTMA 1JTVA 1C0LA 4KPEC 2VDRB 3I92A 2EFYA 4I4NA 3BWDD 3SCZA 2PRZA 3TR0A 1Y3FE 2FN4A 4FKBA 2PFMA 3PC3A 1K1EA 3HPQA 2N75A 4XQCA 2FPGB 5J4KA 4TWRA 2OCPA 1HK7A 4AWXA 4D9GA 5BSWA 2FEAA 5CFLA 3PC6A 3CMMA 2XB9A 2HA6A 1DQPA 3RQSA 4PLZA 4EG7A 5M04A 2CK3A 4UU1A 1QO0A 1PJSA 2H59A 3RSHA 3DLBA 2VL7A 1FUOA 4NPCA 3MGCA 4IV8A 3WIEA 3ZD9A 3B9QA 3DFIA 3NHMA 3D8SA 5AOVA 1PW7A 4W99A 3U49A 4KPYA 1R6TA 3I2IA 3OJCA 1BHJA 1MX9A 1O87A 1RRGA 2O2GA 1H42A 3L9XA 2NVOA 3RD8A 2UZ0A 1T3SA 2WWIA 4KOAA 3O8QA 1XLTA 1ZEJA 4DLWA 1AQNA 4IDDA 4RNCA 3TL6A 1VJRA 1ID1A 4BGVA 3G13A 3IDOA 4OYHA 5C5IA 3B1XA 4PYLA 1WULS 4AO8A 4PNZA 1CDDA 1AQUA 4UOQA 4PG8A 1EXVA 3CT6A 1O89A 4ZEVA 3CH4B 4HGOA 2YWHA 4WN3A 2Z2ZA 3HGMA 3DUFA 4JUFA 5E0OA 1WD5A 1FRFS 4DOMA 3OFKA 1P4GA 1H2WA 2I6TA 5H3HA 3BBLA 4ZICA 3AM3A 4G4SP 4JP2A 3N8HA 2D3WA 4N8SA 3R7WA 3TAUA 3ML1A 1MOPA 4YJ2B 4YFVA 1HOTA 2B1IA 4F06A 1XPRA 1AF7A 3CEJA 5GOZA 3F4SA 4CR7A 3TF5A 2C57A 5LMNB 1FYFA 1ZRNA 2EX0A 4UHJA 3V8QA 3WK7A 2A9VA 2D0DA 1QUEA 4M0FA 2VPWA 2OL4A 3PTZA 4Y2RA 2IYRA 1MMFB 2IYEA 2FX2A 3I9LA 5I7RA 1CF9A 3QMMA 4QYIA 4TGLA 4R01A 4QHYA 5TV2A 1IRIA 1D2HA 2YHSA 3UGTA 5K3BA 3SIRA 3SDBA 3SNKA 3IXQA 4D81A 2E4ZA 1Y63A 2AHRA 3DP9A 2GBFA 4J7AA 4N3GA 3TLCA 1QGAA 4O33A 4E5NA 3RSCA 3TEMA 2HK6A 3IPYA 3QE3A 3TRFA 1W5FA 1XA4A 3IEVA 5ICEA 2E9FA 4HRAA 1CZRA 2IIBA 4FP9A 2GKSA 3JVEA 1QX3A 3SYMA 3HYRA 1RD4A 4LZJA 3AVXA 1JDUA 2SCUB 4JXKA 4TLLB 3ADPA 1T35A 3OMXA 2PX8A 2X14A 5EERA 5FADA 2BGWA 4FEGA 4NL4H 4O4HF 5TMDA 1R88A 2VKTA 4CKXA 3GRVA 5BT9A 3EDRA 2PBFA 2HBZA 3RREA 2Q0XA 3OH8A 1CNFA 5L3RA 1X8KA 4P86A 4E6PA 5JSKA 4P0PB 1JQKA 1WPQA 5LBUA 1KF0A 3NTOA 3QX8A 4FWBA 1AHHA 4FCVA 5E8JA 2EBUA 2GPNA 4LMBA 5KPDA 5FO0A 1TGVA 2P5YA 1BVYF 1FDIA 3KC2A 4FGJA 3FKJA 4JJKA 4NFYA 2MCFA 4LPKA 5JSZB 4K81B 2XCSB 1JSZA 2EDAA 1VKRA 5FWDA 3CUVA 3VC2A 3KEMA 1OXSC 5HDBB 3ZZMA 5B1EA 3ZH2A 