2JAUA

Crystal structure of d41n variant of human mitochondrial 5'(3')- deoxyribonucleotidase (mdn) in complex with 3'-azidothymidine 5'- monophosphate
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
194
structure length
194
Chain Sequence
RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Human and Murine Deoxyribonucleotidases: Insights Into Recognition of Substrates and Nucleotide Analogues.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords 5'(3')-DEOXYRIBONUCLEOTIDASE
total genus 65
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 2jauA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2jauA01
3MPOA 2R8EA 2B0CA 4Y2YA 3UMGA 3S6JA 3SKYA 2HOQA 2WFAA 2YFYA 4BX0A 1T5SA 4HGQA 2GHQA 3B9RA 3ESRA 4HYTA 5AI0A 2YMLA 1N9KA 4EZEA 2GHTA 4UU1A 5AKYA 3UMBA 3FPBA 4OD0A 5AHXA 3U13A 1WVIA 2C8LA 5AM1A 2GFHA 3KDPA 4RETA 2G1AA 2MSNA 4FE3A 3OCZA 5AIAA 4UAVA 3L8HA 5ALKA 3WGUA 3U19A 5AKXA 5AKZA 5ALHA 2R8ZA 4Y2VA 5AKJA 4MUMA 2OBBA 2Q4TA 5FP0A 1SU4A 4I9GA 4KN8A 3WKEA 1RQLA 2JGAA 5ALIA 1O08A 1WPGA 4JB3A 4UMFA 3SD7A 2BDEA 2AH5A 2G07A 3KZXA 1Q92A 4EEKA 3QU2A 2RBKA 4PNHA 4HGOA 3BA6A 5ALFA 3ZU6A 1TE2A 3UMCA 3WKBA 4Y2XA 1QH9A 1TJ4A 1F5SA 1ZJJA 1ZD5A 3WGVA 5A3QA 4Y2RA 5IT0A 4IFTA 5ALXA 2P27A 5AK3A 4DCCA 2GO7A 5AW9A 4C4RA 5AW0A 2FPXA 5ALWA 2HX1A 5ALEA 5AM3A 1Z4JA 3ZTWA 3ONNA 3E81A 1RLTA 2EARA 3ZTYA 1QQ7A 1YDFA 3OCWA 1U2SA 4OCZA 5AICA 1AQ6A 4YGYA 3SMVA 1Z4PX 4IG4A 1VJRA 3U7EB 1T9ZA 4GXTA 3WK5A 2Q5EA 2OYCA 3UM9A 5JJBA 2Q4RA 3L7YA 2FUCA 4Y2JA 3U7GA 3ED5A 4MWOA 5AKLA 5AW2A 4XQ0A 4Y3UA 5ALSA 5ALRA 3W5CA 1RPZA 3QU4A 1RKQA 1JUDA 1L7NA 2NO5A 3R9KA 2R8XA 4BEVA 2C9MA 3QYPA 2G80A 2HEGA 2FUEA 1Q91A 3WK4A 3WK7A 4J03A 2O9JA 3A1EA 2WF6A 2YY6A 3QNMA 4J2TA 2P11A 2WF5A 5ALLA 5AESA 2I34A 3ZW7A 4FYPA 1N8NA 3WKDA 3CZ4A 4UARA 2YMPA 1RRCA 5AVTA 3BWVA 3L0YA 3FVVA 2MU1A 2W43A 5AKIA 2ZBFA 4CE6A 4YCNA 1L7PA 5AVUA 2CFTA 2BY4A 2DQSA 3KD3A 3F9RA 2HF2A 4Y2PA 3KOOA 4KNVA 4UM7A 2D2VA 3AR8A 3K1ZA 4F72A 3WKCA 5AKEA 3OCYA 2OA0A 1QQ6A 4XE5A 4L57A 2I7DA 1RC8A 1TJ3A 5ALOA 2RARA 2IA5A 2JAOA 2ZG6A 2P9JA 5E0OA 3WK9A 2AUTA 2WM8A 4UMDA 4BKMA 5AVWA 2YJ5A 3AR6A 2PKEA 3QUQA 1RDFA 3QXGA 3ZWKA 3DDHA 3R09A 2FDRA 2IYEA 4UMVA 1CQZA 2CFSA 3U26A 3CNHA 1ZD4A 5AVXA 2BDUA 2AGVA 1O03A 4NAVA 3A3YA 4BEWA 3FM9A 4DW8A 4HAIA 1EK2A 4GIBA 2ODAA 3VAYA 4UAUA 2YN4A 3L1VA 4XPZA 5ALDA 5AK5A 2HI0A 3L8FA 2I55A 3OPXA 2X4DA 4G9BA 4F71A 3L1UA 3QUTA 3I28A 1Z4LA 1ZD3A 3ZUPA 1PW5A 2B82A 3I1YA 1J97A 3M9LA 5AW3A 4BX3A 1Y8AA 1Z88A 3E8MA 3IJ5A 3QU9A 5AM2A 5AVYA 1X42A 5AI9A 3AR7A 3N5KA 3NUQA 3IB6A 4UATA 3WK8A 4AS3A 1EK1A 1NRWA 3PCTA 3W5BA 4EX6A 5ALGA 2PQ0A 3DV9A 1QYIA 2G0AA 5ALUA 5AI4A 2C88A 2QYHA 1ZRMA 1S8OA 4RESA 2RB5A 3HLTA 2R8YA 4UU0A 3NRJA 5A3RA 2HHLA 3SF0A 5ALYA 1NNLA 1RMTA 1YJ5A 2IOFK 4CNQA 5ALVA 4C4SA 4HGRA 2NO4A 1XP5A 5AVRA 2YJ3A 5AI6A 2FI1A 1U7OA 1RQNA 3L5KA 5AKGA 2I54A 3WKAA 3ZX5A 1Z5UA 3ESQA 4EX7A 1Z4MA 1L6RA 1YNSA 3DNPA 4UMEA 1Z4OA 2G06A 5ALQA 3FZQA 1RMYA 2P69A 5AK6A 1CR6A 2WHEA 3TLMA 1IWOA 5IS2A 1QQ5A 2IOHA 3DAOA 3D6JA 2B1QA 1Z4IA 4DWOA 5AM4A 3MMZA 4ZEXA 4OFZA 3NANA 2HO4A 3QUCA 2B30A 2JAWA 5ALMA 2CN1A 3R4CA 2IOFA 3QGMA 4Y2QA 5ALJA 4FFDA 2W11A 2YMQA 3QX7A 4O8CA 3FPSA 3A1CA 3GYGA 5AI8A 3WK6A 5IT4A 2YMMA 2W4MA 2WF7A 3NASA 1XPJA 3NALA 1RKVA 3EF1A 4BYGA 3NIWA 3AR4A 1ZS9A 1YV9A 1ZRNA 3N28A 3E84A 5AVQA 3AR2A 1VJ5A 1YMQA 3B8EA 2C8KA 4YIHA 5ALNA 3OCUA 4EELA 5AIBA 3N1UA 4AS2A 4NABA 3AR9A 4HGNA 4KYTA 4BBJA 5AK4A 3PDWA 3I76A 3B9BA 3SHQA 4KX5A 2HDOA 2ZXEA 2QLTA 3P96A 5ALZA 2RAVA 3L0CA 1SWVA 3HYCA 3MN1A 2FPWA 2FPUA 1J8DA 4Y2TA 2WF8A 5ALTA 4UM5A 1L7MA 3N8GA 3W5AA 2ZBGA 2JARA 1L8OA 2HF7A 3I6BA 1ZOLA 3AR3A 3ZWDA 1RLOA 4YH1A 3KBBA 3ZX4A 3KC2A 2EAUA 2GMWA 3RFUA 1SWWA 1L7OA 1U02A 1VFPA 3EWIA 4Y2SA 1Z4QA 3QU5A 1XVIA 4OHFA 1U7PA 5AVVA 1NF2A 2O2XA 4QQFA 4YIKA 1RKUA 5AVSA 3J7TA 4E88A 5AW5A 3A1DA 5AW4A 3PGLA 5ALPA 2EATA 4G63A 4H1WA 5A3SA 1YS9A 2ZBEA 3MC1A 4HGPA 3ZVLA 4BNDA 1Z4KA 3N07A 3M1YA 2NYVA 4UW9A 3NAMA 3IRUA 2PR7A 2FPSA 2HCFA 4DFDA 2B8EA 4CF4A 4YCMA 4KNWA 2WF9A 4L6AA 4Y2UA 3PGVA 2ZOSA 1U2TA 4ZEVA 4L6CA 2CFRA 2YBDA 1MH9A 3OCVA 2ZBDA 1Z4NA 5AW6A 3ZI4A 5AW8A 1Z5GA 2YJ6A 2FEAA 4YCLA 1LVHA 2I6XA 2C4NA 2FPRA 4UASA 4NWIA 1FEZA 2YJ4A 1S2OA 5AW7A 3ET5A 2B1RA 3QUBA 1RLMA 1LTQA 3L8EA 2B8JA 5AW1A 3L8GA 3ZVNA 3U7HB 3OCXA 4JDPA 2JAUA 3EPRA 2G08A 4AP9A 1KYTA 5AM5A 2OM6A 4I9FA 3ET4A 1TJ5A 4B6JA 3U7FB 4ZEWA 5AKHA 3SLRA 1TA0A 2VKQA 3ZVMA 5AI5A 3QLEA 4BX2A 3E58A 2G09A 4NV0A 3SKXA 4QJBA 3L0BA 5AVZA 3RF6A 5AM0A 4BNDB 1L8LA 4NFLA 1ZD2P 1RMQA 2HSZA 2I33A 3OTQA 4EENA 1K1EA 4XOUA 4C4TA 5T41A 3W5DA 4CF3A 5AKKA 3FGOA 1WR8A 1T5TA 2AMYA 4KX3A 4CF5A 1WZCA 3AR5A 3QU7A 3EF0A
chains in the Genus database with same CATH superfamily
