2JAUA

Crystal structure of d41n variant of human mitochondrial 5'(3')- deoxyribonucleotidase (mdn) in complex with 3'-azidothymidine 5'- monophosphate
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
194
structure length
194
Chain Sequence
RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-DEOXYRIBONUCLEOTIDASE
publication title Crystal Structures of Human and Murine Deoxyribonucleotidases: Insights Into Recognition of Substrates and Nucleotide Analogues.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 65
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 2jauA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2jauA01
3ZWKA 4IFTA 4L6AA 3OTQA 3ZW7A 4UARA 1RPZA 4UASA 2JGAA 3IRUA 1K1EA 2FPXA 1X42A 1WVIA 3FPSA 5ALEA 3R09A 2GHQA 4UW9A 4XPZA 3AR8A 2JAUA 5AI6A 3W5BA 3QU4A 5T41A 3KBBA 2OM6A 1N8NA 4MWOA 1RLMA 3QXGA 4MUMA 4ZEVA 3WK4A 4EZEA 5IT4A 2WF7A 5ALQA 2PKEA 1WR8A 5ALLA 3QUBA 4YCNA 1YS9A 1YMQA 1CR6A 5AKJA 4Y2XA 1T5SA 4Y2SA 1VJ5A 2C9MA 3WK9A 3WGUA 4BNDA 3L0CA 3DV9A 3QU5A 4HGPA 3NAMA 1Z4PX 1N9KA 4YGYA 3S6JA 2NYVA 1NRWA 1U7PA 2C8LA 4DW8A 1XP5A 5AK6A 1T5TA 3ZVMA 2B82A 2AH5A 2B8JA 1JUDA 2EARA 2HOQA 2Q5EA 3UMCA 1Q92A 5AW3A 3N5KA 4BNDB 2W4MA 4I9FA 2FPSA 2G80A 2P11A 1L6RA 1ZJJA 2AGVA 4OFZA 1AQ6A 4PNHA 4UM7A 5A3QA 3A1CA 1Z4JA 4EEKA 1RKVA 1VJRA 3KDPA 2FUCA 4UATA 5ALNA 1WZCA 1RLTA 2I54A 3M1YA 3SLRA 3VAYA 2OBBA 2YMLA 5AVZA 1Z4NA 2YJ3A 4KX3A 3UMBA 1ZOLA 1Z4IA 3OCVA 2O9JA 5ALOA 2B1RA 1ZS9A 2WM8A 2C4NA 1Z5GA 3WKDA 1XVIA 3L1VA 2WF8A 2ZBFA 1MH9A 3SHQA 1T9ZA 1RDFA 2ZG6A 3B9BA 2AMYA 4G9BA 3ET5A 4C4SA 4OCZA 4UAVA 4GXTA 4ZEXA 5A3SA 1VFPA 4UMDA 1O08A 4YCMA 1YJ5A 2YFYA 2ZXEA 3WKCA 4IG4A 4FE3A 1XPJA 3EF0A 5AKLA 1ZD5A 4QJBA 5AVQA 3U19A 1F5SA 4O8CA 3I6BA 2WF9A 3FM9A 1YNSA 5AKIA 5AICA 3IJ5A 3OCZA 3NALA 1Z4MA 2I6XA 1ZRNA 2QYHA 3ZVLA 2AUTA 2RAVA 3ESRA 3J7TA 3MC1A 2GO7A 2FUEA 5AHXA 2HEGA 2NO5A 5AVTA 5AK3A 1S2OA 1QQ6A 3QUCA 4KN8A 2ZBGA 3AR3A 4BKMA 4CF4A 4RESA 2NO4A 5ALYA 1RMQA 5ALGA 3CNHA 5AVRA 2IA5A 4HYTA 5E0OA 5ALKA 5ALVA 3I28A 3HYCA 2JARA 3E84A 4YIKA 3KZXA 5JJBA 3P96A 3OCUA 4NABA 4Y2JA 3SKXA 4DWOA 2HF2A 3OCYA 3ZU6A 4GIBA 1S8OA 4FFDA 1U7OA 4HGNA 2JAOA 3ZUPA 1RKUA 3A1EA 3WKEA 2I34A 4AS2A 3F9RA 1SWWA 2ZOSA 4EELA 2G06A 3QNMA 2GHTA 3L8EA 3PGVA 5A3RA 2FDRA 4Y2YA 1SU4A 5AW2A 5IT0A 3I76A 3ONNA 1FEZA 3FGOA 3QUQA 3D6JA 1YDFA 4JDPA 3R4CA 4I9GA 3GYGA 4ZEWA 3OCWA 5ALJA 2BDUA 1LVHA 3A1DA 2B1QA 3AR2A 2YMPA 4FYPA 2YN4A 4JB3A 5ALSA 2HF7A 3SF0A 5AKXA 3FZQA 3NANA 3K1ZA 5ALIA 5AKZA 1RQNA 5ALRA 2G09A 2YJ4A 3EWIA 4J03A 2GFHA 1WPGA 3ZX5A 3I1YA 3NRJA 4UAUA 4BX3A 4UMVA 2HCFA 2IYEA 3PDWA 3L8GA 1L7PA 3QUTA 4Y2UA 3PCTA 1KYTA 3L1UA 4Y2PA 3AR5A 1ZD3A 3A3YA 4HAIA 4AP9A 2HO4A 5AW1A 1RMTA 4NAVA 2G1AA 1TE2A 2I7DA 2IOFA 5AVYA 3KOOA 3ED5A 3N8GA 3W5AA 4AS3A 3QGMA 1YV9A 4EENA 3ZTWA 5AI9A 3WK7A 2RB5A 1Z4LA 3U26A 3KD3A 1RMYA 3RFUA 3L8HA 4XE5A 2GMWA 3E81A 4KX5A 4EX6A 3KC2A 1QQ7A 4CNQA 5AESA 1TA0A 3ET4A 3E58A 5AKKA 4Y3UA 4F71A 2FI1A 1EK2A 2R8ZA 5AI5A 4L6CA 4UMFA 3U13A 4F72A 2ODAA 2RARA 3DNPA 3QU7A 4C4RA 5AM2A 2X4DA 5AVWA 3L8FA 3MN1A 3TLMA 4NFLA 2ZBDA 4KYTA 2HI0A 4J2TA 2FPUA 1RLOA 5ALFA 4OHFA 4HGOA 1TJ3A 2G0AA 2B30A 4RETA 4H1WA 5AVSA 5AW4A 4UMEA 5IS2A 2P69A 4Y2RA 1J97A 5AI4A 5ALUA 1Q91A 3EPRA 1L7OA 2MU1A 4NWIA 3SKYA 1U2TA 2YY6A 2HDOA 2IOFK 3L0BA 5ALPA 2YJ5A 2RBKA 2HHLA 4L57A 3SD7A 2WFAA 3U7GA 3U7FB 2R8EA 1CQZA 5ALMA 2WF5A 3WK5A 2PR7A 2FPRA 2FPWA 3MMZA 4UU1A 3U7EB 4Y2TA 2WHEA 1IWOA 1LTQA 2CN1A 1PW5A 3WKBA 2YMQA 2I55A 4XQ0A 2CFSA 5AM0A 4QQFA 3NIWA 3ZI4A 5AIAA 5AW0A 5ALXA 2CFTA 5ALHA 2P9JA 3CZ4A 1J8DA 3UMGA 5AM3A 4CE6A 1Z4KA 3ZTYA 3W5CA 1L8OA 2EATA 3DAOA 4YIHA 5AM4A 4C4TA 5AW6A 1ZD4A 3N28A 4NV0A 1ZD2P 3RF6A 3AR4A 1QH9A 3PGLA 3B8EA 1TJ5A 5AW9A 1TJ4A 2D2VA 5AVVA 3BWVA 3WKAA 5AIBA 4YH1A 1SWVA 2JAWA 3L7YA 1RKQA 1O03A 3ZX4A 3QX7A 2HX1A 3IB6A 4Y2QA 2QLTA 4BEWA 4OD0A 2EAUA 4DCCA 3WGVA 2BY4A 4G63A 4CF3A 3QYPA 4UM5A 1ZRMA 2R8XA 5AK4A 3M9LA 3B9RA 2YJ6A 1U02A 3ZVNA 4BX2A 3QLEA 5ALWA 2IOHA 2W43A 5ALTA 1Z4QA 3WK8A 1Z4OA 3FVVA 4CF5A 3AR6A 3QU9A 5AKHA 5FP0A 2W11A 3EF1A 4BYGA 1Y8AA 3ESQA 1U2SA 3E8MA 1QYIA 2WF6A 2PQ0A 4XOUA 3MPOA 3L5KA 2YMMA 4BBJA 3ZWDA 1NNLA 5AVUA 4YCLA 3OPXA 4B6JA 2ZBEA 2I33A 2R8YA 3R9KA 1NF2A 3HLTA 4Y2VA 2O2XA 2C8KA 2DQSA 5AKEA 3L0YA 4UU0A 3DDHA 1Z88A 1Z5UA 5ALZA 2BDEA 3N07A 1EK1A 1L8LA 4DFDA 3U7HB 1L7NA 3NUQA 2HSZA 5AI0A 2OYCA 5AW7A 2MSNA 5AM1A 3AR7A 2OA0A 5AKYA 5AK5A 1RQLA 4HGRA 2G07A 4E88A 2Q4RA 1RC8A 3FPBA 2C88A 4KNVA 5AW8A 2YBDA 2Q4TA 1L7MA 3UM9A 3W5DA 3NASA 2CFRA 4KNWA 2G08A 5AKGA 5AW5A 5ALDA 5AI8A 3WK6A 3BA6A 1QQ5A 3N1UA 4BEVA 3OCXA 1RRCA 2B8EA 2FEAA 3QU2A 4BX0A 4HGQA 2P27A 3AR9A 2VKQA 3SMVA 2B0CA 5AM5A 4EX7A 5AVXA
chains in the Genus database with same CATH superfamily