3AUYA 1H65A 1V25A 4E5KA 1HNNA 1I4LD 1XTPA 2CLLB 3FHJA 4OSPA 4CKWA 2XYPA 3G8AA 3JYPA 4OUDB 2FK8A 2NWQA 3BE5A 2VDKB 1AKRA 1YZ3A 2Z5VA 1K98A 4NULA 5D87A 4BNLA 4TZ0A 3AK4A 2JGKA 2SNIE 2FEKA 4KHZA 4PW0A 4ND2A 2C4TA 4UAUA 4CL0A 5JXHA 3T1TA 1BDHA 1LXCA 3ZXIA 4D80A 4XW2A 1NL3A 4QPJC 3EPJA 5JARA 4PZUA 3B82A 2XCIA 3TO5A 1RQNA 1ISSA 5T4FA 1E92A 1O3YA 2QUIA 2PD3A 1CKEA 3IC5A 4MKZA 1NMEA 3STVA 3A31A 5AI6A 4ZCSA 3U26A 2PL5A 2PSJA 4F2GA 3P0IA 2G67A 1G5IA 1N7HA 4IHJF 5J5VA 1T2UA 2V96A 2Y8EA 2ZUSA 4KXUA 1UT8A 2VRCA 2DLDA 4DLLA 5ICFA 1FP1D 5A7FA 4R1PA 4FFVA 2JJQA 3D8RA 2GPSA 2Y4NA 3NU1A 2P6MA 4TL9A 1W4AA 2AG6A 2VTDA 5CK4A 1U5BB 2G0AA 3MINB 2I33A 2HQOA 3FCAA 2ZQZA 3CEMA 4NCBA 2O1SA 1YB6A 2GARA 4CCSA 3LYAA 4DEYA 4HGQA 2COUA 5F4BA 1NRXA 3QVWA 5IZ4A 1AQJA 1TT7A 3RBXA 3SSAA 2VQFB 1A9YA 1JHAA 3KUDA 1QDEA 2PG3A 5EJ5A 2PFSA 2OT3B 2XYVA 1EHYA 3BFJA 4I55A 4QU0A 1SQSA 2OAQ1 1DZ3A 2YS6A 3DF9A 4MLCA 4MMXB 1NY6A 1OU4A 2X5XA 4W9RA 2H57A 1L6RA 3G23A 4U2DA 3H17A 1O9GA 3GRRA 4PR3A 2H2IA 2HJSA 2BKEA 2NP7A 4L9WA 2ECKA 3T4PA 1LRLA 5A4IS 4DLSA 3BM5A 4G6ZA 1VLLA 3HG7A 1C8LA 4R7ZA 3F8TA 3E5NA 1O97C 1Z5GA 4XDGA 5IJWA 4KE7A 2W6JD 1A7KA 1ZBQA 4ZQEA 5BV0A 4DJDC 1DO2A 5BMVB 3R3UA 5CXUA 1VJCA 3D5TA 2C2HA 3EXHB 3O3OB 4A1FA 3OEHA 1CY4A 1I32A 4GVLA 4BVAA 1NW5A 3IMFA 1TFRA 2FCRA 2JAXA 3BMOB 4V1CA 1M2VB 1EB9A 1QR6A 2C83A 1ADJA 4TZTA 1RKVA 4DR5B 3B1VA 2GBPA 4EHLA 5GPBA 4Y2PA 2NGRA 2NNLD 1HDEA 4GMFA 3TW0A 1B76A 2HSWA 1LPMA 4KLNA 1U98A 1JDSA 5H3LA 4YPOA 1T0HB 2BFMA 5B36A 2YR0A 5MF6A 1CRWG 2BP7A 4K9SA 1QV6A 4MW6A 1SCUA 3VKVA 3WNCA 5EJMA 1VPEA 4ER7A 4O25A 3JAMA 2J31A 3EIHA 3OPYI 2HCFA 1E8NA 4OU5A 5AJUA 3RANA 1F0YA 3SOPA 4DSUA 5HZGA 5KQGA 2HV8A 4GGMX 1TQDA 4B9EA 1VCMA 1RI5A 2VDPB 1NPTO 3ABSB 3KTAA 1YUNA 1DKUA 2ZJ7A 5DMHA 4ZI5A 1GYPA 1SVIA 3EVEA 5HKLA 2JCYA 5LBTA 3UAYA 3VH2A 3K6SA 4DV7B 3O4RA 3B38A 1NFRA 