4FIDA 3L82B 1UWCA 1Z38A 4G4SP 1RBZA 5DEIA 2PGJA 4UHFA 4IRXA 3E9EA 3L02A 4HMPA 3W8EA 5C1DA 2XE6A 5T8KC 3R7WB 4DPKA 3EARA 3P9XA 3DLPX 3VHRA 4CKBA 1NQOA 5K8UA 2YRWA 4KPGA 4NFYA 4KZPA 3ESCA 2GHQA 1ORTA 4RF5A 4Z1MD 2A1UA 3A4YA 4PZYA 1C1YA 4TTTS 4AZ3A 4BVHA 4YB8A 1JJVA 3JQAA 5IKXA 3SC2B 1YKGA 2OCBA 3EZ9A 2GHTA 3EYAA 4HH4A 3QNUA 4MB6A 3WAKA 5F3WB 2PWBA 4KVGA 5JYCA 3T9BA 2XOEA 3LTNC 3MEQA 1ZSYA 1VKZA 3ZD9A 1EVEA 2OQ2A 1VBNA 1GPNA 3IVRA 4TT8A 5T4HA 2GFHA 4I50B 3S8MA 2WLSA 4E1VA 4RETA 4NV1A 4B84A 4ER3A 3P0JA 3KQNA 1Q1EA 2C0PA 2RK6A 4AYWA 4XEUA 1T5BA 3CEAA 3NBUA 5AIAA 5BRJA 2FX2A 1FFSA 1W47A 2Y67A 4CV2A 4LBVA 5AWFC 3MHPA 4MUMA 4Q37A 5F2KA 3C8DA 3PQFA 3BFKA 4M9XA 2IH4A 4RA6B 1EUYA 1XC7A 2QENA 2G67A 2K6GA 4RK5A 2WVJA 3QY0A 3ZI7A 4CLRA 1LPBB 3CVUA 4B3RB 1X86B 2ZI9A 1YR8A 3VNRA 3OZRA 3Q5DA 4ER5A 1TJYA 3S2FA 4BQNA 2BDEA 3NHRA 4CMIB 4BFCA 2O0HA 3K53A 2G72A 3NLLA 2ZTMA 1PJ3A 3NG1A 4YAGA 1T0IA 1GNRA 2P62A 5BO5A 3SS9X 1T1RA 2XTAA 2DR0A 2D6FA 4DHEA 4U6QA 3OQIA 1CEQA 3AF4A 3TW4A 1OI7A 2NPFA 2P27A 2W6OA 3D5TA 1VZ3A 2XCRB 3RO7A 5DE3A 9MHTA 1H85A 3LCVB 2Y05A 1O58A 1T6BY 4JLSA 2ROQA 3EXEB 1V2HE 4U9UA 4LF4B 2MR5A 2P35A 1JPJA 2ZJOA 4TGLA 5CH3A 3LDHA 1EFRD 2O2YA 4WE3A 3E81A 5B1EA 3LO8A 4MCJA 1FYWA 5BNFA 5JXHA 2NVOA 4PCUA 1U2SA 3KPVA 4RMJA 1UPXA 3OWHA 2QY9A 4FSXA 1JBEA 1E1MA 3GCXA 3FMGA 4J07A 4P4LA 1E92A 5COQA 1T10A 2EW2A 4D25A 1NUPA 2IXDA 5C8XA 5FV4A 3D6MA 2FUCA 1Q12A 2GSDA 4G07A 3GUVA 3RIMA 1JDNA 1VLMA 1ZJ4A 1Z5ZA 3EB9A 4JI5B 2W2KA 2FMKA 4Z2YA 3H5NA 3HB9A 4XQ0A 4Y3UA 5H4HA 5EESA 5DM2A 4LOKA 2HA2A 3E4DA 1K63A 2GWHA 4JI7B 3NM6B 3W5CA 3PT9A 3V7UA 2KLHA 1NI4A 4GI7A 4U2CA 4X3PA 1L7NA 4GOLD 4RVHA 2NO5A 1II0A 3R6WA 2HMVA 2G80A 4ZOAA 4CKWA 2XXAB 1GJRA 1NU8A 1QK4A 2W98A 4YJ3B 5LA6A 4U6SA 1YS2X 4B8ZA 5H80A 5E7JA 1DMRA 2XV1A 4PG7A 4PSVA 1E1QD 3MJFA 2OXRA 2I29A 1C3UA 4IW3B 4RTLA 3M33A 1E99A 2NQTA 5ADUS 3MRXA 1YKFA 3CSUA 2RHJA 3IXLA 1CB7A 2F9FA 3CBQA 3IMCA 4QQRA 4A6EA 1Y82A 2WU3A 2QRKA 3A6LA 4HVAA 1KEUA 1KJYA 5BW5A 2F43B 4FC6A 3BWVA 2V0NA 2GN4A 3TKLA 4O2BF 1Y5LA 2QBYB 3CF4A 5KSYA 1XT6A 1V39A 2P1RA 3EDQA 3GZNA 3EZ7A 4KSCA 5IULC 4HV4A 4Y2PA 4HAWA 4OQFA 4OHYA 3HSYA 4MYCA 1PVVA 2O3RA 4C4AA 4DYVA 5KHLB 4P0PB 3R7AA 3OH8A 2D54A 2O8BA 1LW6E 4L57A 1F2DA 1BHSA 1DX6A 4DMGA 1RC8A 3FAKA 1GAQA 1XD2A 4PIMA 1YQDA 5KTSA 2ZWIA 1AQNA 1HY3A 1LSJA 1GGMA 2CT8A 1JFLA 2ONYA 1I2DA 4YI5A 5E0OA 4BO9A 2Y1XA 1KNQA 1ZGCA 2FXIA 3R3UA 3FH0A 4S05A 1DOHA 1OLXB 2AJLI 4LC9A 4MB0A 1QS0A 1A7UA 1GNLA 5FIUA 1CZLA 1I1NA 1QGZA 5DNVA 3TTYA 3R9XA 3HDJA 2VPYA 4RADA 2RHRA 3B6KA 3BMOB 3OC0A 2QQEA 4RX1A 4AJ4A 3G59A 5HDBB 3UHAA 1F2TB 4BMZA 4OMDA 1Z8DA 1K98A 1SC9A 5IM5A 1U0JA 2F3QA 4DCJA 2IT1A 2LP4Y 4HBZA 1M3SA 4WXEA 4EG1A 2FDRA 4J8PA 1SO8A 2LW7A 1NVDA 2YNMC 3ZJTA 4UULA 1AKYA 5IANA 1V4NA 1X2EA 3EOAI 2C94A 2Y0EA 1PNVA 1E1NA 2BTQB 4I46A 1QVRA 1NKTA 4MPTA 2NXEA 4R9UC 3JQFC 3ETCA 1JQ5A 3RKUA 3SEZA 3WIEA 4DCUA 4NAVA 4CKZA 5TDHA 1N2CE 2PS3A 3WA6A 3HU5A 1UK8A 4L02A 4RA6A 1EWRA 3IH5A 4G4GA 4IEIA 3UWSA 5C3MA 2D4HA 4L78A 3GT7A 4QBTA 4TLCA 1I7LA 4V1CB 3KDAA 5KOHA 1VL2A 3L8FA 3S8YA 3ANXA 1ATIA 3NDJA 2DEUA 4YEDA 4EQ6B 5K0JA 5HUQA 3FUWA 4J6EA 5LQKA 4ZOLB 2ZJAA 1SR8A 2GSWA 2YNMA 1TYAE 3QVJA 4R2MA 4RPHA 4ZT4A 1JX6A 3RW9A 2PA0A 1PW5A 3ZJUA 3PXAA 1IYZA 2DJIA 2V5UA 1FMTA 3GUYA 3H0KA 3Q7EA 4X5OA 4PLYA 3S7TA 3SIXA 5TVGA 2LCIA 4M1QA 3PXGA 1N7JA 3ELWA 3TLZA 3B3QA 3T7KA 3KWMA 2ZAGA 3BIWA 3HO6A 1ORDA 1PEAA 4ZWNA 2R2GA 4HUJA 2V6FA 2EEPA 4G5YA 5H59A 5PNTA 1FU7A 3EVFA 5EWJA 4N0MA 2GK4A 1GKYA 2G7ZA 3E5RA 2FFQA 1VQ1A 2VDOB 3FDZB 2V6GA 2J6IA 5EGNA 4BQFA 3TG2A 1JDJA 5IT9A 3UFXB 3TQRA 4C87A 1SHJA 3AQ4A 4CT0A 5EAIA 1ZUNB 4UXIA 4CDNA 3BRSA 5AI4A 1Z3CA 2ODTX 1IULA 2C97A 3BHJA 2FDXA 3H13A 3OY7A 4N7JA 5LUBA 3B7WA 4QUAA 1QO0A 2C9BA 1Y1PA 2F48A 3ZNOA 1M6HA 2Q1TA 3QV1A 3VJKA 1KRXA 3VNUA 121PA 3MZ0A 2XTMA 1OWPA 2GUGA 4EEZA 2HK7A 2XNJA 4KITB 4L3OA 1DDGA 1V1RB 5EJFA 3O5AA 3KUDA 1GAWA 1CQIA 4HDNB 3P27A 5ESXA 4CEHB 3H3FA 4KXYA 3T7SA 4YMUA 2B3TA 5SY9A 1E58A 4JASB 1UM8A 4JBIA 1NSYA 4N9QA 5EIAA 4F4CA 1ISGA 3NIDB 2FZ5A 2P7IA 4DPMA 2ZVDA 1O7JA 1YZTA 3RS3A 2P77A 3AY0A 4PRLA 4EUKA 1GUDA 3R8CA 1E7RA 1UFVA 2JA2A 4X54A 1E7QA 2ZRLA 4X95A 3AV3A 3U1VA 3EIEA 3EPJA 3DQQA 4I1RA 2I78A 4HN2A 5BUQA 4I1OA 5L95A 1M5RA 1XBTA 2WZQA 3W34A 5TPZD 1KYYA 4NYJR 5IP5A 5A4FS 3CEPB 4JYZA 1RAEA 1US8B 5LSAA 5CAEA 5HM8A 1Q0RA 1Z4OA 3U44A 4UDOA 2TYSB 4ZO4A 3BFXA 1CR6A 2GAAA 1IZ0A 1VJGA 4N6OA 4V03A 1GVHA 2G70A 1E2PA 3BMQB 1KQGA 3OP1A 1Q77A 1S2GA 1VMDA 2IOHA 3UEOA 3RS5A 1WCWA 4DIUA 3F8TA 1XHFA 3ADOA 3AG6A 4EY4A 1GPJA 4KV7A 5AM4A 4A1OA 5A5VA 3DW1X 1SD2A 3R4VA 4QLOA 3SG0A 2MYTA 3I42A 3ZOZA 1EXDA 1SOUA 1YRWA 2B30A 1CR2A 1R4NB 2A84A 4YRFA 4YMTA 1OB2A 3V3KA 1M6YA 3IT0A 1VSVA 1NM5A 1W44A 3I32A 2H1OA 1B1AA 5EIHA 5KNBH 2Y1FA 1DC6A 2B8TA 4U8HA 4Y18A 5FXMA 1Q14A 4EATA 3GARA 4G81A 5G1PA 3GA5A 4TVOA 2Z6UA 1N5RA 3DQPA 3QPBA 2FPKA 5LU8A 2CV2A 1WL8A 1WAMA 3FLMA 1A9YA 3A6PC 3HR7A 3D3KA 4OQEA 3M8KA 3VI4B 3V4FA 2B9EA 2UDPA 2DHDA 3TN7A 3N3AC 4BRWA 1Y1QA 2IUUA 1HT1E 5K4AA 1UOEA 3PUKA 5LNK6 2OO5C 3H2SA 1M1NB 4KXNA 1QSGA 1YUMA 1DFIA 1T8TA 4HN9A 3CONA 5BSMA 3GZ4A 1KQOA 4Q0MA 1XTUA 4FGUA 2Q6OA 2Q5QA 1QG0A 3PE4A 3R3HA 3I2GA 1YMQA 4IIFA 2D1SA 2XJ9A 4G8DA 3ULKA 5IN4A 4C3UA 2Z04A 4HQ0A 2ODEA 1IOLA 1QHIA 1LRJA 2NV6A 3JTEA 1E1DA 1I9CA 3EUEA 1QP0A 3PRYA 3CU5A 3GLVA 3HJNA 2HDOA 4EGFA 1JEJA 4HRXA 1J90A 1XCOA 2ZCUA 4J76A 3V32A 5CG1A 2VNJA 1R8XA 4FFSA 5JDCC 2ZR7A 1M6VB 1XI2A 