1IULA 2AJCA 4LZLA 5ENZA 2FJ0A 5L3SB 2VK2A 1EVQA 1L5GB 5DSXA 3S2ZA 4GMGA 3CNOA 1VG0B 4R2KA 3ZHRA 2QAIA 4BNFA 1ZUD1 1KXJA 4QOHA 4RNCA 1IUNA 1TKBA 3W5VA 4EH1A 4ZMRA 3GVCA 1XZLA 4RIEA 1P7WA 4M0UA 1T9GR 1IN7A 1RR6A 1X42A 2DFTA 5DNEA 3JAWB 2VRCD 4YASA 5P21A 3NVMB 5CFOA 1CJBA 2E7ZA 1E2LA 3H3FA 3KBOA 1HT2E 1PU2A 4GYJA 1BDJA 4BVKA 3MHTA 1NW3A 1TQ2A 3DWFA 1UXHA 5CD9A 1Y3HA 1HV8A 2Q6VA 3SXJA 3E9NA 4QBIA 1BA2A 3MW8A 4CL8A 4DJEC 1RM4A 4FKBA 4JX9A 3GUVA 5FPYA 4IINA 4JY7A 3TUJC 4DWWA 3WDKA 3UH1A 5JCOA 2PZAA 2KS6A 2OC9A 1D6SA 3ZNPA 4MUMA 5HZGA 4V0QA 1TLTA 2YY7A 1TO6A 1CUHA 1N8TA 3MWFA 4O4LF 3RIYA 3UQYS 4EKEA 1AJEA 1TFRA 3DMPA 1F3OA 3L43A 5DNVA 4MULA 2I22A 4GC5A 4OAOA 2JLVA 1N34B 4WCFA 2VAWA 2VOEA 2PQ6A 2ZYHA 3ITNA 1E4VA 4XGNA 2J08A 3NGXA 4PNPA 1P7CA 5T64A 1K3TA 1CUZA 3GRPA 4L7QA 3LD9A 2JI9A 1BMTA 1G5PA 3D6HA 2VBGA 3FOAA 4BNZA 4DKJA 3EZ2A 2BEWA 2YHIA 1DAFA 3HV0A 4MVCA 1K98A 4IQ4A 4RL6A 4ZYXA 5LP1A 1PG0A 1P2FA 1PHPA 2QPTA 3M6MD 3WXBA 2G8LA 2QRGA 4N9QA 2G9ZA 1KRXA 1FLAA 4HDKB 1MTOA 3DEZA 3UYKA 4WCFB 4LJSA 5DW3A 1YUBA 2B83A 3SYRA 4KN5A 1BCSA 3V8BA 5K3DA 3ETJA 1I7LA 5C81A 3W3AD 1TGVA 3NOVA 4YGXB 1LS1A 1AN9A 1Q57A 3JD3A 2O6HA 2I9KA 3NDJA 1T2EA 2HSJA 4L75A 3SJCA 2KPOA 5DV9A 2F9LA 2BCGY 3NNDA 1M1NA 1RAIA 2VAMA 2PD4A 3NRBA 2C4UA 4JSTA 5CGQB 4ZO8A 5J2UB 5TMBA 2BEWB 2YHIB 3N58A 4REQA 5J2UA 3CISA 1UEJA 3CV3A 2FXVA 3M1AA 2A9VA 2FR1A 5DLEA 2HNKA 3ZWQA 1RKVA 1JR6A 5TARA 1TLLA 1FFSA 4TTTS 4JS0A 1HG1A 1WHTA 3NKVA 1BCSB 3ETCA 1R0YA 2TSYB 4Q24A 3G8AA 2B8TA 1PV2A 3OZGA 4D3ZA 3PKJA 4Q7MB 4G0PA 4BO3A 5FBQB 4HUTA 2WMNB 4PLWA 1M1NB 5ALOA 2CCKA 1M3SA 4AQDA 1L9XA 3C6XA 4REQB 4D7AA 4G1CA 1E89A 1KDRA 1MH9A 3K16A 4AICA 4LA4A 3EE6A 5LD2B 1Z2OX 2NTEA 4IIJF 4EW6A 2IUEA 2P9FA 4IIGA 2XBMA 1MJFA 2OYRA 1WHTB 1R16A 4GSLA 3Q85A 3VR4A 1FDWA 3ZLJA 1INLA 1MHPA 1ZMXA 2HB6A 4TMZA 1BDMA 1R6TA 1GZVA 2VK1A 4PLCA 1X0VA 3OU6A 4RO0A 1AUXA 1EXDA 3Q9SA 1YRLA 5IC6A 1LBSA 2QMQA 4OIMA 1VDMA 1XF1A 4ILEA 3SM3A 1IC6A 3RVKA 4CTOA 1DEXA 1A4XA 5DO9A 2P9EA 2PSSA 3EGIA 3KZCA 3MT0A 1XYGA 3NHAA 4HAYA 3E9ZA 4ZJYA 1WULS 2IYWA 3HBLA 4H3KB 1XTSA 3OWOA 3NWEA 1AHNA 3QVTA 2BMDA 2Q3DA 2P1RA 2IGTA 2QJWA 3PJDA 1ESZA 1NG9A 1R5NA 2Y1DA 1QTIA 3PTLA 4WKBA 1YGYA 1VPEA 4RPKA 2PMWB 4PFJA 3N0XA 3ONDA 2PFMA 2WU0A 4YQYA 4DIKA 1M73E 5ITZA 2YICA 2W42A 2ONKA 4OBWA 2ZI7A 1S2OA 5JZVA 2ZBGA 1GITA 3A4VA 1OZGA 4PC7A 4J29A 4MGHA 3CTPA 4HVAA 1JT9A 2GK3A 2ZBVA 3D4OA 2YR0A 2KE5A 2XYVA 5ED4A 3ER9A 5LIPA 1RWMA 3Q0EA 3HVKA 3UJPA 3VZBA 1GG2A 1UANA 1ECPA 3HG7A 2HBRA 2CJYA 5L7YA 3WY9A 3WZ2A 2WP0A 4AJNA 5ITZB 3KZXA 4FDTA 4FE4A 3FI0A 2JJYA 2FEMA 2ETVA 2C3MA 3DKRA 4H7EA 4IIHA 1HEIA 1SBHA 1KSGA 4JC0A 2W90A 1ACLA 3AKYA 3AM4A 4QQNA 4TXJA 5HDQA 3BDVA 1IAVA 1SVLA 3RIXA 3NBKA 1QBKC 1JAHA 3AUXA 4D3SA 2WA1A 3IE2A 1GKUB 3SE7A 1LX6A 3SEZA 5BQ5A 4OQNA 2NLOA 3BHGA 1QIJA 4GC9A 3K5IA 4LY0A 3FYUA 3LKZA 3NP9A 1DTSA 3T0IA 2HBQA 2FEWB 3QA9A 4M0EA 3DBIA 4P84A 4Y30A 4DVJA 4HEA1 4OOFA 1T2AA 3PNQA 3TMKA 2VUTA 4HPWA 2DHCA 1A9PA 4HADA 5FAXA 2J30A 5JHHB 5I7WA 1JALA 3L8EA 4JJKA 2F8MA 1JU3A 1NPYA 4P0QB 5BW4A 2Z1MA 4RQTA 3ZDQA 4IX9A 1BEZA 3DWGA 4MI9A 2OZKA 3TF5A 2F90A 2F7SA 4QUHA 2OV1A 4PBSA 3OQNA 5FPPA 1J5XA 5DXFA 1JW9B 2C84A 3SYMA 3FYUB 2E85A 1TQHA 2QOEA 2NZUG 4ROTA 1PFWA 5FI5A 2OQVA 1XC7A 2QN6A 4MCAA 4ZVSA 5GJBA 1NW8A 1RZ3A 2VDVE 3ZDAA 1N2JA 3A9SA 2B1QA 4JXJA 1YZTA 4G5RA 4NEHB 2IYZA 1E1YA 5B1DA 3UJ3X 4MYDA 1Z38A 1G0OA 4KACA 4LMRA 5ESWA 5F1YA 1WSDA 4CLOA 1XD9A 1CDEA 1FSZA 1ZOSA 2H17A 4F1JA 1FDSA 1W5EA 5JZ9A 3V48A 2R47A 2A4MA 1WUJS 1M75A 3EGCA 1OLSA 1U94A 3KJNA 4EZIA 1O6ZA 2CCGA 1QFYA 3I2YX 1CRWG 3QP9A 4LJLA 3TUIC 1JYFA 3GGSA 2OBMA 5LKAA 3D3JA 3H9UA 3ZWWA 1OXSC 3VPSA 3MJSA 2ZPTX 2OG1A 3FNQA 3KT6A 4UAUA 5HS6A 3RSQA 4F92B 1E2BA 5K0EA 3CZ5A 4WFQA 4FCVA 3JSXA 5KTSA 2GWHA 1EFRA 3QUTA 3KJEA 3PCTA 4IXWA 4ZCSA 1RJ9A 2ODEA 3V2UA 1X9HA 4CLOB 3FHTA 1FTSA 1VPLA 5IEJA 1UINA 1P2DA 2XMRA 4Q1BA 3ZHCA 1ORTA 3HFJA 4LSGA 2HR1A 3DC7A 2Z6AA 4XFKA 3SIRA 4TN1A 1OLSB 4OSOA 1AXRA 4JSRA 4ODIA 4ZAWA 1VLJA 2UYYA 3EQ6A 4N18A 4UDYX 5ICGA 1G8YA 2OHOA 3ANMA 2W6ID 3U37A 4LWOA 3QGMA 4RF5A 3ZGVA 1N5OX 3K05A 3K4QA 3U4GA 4B09A 5DNYB 5C1IA 4R1LA 3V1YA 1EJ2A 3M0EA 3T12A 3E7PA 3BIFA 1BH6A 3WLJA 1RJ9B 4ZMSA 3OZEA 1Z63A 1CUIA 3S1LA 4RGBA 1S8FA 2BJWA 4ZPJA 7ABPA 3UC5A 1KQOA 4KMRA 4NOLA 1M8FA 2PZBA 2QVLA 4DTCA 2IELA 5TDHA 4BFTA 1L3BA 1Y4UA 2C7GA 1QV7A 2X5KO 2YOGA 4OUKX 5D51S 3WNZA 1FBTA 1C1DA 1SUPA 2ZBPA 3NTLA 5EGSA 4ZDIA 2HCTA 3F4RA 3G02A 2NZJA 2BHNA 3L8FA 3TLMA 4B1FA 4IDBA 1I7NA 1ZM4A 3B48A 4B76A 5KNDA 3AVYA 2A6PA 4EG5A 4J2TA 2H1FA 1KQGA 4NH4A 1D5CA 1R8JA 1OXVA 2I3BA 3JZFA 5IM4F 3FKQA 1U15A 3P9SA 4DLPA 1IG0A 4DA9A 4MA4A 2JGNA 5AVSA 1EB8A 1H0SA 1DC5A 1F1JA 3W7BA 3HJNA 1YC2A 2A0KA 3EPRA 1DAPA 3DHYA 1C1DB 1U6JA 2A9OA 4TYWA 1Z7YA 1W0JD 1R2QA 2WJZB 3BDIA 3F90A 3MBKA 4IPTA 1PJ3A 4N0EA 1SU6A 4NWIA 4W1RA 1U7UA 2OCAA 1OFUX 4AJLA 5IM4A 3WYDA 2PJDA 2RHWA 5DHQA 5H0IA 3PUWA 3L05A 4LDQA 3SD7A 1ZI8A 2EWWA 1DO8A 4CIXA 1Y5MA 1ARZA 1DQYA 3I0NA 3LUBA 3E7DA 4EA9A 4DNQA 2GPYA 4J76A 1ADYA 3DTVA 1QVAA 2FPWA 3PYLA 5EMNA 1XQYA 5E0KB 1WNTA 2MSDB 4WKPA 2FF7A 2J0UA 3PEWA 1TGYA 4Q3LA 4Q4LA 4RIFA 3SZLA 2I55A 2R00C 4L9AA 4A5SA 4B3HA 4MIOA 1YR1A 3HU3A 1POXA 2VEOA 3L04A 1DAMA 2QZ9A 3C3BA 2GILA 3RJMA 3WGMA 4FIZA 4FEAA 4FFOA 1QDLB 3QWBA 3GEHA 5AJHA 3QKRA 1QRUA 2V7GA 4BO2A 1BFKA 3KZVA 2MMCA 3DTVB 4GBJA 1H2FA 2B94A 1X1RA 2D0PB 2O0KA 3L6RA 4FYWA 1Q2XA 3OM9A 4U2BA 1O95C 2J0UB 