2QP9X 3JVIA 1TLFA 3NKLA 1Z0KA 4J3JA 5K5EA 4J0GA 5CA0A 3E22B 5HJ5A 4QJ3A 3R0QA 4KQGA 3W5BA 1SULA 4PX3A 2X8LA 1W581 3KXKA 5B6PA 3GZNA 2A86A 3HBAA 1XTTA 4JJEA 5AVJA 3IA2A 4CIAA 1G3MA 3AEKB 5I7OA 3D3EA 5CLGA 1DCNA 1N75A 4H3KB 4QRDA 2IYUA 4Z54A 2ZK7A 2X9GA 5B7QA 3C7TA 1FSPA 4WL0A 5AKKA 4HWRA 2B61A 1PFVA 4H7FA 1DJLA 4M9SA 5DSTA 1Y0BA 1USKA 2HLHA 2HU2A 3DBOB 3ZHXA 4A5OA 4TTQA 3THOA 2RAUA 1IZYA 4DJ5X 4DLRA 2CY0A 5KIAA 2WP8J 1ZOOA 2AXPA 3VRHA 2F1OA 1GPAA 2YVKA 5CB4B 1F2DA 1ZDMA 2Y05A 4EJ6A 1UAAA 1VRCA 4S04A 4JLNA 4YT2A 1MH1A 4RTKA 3OWXA 2PUBA 2G6TA 3TRJA 1H0HA 4ZT6A 3IV7A 5FTJA 1L5LA 3GZHA 4Z3OA 5DLEA 2J9ZB 4JI1B 1ZZEA 2BEVA 2GCNA 2DY1A 3U44B 4R3WA 1PU2A 2AFHA 2LGJA 2RKWA 3VX3A 1PQPA 4LBVA 1U8CB 1NYLA 3JAWB 3DTTA 1DRUA 4KVFA 3NTXA 4JC5A 4YP6A 3WV5A 2ZBEA 3CNHA 5FWNA 1M8JA 3KQQA 4ALKA 2G5GX 4I4LA 5B7GA 2VJAA 2DFPA 3HEMA 1G66A 2AWNA 3PWSA 1UJ2A 3JQGA 3AESA 1Z6PA 5DGTA 4EA8A 5BSEA 5DCYA 1YJCA 1GRCA 3DVAA 4YWJA 5ESWA 2NV6A 1I3MA 3DD1A 2LIVA 3LT5A 4MQ4A 3TWOA 2ZJYA 1R50A 4FOPA 4MQFA 1TUGA 3LT4A 3TD2A 3GEBA 4HWKA 3V2GA 4WXHA 5F1KA 3D4NA 4CZ2A 2QR3A 3AJ8A 3ZK8A 1W36C 2C5AA 3OZVA 4GKBA 4POOA 4ASUA 4BNJA 1CUDA 1E6WA 2WJJA 2NTYC 4GYYA 4LS3A 4NOLA 3WRXA 4GWLA 4O1MA 1JEYB 4P2BA 1ARZA 1H1TA 2PKWA 3HUDA 5A4KA 2VEOA 3GB9A 4TS4A 4AWAA 1RYFA 3AUKA 3PFKA 1WMAA 3QYPA 2Z2XA 4S1VA 3EEOA 3PNSA 3ZX4A 3GJSA 2ILVA 4MUJA 1PV4A 1MHTA 1VG0B 3DMHA 3JSAA 4P4LA 4XJVA 1DG9A 2I78A 4HLUC 1OI2A 4U2EA 5DHUA 5FA5A 5D7BA 3NHPA 5KJ6A 2OGTA 4LRSB 4YRZA 1GPNA 3W2IA 4DG5A 2BI4A 1COWD 1PQYA 2NZUG 2M32A 1NRIA 1AGXA 3WRYC 5A5DA 4HH4A 2VATA 2R48A 3HXPA 2NU6B 2AN5A 2K2QB 3FOEC 2PTGA 5U9CA 3GLHE 5K3DA 2DC1A 2ZRKA 4TS9A 3QXSA 1T9BA 3OD1A 4FD2A 4LKOA 1QRDA 2IYOA 1IJFA 4JQSA 4U7FA 2H2FA 3LT1A 5THXA 4MUIA 1UDCA 2WPDD 1VA5A 5FWAA 4NDZA 2V55B 2VYCA 5B53A 3SYTA 4UAJA 5IJ0B 4AJPA 5DIFA 2DECA 4Y2TA 4LNAA 3TBKA 