3KU4A 4DM4A 3IQFA 1G20E 2WF8A 4WAUA 3BAZA 1CDDA 3RTEA 2PLRA 3RROA 4B6QA 4NR0A 3UHJA 2E1PA 2E85A 5EKSA 4CG3A 2CYCA 4BVKA 2EF0A 1GSIA 1J20A 5DTIA 2R7KA 4RAQA 1L1QA 2LZ0A 1BGWA 3AX6A 4QODA 3VVMA 3BH7A 3U7QB 3RH0A 3WYAA 2HPZA 3IXQA 4KQKA 1N6PA 3I73A 3LKZA 2GMWA 4W8HA 5LLDA 4NCBA 4C0XA 2NZJA 5JSYA 4AUMA 2BGGA 1Z47A 4NZOA 4B46A 4ESOA 3UTCA 1Z2EA 2GBIA 2BFCA 4OHFA 2JHFA 4L1KA 2LGJA 4JCOA 4UZSA 16PKA 1ZISA 2HQBA 2BMDA 3NYQA 3KETA 3I1FA 3UV3A 3VHQA 3DTTA 5LYYA 2H54A 1RJWA 3ICOA 4KXFB 4B8WA 5MN5A 2BFFB 4RTOA 2JH8A 3EFHA 3ZHOA 3G2NA 3QLJA 4Y1FA 2I80A 2XMGA 1KMCA 2ERYA 2B0JA 2IELA 4NAUA 2FEMA 5FQNA 3PQ5A 4AJKA 2RGWA 2JGFA 1J9ZA 1SKQA 1NJ5A 3IT3A 4MUXA 4YJFB 5HF9A 1D6MA 3ZVLA 2I2AA 2J3DA 1E61A 2VQDA 3AUXA 1GTVA 4GWLA 4OHXA 3LT4A 2QQFA 3GDGA 1K7CA 4LE0A 2D4AA 4QNRA 4N5IX 1M2KA 2C5AA 3O8QB 3OFSA 2H5EA 1GL9B 2QXYA 3OZ7A 3F1LA 1H93A 2HCFA 5F3RA 2I3GA 2WUDA 5REQA 3SOPA 4DFDA 3S29A 1MXFA 2B8EA 3K0AB 4GI3A 5IM4F 1U3CA 3EIUA 4IGAA 5EWLB 5GONB 3IDZA 1MABB 2QOEA 1IVNA 1FPMA 3I6QA 4G01B 3UW3A 4PQGA 2XWQA 3JSXA 4F04A 3FBTA 1FRQA 1PFGA 1VXOA 1ZXBA 1JQ3A 2QQ0A 2HADA 4I55F 3GWZA 1BGVA 3FNGA 5FTLA 5EOVA 4L4UA 2YJ6A 3JR7A 2QJOA 2G3YA 2I6XA 4O08A 4LY0A 1HNNA 2ZROA 3DLTA 4PCVA 2HXSA 2IBMA 2C57A 2FPRA 1G5PA 3HC7A 1K7XB 3SEAA 5KYUB 1MJFA 4G5XA 1NW8A 3O84A 3HADA 2PVCA 4MITA 3GRAA 4RJIA 2RJOA 5E1MA 3TIVA 4EGAA 3VOTA 1FFDA 3TECE 2Z95A 2Q6VA 4RWZA 4Q1VA 3VPFA 3O8OB 1U8TA 3S0JA 3Q6IA 3OCXA 2JAUA 2J9YB 4CDGA 4IJVA 4JS0A 1CUYA 4JLJA 3GLGA 1AUXA 5KWSA 2F4NA 4PEVA 2QMUA 2QRMA 1E79A 2FFHA 3E0XA 3WX0A 5K2OA 4OLAA 1I4DD 1U2ZA 3IA2A 4AY5A 3PICA 4LXUA 4PYOA 5F7ZA 3UKJA 3VH3A 3PCRB 1I7PA 2AMLA 4UCWA 4LDQA 1I7SB 1I0LA 1LRKA 1D2MA 2AN5A 4E6PA 4Z5XA 5LQNA 1V7CA 1J9EA 2QLNA 3THRA 3ZVMA 3EGVA 5BR8B 4I1SA 1A96A 1FMCA 2HFKA 1GLNA 4NBKA 2AX4A 4MVJP 4QNMA 4M49A 3EDMA 4U7TB 1RYFA 4MIOA 3C39A 1E3DA 1LI7A 2N42A 1XWIA 2GLUA 2NTNA 2GD2A 3JW8A 1TF5A 5G40A 4BAUA 3ZNNA 4NFLA 2FPGA 3IOEA 4DXDA 1DNPA 2X0KA 4HEHA 2QS9A 4MS1A 1DAIA 4ZREA 3UFBA 2C4WA 3V34A 2CL0X 4L0QA 1EJ6A 1E2DA 2D7DA 1JG4A 1JYSA 4JVSB 2HU8A 1Y3BE 3N2GA 3V6LA 3UJ6A 2XMRA 2VZ0A 1WW8A 3RGGA 3AVYA 4PHHA 1QLHA 3GLTA 2Z2KA 1RD4A 1JMKC 2ZZKA 1KJQA 1Y3AA 5DYWA 4RULA 4FI3F 3BD8A 3MB8A 1P75A 1WHTB 5DF1A 4A8TA 1DELA 1SC1A 2B6HA 1Q19A 4IQ8A 1MTOA 1I30A 1ULBA 3UMGA 2DVMA 4C2BA 1Z2PX 2HA6A 3LLUA 1LF0A 4KEAA 4M21A 4QBIA 3ASVA 2VZ8A 5F1KA 5CD1A 2EWVA 2X6RA 4ER0A 4F9GA 2EVWX 4JP2A 4LYDA 3UJ9A 4ALLA 3HNRA 3KLBA 5E6UA 3VOBA 4YRGA 4XI9A 3ABIA 1WPQA 5GZ3A 4Y30A 2QX7A 4M9QA 3SYKA 2R6R1 3OLZA 4RQTA 1Q0TA 2PTSA 1MEOA 2DHRA 4YCSA 4GL4A 1TD9A 1JTEA 1OFUX 3DDOA 3X1DA 3U13A 5JYEA 3UN1A 4U0JA 2OWDA 4OBXA 5KJ1A 1RE1A 2XMCA 3DP9A 4GOND 4P81A 4Z7NB 3KSUA 4PU0A 5LVAA 4JMLA 4W9RA 1YGPA 3NCTA 1GL3A 1KYZA 1QHHA 2IDMA 2Z43A 1ODLA 3IO3A 3M6FA 1BFUA 3R0VA 3CY6A 4HNRA 3W06A 4QJ3A 5DCLA 2VXCA 5DCYA 4GYWA 3HM2A 4K26A 4EG4A 5HMMA 3TPZA 4EVQA 4YRQA 5JCZA 2NAPA 2PMDA 4KYIB 3Q8LA 1E7SA 3HXLA 1OZAA 1YTUA 3AHJA 1WPGA 3NBXX 4YBRA 1N1EA 2A0YA 3CMMA 4J4BA 4YTEA 1WD7A 1LS1A 4U4AA 9LDTA 1Q92A 3NBQA 2BJVA 3H05A 3NWBA 3MINB 4IHAA 5H16A 2R6ZA 4N7MA 5JBIA 2JFHA 1TKBA 5IXJA 4D1YA 1XNGA 1ZMOA 4NL4H 2XEDA 3VPHA 4X94A 4ZTUB 3HWX1 1LSUA 3TSZA 3ZLVA 1DV1A 1L7XA 3HVHA 3VBCA 4BRZA 5KOJA 3HKBB 1BU5A 1C8BA 1LDNA 2AFVA 2H2IA 4JLUA 2DB3A 1EX1A 4B6GA 4HHEA 3EHDA 1OC2A 4UXJA 4BCCA 3GEDA 4U2BA 5M34A 2FWPA 2WSSD 4Y7DA 2MT9A 3I9JA 5IJ0A 1AQ6A 2IZ7A 2QVBA 2GN9A 3L40A 2WA2A 1P61B 3K1AB 2JJYA 4NMLA 5ADHA 4CETA 5I7WA 5K8LA 1IIBA 1XAHA 4J3NA 2EKPA 4KQMA 4QXMA 2FX5A 4QDOA 1C0KA 2GX6A 2PZBA 3TR5A 5B2FA 5JJBA 1JW9B 1KA9H 5JQGF 2RB4A 1LX6A 1L1RA 4ALIA 2ZRGA 5E6SA 3V00A 1UT5A 3TSYA 4N40A 1TU4A 3MLEA 1T6ZA 4MRNA 1PZMA 1ABEA 3VPSA 5CYFA 3DFKA 4ZRMA 5ALRA 1NV8A 4NVRA 1THGA 3QUAA 4DNPA 5BMOA 4M0FA 3A70A 3I52A 1IAQA 2RGDA 2V03A 5TMPA 1O6CA 4UE3S 1UINA 2DPXA 2O23A 4H3KB 5BW8A 4PF1A 3QE9Y 1ZRSA 1IAVA 2G5GX 3AIIA 4JCCA 3K9FC 3AY6A 3KV1A 4FDMA 1WCIA 4AAYA 1S3FA 3ZDBA 1OHHA 5BW4A 3FKJA 5I4CA 4RY2A 2VTBB 2W6JD 1NG1A 1Y8CA 2GXUA 2I4IA 5ELMA 4NKRA 3R5XA 4KE9A 1DEXA 2WVGA 2LXNA 4X1YB 2WF5A 2FUSA 2I2XB 2I34A 1KKMA 4E4RA 1V45E 2HIMA 4DNQA 3WKDA 4C76A 4I3GA 1N33B 3HN6A 1ISMA 5AKIA 4PQEA 1ZW6A 4ZA2A 3E70C 3L9XA 5EXEA 1I4OA 2VWQA 5FDFA 5AVUA 4BB6A 2OCDA 3F9RA 1QHXA 4WEQA 2W2OA 4V0KA 1WXGA 2SNIE 2HSDA 2OA0A 3EVCA 5C9ZA 1TJ3A 4DMMA 3TD6A 3PNPA 4E94A 1ELOA 4YCJA 4HFJA 4D9MA 3Q9LA 1PR3A 1XTIA 5EERA 2DP4E 2GPTA 4WKOA 4OBWA 3DVQX 4Z2AA 1RI5A 4KN9S 3NQ41 2ZJBA 4D8VA 1Z0UA 2BFOA 3ETNA 2G5CA 4YWJA 1T1IA 5HA5A 2OV4A 3O8DA 4EJ2A 4BVFA 1DFHA 4TRRA 2IXBA 1XELA 3PRKE 1QRAA 3NNSA 3CX3A 3H9BA 4X8LA 3ZK8A 1LPPA 3R09A 4RS4A 4UNIA 3AIMA 1K6EA 2DMRA 3DTVB 3T7TA 3U26A 4MRPA 2GCOA 4I8XA 4N47A 4ETWA 4EFKA 4HLUC 2IV3A 3WISA 3DEKA 1N2OA 3V46A 4CODB 1MU0A 1X7YA 2XCQA 1E1QA 2PWPA 3FKSD 3CBGA 4BDTA 2DCUA 1T0PA 1T2FA 1F6DA 1UUFA 4MP3A 1W581 1VKJA 3SQMA 1ML3A 1W73A 2DKOA 1C3OB 3KOMA 3TUZC 1H22A 1V5FA 4BEBA 5FQOA 3RU3A 4L50A 1V5WA 2YH2A 4L51A 1M2NA 4RK1A 2R62A 4YFVA 5A9SB 1EHYA 2IDZA 4TZKA 5G4LA 4WEOA 2XMPA 2VEOA 2AI1A 4O4JF 1NTRA 5KVCA 2C7QA 2GBLA 4IVQA 2XUDA 1B0AA 