5K99A 4OBXA 5EHXA 4OFXA 2J31A 2J3JA 3I92A 4MLZA 3AINA 4KU4A 3HZOA 5EUBA 3WP1B 2KWIA 1PG2A 1GNPA 2EOAA 1A5SB 2R1VA 4GM4A 2V6MA 4EGFA 5K0ZA 1O7JA 3HDTA 1UBLS 2J4CA 2IS4A 2WLSA 5K0SA 1MB4A 5LVAA 1VJ1A 2PRJA 3K35A 3QKRB 4NE2A 5BSFA 1ZESA 1QHYA 2ATXA 4L85A 4B4OA 1GWNA 1NZDA 2CNKA 1I51A 2GN2A 3FYHA 2JCVA 2WVHA 5JRZA 3L6UA 3QHQA 2JAWA 1HDZA 2JJ1A 4Q47A 4AQYB 5K3CA 1Z6ZA 1O03A 5AHOA 1U1EA 3E9CA 5HJ2A 5A4JA 5HKBA 3H5VA 4OK6A 2JI6A 1JDSA 2R1VB 5LDGA 2P4QA 4E14A 1YO6A 5A04A 4MQLA 1NBWB 4US2R 2QRUA 2WB2A 1YACA 2E4ZA 2YDYA 3AYZB 1RWOA 5F2OA 4X1OA 3GB9A 2QT9A 2WYIA 4NU5A 3NVAA 5LWQA 1GDDA 1ORIA 1OWMA 4U7GA 4IXNA 1UOQA 4XDGA 2GTHA 5EJ9A 3GH3A 4B8ZA 4BFXA 1D1TA 1OYWA 3B9RA 5LQDA 4AKIA 2NAFA 3EC2A 3GJSA 5G02A 2PLAA 3BL5A 3UJ9A 1LDGA 1UZLA 1JFVA 4CFSA 5E38A 1C80A 3PKIA 1PT8A 4XFJA 1U4NA 2ZU6A 2VC2B 4TTSA 1DDIA 1UADA 1A7KA 1WU8A 5ESRA 5J4LA 2IT1A 5HVNA 4X66B 1AK1A 4ZVLA 1K9SA 3SK0A 3WAJA 1K9VF 4TXLA 1XZQA 4WKOA 1Q0QA 4DMUB 2ZI4A 1YOVA 2I99A 3DBOB 1E6KA 5B2ZA 3VHXA 3RDPA 4NMWA 2OFXA 4TKVA 3WLFA 4PBRA 3LP8A 2W6NA 4ARIA 5G1OA 3SBEA 1HURA 1O6GA 2ZS8A 4GI2A 4EABA 2D13A 1DFIA 4QSMA 2X0IA 3ZE1B 2EGUA 4E6PA 1XEWX 1BQ3A 2YMMA 1Q20A 1DKMA 2D59A 3F8WA 4ZO7A 1R88A 1J20A 1U3VA 1Z5ZA 2O3RA 4E5KA 3GP3A 1YOVB 2ZBEA 4N7BA 4DZZA 4E5DA 5LM3A 4JP8A 1FYFA 3H9JA 4I6EA 2HZ7A 4Y2VA 3V32A 4HVTA 4TKVB 1S5PA 2FEOA 1BH2A 3CKMA 4P7BA 3S55A 4GDMA 3PR1A 4RPCA 5HIKA 2J9XB 1KI2A 2WSSA 3MS4A 4KH0A 1T1RA 4PRKA 3EIQA 1O0BA 5ALZA 1N6PA 2MSWA 2XXAA 4P4SA 2LBPA 1VSTA 1MPXA 3QX8A 4FXPA 4CN8A 2XRMA 3U7HB 3X3HA 3BWYA 5ECWA 4QEKA 3H83A 3K09C 4DLUA 3UXHA 4J2HA 1J5EB 3EUEA 4M8LA 5ICSA 2AI1A 4YV0A 1L7DA 1VL6A 4BO5A 3EXG1 2M32A 1IJEA 5AKYA 3H6KA 5AK5A 4OMUA 3MVEA 1X8XA 3PUJA 4YLGA 4E88A 4DJJA 5BMVA 4ESEA 5DNCA 3HDHA 1RLUA 4KG7A 2I3AA 1MB2A 1JYSA 3UOGA 4X1KA 2XXAB 4IQJM 4P4SB 1C50A 1B6RA 3ETHA 5HKKA 4KOAA 3GGGA 4ENQA 1GY8A 1MVLA 3DMNA 1W19A 5JSUA 1I6KA 1Q74A 5JYDA 3COJA 4RADA 1IZ8A 3OM8A 2E5LB 2YUTA 5G3YA 4QYIA 4FWTA 2ZUEA 1USIA 3KR0A 3V4OA 2F3SA 1EVIA 1M8KA 3SFTA 4D9IA 2JFOA 1QLJA 2VAXA 5CITA 4OAQA 821PA 3QNUA 1KFEB 1KJJA 2QLLA 5AM5A 5BMVB 3U9LA 3KXLA 2A3NA 1BGVA 2ROQA 1EFPA 3EF3A 3C8ZA 3DF9A 4F5DA 2PYDA 1QV6A 4X1KB 2WIGA 1NQUA 3PHBE 5BT9A 4UASA 1SH7A 1TECE 1JHAA 1V7QA 1ZCBA 2WTNA 1FUQA 4UCWA 1TK3A 2YXPX 1GPMA 4QYIB 1G8FA 2OZPA 3EHEA 3U2QA 1FYWA 1NTRA 3VR3D 3W9BA 5JO0A 1G9TA 5KTPA 1KAMA 2UYQA 5F12A 2C7RA 1O94A 2XTMA 2I8CA 1RBYA 1Z7GA 2WTMA 3O0DA 4TT3D 4D5GA 4HH1A 1E5DA 1U0SY 3W5BA 1DBSA 1W35A 1EFPB 1IU9A 4A2QA 4OHBA 4H0FA 1JTEA 3ONFA 2QX6A 4GI7A 3UATA 1BDBA 4PQYA 2JH8A 4D0GA 1N8NA 4RA6A 4MWOA 1Y3FE 2BMWA 1J2YA 2TMDA 4MA0A 3TQCA 5E3HA 5KMGA 1C0EA 4H15A 2VZ9A 4G2TA 2JFBA 4BVLA 5L3ZA 4EPVA 4R6XA 2J7PA 2XVZA 3RFVA 1YASA 2NXNA 3R20A 1JQ3A 1KBOA 3TMYA 3P5SA 4P82A 3USZA 3NPAA 2IGBA 4QVKA 3CZCA 4B4VA 3IS3A 1U0LA 4RDHA 1JH8A 4ZEMA 5K5EA 4QOFA 4BWYA 2Q3JA 4AMBA 2HFJA 1JFTA 2Q2NA 3L8YA 4IGKA 1ZEJA 2HJWA 4RA6B 1IDN1 2PL9A 3VPAA 4PAOA 5KMGB 2Y27A 2Q0HA 3GEGA 3VU9A 3ZIUA 1VBKA 2DUMA 4WK4B 4Z49A 4OLJA 2FKAA 4HDOB 2YXBA 1MEJA 2Z5LA 3VZQA 3JQEA 5LZ7A 4NMLA 3F4TA 4DWJA 1VL5A 5JZMA 1PJSA 3BHMA 3T0FA 3CR3C 1JDUA 3WWYA 1FUEA 4MYCA 2AN3A 3HCPA 2GZ2A 1YHNA 4K9DA 1XRPA 3WRYA 1PGQA 5BWBA 2AK3A 3KUCA 4OH1A 5C4IA 4C0BA 1TU4A 1VJDA 1HYBA 1X2EA 1A97A 2OO5C 2RIPA 3BQ9A 2NX2A 3IOMA 1P45A 1TX4B 1EWRA 1V45E 2FPOA 4DDWA 1TRHA 1V3VA 3DM5A 3NEAA 3VU9B 4M8IA 4BATA 1GUFA 3UK7A 2XCSB 3VYWA 2GJAA 5BMOA 2GD6A 2CXNA 4JBGA 1IBLB 4FHDA 1UPFA 2P2CA 1BXZA 1OTXA 3USES 2D62A 4NBWA 2EL9A 3P9CA 2C1ZA 2CL0X 3NJ4A 4UKDA 2Q07A 3CH5A 1CX9B 1XQ1A 4TRJA 2ZQ5A 4AWAA 3GHYA 4D25A 3R1IA 5H3CA 1NVBA 4F4CA 3I64A 2O9JA 3G8DA 1SIOA 1TNDA 4G84A 4P36A 3GN1A 5KCZA 1PL8A 5FUBA 3CVWA 1BJKA 2P9CA 2VSOA 4FD3A 4RENA 2Y93A 2WF8A 2NZXA 2W2PA 2C2GA 2ZG6A 4ER0A 3GLFA 5EXXA 4YCJA 4QU5A 3FTPA 4V3BA 4S1PA 5KVQA 4OHPA 4PEVA 3VZSA 5C4MA 1VE3A 3KJZA 3QFHA 4LC0A 3GNQA 2L19A 4BCDA 4MW6A 1Z2NX 4CTJA 5IF3A 4MRSA 2AC4A 4QGAA 3IXMA 4TROA 1OBOA 3CPJB 5EKDA 3HXLA 4LJRA 1QSGA 5EIEA 2BJHA 5BVGA 4HZGA 4PYMA 5TS3A 1FFHA 3PPXA 4L5IA 5LCXA 3B3JA 4LSMA 4P0TA 3SHOA 3CW2A 3TI7A 2Z3VA 4IF6A 5AFSA 1QORA 5IBCA 3BXFA 3FM9A 5EFOA 3GLFB 1WD5A 3U3OA 2DU8A 4AFNA 1QO0D 3CNEA 3AL3A 3MTJA 3CCFA 4Q9AA 3H1GA 1Z4MA 2GBFA 2LGJA 1A5BB 3VX4A 4WASA 4B47A 4BPRA 3JARA 3KL2A 3OQMA 1RTKA 1O2DA 3I32A 3N5CA 2EJWA 3NTUA 4RGQA 3VPHA 5KU1A 2GO7A 1P4HA 4U00A 3TS1A 3V4LA 1ZK1A 2GF0A 1IQRA 4QXOA 4XAQA 3SU8A 2Y1OA 5BVGB 3FF4A 3TLJA 1K7CA 1P0FA 1HQCA 2IW3A 3C16C 3SZOA 3IQIX 3WYCA 4GNRA 3W9SA 2YWEA 1OZAA 4LY3A 3A6FA 1N2EA 2PE5A 3CJTA 1VLVA 3L4SO 1UJ5A 1I4TD 3O38A 4BCBA 1RYEA 3JARB 5I3ZA 1P1FA 1HDGO 2YNMA 3LP5A 4M1KA 3A0RB 4Y7CA 1GNSA 1GGHA 1OMOA 1EBFA 3HM9A 1YHYA 2V7TA 2R86A 3JQFA 1TQ8A 3ANYB 4AJEA 1J8MF 2CNNA 1U2DC 1MRZA 2JARA 1GNQA 1AG9A 1X8LA 4OYLA 2I4MA 3NW9A 3N75A 3BTSA 5BQXA 3X2FA 4F84A 4O29A 4J90A 4IIXA 1RNLA 3SDSA 5BOVA 4M1MA 1AGRA 4UAGA 4UFNA 3H5WA 3GZHA 1C41A 1SXPA 1U3CA 3CC8A 4IOJA 5J2TA 3QEOA 2ORWA 2UZ0A 2AKEA 1KVTA 3CG4A 3QKWA 3NHPA 2A9RA 1N75A 1L5MA 4IR7A 3ZDRA 2R6FA 3DMRA 3S2FA 5FR2A 2ZVPX 4ZREA 3ROTA 3WP0A 3CT4A 4MMZB 