1VJGA 2XE8A 4U9IS 5ITZB 1WW3A 1WMBA 5KYGA 5K0ZA 3EQ2A 1OXTA 4YROA 1ZVJA 1OFVA 2QJFA 4JLKA 3VR2D 5KC9A 1NT4A 4ZVOA 3A4YA 1V8PA 1XA3A 1NVVQ 4BAZA 3U7QA 5KJFA 3U60B 4B8YA 2ZAGA 2NZWA 3KSDO 2Q4DA 2R2GA 2NO9A 2R62A 3CWCA 3ED5A 5F5LA 4ZZIA 1DTSA 4ABTA 4EHAA 4V2IA 3G5LA 3P19A 2VHTA 2ENWA 4WDQA 3E2PA 2O2YA 5KOHB 1LVHA 3KKMA 1T9HA 2ZKIA 1XNJA 1IB6A 1F2TA 2O2CA 1WLYA 4Q3OA 1N2HA 3HCFA 3GRYA 3HP7A 3RUIA 2P35A 1N9ZA 3HWX1 4K5QA 4RJIA 1BXRA 3DWGA 5FL7D 1N3IA 4QDJA 5FORA 3HN2A 3OECA 3ORFA 2IXEA 2HJWA 3RS8A 3UV6A 2A0UA 3KG2A 2VJPA 3KSZO 5F3DA 5K8CA 3EF3A 2D27A 1UWKA 2ETXA 3N8IA 3OCVA 5U1PA 2W9XA 4HDKB 4LSMA 1E2BA 4IIEA 2AH5A 2XCTB 1FOEB 2IKQA 4UFNA 3K2QA 3VXKA 1JIUA 1E2QA 2JH9A 3RSGA 4B6PA 1C0PA 4J16A 1QMGA 2JAUA 3QIAA 2FKNA 1RYMA 4QAJA 5CLQA 2AQHA 1JFSA 3VPGA 5IKMA 4CLEA 1L8OA 4DLBA 1VSQA 3HBMA 5K3FA 3DXXA 4R40A 3ZHZA 1UXKA 3HJAA 3ZTWA 3IB3A 1QANA 3GT3A 2QY9A 4TLAA 1DRJA 1TJ5A 4LIPD 5FYQA 4LRTB 2W2LD 1SXHA 1PT8A 3FLMA 4KR3A 1KDPA 2IFTA 5FWYB 3RRNA 1I5RA 4E1VA 4UNQA 4UASA 1EAMA 2AUNA 3EAGA 3ANMA 4DADA 4EJFA 2TMDA 4XD7A 3W3AH 4H1HA 1VGVA 2C9MA 2GJKA 3WVNA 1ODKA 3PVSA 5KKNB 2EYQA 3H9EO 2FK7A 1EXDA 1N4DA 2PQMA 3QWHA 3I45A 2R68A 3R3ZA 4FHDA 4GU5A 4HDQB 3WJ2A 3D7KA 4JSTA 3GJ6A 3KFXA 1U7UA 2BFDB 5TQVA 4BJHB 4F1KA 3F1LA 4B2PA 3H5OA 3WMXA 1CDEA 2XB6A 3C97A 3GGPA 3F3KA 1EX1A 4HAUA 4XTRA 1UFVA 1C2YA 1V5WA 4F11A 2PT5A 4MLPA 2RH9B 2WB4A 3BEOA 4P3PA 4LPSA 3BTOA 3WGTA 2CMGA 3KKOA 1S5PA 2AE1A 2WKWA 1KDYA 4YMIA 2DZDA 1E0KA 2FLVA 3P4UA 4B7CA 4ZOLA 1EDBA 1YOBA 3VSBA 4LNUA 1V1MB 4TT3D 4PZEA 1UK7A 1YI1A 3AV0B 1TM1E 5CDYA 2FUSA 3FDZA 4EY4A 5JANA 5CCEA 2IY9A 3WZLA 5T4BA 1X3SA 2J9GA 2YJTD 1VKNA 1GVNB 3U7HB 2JH8A 1EINA 1AUPA 5B5SA 5BP7A 2JI4A 3I05A 3UH1A 4XYLA 5KNBH 1OQAA 3UJBA 1XMSA 4DE5A 1BC5A 2BMAA 1SELA 1J2JA 2KQUA 5CIQA 4HNRA 5DYIA 4WIAA 4JYPA 4WOKA 1Q7RA 1QZTA 3OHSX 2W7TA 1BXGA 1Q14A 