2JAUA

Crystal structure of d41n variant of human mitochondrial 5'(3')- deoxyribonucleotidase (mdn) in complex with 3'-azidothymidine 5'- monophosphate
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
194
structure length
194
Chain Sequence
RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 5'(3')-DEOXYRIBONUCLEOTIDASE
publication title Crystal Structures of Human and Murine Deoxyribonucleotidases: Insights Into Recognition of Substrates and Nucleotide Analogues.
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 2jauA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2jauA01
4EZEA 1RMTA 4Y2RA 1Z4KA 2ZBEA 2BY4A 5A3QA 1S2OA 2B30A 2YMPA 1RLTA 4Y2TA 3QGMA 3N1UA 5AKHA 2C8LA 3E58A 3WKEA 3E84A 4EX6A 2WF6A 1CQZA 4C4TA 5AIAA 4YCMA 3QU9A 3QYPA 4YIHA 4Y2VA 4Y3UA 1CR6A 1X42A 4E88A 4QJBA 1L7MA 2PQ0A 3R9KA 2FPSA 2IOFA 1Z4OA 4Y2YA 4BX0A 3EF1A 4FYPA 2IOHA 1WZCA 2DQSA 4RETA 1L8LA 3AR3A 1LTQA 3K1ZA 2HX1A 5ALOA 1PW5A 1O03A 1SU4A 4IG4A 1L6RA 3BWVA 3QUCA 2CFRA 1RC8A 4BX2A 5ALWA 3FGOA 2C9MA 5AVSA 3KOOA 2C88A 1RMQA 2X4DA 3WKDA 2I6XA 3OPXA 3SF0A 4XPZA 4MWOA 3QX7A 3QLEA 2FPWA 3AR9A 3ESRA 3L0BA 1Z4NA 4FFDA 5AKEA 3FM9A 3WKCA 1SWWA 3NUQA 3ET4A 3SLRA 2IA5A 2YFYA 5ALYA 3UMGA 3A1DA 4OD0A 3ZW7A 5AI0A 5AM4A 2JARA 2G80A 2B1QA 4UAUA 3WK9A 2CFSA 3IB6A 4YCLA 1L7NA 3WKBA 1Q92A 5AI6A 2O9JA 3VAYA 3L5KA 5AVTA 5ALPA 2ZXEA 5AVRA 4Y2UA 3QUBA 5AKXA 5ALKA 4UM5A 2B0CA 3QU2A 3CNHA 2YY6A 1QYIA 2W43A 3ED5A 3OCYA 1ZD2P 3OCXA 3M9LA 2O2XA 3BA6A 1EK2A 3QU4A 5AVQA 1QQ7A 3N8GA 1T5TA 3IJ5A 2ZBFA 1EK1A 2YJ5A 2HF7A 2GFHA 1ZD5A 1ZJJA 5AK4A 2B8EA 3R09A 4UATA 5AKJA 3ZTYA 5AVWA 1T9ZA 1TJ5A 5AKZA 4HGOA 2OA0A 4GXTA 2PKEA 2HOQA 1T5SA 2OM6A 3PDWA 5AI8A 4J03A 4KX5A 2AUTA 3WK6A 4Y2QA 1QQ6A 1RLMA 2GHQA 3A1EA 3FZQA 3MC1A 5AK5A 4BNDA 2RAVA 2VKQA 2BDEA 4DW8A 4AP9A 3ZX4A 2HO4A 4UMFA 5AM0A 4UAVA 3L0YA 4HGRA 5ALTA 5FP0A 3SHQA 3W5DA 