5A0FA 4G65A 4HGNA 2ONJA 1RKUA 2BSAA 3CSSA 3IP8A 4BO8A 5KVAA 1M2HA 1FDOA 1WJGA 2Q1SA 4ZAXA 1Z36A 1FTQA 1WSAA 1FJ2A 1YUNA 4GSYA 1YFLA 4KQCA 4OG2A 3CRZA 3ULKA 5EJIA 2QU7A 4IRXA 5C1OA 2YDXA 3MXOA 5J2TB 2CVPA 3GL9A 4NULA 4AYTA 1DIGA 2IZ5A 4JB2A 1KYIA 3FBGA 1W75A 1P9OA 1VB3A 2J41A 3IT2A 3KOWA 4G36A 5K2MA 9ATCA 1EIWA 1KO7A 3EIEA 4GEKA 3PC8C 3DMYA 1OB5A 3KB8A 3QUQA 2LWIA 2XZLA 3IP6A 4EJSB 3I2KA 1NVEA 4M1OA 2GM5A 2F3QA 5HFJA 4PG8A 5IJ0A 3L8ZA 4AW9A 3V8QA 2GM4A 2HFKA 3OCWA 1M8GA 5ALJA 3RUIA 4MA5A 2PSFA 4UUOA 3WDLA 1LVHA 2RHRA 2SCUA 1JIXA 3E5HA 4EL0A 1DJNA 2G5TA 2GAIA 1XXLA 2ZJ8A 1EVYA 1TM3E 3TN7A 3ND9A 1G6Q1 4DQVA 2E4UA 1IJKA 1NF3A 4FYPA 3UB3A 1T4DA 4ACAA 5JC8A 4A36A 1GTG1 2LNDA 5DYGA 4NL4H 2I2AA 2XKJE 4C7MA 5HJ7A 5JPIA 1S0UA 3SQOA 2B3DA 1Y33E 1QIKA 1V96A 3LIPA 2GFHA 3CSDA 3WMRA 3EXEA 2QD4A 3KT0A 5IJ0B 1AHPA 3WGLA 3DAHA 3NT5A 3RK1A 2SCUB 2XGJA 5BXQC 1VIVA 5D01A 1TVMA 3JWGA 2BGLA 3CZMA 2C00A 3JQ6A 3PUHA 1W93A 4DG5A 4OFWA 3RV3A 1EP2B 3G85A 4IZOA 4NH0A 3T5PA 2OFWA 1DMRA 1JHQA 3A4MA 4EG8A 4YMUA 5HRUA 1G4UR 3T7TA 3ZWNA 3AR5A 3GCXA 1QGZA 4ZVTA 3L8DA 3TTXA 1CUFA 1HYQA 4NAVA 1C4XA 4TL9A 2I7DA 4UHCA 1FF9A 4JITA 5EAIA 3EXEB 2NPIA 1BD3A 3NR2A 4HN4B 2BH9A 5B37A 3VC3A 4UQLA 1JFSA 2D2EA 3WBFA 3G6KA 1KOGA 5AI9A 2BF4A 2KM1A 1RBMA 1TT7A 2IHBA 4GM0A 1ZM9A 3OCJA 4HBZA 2GKGA 3UFBA 1AO3A 5DBHX 5HPYB 5ILOA 3RFUA 2YKGA 4GI1A 2E6UX 3GUYA 2PWBA 3I30X 4KQIA 4QJIA 4XI9A 3BSFA 1UJCA 4CU2A 3QG1A 3S2EA 3KC2A 5K4GA 1XLUA 1Z6QA 5CT4A 3TZ6A 1GNLA 3AKDA 4UEQA 3FGPA 1MTZA 1TJYA 3ET4A 5DPMA 3CEAA 3PX3A 4PQFA 2QT0A 1RWWA 4F2PA 1KYVA 4L6CA 3AH8A 5SY9A 2CCJA 2FUG1 1KVUA 2J5KA 5AOBA 5AVOA 3WB1A 3TPFA 3ZNNA 2QVGA 4BKQA 4C4RA 5BYAA 5COQA 5B4TA 1V5GA 4QWWA 1GTJ1 3S8YA 1QYRA 1XEAA 1DQRA 4KYTA 2H1RA 3BE4A 3CONA 1PUXA 3IAM1 3RC9A 2HHAA 1QB8A 5L9AA 1HFKA 1P2GA 2G0AA 3LKDA 3ENVA 5HE9A 2V3VA 4Y98A 3PRYA 4NVRA 3RVBA 4A7PA 4B6FA 4IZIA 5AMXA 1GTSA 1HBJA 4BMPB 2V7PA 5B3JC 2QGZA 4KXQA 1P9LA 3GRRA 4A8HA 1KH2A 4KVFA 1ABFA 3AIKA 3I45A 1LQUA 2HDHA 3WZLA 3P0HA 1C9MA 1P1IA 2CBZA 3PI7A 5JSQA 2C31A 3L7JA 3SXUA 2W0MA 3ZZMA 4B3SB 2ECQA 4CTNA 3FG9A 3HUEA 1K27A 2HV9A 5JC1A 4L57A 4K46A 3LT0A 4B8WA 1XZIA 2ILTA 2X5NA 4Z5XA 2VPPA 3ORRA 2C95A 2ZSJA 1UDCA 3ZD6A 5DLDA 2H1CA 1EDEA 3D3KA 3GAZA 4XUCA 1BWPA 2VPWA 4E4RA 2I4NA 1Z12A 1UPTA 2PFSA 3BB3A 3DQZA 2PD3A 2WFLA 2Z4SA 3HDQA 3QM1A 2GM3A 2IDJA 5F23A 1W5BA 5DHFA 4TLLB 3NCTA 1TMYA 1RWVA 4YAJA 3Q7TA 5AM0A 3UWKA 2GSWA 3SXUB 2JBHA 2ZYTX 3AERA 3B3QA 1MX1A 1GQYA 3QBJA 1EK0A 2GJ9A 4FILA 4NQRA 3RR2A 5F64A 4ZEOA 1XP8A 1C3LA 1LVGA 5CX4A 4KE7A 2ZSFA 4M7PA 5K51A 4E5PA 3HKDA 3ZN2A 1WW8A 2QTBA 2WFLB 2A0XA 4LJ6A 1V41E 1V9SA 4ZYWA 1FFBA 3PDIA 3QPBA 3K6RA 3IJEB 5KX5F 1TIKA 1RACA 2VVTA 3V46A 5G1NA 1D1SA 1ZD2P 2IZOA 4KV7A 3PX2A 4HAXA 3BULA 1AKWA 3AERB 2ZRGA 3EG9A 2C2ZA 3S1AA 3BORA 4RY0A 4W1SA 3B1WA 4DA4A 3G9UA 5FL3A 2XWQA 2DLCX 2Q4BA 3ICCA 3M2TA 3NU1A 1ZD1A 3O4FA 3QPAA 5DP2A 1CDZA 1JLSA 3ELUA 2OZEA 1CJUC 1MC5A 1V8ZA 4ON9A 4ZQCB 4F8EA 3HKDB 4BB9A 3CR8A 2WWXA 3EZNA 3WS7A 1Z28A 1Q16A 3PDIB 3TCNA 1S6YA 1IQPA 1G7SA 2X9QA 2NP6A 1N4DA 3I73A 4C5BA 4DGSA 2HAEA 2IIBA 1ZIXA 3EG9B 3V4VB 3S1AB 4R2JA 4CJXA 4EBBA 3UENA 4DF3A 1Z7EA 2NM0A 1FRVA 2BHLA 2A7XA 3KU1A 3LL4A 4GRAA 5H83A 1JDPA 3QYPA 3A3OA 5KX5B 3B89A 3KFVA 3M9LA 4HDCA 1Q3TA 2EQAA 2PUWA 1JKJA 1USUA 2E6KA 1GSOA 2YJ6A 2V4ZA 4DIDA 5JPCA 2G1PA 3MELA 4PS1A 2UVDA 2P4HX 1FS5A 1ZK2A 4C7VA 1CRPA 2R7MA 2E87A 5E1OA 3GFOA 5A02A 3NHRA 4JASB 1VIAA 2PAFA 2DHEA 4L51A 5HRAA 1NWHA 1SK8A 3H0EA 3PNYA 4HZUB 4MW0A 2GA9A 3C4VA 3B5JA 4PGAA 4WXHA 4EHLA 3K9QO 3SOZA 3I39X 2PUDA 3RARA 2WG0A 5CR9A 2EKZA 3GNLA 1GM5A 2GKSA 3GLRA 2DFVA 2FMHA 3WQRA 4YPVA 1FMLA 2FZLA 4FMDB 1UBJS 1JKJB 3O3MB 4II3A 4C0WA 2P90A 1EJ6A 5AUNB 1GCUA 3EJWA 4DB2A 3A2LA 1RRKA 2ZGVA 1YR8A 5CYPA 5THQA 3DEHA 4M9RA 4FEYA 1EX7A 2Y2UA 2P2YA 2QMHA 5JT1A 3GBSA 2O20A 1A7UA 4C76A 1U0TA 3V33A 3LXXA 1JG2A 1XHEA 3TLEA 3L92A 3OJOA 2HJGA 2O57A 5KEIA 4MMXB 4UHEA 3SHTA 2YH2A 4QRHA 1P62B 2BWJA 1TKAA 2JGJA 3EMBA 3LG2A 1N0IA 1CRLA 1XO1A 1ADGA 2JI4A 2W2MA 2XKBA 3GEMA 4L6IA 3TEFA 3UW1A 5H68A 1CZHA 3IPYA 3TXXA 1MUUA 3GA7A 1QKJA 4LK2A 2MIIA 1SCDA 1HI9A 4RTKA 4O3FA 4H1TA 4BN0A 1Z5UA 1P0IA 1F7UA 3N07A 4X95A 3AIOA 4DLLA 1DO2A 2IVFA 4ILKA 5AUPB 4YMLA 3QEAZ 1QK5A 4RFVA 5FOUA 5J43A 4GVPA 3EVBA 3HBJA 3MCTA 3T52A 5BN3A 2P30A 2WU4A 3BB1A 4PQGA 1P77A 1X7DA 4JBIA 4Q19A 4EFNA 1OLXA 3K8QA 2ZRNA 1K0FA 3KQLA 3R7SA 5FRDA 5IASA 5LZ9A 4DR7B 3LPCA 1PS8A 4MVYA 5ECYA 5B4VA 4KQXA 2DFNA 1D03A 1SZDA 4KRYA 4OA5A 3ONWA 2CZCA 2Q4RA 3F3MA 4GOLD 1GPAA 4DIMA 4XVQA 1YOBA 2C88A 2VYQA 3BWXA 1E6UA 3FPBA 3PPWA 3AF6A 3PICA 1P2SA 1OXTA 2FUNB 3U31A 1DCKA 4AP5A 5DK6A 3ZXSA 2WKRA 3HWSA 3I2JA 2XD9A 3I5UA 1W88A 4WKGA 5BN3B 3PUVA 1Z8DA 1ZL2A 3WK6A 4C9BA 3T4PA 1M1ZA 5JDIA 1SKUA 3B1FA 4PYQA 4J49A 4QICA 5CHEA 1P2BA 1GA1A 1SD5A 3P0FA 1VL8A 3PFIA 3LGXA 2GZ1A 1DT3A 1E2QA 2G25A 1HZZA 3QVJA 2VA9A 4DCNA 1XPOA 1RPZA 2VJBA 3B1ZA 4S1VA 2PMDA 4YWJA 5JWOA 1UK8A 4GVLA 1W88B 5K7SA 4INJA 1H8HA 1DDOA 2O2EA 2XA2A 4HLNA 3MWKA 3G2NA 4QT0A 1K68A 1TO1E 5ALEA 1P39A 5I4CA 1JLMA 1TEZA 2QVCA 2ZJ3A 1BX1A 