3VPXA 1KS2A 3AHFA 3KFXA 5D84A 5KVAA 1VI2A 5CK5A 3CO0S 1X7ZA 3I5UA 4OQPA 1I6LA 3M6AA 5J58A 3ZOKA 5C1OA 1OLSA 1WO8A 3QEOA 3UMJA 4M0DA 4WOPA 2OV3A 2F9LA 4GBJA 2RHWA 2CXHA 2AL7A 3FGNA 3V4ZA 1PSWA 5M04A 3N5KA 3BDVA 3RWMB 3O8QA 3EAGA 2XTZA 4GSKA 3Q7PA 2XYGA 5CBPA 4UQLA 3ZHCA 2XA9A 4E5PA 2WWXA 1WOYA 1FS5A 2Q62A 3Q3EA 1OZFA 1ZN9A 1BCSB 1W52X 4RF2A 5EJMA 2LPMA 1PSDA 5E3JA 5K3SA 3W5BA 5EWLA 1THMA 5I4IA 4X6UA 2WMNB 3ONDA 3BFVA 3EW7A 2RGNA 3GAFA 4L4YA 3TKYA 3AOEA 1N8SA 3E53A 3H84A 4HDRA 4G2NA 4DLWA 4EO9A 4XVQA 1K5GA 3OPNA 1TTTA 2H2FA 3LW7A 1F7UA 3JWHA 2O2ZA 2OD2A 3COPA 3EXG2 1NQAO 1AXGA 3F6CA 3LUAA 2CHUA 1NF3A 1UQTA 5AQEA 1UBCA 3LL7A 3J7AC 3C6YA 1FDIA 4XLLA 1XALA 3N8IA 4KQ6A 1QC5A 1PT7A 2VDPB 1ZIYA 2ZDQA 2ADOA 3W79A 3G8DA 3M5WA 4CNQA 2A9FA 5T7BA 1PZHA 2VAPA 3HP7A 4LHYA 4OFWA 1XP5A 3C74A 3V4LA 1RWNA 1BXZA 1KF0A 1UXGA 1E2EA 2QJRA 4WADA 1BFDA 3FB4A 1RYMA 2J5BA 5AJHA 4YRJA 3CZCA 2JLWA 4TYQA 1NURA 3C6BA 1IQ0A 4II2A 1P7CA 3EVGA 3SIPA 2KE5A 1RQNA 2D3TA 5IM4A 2HJHA 1F4PA 2NUPB 5FL3A 3IJPA 3OKAA 4YROA 5LQUA 2YWGA 2ASVA 4YPVA 4ZDIA 4KW7A 1KQNA 4YUWA 3VU8A 1XP8A 2APJA 1Q44A 1YNSA 2QRVB 4FYWA 2HCJB 4I55A 5EJ9A 4G26A 1HLGA 3O92A 3RADC 3LC1O 2O05A 5AK6A 2UZ0A 1TXGA 3CVVA 1L8QA 2F3UA 5LMCA 5KQPA 2EKZA 4F3KA 1CRZA 1RU3A 3BMNB 3D2LA 4H17A 3VO1A 5FTKA 1LZLA 3L7CA 2DQ4A 2RHTA 4XYEA 4XRGA 4MJXA 2GVDC 2XBMA 4DA7A 2B1QA 2NX2A 1BKYA 4BB5A 2O4UX 4HEA1 5DSZA 4JVOA 2OT3B 2P4SA 4ZI7A 1HK7A 4D3DA 5KHAA 1KMHA 2A4KA 5TF4A 3P5SA 2VEDA 1NQ5A 4LZWA 3WL7A 3HCNA 5LOVF 1YKSA 3LOPA 4NJMA 4G5FA 2Z5VA 2FWRA 3MUNA 2CXRA 1RNLA 4NMHA 3U16A 1T6XA 3FMVA 4P3NA 4N49A 4V0RA 4V0NA 2ZJ1A 1GRRA 2NOAA 3H5IA 3JQRA 5CTAA 4KHPB 3G2LA 3RYIB 1BSVA 1G0OA 1K6MA 2GEJA 3TR0A 3X1KA 1IUNA 4HAOA 3M6XA 4YS6A 3RVRA 3LA8A 3C7AA 3U4HA 5L6MB 3UWOA 2QTAA 2D27A 5KYVA 1E5XA 4Z1MA 4NXNB 2ZSAA 1EVLA 1J8FA 5EXTA 2D2IA 2QN1A 2QJTA 2OAGA 2C8JA 1JQAA 2HC9A 2QLLA 2JGEA 2OXEA 3IQEA 4FMPA 2FZEA 5D6NA 3ZE6A 4EFMA 2J3IA 2JKYA 4DG9A 1EGVB 1KK1A 3N0VA 1TQDA 1RIIA 3WGZA 2DX7A 3WI7A 5F98A 3WBKA 2R2AA 4IH9A 4HXEB 4FD2A 4WDRA 1W4AA 3DBOB 1UZLA 4G1CA 1N77A 1O94D 3DHYA 5C8ZA 2O5EA 1IN8A 2X8LA 4RYDA 5EMNA 1K68A 2UZ4A 1VE1A 4PN3A 2XH8A 1JI3A 3HJFA 3CW2A 4WLEA 4JBHA 1TO6A 2E2WA 3PNLA 4NDNE 1EQAA 2FQ1A 4QZVA 2VN8A 1RI2A 5A9SA 1U1GA 1U3TA 4XDGA 3S1SA 1IN4A 3LZCA 3KLMX 1SMKA 3T3NA 3K05A 3L6CA 4FC7A 1RLOA 1S4QA 2H17A 3S68A 2I6GA 3ELYA 2K87A 4BVJA 4UAGA 3Q72A 1AA9A 3QXCA 4B0OA 3HXQA 4NZMA 4MQ4A 3RRNA 1MZVA 5TMEA 2C9ZA 1R9NA 1V48A 2YHUA 3KC2A 3MTAA 3HCEA 1V16A 2RH5A 1OGIA 4IZIA 2E37A 3PENA 4M55A 1VFPA 3VPBA 3IGFA 3KTAB 4JWKA 1LV7A 3QLUA 2ZUFA 4P2BA 4MRMB 4PZDA 3NFRA 3TXXA 4R9NA 1VMKA 4LGVA 5B3AA 4LWOA 4CWAA 2X75A 2WHPA 4YYEA 4O4LB 3D59A 2C7VA 3C1AA 4AMGA 1YB4A 1KVRA 3K5IA 2YUIA 2P9YA 4W5RA 1RLIA 2A9PA 3KEQA 2AOUB 3B38A 4G0MA 4U7GA 2J32A 1P0IA 5E8JA 2ZYVX 1M7BA 2ZB4A 1MXHA 4X8HA 2O7QA 1JKFA 1K88A 2HY7A 4RPKA 1NXVA 4TVSA 4UUMA 3CNOA 2GTHA 3NTQA 5DK6A 2Y99A 4G63A 4UUNA 1LLCA 3P26A 3QMWA 4H4CA 2M1XA 2VDWA 3ESDA 4HGPA 4OMUA 5BV1A 3EVEA 5IZCA 3O26A 2J33A 4QG7A 1W4LA 3DM5A 4RZSA 2HBZA 2OE2A 4TL6A 4LQLA 1JJ7A 3A26A 4NESA 2XE4A 3GDHA 3GJ8A 3IDOA 3IPAA 4YCAA 1H2XA 4RPJA 4J43A 5DT9A 1ZC3A 3FETA 2YVKA 3Q12A 1QHNA 5CDFE 4UNSA 4IVPA 1FX0B 4B7XA 4GWGA 4IICA 2P8JA 5FPPA 4RCYA 5AJVB 5FWAA 1FVXA 1KR5A 4B3FX 4CF4A 3IBCA 4MI6A 4GVXA 2VCYA 1ZKMA 5CB4B 1RXWA 4Q3NA 1VLLA 2CEKA 1E6KA 2FLWA 5TPZA 4ATNA 3ZD7A 1MH9A 1RRGA 4MICA 3DL4A 1IEQA 5CM8B 4K86A 4ZQHA 3ZKAA 4DB4A 1G59A 3BM5A 1DG9A 2I3ZA 2IS6A 4FGLA 2FW6A 2ZVQX 1Z83A 3MJHA 3KUCA 2DHCA 4YMHA 3DTVA 1C9DB 4YMIA 2V7GA 2XZDA 3JQ8B 3HUEA 5JVDF 2ZXFA 4DLZA 3Q0IA 1ZJ6A 4JLBA 4UZFA 1H05A 3BJRA 1RWXA 4C0KA 1PFUA 1U2PA 3ZWYA 4C7OB 5EZYF 3OHPA 1SOAA 1LQTA 1HEIA 2WJJA 1UAGA 1LUAA 2FP3A 4NENB 1T15A 1VE5A 4UBNA 4E11A 1SOMA 4CM3A 4YX9A 1XEWX 4E5DA 4F60A 4XWWA 3T9EA 2DWUA 3O8LA 2NN3C 4O25A 1SY7A 4A2WA 1NPDA 2BW0A 3L8GA 3WBBA 2AF3C 1YQEA 3SXUB 2H7VA 2BE9A 5KSZA 2CVFA 1FDOA 2HPHA 2Q1SA 1R0RE 1FL9A 3QVVA 3U3KA 2JLRA 3MSCA 3WZMA 3TVTA 3VO9A 2PSHA 5A4JA 3JD3A 4JIGA 3FAZA 4BNNA 4NHOA 4YT5A 3VR4A 2QXTA 3AU9A 3PQ4A 1M8JA 1G8SA 4BVLA 3N0XA 1F2UB 3DONA 2LCFA 3JRXA 4RSMA 4DIEA 4EHHA 2G9RA 2ZSFA 4KGDA 1YOVA 2UYYA 3PC2A 3ZHYA 2H8GA 1B00A 1FDTA 3VC3A 3NHFA 2QR3A 3G3EA 3OJEA 4JUFA 3BTVA 3PC4A 1K62A 2VA8A 4LIPD 5DHUA 1OIWA 2A5DA 1EDDA 2JAHA 5P8WA 1BHO1 3T7JA 3VU3A 3E15A 5C35A 5IH3A 5J4KA 3LP5A 1I7DA 1K9VF 2Q1UA 2EKBA 4HX2A 4LKRA 3NO9A 5AKKA 3T6KA 4AXXA 1T5TA 1JHXA 1V5EA 4UVIA 3MGCA 4TTQA 4JVLA 1K08A 2JEYA 5GGXA 1WZCA 3A6GA 4QJIA 2F8TA 2CMKA 1L3CA 4YCCA 2O8DA 3Q9UA 5LDGA 1DO8A 4IRUB 4TLBA 3MTQA 2PFSA 4D9NA 4GM0A 1T3GA 4Q9AA 3CRZA 2E55A 3L0OA 5DMXA 1XYVA 4MQLA 3ZGNA 3JQGB 4MP8A 2DOKA 3PC7A 5TGDA 3UAYA 3RUAA 5KTYA 1IWBB 2QN9A 2QRQA 4L85A 2VBCA 5BVHB 4XDYA 5FWNA 3HUDA 3BAFA 1JEYA 4FS8A 4CCSA 4JX8A 4F2GA 1C1HA 1G8KA 2UXBB 1BN7A 3B70A 2BTQA 5T4BA 1TEXA 3V1LA 2BZ1A 4KIJA 2X9VA 4MPDA 2XXAA 2P0AA 2NUAA 1TCAA 4L7VA 1L0BA 4M9ZA 3S2EA 4ND8A 6LDHA 3KP1A 5GADl 4KXXA 2R6FA 3OOYA 4ZYLA 2C7PA 3KHKA 1XB2A 2PL3A 2B34A 3DB2A 4WINA 3PIRA 1X94A 3FHCB 3RU2A 3I01M 1TB4A 