2B82A 2NO4A 3HLTA 5T41A 1WPGA 1Z4LA 1YNSA 1TJ4A 5ALUA 4ZEWA 2GO7A 2I33A 3ZI4A 5ALFA 5AESA 5AVYA 5AKIA 2I7DA 1N8NA 3KDPA 3SD7A 5AW9A 5AW1A 3QU7A 4IFTA 4JB3A 1Z4QA 1Z4MA 4OFZA 3N28A 4Y2JA 4ZEXA 2MSNA 5AKKA 4DFDA 4UARA 3AR8A 4L57A 1F5SA 1ZS9A 3U7GA 3I1YA 4PNHA 3QUQA 5AW2A 2RARA 1NNLA 1U2SA 1Z4PX 3ZX5A 2MU1A 3NAMA 1LVHA 2NO5A 2R8YA 1L7PA 3J7TA 4NV0A 3ZWDA 2YJ3A 2CFTA 1L8OA 3DDHA 3NRJA 3KC2A 3ZVLA 2C8KA 4RESA 4KX3A 2P9JA 3U19A 1QH9A 3AR5A 5AKYA 2ZBDA 2RBKA 4F72A 4F71A 4HAIA 3N5KA 1TE2A 2EATA 4BNDB 2RB5A 2G0AA 3EPRA 4CE6A 3EF0A 4UMEA 5AM1A 5AW6A 3U7FB 3W5AA 3ONNA 1N9KA 5JJBA 1Z5GA 4AS2A 1RPZA 3RF6A 5AVVA 1L7OA 2EARA 3FVVA 3QNMA 2GMWA 2FI1A 3KBBA 5ALSA 4UM7A 3ZUPA 4KYTA 1J8DA 2YMLA 3M1YA 3L1UA 5AW0A 3UMCA 4L6CA 1S8OA 3R4CA 4I9FA 1Q91A 5ALGA 2YJ4A 4UMDA 1O08A 3B9RA 4Y2XA 4I9GA 5AM3A 5AW3A 1U2TA 2G09A 4DCCA 4BBJA 1RQLA 2I54A 2I34A 2ODAA 2G06A 1YMQA 1VJRA 1ZOLA 4QQFA 1RKQA 4UU1A 1XP5A 3ET5A 5ALQA 3TLMA 5ALXA 3ZWKA 2HDOA 1TJ3A 5ALEA 2P11A 2AMYA 4CNQA 3WK5A 3SKXA 5A3RA 1YJ5A 2G07A 1XVIA 1Z88A 5AHXA 2W4MA 2B1RA 4BEVA 1RKVA 3AR7A 3OCVA 5IS2A 3MPOA 3L7YA 1RDFA 3QU5A 4CF3A 3NALA 2Q5EA 4GIBA 1U02A 2YMQA 3SKYA 3CZ4A 3SMVA 3DNPA 3U26A 4KNVA 2WF7A 3OCWA 2Q4RA 4YCNA 2Q4TA 3A3YA 4UW9A 2QLTA 3NASA 5ALHA 4DWOA 3QUTA 1RMYA 1YDFA 1RLOA 1ZRNA 3ZU6A 1U7OA 5ALRA 2FEAA 2FUCA 2NYVA 4BX3A 2GHTA 4Y2PA 5A3SA 2JGAA 2WM8A 4UMVA 5ALDA 1JUDA 3L0CA 3EWIA 1J97A 3OTQA 5AK3A 4EELA 3L8HA 3ZVNA 5ALZA 4KN8A 5AI5A 3E8MA 1NF2A 2P69A 3WKAA 4KNWA 3U7EB 4BEWA 3GYGA 4YGYA 3I28A 5AW5A 3QXGA 4H1WA 3ESQA 3WGUA 2JAWA 1ZD4A 2I55A 4UASA 4OHFA 2EAUA 2C4NA 5AK6A 2WHEA 4XQ0A 4EX7A 2JAOA 4G63A 5AVZA 4C4RA 2OYCA 2HF2A 2R8EA 1IWOA 4HGPA 4Y2SA 4JDPA 2HEGA 2HI0A 2D2VA 1Z5UA 2WF8A 2HHLA 1VJ5A 3PCTA 4MUMA 1SWVA 4EEKA 1KYTA 2QYHA 4XOUA 1XPJA 3S6JA 3ZVMA 3I76A 2AGVA 5AW7A 3MN1A 5AW8A 1QQ5A 5E0OA 3N07A 3D6JA 4BKMA 5IT4A 2G08A 1TA0A 5AIBA 