3LGSA 4XPZA 2Y2VA 1W30A 3JWHA 3NZEA 5HMMA 2BFFA 2EKQA 4B45A 2JHPA 3MGCA 2CYCA 1MBZA 3HI6A 4G1EB 5T41A 3UHFA 5HUQA 2HQSA 2VL7A 2PGJA 2OM6A 3O8BA 1OX6A 3NHYA 1G98A 3ABSB 2PUEA 5DW0A 1I2MA 4IOKA 5F51A 4PV7A 1O57A 1JR3E 1FBNA 1XHFA 4AMVA 4NZ9A 1IOWA 1FNDA 1ZFNA 3IMGA 1RYBA 5BN1A 4HCJA 2B7CA 4H3VA 2OPHA 4RMGA 2OCLA 4QPPA 5SY6A 1KS2A 2BFFB 1FUIA 5JISA 1ZONA 5KVSA 3ANNA 1WY5A 3K0AA 1JNXX 3RRPA 4ZRMA 3NI2A 3KQKA 2RHOA 1NBAA 3JYQA 2L69A 4WFIA 4DLBA 2ZCVA 4H3SA 3WMEA 4BNDA 3ZZ1A 5KQPA 4DXAA 5GINE 3UNXA 1J4AA 5KIAA 3QMPA 4XYEA 3WGOA 1T5HX 4TTAA 1LTHR 2OXIA 2QTMA 2VHJA 1IPEA 4TTPA 1Z0DA 1MN6A 5I7AA 1VSVA 5HIAA 1EGAA 1EFTA 2VNAA 1RXCA 2ATEA 3TRJA 3EXIA 3GA5A 4MUJA 1H05A 4NFHA 5BORA 4ARAA 4DJAA 4EZBA 3ZJVA 4HWKA 1HPLA 3K0AB 5JBNA 2D2XA 3G2JA 1QYXA 2B8JA 1EGQA 2Q4EA 4B2YA 4QC2A 3HK2A 3IV9A 3QFSA 2HOQA 3O8QA 4BNDB 2KMLA 2XE7A 3BICA 5GOTA 3UMSA 2PV7A 3HYLA 3V7UA 2A4KA 3VHRA 5BPHA 1JJFA 3TCKA 5HOQA 3L06A 1IMJA 2RGBA 4B0PA 4D99A 3JZAA 3KSAC 4LRUA 2I1VB 5CLGA 3ZE7A 1N1MA 3K0CA 3NC4A 3A05A 5KZMB 4DUYB 5BWNA 1UC4B 3EXIB 4M1SA 1RQRA 4XJVA 1AUWA 4DYDA 2UUPA 3CRRA 4EPXA 5I01A 2LP4Y 2YIJA 3P27A 2OR3A 4L5YA 3L4BA 2WEKA 4NZMA 3R9IA 1E59A 2OHFA 4E31A 3QLVA 3O8QB 4K6KA 1WCIA 1ML4A 2YV4A 4LDZA 2WSBA 2QXTA 5EMKA 3WBBA 4X97A 1E1MA 5D1HA 1CPYA 2V0CA 4BFZA 4BVEA 4E12A 1Z5GA 4BGEA 4CHTA 1O95D 1ZG3A 2A0UA 3OLVA 1SCBA 1JLLA 4R54A 1Y89A 3ZWXA 1SC3A 3WWPA 3HCEA 1XZNA 3JY6A 4JQZA 2X8WA 3T3HA 3VC1A 5LQAA 5A3JA 1A72A 5SV2A 1H6BA 2Z57A 3EZXA 2IUSA 3IAAA 4UMDA 2VQ6A 4S2EA 2HBYA 2G3YA 5IANA 4PYOA 4XX1A 2DEUA 1WCIB 4U7TB 4ZOCA 1JDBC 1GU1A 4IVRA 3F2IA 1ML3A 3C3JA 3MTEA 2PKRA 2C1XA 1I2BA 4P0PB 5FTWA 4QTTB 4EHIA 2H54A 2QVYX 3LU1A 1JLLB 4GE0A 4EO9A 2APJA 4E30A 5FPTA 4RMHA 1NW6A 4FYYA 1Z16A 2VF8A 1YQUA 3CUTA 2OM2A 2IXDA 4AN1A 2IS2A 1G63A 3SX4A 4G5QA 5HZMA 4H7IA 2N1MA 4G26A 2HGSA 5IVPA 1UPUA 2C99A 5LFAA 1VYTA 2AUTA 1QF7A 3KB1A 4WX2B 1VJTA 1DCFA 3T9DA 5KUTA 2QLFA 4KGDA 1AHHA 3FSGA 2AFHE 2I1QA 4E46A 2JLSA 4B32A 1CF4A 1K8XB 3AHFA 1YDWA 2MSCB 4US0R 2HNAA 4G8CA 1AX9A 2XVYA 1FSSA 1UODA 4N5HX 2WVAA 1M74A 4Q21A 1XKLA 3LPLA 2AMFA 2C57A 1XXHE 4N5LA 4W9MC 2J5QA 2JKYA 5E6UA 3ZZTA 4JI7B 3O9ZA 1B1CA 4D0RA 4HLCA 4ESVA 3G2PA 2D06A 2IYRA 1E4YA 4L7VA 2IA5A 3TIXB 4YBRA 5ALKA 2VNSA 4Z1MA 3UV3A 3M6AA 4WUTA 1F0PA 2WHYA 3B6IA 2H29A 3HFRA 3P96A 4JLMA 2IITA 1TUIA 2P1DA 3NGMA 1KMHA 1RAGA 5DHAA 4CMJA 4RU1A 3TSAA 3U4MA 2QUKA 3GQBA 1RU3A 2ZIXA 3OQIB 5E6UB 2J7KA 4W7IA 3QVVA 5H80A 2BKUA 3HQ4O 4X61A 2AJLI 1IY8A 1MD9A 1GZUA 2FN9A 2GAAA 2QTCA 4JUIA 1XAIA 4H08A 2BE9A 3DAGA 4A9AA 1UAAA 4PLZA 1OREA 4MOWA 5DE3A 3VR5A 2PUHA 2ZQZA 2I76A 3USCS 3SM9A 2PXXA 3QKUA 4NDZA 4PG5A 1GFWA 1DC4A 4TMKA 3PXUA 3VQTA 4EW3A 1UXKA 2V7VA 4CKWB 1NN5A 1KMHB 3GNSA 3O82A 3QNMA 3WYBA 4F8YA 4OX9Y 4LHVA 1Z18A 1P9NA 3G3EA 1OV6A 3F6PA 1IXSB 1O4VA 3GQBB 2ZIXB 4V0NA 8LDHA 1OV4A 3ORFA 4DA8A 2RDMA 3O94A 4FEEA 5CNJA 1TC2A 1TYBE 3LS2A 2M6LA 3UEOA 2Z98A 4QDXA 4ALLA 3QV1A 2EF1A 2SKDA 2IV2X 4JDPA 1TI7A 3D31A 2H1LA 4LI0A 1JL3A 4B35A 4MQ4A 4WLUA 3WMFA 1E2JA 1P81A 1BE8A 3VMMA 1MH1A 2YJGA 3JD4A 1DADA 4EVRA 4TLDA 1ZA2A 1RC0A 1HQDA 4FLMA 3BQNB 2WB4A 3IODA 1SKMA 4PPQA 4DBLE 4K05A 2Y8EA 4CR6A 5BWOA 1AQJA 4RVCA 5TF0A 1E9RA 2HF7A 3AEQA 2GZSA 3COZA 2W71A 3NANA 4JC8A 2PDAA 3QPWA 2NXJA 1KC3A 2GCNA 2ZIGA 4EJ0A 4PYRA 4F60A 5CEFA 4BGVA 2HMAA 4DV0B 4BZQA 1EE2A 2LW7A 2WICA 4FZ3A 4H7DA 5E4YA 5EE1A 1IOZA 3GCGA 3KAQA 4MUHA 3VTAA 4XWWA 2G5PA 4J0CA 2CXPA 2Y05A 3GJ6A 4HB0A 1M0WA 2HCFA 3ZE6A 4TVOA 4AO6A 2OAQ1 4DLAA 2Z2YA 2DRIA 2V97A 2QRNA 1PD1A 1VGRA 3AEQB 5EKTA 3HNOA 3PR3A 3N0RA 5F5LA 1B43A 3KEQA 3W04A 4OKIA 1WKVA 1JXQA 1JAIA 2HHCA 2Q45A 1H4VB 5HG0A 5J9FA 2R6AA 4F5ZA 4AI6A 4G4SO 1L7RA 2XT0A 4C08A 1YRHA 3N2KA 1VG9B 2H08A 1PX0A 1FNSA 4JA2A 3U4CA 4IDFA 3O4GA 5DKFA 2I7TA 5IBPA 3AF4A 1HKHA 3BMNA 1BOOA 4AG5A 4BNMA 1PYOA 2H9AA 3DAYA 1XUOA 1XKTA 3EFEA 2YCBA 4M36A 1MABA 3O84A 1ESMA 3G5LA 3THYA 2TS1A 4Z9BA 3ZV3A 3HPQA 4MJ7A 5T6BA 2IPOA 2I0FA 3I9KA 1DKOA 1Z8FA 1UMBA 1MGOA 1OFIA 2VF7A 4KFSA 5LB4A 4WE3A 5A7HA 4PSDA 2B4RO 2KHZA 4KJXA 5EP2A 3N2KB 4OMDA 3V4SA 2QT1A 2BFBA 2XUPA 1BDHA 3HSKA 1DKQA 2X2PA 2CMFA 4DMGA 4W9NA 2QZZA 5HQJA 3GCWA 3O2NA 3BMNB 3QUSA 3IDZA 4FR0A 2V6FA 4X85A 1J2JA 2CXTA 1KZ7B 4HJRA 3X43A 3EFOA 1N6RA 2G40A 2IEBA 2YHBA 3KXKA 1MABB 1N7IA 5KYNA 1RAFA 3THYB 4NBNA 5D6OA 1P4JA 2C83A 4GWKA 1ABBA 1UMBB 3EXHC 1B93A 3A11A 4OYRA 2RGNC 1J97A 2W6ZA 1J24A 3UK2A 3NBXX 3DVRX 2BFBB 3O75A 4LBVA 4C14A 5TT1A 2RD2A 3A2NA 3DKPA 1YXMA 5CVEA 3ZHUA 5HWSA 1NJGA 1FSGA 5CM8B 4I1RA 5EP4A 2V4MA 3EFOB 1N6OA 4ZAZA 2YRXA 2ZBUA 1K66A 4URXR 4O2BA 4FIDA 2WFAA 4PPNA 1DAIA 4J1TA 4CI0B 2W00A 3WNVA 4B4KA 1RYNA 2RE8A 4M53A 2GCIA 1O9HA 5E2IA 1USVA 4ZJPA 2B69A 2PSEA 3EVNA 1JSCA 3MT9A 5DRYA 1H2WA 1L5SA 3QVLA 3MQ2A 3RJZA 3WL8A 4X8MA 1DAKA 2B9EA 3CY6A 2MYNA 4X6YA 5ICCA 2XQJA 3QEMA 4NJOA 4DNXA 7AT1A 1Y1PA 1T9BA 2C5BA 3WJ2A 4WOCA 1UPCA 4DS3A 3CBQA 3AVXA 1AQIA 3BTUA 2LUOA 4C30A 4AJKA 3PIRA 2GEBA 2LCIA 2F4VB 4JBNA 1SUWA 2C5LA 4HNGA 4OQLA 5ALHA 3FYSA 1SK9A 1ETUA 2BKEA 1E2IA 5FLYA 4OK3A 3OFVA 4KTVE 2ZI3A 2C20A 1ICIA 2CDBA 3SSNA 5ELXA 4LF7B 