2QU8A 5CX1A 3NBFA 2OFWA 4P36A 4FBGA 3KZ1E 4P34A 1A5TA 3KJXA 4PS1A 2J87A 1YU9A 1UMKA 4QDKA 4ASUD 4F9TA 5G0UA 2WHPB 2BFBA 5DN9A 1CP2A 2QMZA 1DCMA 1WMEA 3FHJA 1BJTA 3DTYA 3FPCA 3DMPA 2V1UA 4PX5A 3W7VA 2V54A 4QUHA 4NK4A 4ID9A 4QTUB 4RFLA 1NNEA 5IXSA 2RFLA 4XM0A 5HF5A 1NUAA 4B4OA 4I5DA 1G6Q1 1I1HA 4MKHA 4PAQA 4V0ME 4LGYA 1Z45A 4RJTA 1SQSA 2V6JA 3EXFA 2ID7A 2YVAA 2COEA 2D5BA 1QANA 2B6NA 3H0EA 2Z9DA 2VP0A 3KB2A 2HF9A 3Q0TA 4BFXA 5GJBA 3KVVA 4XGKA 4R6XA 1Z0IA 2VDMB 3TQSA 4RORA 2OAEA 3GEBA 4ABYA 3BIOA 3EYWA 1QYDA 3MTJA 1KEKA 3SJZA 1SCDA 4EJSC 2VHJA 2L69A 1J7KA 3AOEC 3P20A 3RBZA 3TI7A 5IUNC 2OOSA 4QVGA 3OPYB 3W4JA 5ITWA 3EPLA 1R0WA 4U7PB 4H3SA 5A3JA 1FDSA 1TJ7A 1PI3A 1X8KA 2AQIA 3VKHA 4O2AF 3N0RA 1GQOA 4R1OA 3FFBA 3ZTYA 1BMQA 1ULAA 2A3NA 1J0XO 3E3NA 3Q1LA 4KN5A 4LJSA 1K8ZB 2GJ4A 5FTMA 2QNBA 4PAGA 1Z22A 2VFAA 3JQ8A 1T3TA 3N6RA 1QGUA 4EVIA 3HKCA 2WU4A 1B6GA 1WS6A 2IF0A 1PGJA 5F4BA 1DIRA 4EYKA 4NOKA 3C6XA 4GEGA 1C4KA 4ML3A 4NULA 3O4RA 2X15A 3DEHA 4UU7A 1A95A 2I4RA 2NU8A 2F2TA 1XTVA 4CQMA 1K66A 1BJKA 3ILSA 3KEMA 4DY6A 4GL2A 3UHOA 1HDGO 1S02A 4MVJG 1T1JA 3RYHB 3SBEA 2HR1A 1IUPA 1P6QA 1YS7A 4KMMA 4PG6A 1X8LA 2BTOA 3LPDA 3LX6A 5IVIA 2QB5A 1KEEA 1GTRA 1KS9A 2QL9A 3LQ2A 4I0WB 2P4QA 3PPIA 4QYIB 4MCIA 3WADA 2UUAB 2WJIA 4B3MB 1W2WB 1KSHA 2JLSA 5TE9A 1JQEA 5GIPE 1NJGA 2ZI4A 5IKPA 1M8FA 3GMTA 2Z5GA 3RG8A 1X8JA 1KP2A 1JH9A 1GGFA 4WJLA 1JG1A 2YWJA 4I99A 1YCGA 2AZTA 2DY1A 5LQSA 5TGTA 2H6EA 3HBMA 1MC8A 3ZBUA 5KTPA 2AMFA 5JYBA 1W59A 3EG5A 3QTTA 4PPQA 4QQNA 3K30A 3MWLA 2IF2A 3E1GA 4O4LA 4KGZA 4Q1FA 3MLBA 2WJ4A 3EGXA 1ZVVA 4MZDA 2RHGB 2FK7A 4KWTA 1G5IA 4JI6B 3FVVA 2X2OA 4M7WA 4R51A 5DXAA 2HN9A 1VYHA 2RK3A 4KTVE 1L7PA 4FB5A 1P62B 2WR8A 2YASA 4XLTA 5LQCA 1JT2A 4WZBA 3TI9A 2RI0A 5FOQA 3W0LB 1QB8A 1YB1A 2FPMA 2VDWB 4K40A 2D5LA 3DEIA 1TLLA 3RTBA 3KWFA 3TAHA 9GPBA 5JZSA 1TJWA 5DLPA 1EVYA 4FX2A 5BXYA 1KK2A 4PIPA 2RARA 1Z08A 1ZICA 1UBGA 3I6ZA 3D7SA 5HMLA 1I13A 1VHLA 1XPUA 2HV8A 4XFKA 2V7BA 4Q93A 3GOHA 4RVFA 3ZDYB 1L9KA 3M70A 4X85A 2XB4A 1I2MA 3ABRB 1E7YA 3ASZA 4YA6A 4DR6B 4MWCA 4RMHA 3PNMA 1MQ8B 2W2NA 3H65A 3MCAA 3SPXA 2CD9A 3OWOA 3LT2A 4OIFA 3GLFE 4EPRA 4PR0A 4GGPA 1NLMA 2OGUA 3QXGA 1GRCA 4A2QA 3TVDA 2QSYA 4L8GA 4WUVA 4JHLA 3V33A 8ABPA 1QTQA 1Y89A 1K7SN 4KQ1A 1R9JA 4PW0A 3DZBA 1R0LA 4KIWA 4CLDA 2C00A 4R8LA 3NHYA 1JLSA 4NNOA 5A7FA 5H7XA 3VZBA 3O1JC 1MAWA 2GN0A 3NXSA 4LC1A 1SB8A 2QLJA 2QNIA 1VRCA 3A9UA 5A2QA 2TMDA 1EB9A 5K8CA 4Q39A 2R4QA 3AWDA 1E4YA 1RQPA 1ZOIA 2QVXX 1KMIY 3ENNA 721PA 3V1YA 3OBIA 3GEPA 1CY6A 3KZOA 1XCLA 3GLFA 2HMSA 3W2FA 2C3MA 3W9UA 2OLJA 4NE9A 3ZE2B 2XOKD 1RXEA 1K92A 4H1TA 3ND5A 3N2KB 3OPXA 1QFXA 1XLTA 3DDSA 1GV0A 3WGKA 5MGNA 1NYTA 1HZZA 2RGBA 5EUMA 2IYQA 1G6OA 1JQLB 4PYQA 3OD5A 5DTQA 3SJUA 1EVZA 3DEJA 2GASA 2WM9B 2I91A 2Q3LA 3M9LA 3Q6NA 1A2QA 4MLCA 3WAGA 4Q21A 5AM2A 2Y0PA 3KFVA 3B36A 2ZU6A 1FQOA 3DOUA 3AIKA 4GC9A 4FDAA 2QTNA 5B53A 1FYDA 1A2KC 1M5UA 4FFLA 2EZ8A 2R3SA 4D0RA 3EXIA 4BFWA 3ABZA 5H3HA 5CLJA 4TL7A 5L3QB 1VLHA 2H1VA 3A25A 5FR2A 2Q0SA 3C48A 1RR6A 2JIPA 2QN6A 2X9LA 4PLWA 4JZYA 1M74A 1ZNQO 4FSDA 2A33A 3DV9A 1ZD8A 2JFBA 1I2ZA 5AUQA 3ROZA 1GZUA 2G0AA 3L77A 3UKOA 4Q1DA 1WCV1 1JXMA 4G0XA 4IWNA 1NFQA 1WSDA 1ODKA 1B2LA 3KB1A 3W6PA 4YHHB 1V37A 1J0AA 4M60A 2WJ3A 4A26A 1IVYA 5LZ7A 1SBCA 4I8IA 4GX2A 3VVCA 4RCZA 2W58A 3BRWA 2JDID 3B1YA 1QZTA 5J4VA 3ZVKA 1M6EX 4HNHA 1R4MA 2IOFK 1YR6A 3OZBA 4EHBA 1Q1ZA 1Y1SA 1OVGA 1K5DA 2PO5A 4EA6A 4YY3B 1M73E 1RAIA 1H5UA 5JALA 2DHEA 5ECYA 3QE4A 2QMEA 1EIWA 3IKVA 1GDDA 3W9BA 2JGMA 2W2TA 4GSYA 1CUFA 3NBAA 5HQ3A 2X0IA 1FP2A 3IX7A 3HR8A 3S1AB 3LUBA 2AZXA 1OB5A 4LMPA 5H5JA 2A92A 2R00A 3FYHA 3SBDA 4PLHA 3KPWA 1BYUA 1GLGA 1OYVA 2B99A 3GGPA 1DKQA 1G20B 1RP1A 2R8OA 4FHFA 5CXQA 1D03A 1LFAA 2JRCA 4F2HA 2Y9PB 2G06A 1LJ8A 2GPNA 4CG1A 2G9NA 1R37A 3EGXB 1EH5A 1UC9A 3V7FA 1L5SA 4QOFA 3FE2A 2W0MA 4ER7A 5IKOA 3T3MB 3TLGA 4M53A 2IS1A 3KQVA 4GWKA 2IHTA 3RS7A 4DWOA 4NMXB 4DVJA 1I3KA 2P78A 2R7LA 4YUVA 4QULA 1ST2A 1BVYF 4YV1A 3LIPA 1N9GA 4JJ4A 2RHLA 4LXYA 2ANBA 4UQPA 1M33A 5KJFA 1MZPA 2RDMA 1E8NA 3EIOA 3ME5A 2FPPA 5FBWB 4G5QA 3I6MA 4Y2QA 3HXMA 1FC0A 2IPMA 1H2FA 3DMRA 4G5GA 4X92A 2GN2A 3UMVA 4OLBA 5AVJA 4ZHQA 1XPOA 3OMWA 1OH6A 1ENPA 1P1RA 5FD8A 3OF5A 4IIEA 1QJ4A 2R1VB 4QQ8A 3AY3A 3U49A 2L0XA 3N70A 3ZV3A 3QVGB 3JYPA 4BYGA 2R47A 3F6BX 1FVOA 3NIWA 1UJBA 4JFAA 1QQBA 3HU1A 2REQA 4TKZA 3FSRA 3T06B 1BRMA 3OWXA 1UPCA 1KL7A 3P2OA 4RHXA 2VTKA 3HCDA 3N7TA 3PS9A 5DP2A 1KIAA 2I3AA 2J7PD 4B2IA 1DTEA 1ZKDA 3HKCB 4JA2A 2O8FA 4YIHA 1KHTA 2CLHB 5DGHA 5JZVA 4HTAA 2XEXA 3CX6A 4LYAA 4RO0A 3GF4A 4Q3KA 5I5GA 5DW0A 4BTVA 1NNUA 1KEVA 3KSBC 3EEFA 3OQ1A 3KKNA 1JLMA 5KX5B 1MB4A 3JD1A 2IOQA 1T2UA 3KB8A 3C14C 3L6UA 3ZJ4A 3PP8A 3A1WA 2XUKA 2QLTA 2FB9A 1QV7A 4P53A 3CJQA 5K9ZA 2WWTA 4FWBA 4O0MA 2Q2OA 5ALZA 2M6RA 2H92A 2B25A 5A7HA 1NBIA 3D2CA 2OFXA 1SUCA 4OY3A 4A82A 2QM0A 1B42A 2EGHA 2PVPA 4ITUA 2REOA 2QIPA 2VUTA 3AEQB 1MVOA 3BQ9A 3DBLA 3DVAB 3GAMA 3I6BA 5KWIA 3V6MA 3IL2A 2O2GA 1E9SA 2WILA 4DA9A 4E4TA 3W4KA 1VSUA 1Y7HA 7REQA 3BORA 1CRWG 3EGCA 3KBBA 1K2WA 1GKLA 4MVXA 4AB1A 1XMIA 1LNQA 1U9YA 