2W2PA 1B16A 3KYIB 2FOIA 3LVFO 3AF2A 1M2JA 2PMDA 3MWKA 4YJ3A 5DJ5A 3J7TA 3ZY4A 2KB0A 4BMNA 1CUYA 2E4UA 1PL6A 1S4MA 3LWBA 5FI0B 5JRZA 2V7TA 1RJGA 3TQCA 1VBMA 2IK8A 3SEAA 2G5TA 2P2CA 2IZ0A 3TL3A 4E4RA 4F7DA 3LCMA 1MPTA 1URPA 2HA0A 3RUFA 4RKFA 4YP5A 4US1R 1Z8DA 1W6UA 3Q9UA 3RLFA 5B37A 2VHYA 2WG0A 1O9HA 2ZVQX 3ELBA 1TEVA 3PCXA 4FGKA 5FAKA 4JI7B 4BJ1A 2D5IA 1P1IA 3NHLA 5A04A 3N53A 1FP4A 2HMWA 2I3ZA 1C9EA 4ZCPA 4C5CA 4PO1A 3K35A 1S7CA 1HEYA 3U37A 3ZS9A 4F4FA 1Q44A 1E64A 1JP7A 1W5SA 2XCLA 4XPZA 4F6CA 1KQPA 5KVCA 3FGNA 2EJWA 2JFWA 1R7RA 2AK2A 1E1QD 1WZNA 1LNSA 3GCDA 1UJ4A 4PG6A 4OHPA 1SXJE 5F2OA 1A5TA 2FSSA 1FLNA 2PZFA 5GM2A 4BKOA 4ETWA 5JWRA 3WLLA 4JUCA 2QD2A 2EWWA 3N7TA 3OX4A 4J1QA 8LDHA 3ERCA 3VBCA 2H54A 3G2OA 4ZEOA 3R7WB 4DUGD 2H1SA 1A9SA 3P20A 4CQJA 3R3YA 3FSGD 4HLCA 3F5MA 2Y1XA 4JNKA 2B5VA 5KTTA 2RHTA 1IUNA 1RC1A 3C3XA 3H7AA 4C4XA 3A04A 4K1XA 5DB4A 1VJDA 2HLNA 1JIVA 3D0OA 5KJEA 2FFQA 5T3UA 5KOJA 1P19A 2CMKA 2F3UA 1C1YA 3QKSB 1UBLS 3OLZA 4FIDA 4QYIB 5HMMA 2D1YA 4D5GA 1FNDA 2EW8A 3NOVA 5TNXA 3ZOZA 4JB2A 1UKZA 2H11A 5IMSA 2AUTA 4H6XA 1J00A 2FDRA 2ZJ5A 4GOND 4ZA2A 4NDNE 3C6BA 1G5TA 1G9TA 1M1NA 2J46A 3LPCA 4ZO4A 1FFGA 2B7CA 3PYMA 4PRKA 2BFNA 3LBFA 3NB0A 4MV3A 5GJCA 3CX4A 1PHPA 2IYSA 1D0IA 4NMMA 3PJDA 1RWQA 4HL6A 3KJEA 2QLLA 1RT9A 4AJ1A 4AZTA 1X1EA 1RQLA 1UM8A 2H16A 3D6AA 5GJWC 4W5TA 2XF8A 1JQBA 1WOYA 1H1LB 2JJ2A 2WHEA 3LBNA 4GE3A 4E46A 5JXWA 1KAMA 1E2GA 1WF3A 2H0AA 4NATA 2BEUB 1XJWA 1LDEA 2H9IA 2Q3BA 3AVPA 3QPDA 3AIIA 2ZB3A 3CNOA 2Q2OA 3T0GA 1K8RA 1GT91 1PFWA 1GTRA 4JBXA 5CU7A 2QTFA 1OZFA 3F47A 3QLVC 1U5AA 1MJHA 2EP7A 4GVXA 4TMTA 3SSMA 1N5IA 1R4MA 2DWPA 3LT2A 2ZJZA 2DAPA 2DP4E 3IPAA 1BMQA 1ZUWA 2WZCA 2FWMX 4KAAA 4U02A 3RW9A 2ZRNA 3UAWA 3HR8A 3ZW9A 3L41A 5FTKA 3FFTA 3QW4B 4OF4A 2WQ6A 5ALKA 2YJ6A 5E1MA 1KZ6A 5A06A 1EQ2A 1CVLA 1NBME 1LFDB 1Y80A 4MRAA 4Q4DA 