1E1RD 1QHGA 3QEMB 4C4TA 3VH1A 1GRNA 1TMOA 3LBAA 3RSLA 4FS8A 1YRWA 3DE7X 3GVHA 3U0BA 5BSKA 3HKBA 3E9QA 3R3HA 3PXCX 2QMEA 5BNZA 3S1SA 2AN4A 2MR6A 5CPFA 3U7IA 4FQ8A 1NKVA 1OVMA 4REOA 1LJUA 2BR3A 1PSWA 3KJHA 4G0UA 4IWNA 1ZIOA 1K75A 4P7GA 4JLVA 4EMUA 5GTDA 4MQMA 3DZFA 2Y0PA 1WXWA 3NHJA 2ZETA 4H2DA 1G5HA 4EG1A 1CTQA 1BSVA 4CL2A 1ND6A 3HKBB 3IB6A 4P93A 5JAUA 2QQ0A 1BJTA 1X1AA 4GAEA 3ESZA 4EF6A 1V5IA 1MFZA 1QHFA 3VUEA 1CB7A 2FWBA 2WTXA 5TE9A 3SC6A 4E51A 4EQ6A 4TSFA 1F60A 3NDIA 4UEJA 2Y6VA 1LPSA 3B2QA 2FHSA 1LI7A 3BFPA 4ND5A 3UT5A 3HEAA 4RA9A 3Q72A 4BPBA 4OAPA 2DH5A 1HDRA 3V6MA 4QRDA 2HKIA 4RKWA 4FFVA 3GMDA 1GT6A 3I6QA 1J9ZA 1D1PA 2J32A 2ZE6A 3MNFA 4IG9A 4B8YA 4EDFA 4I1PA 2BLNA 3FNIA 3UCFA 1S2NA 1T4MA 5FTJA 3ZGNA 1Y7IA 2I7XA 3AUUA 4ATNA 4JYBA 4EQ6B 3UT5B 2YUIA 4Z4EA 2W43A 4RA9B 2YZNA 3NXSA 2B8NA 3P2YA 1SIBE 1ZI9A 4YDRA 4A0GA 4CTKA 1N33B 4HSGA 2B0JA 2QROA 4R83A 5AKHA 3HBFA 3AEUA 3GMIA 4P3NA 5BWMA 1SRQA 4JI5B 1KEWA 2Y77A 2ZRPA 4ITRC 4HT3B 1ZVVA 5K0GA 4BYGA 4IHKA 4RW0A 4LE1A 2D2FA 4ZYVA 2UVQA 2H2AA 1QK3A 1S1MA 2HA6A 2O48X 1NT4A 2R7NA 4G1FA 4OHOA 3WO1A 1GQQA 1Y9AA 5K3BA 2B4YA 2JC3A 5C80A 1ZBDA 2D54A 4ISBA 3OTIA 4PQEA 4U2EA 4WNIA 5COBA 5EIWA 3W2FA 1I4OA 3F0TA 3AX6A 2XEXA 3FBWA 2IK8A 2C5SA 4O4IA 1NF2A 4MW2A 4QUIA 4KIGA 3AEUB 2Q5LA 4GX1A 2PUFA 3BD8A 5IP5A 1PBNA 4K6CA 2JBAA 4DPMA 5TPZD 4EA7A 1XRRA 3C14C 1Z7BA 4E3ZA 4B3IA 1VHQA 1E79D 2ZRIA 3ZWOA 3U44A 3ZU5A 3ZGXA 5EJ6A 1E5VA 1XN4A 2EZUA 2QSJA 3LRPA 5EJ2A 3X1YA 1USKA 3EPLA 2G7MC 2WE8A 1CB0A 2O8NA 1YDGA 1LKZA 1KMIY 4CCWA 3DOOA 4BEBA 2JIPA 4GXQA 2OYCA 1YA6A 4O4IB 1JI0A 2AUNA 5IDYA 1X3SA 2V96A 2H3HA 1VRCA 1Y82A 3WWCA 4KI7A 1JMYA 3SIPA 1NL3A 2HPVA 3E8XA 2JBAB 1ZLXA 1YFJA 1SVMA 1J0XO 2BIFA 3KX2A 5J1SB 4YP5A 3QE3A 2B4TO 5C8DA 2AZDA 1K6MA 4GR5A 1DKNA 2A5FA 1NP6A 3U44B 5IJWA 4KFTA 3MOSA 3EW7A 2FQWA 2PBRA 3AJEA 1KMQA 2WK1A 1G5TA 1SO8A 3MFYA 3EVAA 4HD8A 5C35A 4W4TA 3OF2A 1AKVA 3TDNA 2JLCA 4KO2S 4W8HA 3LE8A 3ADDA 2DFLA 1RRCA 2ZRFA 3ELYA 4HV4A 2H8GA 2DY1A 3QWHA 3FPJA 3MSCA 2GEKA 4N76A 1SAYA 4LYDA 3W3ZB 2VTBA 1QHIA 1ODCA 1GN8A 4GQAA 5B3AA 3ZKWA 4AZTA 3FTFA 3R9WA 3DV2A 3JWEA 2XNDA 3JVUA 5F73A 3VO8A 4F97A 5JEDA 1DKUA 1VBFA 1AS0A 2JRCA 1V5WA 3NBMA 4XD7D 4UARA 2SBTA 4C03A 3SBDA 4EPYA 2CLLB 4NE7A 5HIMA 3SJAA 2PH7A 4M1YA 4MZXA 1AE1A 5TSDA 2D7JA 3CPHA 3FPSA 5IK2D 4CG1A 4YAGA 1LX7A 4B5KA 1DQPA 1II8A 1WO8A 3H1BA 4QOGA 2GHQA 3AR8A 1LC3A 3LIIA 4PU0A 5DU2A 2VTBB 1YB4A 1ZAKA 2GB4A 2C96A 3ZKWB 2IE0A 4PHTA 3FXAA 4H6PA 3WGQA 3K0KA 3LLVA 2FQXA 5P8WA 1M7BA 4AZSA 4B4UA 2C82A 3BWCA 3F3YA 3BRWA 2GJ4A 2YVQA 4KK3A 1QP8A 4OGLA 4AJIA 1VJCA 3JQAD 1CZNA 4PYKA 2IU6A 5IX8A 4EZEA 5LLDA 4MVXA 4PX2A 1XCPA 1II8B 2ECPA 2FW8A 5E3IA 3SHWA 1C2TA 1E6WA 3VX3A 2GTIA 2QM7A 3THXA 1SU8A 3DF7A 4Z2YA 2QRVB 2EF0A 1R12A 1N57A 4NP6A 4CM9A 4CLEA 4R8MA 4J16C 4K8RB 4JXKA 3WGTA 1JSXA 1TAHA 5EJAA 2TMYA 2HMTA 1X7GA 3QOXA 3B8HA 2H7VA 3P4UA 1NHWA 2Q21A 3QIVA 1H2HA 4MKRA 3W0LB 5GY7A 4O4JF 1SCUA 5GJVC 3A7EA 1Z4PX 3I1JA 4YGYA 5FTKA 4LECA 3DTYA 4MVJI 4YXFA 1Z82A 1GVHA 4IXDA 4PONA 4K9QA 5K6RA 3PENA 1EA5A 4L4YA 4MVJM 2JZNA 1NLZA 2G9UA 4D3DA 1T5TA 4OV6B 4E3WA 3K6SB 4HAOA 3TW0A 3THXB 3R3WA 4CUZA 1R5OA 1NPDA 4JEMA 3KJXA 5C8YA 4A8JC 3C24A 3VKFA 4D9NA 4N82A 1BQEA 1CIJA 2EBWA 4O2AF 5TNXA 1BVHA 16PKA 2EARA 1GPLA 2NWQA 4BO6A 1ZKMA 4QYSA 4EITA 3N5KA 1SXQA 1E2KA 3L0SA 4GVXA 4R2LA 2OMKA 1ZVKA 2AV6A 2VJNA 5AJXA 1TJUA 1SCUB 2HSGA 3TTUA 3U56A 4CT0A 1SHTX 2HWYA 2QUHA 2ZYDA 2QLNA 4DQKA 4Q4HA 3ROPA 3IBTA 1VBMA 4XD2A 2QRJA 4LSZA 3TPCA 3BJRA 1W1IA 3RIMA 4B7CA 5ADUS 4O2RA 2B21A 1QHXA 1FXSA 4UNIA 3UKJA 4ETMA 1LS6A 2IU3A 5CLIA 3STUA 4JKIA 1DVRA 2DZDA 4ZJZA 1YVUA 1Z83A 4F9GA 4KYIB 1XA4A 3RUHA 4DCJA 1RCFA 4TLCA 4C0LA 1MAAA 1OQAA 2GESA 3GJQA 5CT9A 3EPPA 3DZCA 3VO2A 3VXKA 5CB8A 5LQJA 1GU0A 1GZ7A 3ELWA 3OOJA 4P58A 4A0RA 4Q4HB 3U3ZA 1VL0A 5IAOA 3OZAA 3FNHA 1W85A 3K0BA 4WL0A 3WTCA 3ZWPA 1GARA 4MQUA 3R6VA 3AONB 1F8FA 3ABRB 3O4VA 4HBGA 5FDFA 4JI8B 4MP3A 2ZS9A 5K45A 2IL1A 4BQEA 3LKBA 2HC9A 3E48A 5ESDA 4HDNA 3RRJA 3SDBA 2IWRA 2HDNB 7ADHA 2B3TA 1RXVA 2C7PA 2CNDA 2QLMA 4NOJA 5IZCC 4O3MA 3ZZ0A 4KPUA 1U7HA 2PZEA 3OLZA 1U9IC 3GV0A 4GPIB 1Y9ZA 4OJNA 3QVXA 2EJCA 3LTNC 4X3OA 4JUFA 2E21A 2OCXA 3QJ5A 2H2WA 2HMSA 2QTNA 3B20A 1W85B 4FYXA 1SULA 4EHKA 1RI4A 4CWAA 3QXHA 2H59A 5KOJA 2XXJA 1E64A 1KKMA 2LIPA 2CVHA 4H0CA 4UM5A 1XDWA 1MB3A 3GXBA 3S5UA 4HDNB 4WIAA 3AOGA 4YAFA 3WI7A 1DAHA 4KPUB 1IOVA 1UAYA 3T06B 2HEGA 4R9VA 2X3FA 4RD6A 4W63A 2BBWA 2O07A 4IVPA 4YT2A 4YDHB 2PL1A 4IIUA 2Z56A 1TW2A 4UFPA 3AHEA 4OXNA 1L5WA 1K86A 5KOJB 1F4PA 2PRZA 3DKKA 3PNKA 3X1JA 2LIVA 5CA0A 5EN4A 1XZJA 3CZPA 4G5XA 2VP0A 5F98A 1BX0A 4JOBA 1XT6A 2GN6A 1DP4A 2IOYA 3QBTA 4FGJA 5LDHA 2CKMA 4C04A 4DGQA 3OI7A 5LJIA 2IW1A 2O2GA 1XVAA 3FRJA 1HM5A 1R50A 4DC0A 3ZD9A 4IDCA 2ZSIA 3AWIA 4BNHA 4EG6A 1AMNA 4J0FA 3ZWAA 1JECA 4XIJA 3C6QA 3B60A 1JX6A 3OEHD 3OX1A 4IMJB 4XH9B 5CA0B 3TKYA 1U9ZA 3EEFA 2CK3D 2DG2A 1O77A 2PWYA 4DILA 2D6FA 4IDEA 4XJXA 4BO1A 1N2OA 1ONBA 2V0NA 1C8BA 2RGXA 2RKOA 3BD6A 3NFYA 3Q8XB 4Z4QA 3C1AA 3OCEA 1NVDA 1GG9A 1JJVA 4EKNB 1JFFA 1X7XA 5BV7A 1NLFA 