2EG9A 1TEZA 2J6CA 3V8NA 4JWTA 3VYWA 2I76A 1SWWA 4IQGA 1G60A 4C3OB 4GSLA 2LNDA 2SICE 1CCWA 1OT5A 5IAAA 3WJAA 4BC0A 4Y2SA 5F5LA 2VDJA 1WUKS 3KVYA 4TXJA 3TE6A 4JYCA 3A6DA 4W7HA 1HI9A 1XZNA 3KKMA 5DISB 1MAHA 3JRNA 3L6DA 2H9IA 3P2YA 1PJ2A 1FFYA 1FMFA 1PT9A 3D31A 3RVKA 3LYUA 2AFIA 1P33A 2G9ZA 1P4AA 1GN9A 1XO1A 2Y4NA 3HRIA 4HLDA 4ZYTA 5C5DA 1JBQA 2XB9A 3NZEA 4L0CA 4YMVA 4FZJA 3QYAA 5EMMA 2NTVA 4N7RA 5FCDA 2WT9A 2FGKA 1SBQA 4H9GA 1RYZA 1KI4A 1SVWA 2JLUA 3VMMA 1OLXA 2X3UA 3MC1A 2ECKA 4LDPA 3T9AA 3T1NA 3NHWA 4GZ6A 1SPXA 4YT2A 4DRXA 2WJ6A 3DWIA 4URHA 4DQUA 2GHRA 3CRMA 2OD7A 1CUAA 3CLRD 1PQPA 4CMCA 2ZTSA 3MGAA 3G7SA 4H27A 3PNKA 4HYYA 1OU4A 3FFTA 4S1VA 3TAUA 5EJ7A 3E4CA 3UXEA 5AXDA 1L5NA 4LX8A 1O95A 2VNHA 1KP9A 2AG8A 3HU3A 2AFIE 4OF4A 4OP3A 3VZSA 3SHOA 4QM7A 2G6TA 4BFYA 3GLGE 3HABA 1YE8A 3L92A 3NETA 2FG7C 4BBZA 1Z35A 3RT1A 4WCVA 1TW3A 1Q0HA 3R5HA 5JXIA 3S1AA 1A5AB 4V38A 3BSYA 4AULA 2A59A 2L2QA 1JQBA 2PKXA 4D45A 2D0IA 4OYYA 5JXJA 4IXNA 3VAAA 3MGGA 3CJRA 3T1QA 4PPYA 2ENUA 1X13A 3A8TA 3GBVA 4PVDA 3URKA 3UUFA 4P92A 3HCPA 1KO4A 2D1QA 3RYCA 3BGVA 2JFUA 3TCKA 1O9HA 2I7TA 3U9TA 1O6FA 4F4DA 3OETA 3F0TA 3R0QA 5CT8A 2HWKA 1O6GA 4ZVMA 4ZOLA 3WQHA 2BF4A 1X1CA 2J0VA 1WABA 2BV3A 3AHEA 4O2LA 4JEIA 1TMKA 2PLWA 4DV2B 4OXNA 3N2KA 1V1JA 5EQDA 4R0MA 1CEXA 3IO5A 4BNGA 4DLNA 2AYZA 1KSJA 3O8CA 3GJ6A 3ET4A 3OM9A 4FU0A 4J1TC 4HFNA 2O8BB 1DARA 2VT7A 4W4TA 1VMIA 3BB1A 5K1ZA 4YUAA 3WYFA 3D8BA 3S27A 4JQSA 3FUUA 3SLRA 6REQB 5CNJA 2FXVA 1K6XA 1E3MA 5EY5B 4RJ2A 1UKVY 1II8B 1M0TA 1COWA 3DVLA 3B2NA 5MFZA 3UB2A 2IEYA 4OGLA 3PI6A 3WYDA 4R2HA 1YZYA 3HE3A 4KR3A 5CUQA 2YCBA 4JJIA 1U1DA 3IJRA 1CS0A 2JHPA 4HNAA 3KZKA 1R0YA 4R9SA 3R6TA 2YR0A 3TMKA 2Z2JA 4CM1A 2ZIWB 5TLSA 1G5TA 3N2GB 3EGEA 3RSHA 2ZEJA 1GL6A 1G4HA 3STVA 3ZV7A 4ZCTA 2YWHA 2ZB7A 3IUJA 1NKSA 4AJEA 1E2HA 3AIOA 1MJGM 3D0OA 2FLVA 4B6PA 1CNFA 3MT9A 2O19A 1K5HA 3MGBA 2AE2A 3AR5A 3QMMA 5EP1A 4M9RA 3K9GA 2HJVA 3I8OA 4QOIA 5ESWA 3RYFA 2IXGA 2VPTA 3UXHA 3L7NA 4ZD6A 3WMGA 2ZM6B 1BVUA 4J0JA 4K3VA 2FTKE 5DNDA 2UZAA 2HHJA 3PDJA 3Q40A 3NRCA 2OXTA 3R41A 2P68A 1KZ9A 1WXIA 2BSAA 2YVLA 4O8ZA 2WWGA 3DXXA 3R3XA 4KN6A 1F1JA 3DFFA 2QRUA 3G23A 3OE1A 4YCDA 3HEAA 5C5IA 4AYTA 1Z0KA 3UAGA 4DDKA 2W7TA 4BUZA 3DBLB 4EZEA 4R8KA 1UIMA 4TSFA 2M32A 1RACA 5ANRB 1DXOA 1TDJA 3RHSA 2GB4A 3GLGB 3T5PA 1EXNA 3PC6A 2GVNA 4BVEA 2C8LA 1AGYA 2GZSA 2QRHA 3AINA 3GPIA 3VYTB 3MW8A 1JZSA 2P9EA 1TVMA 3ETJA 3FSJX 3HI6A 3MQ2A 5JPCA 3KUKA 3OCJA 4K46A 4LJ8A 1ZNZA 1XYYA 2FVXA 3L46A 5C4IA 4NX2A 4MW5A 4I14A 4GXQA 4BL5A 1VJDA 3I9V6 5AKXA 5AKZA 2IIVA 3LX8A 1HM5A 3C8TA 1OYWA 5ALHA 4C3ZA 3DUFA 2VQEB 2H1FA 5EA2A 1V35A 3VTZA 4JJFA 4R1PA 2DY0A 3NKVA 3V48A 4OVKA 2VHQA 1IJBA 1X9IA 2OR3A 5FP0A 2BR4A 1YA8A 2CHQA 5LOVA 5JY6A 3DPUA 1T2EA 2JIDA 1H2ZA 4YP6A 4CIBA 1T8WA 1QDLB 2CHGA 3CLRC 3IMGA 3TTWA 5HS4A 4FW8A 4IO0A 2X14A 5I7SA 3EXIB 2WWRA 2QXUA 4M1WA 4AZVA 2QZSA 4ZCRA 1U2GA 1KFCB 1W4CA 4FXOA 2ZSKA 3GLKA 1HLPA 1R4ZA 1JR3A 1JBKA 3DL7A 4FMDB 4H0FA 4I5GA 1R8JA 2XQFA 4TTVA 3E3MA 4O4HB 4XUCA 4MYUA 4EJ0A 6ADHA 4HNTA 1ZINA 1WMDA 2YV2A 4N5NA 1OGJA 1W8IA 5J4LA 3RANA 3CGWA 1SBIA 2P2GA 1TJ4A 5JJIA 1ORHA 1GFSA 4N8SA 5KC9A 2O0KA 1FPQA 1PZEA 1SPBS 4IFTA 5IVPA 2HV9A 2L17A 4D6YA 1R7RA 5H81A 3P0HA 4D3SA 3WL3A 1NOKA 1DJOA 2ATXA 4CU5A 3AB7A 1I0IA 3M89A 4CEIA 2EOAA 4NMWA 5IJ9B 5KSPA 3QPDA 3ZBQA 2FP4B 4J0KA 4B85A 4CLOB 2X2FA 4D0LB 4I4IA 4HG2A 3ZDFA 1P7PA 3TLJA 1KARA 3NH9A 5ETJA 2RAFA 5LL6P 1TAQA 1YDFA 3PQ8A 5GONA 1RAGA 1SCQA 1IFXA 2OBLA 2JH3A 2VPWA 4QARA 4ZCMA 2XDQB 5KYYA 3FBGA 1V5IA 3TB4A 3LA6A 3PQEA 1EWYA 4IRMA 1SUWA 4FDVA 4APBA 2OP0A 2DLNA 3EA5A 2V4MA 4RK6A 3GCDA 1VDMA 3K4QA 1MO2A 3IESA 3QVSA 1GTG1 4O33A 1U9CA 5E6RA 4A4DA 1IHUA 4NH4A 4BO3A 2XPCA 1Q21A 3VFDA 3BWMA 1CWUA 2I71A 2IEGA 2W6ZA 4EZBA 2QD5A 2XE8A 4W6QA 2X1LA 3QU4A 4MSUA 3SSAA 4YRBA 1MW8X 1JUDA 1LQUA 2WG2A 4KREA 2F67A 1PKEA 4UCQA 4JT8A 5FJJA 3TGWA 1MQ9A 5T3UA 1EG7A 4REOA 2ZSHA 4IHQA 1DBQA 2CUZA 3M7IA 5EE1A 2JBWA 3DQZA 5K3BA 1BD3A 4BQEA 5FUQA 5K3EA 3QWBA 2ECOA 3HVKA 2P30A 4IKOA 4K9MA 1AS3A 1II8A 4EQZA 2AMJA 4RHTA 4R1QA 1U0GA 2WF6A 1ZCZA 1PR0A 4R69A 3SIRA 1SRQA 4GOOD 4GR5A 4OX9Y 1ZVQA 3NONA 2QR2A 2Q6TA 2HHHB 1VSBA 4RIIA 1CS0B 4KQCA 4RH0A 4L76A 4Y6OA 1TLTA 1F06A 4I6GA 1MJHA 4MRAA 2QSUA 4IDGA 1HT0A 2ACWA 4M36A 3AJEA 3TIFA 3UT6A 3RAFC 2WPDA 3O9ZA 5BMVA 3A1TA 6AT1A 2P91A 3I9V1 4R5HA 2HSWA 3BWCA 5DXFA 5JU6A 4Z4EA 1JI0A 2BY4A 3P0RA 3PCXA 4YP9A 1K4KA 2BHNA 2JD1A 3WOHA 5CDSA 3L7AA 1Q84A 3C85A 3FTDA 4MW9A 5D00A 5BSUA 1RP7A 1TW2A 2REXB 3IQGX 4Y2HA 1T9CA 2J9XB 4D41A 1BTOA 4G3XA 1MKYA 4PIVA 2PH3A 4ENVA 1YT5A 5BY2A 1EAMA 2I66A 4EAAA 5IX8A 1L5HA 4R54A 3ZLTA 4WDQA 2A6PA 3HUFA 4FBMA 3KKKA 3VKFA 2EEZA 1GR0A 2PUEA 2RKWA 1RADA 2Y1CA 4FKZA 2AUTA 3JX9A 2ODNA 1O96B 3ZWOA 4BWYA 5BT8A 1FU8A 4D99A 1GCAA 1OXMA 1QBKC 3ELDA 3O8RA 3TZQA 1CDEA 2OEPA 5BQPA 2QVLA 4GFDA 4RKYA 2I4OA 3EW9A 3HP1A 3K15A 3LQKA 3OZFA 4P3YA 4QAQA 4AG5A 4DA8A 4QDXA 1A2BA 1ADFA 3OUZA 1SURA 4HCJA 2Q9CA 4ZHQF 4UTOA 5JARA 4TZTA 3TBKA 2PKWA 2XD4A 5LN1A 2IYEA 3ZHSA 3DMTA 2ZRIA 4O02B 1ZONA 3R5JA 1WZ2A 2WWVD 2I1LA 3OOHA 2HRCA 