2WF9A 1ZD3A 2FDRA 3PGLA 5ALLA 1RKUA 5AVUA 3W5CA 2FPXA 2YJ6A 3DV9A 3HYCA 3L1VA 3L8EA 4CF5A 2ZG6A 3E81A 3F9RA 4C4SA 3A1CA 2YN4A 3I6BA 3L8GA 2R8ZA 2G1AA 1K1EA 2FPUA 1ZRMA 4YH1A 1Z4IA 1NRWA 1AQ6A 2CN1A 1VFPA 5AI4A 3UM9A 5ALNA 3WK7A 2ZBGA 4G9BA 3B9BA 2FUEA 3FPSA 3DAOA 1WVIA 5AKLA 4NFLA 3UMBA 3WK8A 3U7HB 4UU0A 1RRCA 2YBDA 1YS9A 2OBBA 3IRUA 5ALIA 2AH5A 1Y8AA 5AM5A 3WGVA 4HGQA 5ALVA 5AW4A 3B8EA 4FE3A 3WK4A 4HYTA 4AS3A 4YIKA 1MH9A 3P96A 2P27A 3NANA 4J2TA 4NAVA 3NIWA 3OCZA 2R8XA 4XE5A 3U13A 5AI9A 5AKGA 1WR8A 5AM2A 2IYEA 1U7PA 1FEZA 4OCZA 4NWIA 2FPRA 3W5BA 4NABA 2IOFK 5IT0A 1YV9A 5ALMA 4B6JA 3OCUA 1RQNA 3AR6A 2YMMA 3AR2A 2B8JA 5AICA 2BDUA 5AVXA 2JAUA 4EENA 3ZTWA 2WFAA 3KD3A 5ALJA 4O8CA 4BYGA 3KZXA 3RFUA 2PR7A 1Z4JA 4CF4A 3PGVA 2ZOSA 3AR4A 4HGNA 4L6AA 2WF5A 2HSZA 3MMZA 4ZEVA 3L8FA 2W11A 2HCFA 3FPBA
chains in the Genus database with same CATH superfamily
1F4VA 3QMPA 4UTVA 5L7TA 3D5TA 3HJGA 3RLFA 1ZGZA 1GTJ1 2C1ZA 3O4VA 3FB1A 2TYSB 3DJFA 4GRAA 4L16A 4ETNA 1IUOA 2C8LA 4EFCA 3E58A 3E7FA 5H4HA 1OTHA 4OFWA 5CU7A 4ARZA 3FYSA 4QEZA 1DE0A 5GY7A 1PVOA 1Q20A 4N49A 3L1JA 3VHXB 3K15A 3W4KA 1WLYA 2PZGA 1U0TA 1ZM2A 1UXOA 2VJPA 4DDUA 1XEFA 4P9NA 2QMHA 5KTTA 2BIFA 4IQ4A 1M5UA 2J9FB 2AMFA 4I08A 2EP5A 2IV2X 2IOHA 2HRCA 4Q3LA 1P4SA 1KKMA 3WL4A 3K1ZA 2WJHA 3LGAA 1RR6A 2IT1A 2HT1A 2BT4A 2IVFA 5IBRA 1TQ8A 1C3OB 1AU9A 2GJKA 3ENNA 5F78A 2G4CA 1VIVA 5DO9A 5A4FS 4KODA 1DOZA 2NW6A 1N9GB 1NONA 2C97A 2QR2A 2QT0A 3QUCA 3TINA 2PZFA 4DV0B 5EZYF 4L8LA 4N18A 1I4TD 1DWUA 2W42A 1D2HA 2UVPA 1H3EA 2JCVA 1F7VA 1MJ5A 2PWPA 3ABIA 3HCCA 2BDTA 4Q4CA 5LQRA 1IN4A 2YYSA 5CW1A 4JYAB 2FN9A 3SM9A 2D28C 2XA2A 1O3YA 1CJMA 4IZOA 4O2BA 3BREA 4JUCA 2FPKA 1KC1A 3WQHA 2FPIA 1Z12A 3BQ9A 3D8NA 4I5IA 2ZZKA 3SLRA 3KXDA 5L4LA 1ZP6A 1B3BA 2I3AA 3TZLA 3TGLA 1N2EA 4BO9A 1KK0A 2R44A 1G18A 4TKVA 3HP7A 4R1TA 1JU3A 4X3CA 4DC9A 1JXAA 2NTJA 2PKRA 1W4ZA 