5TRTA 1GIAA 1IXKA 3TI7A 2JVJA 4J0HA 3W5VA 4REQA 4QT0A 2W6CX 2VA8A 3IQHX 3JVDA 3QKWA 4FYHA 5L45A 1U3CA 1JXOA 4TYQA 1LH0A 1DHTA 1WB6A 2COEA 3EWAA 3NM4A 3WYAA 1V3TA 3HCAA 1E9EA 4B85A 2WRZA 1Q0UA 3AONB 2UVQA 1KYXA 4NP6A 3FPGA 1H5NA 3EGDB 1KDZA 3WC4A 5IC4A 2Z2JA 4J3NA 1PNRA 4ND5A 4GQIA 1JHYA 1MX1A 3TE7A 2I2AA 4CCAA 4TKZA 1L7DA 3Q5DA 4UMEA 4B0PA 4DA4A 2E4WA 2QRQA 4HJRA 3UJPA 5EVJA 5IHXA 3BWMA 5ERGB 3W9BA 3I23A 1R2QA 1CSEE 3JASA 4LE1A 4HN4B 3KWFA 5JZOA 4M60A 3DCIA 1H0KA 3DL4A 4JVNA 4O6VA 4YLEA 1MTOA 1RI1A 1X13A 2YNMD 5FA8A 2F9LA 1Y5LA 2PQ6A 4EEXA 2HTEA 2RAPA 2BFOA 5FBHA 1UWVA 3BZUA 3P4YA 2EZ9A 4JOQA 1J5XA 1UPTA 1D8TA 2ZIGA 4LTDA 3ZYCA 1QLJA 2AQ8A 1SOUA 4Q21A 4XQGA 5DZSA 3AVVA 3JVUA 2XMSA 1C3EA 4ZANA 2P62A 4CL2A 4K9KA 2H4XA 3NXKA 1XZMA 4RQBA 3DONA 4KPGA 3CYFA 3L93A 3FYUC 4MUKA 2GT1A 4QFMA 5DXFA 1VC2A 3WLKX 4DY6A 2NAPA 4I55B 4XR9A 1OFIA 1Y98A 3B8HA 4KVGA 4QOFA 4XOUA 1X38A 4KQIA 2HH9A 4G84A 3SVZA 3NT5A 3DHVA 4KLCA 5LDHA 1ZMOA 1YIDA 1T0UA 2BGKA 1KY4A 2FZLA 3CLHA 1OFHA 2WWRA 3O94A 3ZWCA 1R6UA 5TMBA 4BQFA 3C16C 3R0ZA 1E8DA 3AHEA 4HGYA 1IL0A 4NHEA 3ST7A 5HQTA 5JSUA 2ARKA 3UJNA 3GFSA 3D6UA 2YY5A 5CW2A 1QVZA 5ISMA 3NIBA 4TXJA 2QG6A 1IOZA 3NS7A 3A8TA 4EAAA 4G1UC 1MAHA 4E08A 1RPZA 3TTXA 2FN3A 3QBTA 3ONDA 1PLKA 2OE2A 3MMSA 4RY2A 3T7DA 3UPTA 3I04M 2HWKA 1SXJC 4RZSA 5CVEA 1P8JA 5L7TA 3ADBA 2XMPA 1GG5A 2FSIA 3N0TA 3NVDA 3ZQ4A 4D0SA 2BGRA 3P9PA 1IEVA 4BJ3A 4ZIRB 1EVYA 2JAOA 4COKA 3ETHA 3QUCA 4JEMA 1J5PA 1XMPA 2GZ2A 2BP7B 2P2DA 4R8SA 1WP9A 3P5SA 1N5JA 2IV7A 5IUNC 2PZ8A 5L6MB 1JE0A 1V7QA 4EGFA 4UOZA 2X86A 1VHLA 3M6XA 2WYVA 3GJ0A 3RVQA 4EPXA 2A9JA 1LX6A 1WV1A 3CR3C 4OG2A 1E2NA 4QUAA 1E98A 2P79A 3HR7A 1ORHA 4F8YA 1E4VA 3KTAB 5COBA 5AK3A 4M8NE 3U4AA 2ISCA 4HR7A 1NSYA 4ZQBA 2KHZA 4L73A 1C4WA 3TJRA 3TOZA 1GPLA 1FPQA 1NJ6A 5CA0B 3JWEA 3P0JA 3FTFA 2OXRA 3ZZUA 1DAIA 5I9LA 3K9C