1FX1A 1X7YB 4R2LA 1B23P 2I8AA 3OZUA 3O4JA 4NQZA 3KJGA 4B75A 1HG1A 2WNSA 2PX5A 4GF5A 4JYPA 1G2PA 3CPEA 1H4TA 3D8TA 3VKVA 4W5OA 1CVRA 3G02A 1EK2A 1XNJA 3IPXA 4HGYA 1S2IA 5KU1A 3L1IA 3GJ3A 3OU2A 4J49A 4WTOA 4MR8A 4B4DA 4C78A 3HSSA 4X24A 3U09A 3GDOA 1Q2XA 3ISVA 4RL4A 4U6NA 3INNA 3RSQA 3OURA 1H8EA 4RENA 3OTOB 1NULA 2W6ID 2AV6A 4KFTA 4YALA 3TW8A 4IUCS 1KPHA 2P2CA 1ZVJA 2G28A 2X0NA 3MRSA 5KNDD 4H0NA 5DULA 4U7DA 1Y8RA 4YRDA 1I2BA 3UFXA 3MOSA 4MI3A 1EE2A 3VZRA 2ZJ7A 3GT3A 5J4HA 3BQMB 1Z16A 2WU8A 2K4MA 3GGSA 4IR7A 5CYPA 1KEZA 2NSHA 3EISA 3TVYA 4TLAA 3HO8A 4ZVQA 1YDHA 2C3UA 4PRKA 3DO8A 1MO6A 1VJCA 2FKAA 5JDIA 1A1SA 4C7VA 4Q4JB 4QATA 3TRDA 4IKPA 1NOJA 2H7XA 2QUBA 3KKQA 1OYYA 3L9WA 1U6KA 4KSYA 4MQ5A 1MRSA 1KU6A 1GXSB 2I1WA 3PQ3A 1JFSA 2B4QA 1PQ4A 2PKCA 3CF0A 1CQWA 3E61A 4HVLA 1KU0A 1HFKA 4OB8A 4P7BA 4X8OA 3WYGA 1MB0A 4RXUA 3OF2A 1E9CA 3GLHA 2MHCA 1GRNA 2RMKA 3IIIA 1T3HA 1KAOA 1ND5A 1G7CA 4CL3A 1XMOB 4KKXB 4PN7A 1F14A 4GXRA 3EC7A 1JF8A 3WSTA 2IS2A 1O9GA 3CT6A 4DV4B 2JFWA 2IEAA 3IQIX 3JYQA 4EGSA 5C7YA 2WY2D 3ORSA 4UUAA 5E9QA 1ORIA 3S40A 1G8MA 3P9KA 2F90A 3LDGA 3NAZA 4J94A 4LG1A 1E0SA 4CUJA 3JQPA 1PR9A 4MYTA 3IV6A 1X87A 5LB4A 1NVEA 1W7AA 2V55B 4A5OA 5A9RA 4Z7JA 4LF6B 3WBFA 1Y6ZA 4DR4B 1MA0A 3V8MA 1U3UA 4MKRA 3T7AA 4JXZA 1QYVA 5JH7F 1F7VA 1D8TA 4CEJA 5EPUA 1OWLA 2AW3A 3QOFA 1YE3A 5DBHX 4HDQB 4C4XA 1CTQA 1ZCFA 3NH6A 1XQ1A 1JILA 1NVVQ 1HMYA 5G0SA 1IWPB 4F12A 1I6WA 1U8UA 3I61A 1Y80A 5ALQA 1M2HA 1WMSA 1SCIA 1WDWB 3FNIA 1Z36A 2E4WA 5EE0A 3VR3D 5B2ZA 5EINA 1QRTA 4FNOA 4NU8X 1YDEA 1E9DA 4V0QA 1FNDA 5HG0A 1NLFA 3DM9B 2YIDA 3KYIB 1C81A 3UA4A 1GGKA 1EUQA 5JSFA 1E2FA 2CLMB 2AOUA 2C9CA 2RH4A 3DMNA 1V0JA 1U3FA 2FQWA 3I2HA 2C42A 3OFJA 2XT0A 4KHZA 4OYRA 4PQRA 5EWMB 5EMJA 5GJCA 2I62A 4FSHA 4XOIA 1ZK3A 3SFTA 3LL4A 4BRSA 1RHMA 4EG0A 2FR8A 3IE0A 2VRWA 3USES 4LE2A 1YOVB 4DLRA 1RWMA 3Q85A 4BKOA 4EABA 1E4EA 1L5YA 2Q2VA 4N03A 3U39A 4C14A 1PJAA 4URWR 421PA 4YT4A 2VDVE 2X4LA 4BQPA 1HA3A 1PX0A 1GU1A 3STHA 3ZC3A 4OQZA 4GICA 1SQ0A 1JVNA 3NOOA 4RD6A 3W05A 4WBSA 1JWLA 4WVFA 2V4UA 2ZRQA 1Z3IX 1CUVA 2CHVA 4JDUA 5JR3A 2VJAA 4U5QA 2P9HA 2JGDA 4FZ5A 2POQX 1YZHA 3SFZA 1USVA 1T0HB 2JK0A 1QX4A 1SUSA 1C9EA 1JDVA 1Z5VA 3QOXA 1X3LA 4KH1A 3JVDA 4OG2A 4P7FA 5DMHA 2XMDA 2QGNA 5CX4A 5AIBA 3N1UA 1EUDA 4YJ2F 1KO7A 1M8KA 2IEZA 2AEMA 2FSVC 3H2KA 4BYMA 2X5NA 1Y9ZA 2DF8A 2P41A 3R0IA 4I6JA 4ZVKA 3O75A 3YASA 2B7BA 3UJPA 1T4CA 2OLEA 2LVBA 4KX5A 5KNCA 2HA0A 3ZHZA 2C58A 4MXDA 2I87A 3R76A 2J1LA 2NU7A 1U8CB 3I34X 3A1VA 3BHGA 1E0AA 1Y3DE 3OCEA 1P1IA 3PQ7A 4YRAA 2G6BA 2I9PA 4L8VA 5MGBA 3TLBA 4RDXA 1E6WA 1I3MA 1S2NA 3WGJA 2D7JA 3D4IA 4UBJA 3FOEC 2G5TA 2OKGA 1Q50A 2IWRA 4IDOA 1B3BA 1FA9A 2J3QA 2DUUA 2JKVA 3I1JA 3MIIA 4IIGA 1J0BA 4FHCA 5GQSA 3RB8A 5YASA 5CHYA 2ZSEA 3DYIA 5CHEA 4XCQA 2EAUA 3WLOA 4QX6A 3BG5A 5I9TA 3PXEA 2AKEA 3CZPA 1NU6A 4RXMA 4XYBA 1D2HA 3LQ4A 5B1IA 4YQFA 3OX2A 3FW1A 4PAOA 4C4OA 1SCUA 1GKKA 3JAKA 3RC8A 1Z4QA 3F46A 2ECQA 4DARA 1BW9A 2QTMA 3VUEA 1NFFA 3F5MA 5CW2A 1UDWA 1XQ9A 3ELUA 5LZ9A 2WUWE 4CVNA 4E88A 1B26A 1P1KA 2FMFA 3P9ZA 5IAJA 3V2HA 1MBZA 3EBLA 1PBTA 3DC7A 2BCGY 2ICAA 3C15C 3RRMA 1Y9AA 3PQCA 4K9RA 1YS9A 4LOIA 4D8WA 3JATA 2QM7A 1PV1A 3I3SR 1ABFA 4G25A 2WYOA 2O06A 2HQSA 5FWYB 2VHTA 3GMSA 2EF1A 4FDTA 2Q07A 1RJDA 2NW6A 1RLUA 3EXHC 3PC8A 1ZH0A 1QX3A 2BGRA 3HJTA 2P8SA 2Z2IA 4G1EB 4HNGA 1J09A 1ML4A 5JANA 4R8MA 2FW9A 4LZAA 3W9SA 4E14A 4HL6A 1GG9A 4FCTA 2XUJA 1KIFA 5C8YA 2XBUA 3A0RB 3LK6A 3GUHA 1PR1A 2NVUB 3VR6D 4BZXA 2CFCA 5BW6B 4FINA 2YWDA 4QBFA 2CLKB 4EF5A 3P9SA 2FW7A 1TF2A 2Q0XA 4JJEA 4BVBA 3JQ9C 1JAZA 4TZ6A 3V55A 1MEEA 1R6BX 2HPAA 2ZLBA 3SEQA 3DCYA 3ZI4A 3ZXSA 2CCGA 3HTXA 3PB3A 2FEAA 2H1LA 3T4UA 1N6RA 4MMZB 2QZ9A 1I0AA 1QHHB 1TCCA 2V9ZA 3H2GA 3QP9A 4XGIA 5I4KA 4KPUB 2OHOA 2Q5CA 4APAA 4NZNA 3UBTA 1JALA 4Y8VA 5JPIA 1LTQA 1DAFA 1QF6A 4F1WA 2F4VB 3NR2A 3D64A 2B94A 4IDBA 4IOLA 4GKVA 3OEHD 3A0UA 3HCFA 3U7HB 3RLFA 3ZY4A 1H2WA 1NPTO 4BRUA 3GDFA 3RVMA 1XPRA 1K9SA 4OJTA 2WSIA 5CXSA 3ZHXA 1P7VA 1T13A 5CK4A 5L4NA 3VC7A 4F5EA 2BEKA 5B64A 5TRTA 1N5IA 2WZBA 1ZFNA 4JJAA 1CQJB 1USIA 4O4IF 4B71A 1ISPA 4LHWA 1PR6A 2ZRFA 3ND8A 2D00A 3U7FB 2PMKA 3NW9A 4EO7A 2WWWA 5K7SA 2XCIA 3L41A 1ZGAA 2EKQA 1UEJA 2VKQA 3IC5A 3GK3A 3IS3A 3KE9A 4XASA 5AI5A 5FTJA 2LWIA 2FMUA 2YTZA 3E9NA 5KVQA 5H70A 4EL5A 3NDIA 4QJBA 1WA5A 5AVZA 2R6JA 4NZYA 4NE2A 3EEOA 2A9VA 2XTNA 1L5FA 2EFYA 4O1MA 2CBZA 3MWKA 3SSMA 1A9QA 3U4CA 4B31A 4E13A 1RMQA 1UZAA 5BR7A 8AT1A 5LD2C 2DBYA 2FLKA 1XQWA 1G6KA 2JHCA 2ORVA 2UYOA 4JQYA 4P93A 1QV6A 4FNMA 3OT5A 3IHTA 3TO5A 5HFAA 3E48A 1NMSA 5FNVB 2WU0A 3C8MA 1PNOA 4FJ0A 2H5IA 1L7RA 3ZS9A 4JC5A 4QFCA 4L5YA 3KZMA 2VI5A 3FGOA 4H6PA 4HDOB 1GRQA 4KX3A 4MJ7A 3PEUA 1UL1X 1G8FA 1T9GS 1WF3A 3GP5A 3ZLBA 5JHGB 5HM6A 3EF0A 2OXCA 1QH8A 2OTCA 4QGBA 5ALMA 1AK2A 4DR2B 1JTFA 1JPVA 1KVQA 3NNDA 2NV2B 3F67A 3S6JA 4CPDA 3O47A 1V7PC 3ZLJA 4LDZA 1SIWA 4J0IA 5CDGA 1N5JA 4HGQA 1OVMA 2VDKB 2QK4A 3JV7A 4Q4CA 4IIVA 1GZ3A 2GPYA 4ZZ0A 1N9KA 2AS0A 4H7EA 3L7LA 1XXHB 1DQSA 4KTTE 1ZSVA 3F4RA 5DBOA 2ZI5A 2J8ZA 2Y93A 3PPVA 4UEJA 1DJNA 2YVUA 3KBOA 3LKBA 1YCDA 