2D1RA 5CXXA 3O5AA 2BI7A 2IW3A 2QTBA 3AHJA 3NHJA 2ZB7A 3KZCA 5CT5A 4DQXA 1PWHA 3OQIA 3B1FA 4ZYVA 1CTQA 3AHCA 4BMNA 2B1QA 5EKDA 1UK6A 1JA9A 3C41J 5F23A 5FO1A 4JJGA 4R0VA 4DABA 2ES4A 3IB6A 2X0DA 4N6GA 2OSBA 5JLJA 2R2AA 2CXNA 3C1TA 2WVGA 4YJFB 3VQTA 4IO1A 1GTMA 3W6OA 2YXDA 1A8QA 4QM6A 5DXFA 2ZDHA 2P6PA 2X5XA 3PRJA 4B82A 1FUYB 3LQ2A 4K28A 2G1KA 2IYNA 3D81A 4UM5A 2H9AA 1TZJA 2VYCA 2HA5A 4C7OA 1G8SA 2B21A 1MR3F 1QYIA 3RODA 3UXEA 1JKMA 1NZDA 1A9RA 1M83A 1E0DA 3EZ2A 2VCYA 3KXLA 3DEFA 2XV1A 2ZQZA 3UJ3X 2ZI3A 4JL5A 4XEHA 4BV3A 5BV7A 5KOJA 2AEEA 1JQEA 3MT8A 3LBFA 4K1XA 3CW2A 5EHXA 1GZVA 2ZIXA 2FQWA 1FFCA 2FPLA 1RQGA 3PB3A 4RKWA 4EA7A 1P2DA 5HMLA 1GL6A 2XQFA 1TO2E 3EOZA 2IZ7A 5DGHA 4R2MA 1VL8A 2X8JA 3P32A 1YB2A 4MVYA 4YDSA 4GYWA 2FHSA 5TPWA 4AUNA 1WXWA 5FBLB 1S3IA 2X2PA 5IAEA 1TJUA 2EFEB 4HGOA 5K8VA 1A96A 1SA0B 2QM7A 3KR1A 2GN8A 5IJAA 2EQAA 4WTOA 3O1IC 4TMVA 5BSEA 4JI7B 4K26A 1Q7EA 3KQPA 5JNVA 3HKEB 5BV1A 1W4AA 3OFJA 2OO7A 5I9IA 4DWJA 2WQZA 1E3TA 4MQ6A 1GNPA 3NMUF 5FQOA 2XB4A 1ILEA 3TRIA 4DGQA 4ON9A 2Q4EA 2WZQA 1BZYA 2RAVA 3AJ8A 4FP9A 2PUBA 1N5RA 2E21A 1YU9A 4ND5A 3K9NA 3HKBB 3G8AA 3STVA 3ZQ4A 3RADC 3S0JA 1J5XA 4WH0A 3ZDFA 2LE0A 5FP0A 2G5PA 1Q0RA 4XWGA 1YC5A 1PT9A 2NO4A 3H0EA 1TMGE 4C78A 4REOA 4HS4A 3LDFA 4J1SA 4WASA 4EHHA 1JKXA 3FN4A 2JBWA 3EVFA 1TJ4A 3D1VA 5ALUA 3UUFA 1YAJA 1LDYA 3H0KA 2Q99A 2JLZA 5HF8A 1HZJA 7GPBA 3MRXA 2O8VA 1PJ4A 4ZTUB 3IHLA 3AHHA 4HTFA 2Z6VA 4BASA 3ME5A 5TSDA 4H27A 3G85A 2ZIFA 3GQBB 3O47A 1T9HA 1KJNA 4PQFA 2X5JO 4D5EA 3JQ8B 2B4TO 1CUDA 3K6SA 3DMPA 4JVOA 4M2LA 3I2YX 3A4VA 4HRAA 1T4CB 4RVDA 4X0EA 1A72A 1W9HA 2XQGA 5CM8B 1PG0A 1W44A 3HCFA 4KAJA 4DFDA 4ZCRA 3VUEA 3VTZA 4F4UA 4FINA 1XZAA 4ZPXA 3PYXA 2J5BA 3TM5A 2O3TA 3QOYA 1REQA 4RIGA 1LX7A 4HDSA 4H7HA 1IXZA 2J3QA 4S05A 1C3LA 4B7XA 5ENDA 3HU3A 3ML1A 3FKQA 4LIPD 1TK9A 3AIKA 5A7GA 4NV0A 2JKZA 1ZKMA 3VM6A 1H5NA 4IOMA 