2Z1NA 2ZOSA 4RVDA 5FBHA 4BTVA 4LFBB 3GR6A 1CG6A 1Y6ZA 1QZ3A 4F3NA 1WUTA 4HQOA 3ZD7A 1OASA 1YCDA 5ITVA 1HRDA 1PV1A 4IDAA 1LY1A 2W6JD 4N49A 5IAJA 2B25A 2QYSA 4OHWA 1DINA 1Z5OA 4LCJA 1CUEA 2DX7A 3ZXUB 3K4HA 1HE1C 1GPDG 5AOAA 4M1WA 3A9UA 3M6UA 3MAGA 5DT9A 5C9ZA 4PGGA 1ISHA 3O21A 1AS2A 1I94B 3CRNA 4J3NA 2XTAA 1JFFB 1X7XB 2IZ1A 1QH8A 1Q7RA 3GD5A 4MAMA 1U0HC 2Q0QA 4NICA 4S1TA 4C0SA 3E7XA 2JVKA 2R65A 4OSPA 3TSYA 4MUKA 3F4KA 4IJKA 4Q3KA 2OPBA 1DQZA 2WV7A 2ZB2A 1GO2A 2OV4A 3FYDA 3RGWS 2DWOA 4RHYA 4TVKA 3BCRA 4I08A 3T3IA 3WXMA 4AT1A 3F9IA 2BFOA 3LT1A 4MAAA 3OEEA 4Q3OA 1G60A 1CUBA 4NTZA 2BYTA 4UUBA 3P9PA 1U99A 3CI0K 4XWTA 3PQ5A 1DAGA 3EDCA 3U9SA 5CEJA 3AI3A 4R2WA 3DFKA 4ZIRA 2Q41A 2DFPA 2ZJ0A 1QH8B 3UF0A 3V1MA 4MWEA 3J80A 1Q0TA 2AZXA 5LMCA 3T5BA 2HLDD 1R4MA 4B3DA 3FPKA 1TEXA 1OWOA 4D44A 3CB2A 3NO4A 1KYZA 3AEKA 1BS2A 3ZX5A 2VRBA 4CMEC 2WD9A 4CN9A 3R41A 2X14A 1P7PA 1TQ4A 3X2SA 3NTQA 3RG8A 3IIKA 2KJQA 3KR1A 4OJMX 1Y81A 4Z2AA 5B2FA 5I51A 3GLIE 4XB1A 1T9HA 3GEBA 2QSZA 3IKJA 4FX5A 4QG3A 2YY5A 3VPFA 3IIJA 4WZAA 4ZIRB 4AP9A 2CJFA 4JUDX 2PXCA 1N77A 5M3BA 1RMTA 3DZGA 1ZJ6A 3T1TA 2ZIVB 4Q9IA 3NWPA 4WVLA 1WZ2A 1R4MB 4JL8A 4PLFA 3UJ7A 4CT4B 1B2RA 2EFCB 2P4UA 3AEKB 5HE8A 1MFPA 5LZ8A 1OX5A 5JAPA 2R9VA 2DOKA 4QU8A 3E18A 3LSTA 3PUXA 2QTRA 3ESDA 1SHKA 4NU6A 1E7MA 2R751 3D0QA 1CUWA 1QONA 1X1EA 2FSUA 2VS1A 5BUCA 5K8TA 3RUEA 4XPIA 3COSA 4QM7A 4IFBA 1OUMA 4IMIB 4H7JA 1TEHA 1BZYA 4BX9A 3CCBA 4WZAB 4DDVA 1F0NA 1Q6ZA 5E9WA 2NXEA 4Z4HA 1ESCA 1U3UA 2VBFA 1OBVA 3WR5A 1UFOA 2P3LA 4Y3UA 5AJWA 1BW9A 4IJQA 2UYOA 4AN0A 2PT7A 3O8RA 3ANSA 3TR6A 3V1LA 3OPYA 1AC5A 4YVFA 1U3FA 2COUA 2X4DA 3OCFA 2HIMA 3LUDA 3OFSA 4HDAA 3V4FA 4JODA 3VR0A 3VYTB 4DV1B 4JI2B 1MC4A 4NHEA 4XPIB 2XB4A 2BEUA 3WWEA 3LVRE 4QDUA 4D9EA 4Q3AA 1T3HA 1KH3A 3DZKA 3EZ9A 4FKZA 2DXIA 4RL4A 5EJGA 5AW4A 4HNAA 3PTAA 2P69A 3SKVA 2ID9A 3GZNA 1A4UA 3FCEA 1BW9B 4GHWA 1X14A 4I4LA 4GE3A 1GLVA 3A4TA 3C3WA 1ZSNA 1MAVA 1JHUA 3DR5A 5DHSA 4PIVA 1M2JA 1EWQA 1K4KA 3OPYB 4EB6A 5HQTA 1LPAB 1D0IA 1GVNB 1TCUA 1OROA 3K7EA 1LDEA 4I66A 4F1WA 5D3KA 2BV3A 2BEUB 3NAZA 3D8BA 3ZCPA 1W1WA 4TS1A 3T3EA 2B4QA 1BMDA 4YJ3A 2R8EA 4JLDA 4QUGA 5EIXA 4XM0A 4YRQA 4HNAB 1R18A 1KBQA 4IX1A 1KSJA 1HK7A 4N8EA 1NIPA 3SAJA 2IV3A 4O1MA 1JBKA 4E7OA 1YRQA 5CXQA 4JU9A 4J9UE 1JKIA 3CUUA 3MB5A 4Q7KA 4BE4A 4DHWA 1SMKA 1V9LA 1WV0A 4N5IX 4EB6B 2ZM6B 2ZUFA 2VRCA 4JUBA 4XQ0A 1YRAA 1VKHA 3NIWA 5DCUA 3I01A 4L8VA 1ZDMA 3KDSE 1BTOA 4YJ3B 5EI5A 1K97A 2IPMA 4CG3A 4DDMA 1C0LA 3U1VA 1JHVA 2PX6A 3AXTA 3P9ZA 3UK6A 1BGWA 1BN6A 2BRUC 3QKIA 1ECCA 3EHDA 3OUTA 4V24A 4DIOA 1KI9A 2FSPA 1ODLA 1Z35A 1KR5A 2ZRAA 1PWXA 1QF9A 1Z5NA 3T1YB 1AZTA 2VQDA 4NNJA 5K4HA 1E1KA 5EXEA 3LX6A 3PQ3A 1RRGA 4N4AA 5GWXA 1LK0A 1PZEA 1XE3A 2X8AA 1B16A 2YYAA 5ADHA 2VCHA 5JNSA 3LCVB 4ZYUA 3GAMA 1KE1A 1E7WA 3LCCA 1T0PA 2ASEA 2Q99A 3SR4A 1OX4A 2X0NA 4PC1A 5FULA 1CP3A 5KNCA 3PXGA 1PLJA 4UEKA 3LPMA 2Y9MB 3E53A 4C3OB 1JT2A 1PRYA 3SQNA 2X9LA 1OY1A 4QPDA 1APBA 1PNTA 3OJWA 1IW7D 3KJFA 4XGKA 2R7LA 4FD2A 2I3GA 2J9YB 2WUVA 3I1IA 4WXEA 3KZ1E 4CMGA 4IL5A 3QE4A 1DJPA 3L1HA 4HATA 4BEWA 4OD0A 5JBIA 2R3SA 1L4KA 2V74B 4HN2A 1XXHA 3DLCA 3GF4A 3IURA 3W3AA 5EY5B 4BVBA 3AZPA 3FZEA 4TX1A 4U3JA 3BIJA 1OX4B 4M8NE 9GPBA 5EJ7A 5TEVA 2XCUA 1KE2A 4A6EA 1X0XA 1JBQA 2VF2A 3HADA 4GD3Q 1LK5A 4BY9E 1MOSA 1OZ0A 2IPXA 4FGSA 2I6FA 5KX5A 5ES3A 1WBBA 4OQFA 4MHOA 2BE7A 2XTNA 3SF8A 2X22A 1U02A 4QFBA 1E96A 4WGFA 2GF9A 4LZJA 4FZ5A 4OPMA 2YASA 1XXHB 3OTWA 4O0MA 1EUDA 3AF2A 4U3JB 3W7AA 5C5EA 2PJRA 1RE5A 1Z4QA 1BS1A 2Y9PB 4GOMD 5AXBA 5K3FA 4RMJA 3E4DA 4JCCA 4OA8A 2OXTA 2ZSDA 4CF5A 3JQPA 1C81A 3A1UA 2H2DA 4D9JA 2A59A 3BJEA 2AEMA 3SF8B 4TYQA 3VDQA 4DCPA 3BHNA 3SJBA 4CTMA 2JFQA 3H4MA 1ILWA 3DE4X 2PX0A 1EUDB 1CJCA 4UFOA 4UZFA 1NNLA 2R96A 1RXYA 1TMKA 1VCNA 2VO1A 5K3FB 2JB9A 2R2GA 1NU8A 5KYTA 4K0KB 4Z51A 1CT9A 5FWDA 3RFFA 5CUQA 4Z0PA 3FNEA 2OXRA 5B7NA 1N9GA 2Z3WA 5IPFA 5M29A 3HVHA 4IYJA 2VDJA 1J7KA 4G5FA 4F86A 3TLAA 5K6TA 5FOWA 1JIUA 4HYEA 1LPNA 1TUEA 3P7MA 4MVJG 4A2CA 4D3XA 3Q5EA 2BGJA 4EG3A 3O6VA 2QU8A 3EBOA 4KKVA 2DH6A 3AHHA 4IF4A 4LNAA 1B6GA 4PRLA 4FOSA 3AKEA 2XODA 4O2LA 5IJXA 3T5DA 4XWOA 3VM6A 3E5NA 1VYUA 4I1VA 1B1AA 6YASA 1RABA 1L8QA 1A77A 1GSIA 1O5TA 4YRIA 1Z6PA 1N9GB 2QR3A 3N6RA 5EE0A 5GONA 1VP9A 1P4RA 4LI3X 1HOTA 2R5WA 3AB8A 2UZAA 3W8DA 4YRSA 2EX1A 3F1KA 4I5IA 4YHBA 4PIMA 1RWBA 4KMSA 4A5OA 2OY0A 3F5SA 4Q4JA 3G6WA 1GTZA 1OCEA 2BGMA 3EZLA 1RHQA 2G08A 2WZBA 3F49S 3BCHA 2YS7A 2W22A 3KUDA 3NCHA 1E3WA 3E1KA 4UC0A 3ZDYB 2BGNA 2Q5JA 4C4YA 3T9EA 5A7GA 1F3LA 1AH2A 1ZXXA 4KL8S 1II0A 4RNDB 5GONB 3TK1A 1NAHA 4KWEA 4N0DA 3TLYA 2BEJA 1QMGA 2FFBA 1PYDA 1N3YA 1CUGA 3F6EX 5L8VA 3EUFA 3R3YA 3CLTC 3RC1A 1RLJA 2EFHB 2Y76A 4L3OA 1I7DA 2VJMA 3ZW7A 1NFQA 2YHUA 1PJ4A 2JIMA 1PUJA 1U1FA 2JGAA 4Q4JB 3DTTA 3VJLA 5KVCA 4RTJA 3HCOA 4O63O 2V7BA 4POAA 4XDHA 1E3WB 2ZJ5A 4PO8A 4R2XA 3IVMA 4PCLA 3I23A 2V7XA 4UW9A 3ZHVA 2NVWA 1NVVQ 3RHSA 2R87A 1GAXA 4G5YA 2OLJA 3ENKA 1XN1A 1XNRB 3QSGA 1H9AA 4NF2A 2JLUA 4CM3A 4BFUA 2NW6A 2Q0SA 4WTOA 4IQ8A 5CDFE 2VJMB 1V0JA 2LE0A 2XOEA 3AQIA 3MBOA 3EGDB 2A1TS 2PFKA 2WYUA 