1XDSA 4OKNA 5DI9A 4O5OA 2GM5A 3P2EA 3S8EA 3CW8X 3ILXA 3RARA 2IIQA 2Z4SA 4DLKA 3LMKA 1CR1A 1QONA 2VJQA 3ED1A 3PC3A 3CXUA 4HNSA 3NTVA 4GGMX 4L72A 4UAVA 3AUKA 1N3BA 4UHKA 1IVSA 4N7BA 1W49A 2MSKA 1T43A 4N3CA 2XUZA 4LISA 1YDMA 3HKEB 2WD7B 2VNKA 1VCNA 1JXOA 4WGFA 2HRRA 4B3XA 7ABPA 1CLUA 1CQJA 1GFZA 4RLQA 5EZQA 3TQHA 1T5HX 1XZMA 1TF7A 2BRUC 2JASA 2UKDA 4MVCA 4W1SA 4FX5A 4YAJA 5ALIA 2MDTA 1JIUA 1QK5A 3WP1B 4DDMA 4QBGB 2ZTUA 4DBVO 4Q4JA 1UQRA 3EA0A 2WZDA 2FWJA 2OZVA 3OJ0A 3EJ6A 2J9RA 1FSPA 3HLKA 1U4NA 1WV0A 3ZZNA 3O7MA 4G2TA 4WN3A 4BLRA 4UVDA 2FX3A 2X0DA 5L6LB 1ZJJA 3Q41A 4FT4A 1ZD5A 3QXXA 3FPLA 2CXOA 1P1HA 4TLMB 5T4FA 5KTKA 2VSYA 2GO7A 3OJOA 3EMDA 3G1WA 4MWSA 5AW0A 1HV8A 3BSSA 4BNHA 2ET6A 3GVIA 1XN1A 3P0FA 3TL2A 3VJRA 2ZB3A 4LBWA 1R6TA 3AJRA 1EP2B 3RUDA 4F3NA 3G0GA 2MSEB 2QX9A 2EFGA 5HKBA 1GGNA 4MTCA 1COZA 1LWNA 4ZJUA 3M6UA 3PR3A 4OCZA 5AICA 4Z0NA 1IRXA 1HTTA 2J9FB 3PWTA 4UDNA 4I50A 3LQQA 2XCOA 1VJRA 1RZRA 3ZWMA 4FFBB 2VXYA 4CM7A 3IBYA 2Q5EA 2WJHA 4NOLA 4C03A 1NI4B 4E5VA 1I4WA 1N7HA 3TTUA 1O0BA 2AOTA 1AMOA 2GH1A 1OKKD 1PV4A 4M6WA 5H0IA 1JLHA 4TN5A 3AI7A 3QG5A 4X1YA 4M2LA 4C6SA 4RE5A 4RHYA 1U7ZA 1XLTC 3PA8A 1OH7A 4Z4FA 3T1VA 3SVTA 1TC2A 2HUPA 4PC1A 4NYJQ 3W77A 2BOVA 3ORYA 1N5OX 2QTLA 3DE5X 1VOTA 3I37X 4JMPA 4OSOA 5L8VA 3LTEA 1BXGB 2RKOA 3U17A 5KQRA 1ECLA 2WU1A 4A92A 4LF8B 1E6LA 2AUNA 3TS1A 3BS4A 3WK7A 1WW2A 1MJNA 5EHQA 5IH7A 5B7GA 3AF5A 4DIFA 1U9IC 5HEKA 4DAEA 3A1EA 3OEWA 1VGQA 4K81B 4MB2A 3DZ8A 3HCRA 4UTVA 3PGKA 3G49A 2DHQA 5CDFA 5FBQB 3EXEA 4Y9DA 1QNFA 2ZYTX 5B57C 5ESDA 1EA5A 1HLDA 3EH1A 1PS0A 3QUSA 3LY8A 5EHXA 4WA8A 2W2QA 4V3BA 4M1MA 1PS9A 3FI9A 2O8EA 1M34B 2UZ1A 3QRWA 1Z7GA 4KGVA 1X1AA 3L6BA 2C61A 5ELLA 1SKAA 1L5OA 3DTNA 4JBLA 1N34B 4UNQA 5IVKA 4WFJA 1QYWA 3R74A 3X3HA 2YWXA 4OHPA 1TQ4A 3T8YA 4GMKA 3NBZC 1K7YA 3O94A 4B40A 7ADHA 1KQ3A 1T3LA 1WULS 4H15A 4I7EA 5ALOA 5DK4A 4NYIR 2C1ZA 1ITZA 1XTJA 1VBFA 2HYDA 5HUJA 3UWPA 1JEDA 1EUDB 4LNUB 4F45A 4QOGA 2VXBA 3RHZA 3GW8A 5B7PA 3EOBI 1UJMA 2MIIA 4YLYA 4UMDA 5IMSA 2PUFA 1NJSA 2GYVA 3O4VA 2IOYA 5FH9A 5K99A 2PRYA 3T95A 2VVTA 5KOYA 1XTTA 4IV0A 4DY4A 4ZTBA 3LC7O 4ZP1A 4NLLA 1N2SA 3JWPA 5A71A 2CXSA 4ZI5A 2XB6A 3RGWS 2OKCA 3LC2O 1FFGA 1NFRA 4J0DA 1VLQA 1G5HA 3SQWA 3HA7A 1ISIA 1PR5A 5FOSA 1FUYB 5C7IO 3LSYA 4HZGA 3GGCA 5FWXA 3T1HB 4BXOB 4JQZA 5HKKA 3G6WA 1XDDA 2XUIA 1P3DA 1COWD 2QRVA 1KYQA 1H2AS 2VBFA 4MR9B 5A5GA 2FUKA 5U4QA 2HBQA 2IX9A 2BDUA 1W25A 4OL0A 3H87A 4AP6A 5A4DA 1J8VA 3R7FA 2EDCA 3M3HA 2IJGX 4OLJA 1IY9A 3QW4B 3GLIB 1U1CA 1YK1A 2H11A 2WYUA 3DBHA 4GZ5A 4LOAA 5JJLA 3THWB 3AVPA 3FLBA 4S2UA 5DIFA 4GZMA 5J2UB 2ZWPA 5DP1A 2HI0A 2Q3BA 2FQQA 3CSDA 2FN3A 3TSCA 2QF7A 4AO8A 3PGJA 2K2WA 5KI6A 1FK8A 4BNMA 1YRHA 1EFDN 1HL3A 3L1UA 3D3EA 1B7GO 1N6LA 6YASA 2ZUCA 1MGOA 4EBBA 1DMSA 5IN5A 2EFDB 5JADA 3BMCA 4BQSA 5K03A 1F3OA 3ZCUA 3FDIA 3M6VA 4RPCA 1QG2A 5ELXA 4Q66C 5AW3A 2O0MA 2AI2A 3KQKA 3RVDA 3VTKA 3QBPA 4JGGA 1NP6A 4NCHA 4AF6A 2QG4A 1ZUNA 1EFVB 1DWQA 2WA1A 1E5TA 3G2MA 3STWA 1DHRA 2W6MA 4Q12A 5G41A 4JZKA 4ZAWA 4R1LA 3STTA 4KQ9A 4AK9A 3VA7A 2PMFA 4RD0A 5E0KB 1PJLA 3QTLA 3PX7A 3H5AA 2OQVA 1NC3A 1A5ZA 1R10A 1MHTA 2ABWA 3ZNQA 1HBJA 2RGAA 1H0KA 1TRHA 2FH5B 3C8HA 5LB2A 1EG2A 2PBFA 3KOUA 2C2YA 2HK6A 1XTPA 3A1UA 5CXUA 1S2LA 3B7PA 1N25A 1A7AA 4YJKA 1VBMA 5EE9A 2XKKA 3Q7SA 4KIGA 3FUCA 5KX5A 1KO5A 3ER8A 4AICA 1LRLA 5G2OA 4WQMA 4OKSA 3FI0A 3L7MA 1YASA 1BG6A 3LKVA 1R4MB 4D9KA 1SC6A 5EZ6B 1RMTA 5K6AC 3DO6A 3GG2A 5B1DA 5K3DA 5B3LA 3SICE 2V0GA 3F71A 4MO2A 1UPBA 1AF7A 3QFHA 4L9WA 1OXTA 1W0KA 4G97A 2JL1A 3AB8A 3AXSA 2AC7A 4KLRA 4IJMA 3O1HB 3W2TA 1MH1A 1QVWA 1ZMTA 4P1ZA 3GYBA 3PEEA 3GLFB 2IXEA 4EHLA 5C5CA 3VPAA 3MBIA 5I9NA 3G0IA 2WDZA 2Q4EA 2JHAA 5BN4B 1HYBA 4RY9A 4LSMA 4JSTA 4NBRA 4ZOBA 1VC2A 2GZ1A 1H42A 2WVHA 1QVZA 2H7CA 2CMGA 3ZX5A 4TUYA 5KSWB 2ZRPA 1DKPA 3QOYA 1VL6A 3GDWA 4D6XA 1P2SA 4I6EA 3VHLB 1R3DA 2G4CA 4DJFC 4IHJB 4ZPXA 4M99A 4WGGA 2PS9A 1RBYA 2P69A 3BZBA 4ZCLA 4BUCA 4CQMD 5F78A 2WHEA 4IJ5A 5A06A 1QGAA 4OQ4A 5KTTA 3MFYA 1YAJA 1BH6A 4QREA 5FBRB 5IS2A 3ADBA 1QQ5A 4MINA 3H9UA 5DHAA 3RJMA 4BGIA 1RJ9B 4L07A 4AMZA 5HIAA 2PV0A 2DAPA 3ZR4B 2R7MA 3AETB 5BWMA 1R5OA 1KPGA 5K3AA 3BK7A 1M8PA 3MMZA 5IWAB 2FE1A 1KAEA 2VF5X 1LI4A 1HZJA 2XUPA 1AKQA 4B76A 3AHCA 5K0ZA 2I6SA 2BBTA 2QTHA 3BVPA 2CN1A 2HB6A 1E3SA 1MFZA 1EFRA 1KAHA 2FU5C 3HRKA 1E3JA 5HJ5A 3B1KA 4LDAA 1UPUA 4LXQA 2D8MA 4NF2A 4EW1A 2Q4DA 3EDCA 1C14A 3BZWA 4L4SA 4R9RA 4YJ2B 2JI4A 3U3DA 3LV8A 1E1CA 1N0HA 3A1CA 1K7FB 2C4VA 1P29A 4KVAA 3O1LA 3GHHA 4FQ7A 3NAQA 4CM9A 4S04A 1RKVA 4Y6LA 3SC4A 4ME6A 4D9FA 5F7OA 2E4AA 2CFIA 4RJKA 5HIIA 4L22A 1CSEE 2VSXA 4R2WA 5DZSA 2WOOA 5JQWA 1P31A 2R8BA 1GNVA 2XBLA 1NXPA 5AVQA 4K8OA 2OCLA 4FYHA 4RVCA 2GF9A 1ICIA 4I4TA 3T1TA 3N87A 1QOZA 5DYTA 1SKBA 4KLNA 4MV5A 4BZWA 2RI6A 1OW3B 2C2HA 5AK4A 4WESA 2XSZA 3D1VA 4Z3DA 2VDNB 5MF6A 1OX4B 3ZPXA 1M6NA 4JBNA 3MS2A 3ZE8A 1AUVA 1OX5A 2HGSA 4UCXA 3DE6X 1FLDA 3SK0A 1MDBA 3ZXIA 1DC3A 1JDSA 1A8QA 3P2MA 2QTFA 3ZCTA 3FTEA 2Q5JA 2FRDA 2IXTA 1IE3A 1G9XA 1T5DX 1LWOA 1PN3A 2CF5A 4RAOA 3R0JA 3K92A 1OY1A 3EUFA 1Q7CA 4NJOA 1G2QA 3PFNA 1N2CA