1P5RA 1UEIA 3KPUA 4D4HA 3JXEA 1QE3A 4OLHA 4KLRA 1AB6A 1DKPA 3GLHA 1BHSA 1K5DA 2G5CA 4L5AA 2WTUA 2A9FA 3LMKA 3I5XA 2D4AA 2KLHA 2YZMA 3E5RA 1NF8A 4MS1A 4RULA 3W5JA 2G70A 1W4ZA 3IVCA 3JSAA 3VV3A 2FZCA 1G5IA 3EBLA 1ZZGA 1YQWA 1RM0A 2AXNA 3ILYA 4TV9F 1DS6A 1JA0A 4X94A 5MGBA 5HP4A 3OOSA 4LQ4A 2CWDA 1QGED 3IPRA 5FWXA 4PLGA 1Z3IX 2IXGA 4EGSA 2O4CA 2P9GA 1FVOA 4OQMA 3CVVA 3IPCA 4RHXA 2H4HA 3GLHB 4J0DA 1N2ZA 2NYVA 3ZK7A 2XSZA 2KW5A 1IB0A 2QF7A 3HBAA 1B8VA 4EI9A 1KIMA 4YUXA 4MS1B 3RASA 3TSOA 1GG5A 5F7XA 4I6GA 4F3YA 4LZPA 4UTVA 1C5KA 3ZVMA 4FMCB 4J7UA 4G41A 2IYSA 3O1IC 4ZT3A 4YDQA 3DLHA 4MXDA 1GCAA 4WJZA 1T1IA 1S9DA 4UTZA 1NY6A 3UMCA 2VQSA 5FWXB 3HDGA 3ZH9B 3FI9A 2H4JA 2P79A 1OC2A 2NVBA 5AUQA 3GJ4A 2JIRA 4U6SA 1LF5A 2F6RA 3ZY3A 1I1HA 2BMFA 1Y3BE 4B81A 3A1VA 3KDPA 5JFTA 2I54A 2A78A 2RK4A 5I9LA 2W6IA 2WD8A 3T9CA 3QV2A 5EIFA 3U1BA 1GR0A 3U3DA 3PHHA 1OA1A 2HA4A 3D3WA 1TJNA 1XQWA 4AN4A 3BD7A 3ONVA 3QW2A 2JJ8A 4GZ5A 4LDJA 1ZR4A 5CB0A 5IKPA 4R0MA 2Q8QA 2CMKA 3EH2A 1QVRA 2B1RA 3ADKA 1W9MA 2WM8A 3WGYA 3WQSB 3LO5A 4JOCA 2MWMA 2RHTA 3L1VA 4R8RA 4B0OA 4M0LA 2E4WA 2C4KA 1G1MA 2WD7A 4FGZA 4BO7A 2BCJQ 1LDMA 2UZ1A 4H6WA 4CV0A 1FK8A 3HXQA 3AL0C 1NMQA 2JFNA 2XRFA 2R1UA 3MB8A 4K9SA 3K5PA 5G3ZA 3E1GA 5JSFA 4PRYA 1HYHA 1RHUA 4JLWA 5HF5A 1VPVA 3CUSA 1CUDA 3LBYA 4XXHA 5DIZA 4DL9A 2R8BA 2P9QA 5K0BA 3HVJA 4B5LA 4YCMA 2MOKA 1BS9A 4ARCA 3D3WB 2ZBRA 3M7IA 1B23P 4B79A 3QQPA 4C6RA 2J1LA 4RY9A 5H4HA 5JCOC 3EF0A 3QNWA 2WT4A 4L8WB 4OVKA 4DAEA 1EDBA 3OY7A 3N76A 3IEMA 2ZYGA 3KQQA 2WD7B 4GUDA 1EJ0A 2UZ1B 3KQNA 3FDIA 2ZJ6A 1XTBA 1VRVA 3PFNA 1EXWA 3TPZA 3RM3A 2XBUA 5A03A 2XTZA 721PA 2Z4TA 1HGXA 2PT6A 3BCSA 1ZRNA 1VG8A 1AV7A 1G8JA 2O3JA 3FNGA 1YNOA 2VLBA 1G18A 4MPDA 4V38A 4KPGA 4R41A 1I0AA 4FJ2A 1KL7A 3ENNA 3PSHA 3RGGA 2FPMA 3B70A 5T3YA 4ADLA 4C5CA 1JAYA 4DCVA 621PA 4CQMB 1ULTA 2Y66A 5JD6A 1PQPA 2UUOA 2VPZA 1GGMA 2AEEA 4OI4A 4ZT2A 1DPFA 3F4LA 2C2HA 1RZVA 1L5LA 7MDHA 1RWXA 1R6XA 1ZCJA 2CD9A 1RXWA 3GRZA 1Q77A 4ZQEA 5TXGA 1JG4A 3GO4A 4CF4A 3JALA 2XAUA 2HADA 1C4WA 4G25A 3WGZA 2KBFA 1BN7A 5AVRA 5B5SA 4I0WB 2VDPB 3W1WA 2AOXA 4L22A 1YAHA 3OHMA 3OZIA 3KDAA 3G8YA 3HYCA 2GM9A 2GKOA 4D9CA 3EXFB 1NNI1 4C2BA 5FA8A 1OOEA 1TTTA 2GZHA 2HSDA 1JPJA 3CURA 4E5VA 4GLOA 4UHHA 2I67A 5DTRA 2YWXA 3QMVA 3JALB 1FFDA 1FZQA 3P94A 1CUXA 1T2UA 3HJGA 3QKTA 4NCNA 1V5FA 4EI8A 4F56A 5M04A 2HL6A 3RRYA 3T3OA 1K89A 4EF5A 2CNWA 3TQFA 1I3MA 3RVLA 3F73A 3PD0A 4M88A 3GBVA 1IWPB 1R4AA 1K7YA 1XWIA 3ICQB 2F67A 1V6CA 4BS9A 2VSQA 4YUWA 3WNBA 1LPMA 4EELA 4AY6A 4DXHA 3ZBUA 3L7NA 3ZNQA 3EPJA 3BN3A 3L8MA 3GIWA 2EZ9A 4PTLA 1CUYA 3N7UA 3THRA 4QOEA 4F8JA 2YXDA 3BFXA 2A5LA 5K0NA 4Z4CA 2DETA 4Z4IA 2JA1A 1RYDA 4PXAA 4RGYA 4HI0E 3H1AA 1JZTA 5U1PA 3VOTA 1A8IA 4I4TF 2XF8A 4TMVA 2Q2OA 1DO0A 2DF8A 4ENPA 3FGOA 5HFAA 2JAPA 3D6JA 4KHZA 3TH5A 1YE5A 4RZQA 5IBRA 2IXTA 4FFBA 4XASA 1COWD 1QMPA 5A5EA 4FCCA 1XMVA 4RVSA 2VDLB 4Q39A 4HLQB 2IBMA 3DZJA 3N3AC 1JHMA 4Q1CA 4KCGA 4KE6A 3GFFA 3EZYA 3KEGA 5K4AA 4I4TA 1NX6A 3UPUA 2D00A 1Q7EA 1TZ2A 2O5VA 4YI3A 3U7QA 5FOTA 4BNLA 2YMPA 3I6MA 4PLTA 3WHIA 4EG7A 2WM2A 1XPRA 2JIOA 2OZLA 1LV8A 4RJKA 3JR3A 3OJEA 4IDGA 4PXYA 5JRJA 3JRXA 4RDXA 2IP1A 2V7UA 3GHHA 3OZFA 3UO8B 3H65A 4CU5A 4FI3C 3C3KA 2EXXA 3BIOA 1I80A 3CVUA 4FFBB 1RPAA 5BNIA 3DHEA 1DU4A 3I1YA 1GXSA 3I3OA 3WO0A 4BJ1A 1TVCA 2PGOA 5L40A 3DA8A 2QM8A 4I4TB 2D7CA 2IX9A 3U7QB 1YB2A 2HMVA 5JS7A 1CUCA 5G4KA 3FZYA 1K6EA 4ZHQA 2OZLB 2HTFA 2AJTA 2QN3A 3L1UA 3TW4A 1U28A 3DLTA 1Y4DE 1BXKA 3MWJA 3C3XA 2CFOA 1GDHA 2G1AA 4K5QA 1QZXA 2CEAA 2W5UA 3NS7A 4P5EA 5FUVA 2ABWA 3TTSA 4L0CA 2Z2JA 4LS3A 4C4ZA 3TD6A 4HC4A 3PZRA 4G4IA 3PNSA 2R97A 4MVWA 2H4WA 1W44A 4Q5IA 4WINA 2PKCA 3QOYA 5CH3A 3VJKA 1UKYA 5SY4A 4FDAA 3OKFA 5B58C 5B6JA 2RI6A 4AKGA 1U8EA 3LNTA 4CMAA 2ISCA 3AFHA 2WSYB 3DJYA 1JA9A 2GMWA 2JCXA 4AZ3A 4QXMA 3I6IA 4BMDA 3C3PA 1HMYA 3ZCSA 5CVVA 1P5ZB 3FYUC 5AESA 1ISIA 4M9QA 4MDHA 2PIAA 3CJQA 4JVMA 2D3TA 1PO7A 4NBRA 4NBSA 4E09A 1R00A 3NM6B 1BAPA 3B3AA 1TTHA 2CJPA 5MFZA 1KY4A 1EG7A 1TA9A 2PJZA 2VP6A 2DPLA 3FSRA 4GX5A 3MFQA 3V1TC 5AM2A 2QPOA 4KIFA 2HRCA 5G2OA 4F6LA 5FWNA 4JT8A 2HI0A 3W2HA 2VKTA 1B7GO 1MX9A 3M82A 4RMNA 2DM6A 4AZ3B 5BUZA 4BN4A 1M0TA 1KZHA 2Q8NA 3A70A 2AG5A 2JI8A 1SY7A 4I99A 2QR5A 2FX3A 3UK0A 4A92A 2DR2A 1VIYA 1CY0A 4UTOA 1IHXA 4IUDS 3EUWA 3OPQA 4HJXA 4HXFB 1W36D 3EUAA 4RK5A 1Y42X 1DOFA 3MGGA 2ZT8A 1H9CA 3EVDA 4KODA 3FAZA 4NV3A 5J1TB 3RWOA 2QRPA 2EX4A 3RYFA 4CIVA 4RKQA 2WM9B 1UIMA 2X8BA 2YWRA 5HA5A 1KEUA 1BHO1 3OFND 1R0SA 5CK5A 4M7RA 1NHGA 5H9VA 2VWHA 3ETLA 1QRSA 5LYJF 3HEBA 2BSQA 2N46A 1VOTA 3S70A 1WDTA 3JD1A 3LBFA 2WF5A 3NJRA 1QP4A 3C5EA 1G8HA 5AO9A 4LZAA 1ABEA 5FJIA 3M89A 1LPOA 2ZJBA 4GMKA 3P4XA 4Q9KA 4BNUA 4CIWA 1X7HA 3KKPA 3WIUA 2O52A 3ASUA 3SSAA 3IO3A 3VR3A 1C3VA 1HT3A 4P9NA 5FFMA 3RYFB 5LYJA 5EP3A 3P1JA 4ND3A 1U31A 1UP6A 4KQ6A 4Q93A 2DT8A 2P6OA 3OBIA 3I9OA 3GX1A 1UEXC 3KAPA 4LXXA 2GI4A 4M8KA 4UE2A 5BYKA 4RVGA 4RY2A 1ZC3A 5KREA 4ZU1X 2JG3A 2FB9A 4E1BA 1FW6A 4BWVA 1TTQB 4D45A 2HMYB 1EVZA 4JT2A 3GDOA 4R1UA 4LBZA 2V8BA 3DE3X 4MV1A 4OUDA 2ZTHA 3AKZA 1BOFA 3L1KA 4W5JA 1H1TA 2NZ8A