1GNSA 1PFKA 5KHLB 4OQPA 5LKAA 2M2IA 5G53C 1PHPA 2FCAA 3NO4A 4GX0A 4KX3A 2P9JA 2CCGA 4TXHA 1DOHA 5CK5A 3C5EA 1NT4A 3MS4A 4ERNA 2W2NA 1T29A 3H0CA 5I7OA 1UK7A 1P7VA 3KCQA 4KSBA 2FAXA 4OP1A 4P98A 3Q12A 4ZO9A 1C9KA 2QSZA 4F1KA 4MHSA 2VSNA 1OKKA 1D2AA 3C3DA 4H7DA 4JVMA 2X0IA 3GAAA 5BSWA 1QUFA 2VP9A 4GYYA 1M72A 3P27A 1HO3A 3EASA 5EI5A 3UMFA 1PEAA 2Q3MA 4ALIA 3PG5A 4Z9YA 1QIJA 1XVTA 4BCCA 5AVVA 1SULA 4EFKA 2EDCA 1NMQA 2W2MA 3ROQA 3T1OA 1OW3B 4MYHA 1E59A 5ICEA 1IN1A 1J8DA 2HK6A 3DZBA 2XQVA 4OHKA 4P93A 4EH1A 3CVVA 2PX6A 4Q66C 5J59A 3KD2A 1I4DD 5CAEB 4XUCA 5B7QA 2D1FA 2DUUA 2VAXA 3NW9A 4E7OA 3R4CA 3KBOA 1OX5A 3S68A 4CHGA 4FPXA 4GZ6A 5G0TA 4A10A 4EATA 2HDHA 4F6LA 4WBNF 2ATIA 3QOFA 4WY8A 4KUHA 4Y2XA 2IXDA 3BXHA 1T5OA 5AM3A 4DUZB 5JDCA 4NQRA 4YROA 2BBTA 4E22A 3D7MA 2QI9C 1P9NA 1BXZA 1M74A 4TKMA 4YJ2F 4CQNA 1FF9A 2CDRA 1RQLA 3K92A 5AT1A 4BO8A 4JKOA 4NZNA 3ZY6A 2NPIA 4K46A 3KSUA 4HYYA 3ZWYA 3KKZA 1KDRA 5D3KA 4OQMA 2YWHA 5L9AA 2NUAA 1YE3A 4WK4B 1XTUA 2BGJA 4CMIB 3T5CA 2KPOA 4JMPA 2CEAA 1PLKA 3CRNA 4F11A 1I7SB 1AA6A 5FUQA 1IXYA 4EHJA 1SCAA 1TJ3A 2VF4X 4C0AC 3A1WA 5C1BA 4JUBA 5EE3A 2HMWA 3OA2A 2AMYA 4CNQA 4DJ5X 1G5RA 3O4JA 3OOJA 3R5TA 1OXXK 2B4KA 4DL9A 1XVIA 5AHXA 1ECBA 4R3WA 5B7GA 2YIJA 2X8AA 1KYVA 1DKQA 3IVAA 3RRYA 2BH2A 3ZJYA 2G82A 2H59A 5K99A 5GPBA 3ZLJA 4L5AA 3B2NA 1L0BA 1TM1E 2XVMA 4UNIA 1M2JA 3ZXYA 3OEWA 4YLEA 4E51A 2PR2A 1EVYA 1Z5NA 4R8LA 2BVNA 3PC7A 1CUFA 1UP6A 1SBIA 2PGXA 4DLLA 1PQ4A 1QCYA 4I5DA 1QP8A 2ACWA 3CUSA 2EFYA 4WZ6A 4R54A 4TUYF 5FWDA 4KNVA 4OI2A 3AHFA 4Q7EA 2Q6LA 5ICCA 4DDWA 1ICEA 3S8EA 3LFHA 5A6SA 5EKSA 1ODTC 2F55A 2PGDA 1Q1QA 4BJ5A 4Y6PA 2O3JA 3VKWA 2VLBA 1UDAA 2QLTA 1KMMA 1LTHR 5IBPA 3TR5A 4ZP1A 4JVNA 3EDOA 3KL2A 1RHKA 4HMPA 4UTPA 1D7OA 3I9FA 1SXJB 4L8WB 3FJ1A 4QRHA 1Z5WA 2BM8A 1PJBA 1T1IA 1ZNXA 4BX3A 2Z0MA 1BWQA 4EHDA 1YHYA 2DKNA 2PUFA 3DW3X 1G2OA 2ZBUA 4JVLA 2PT7A 2CXOA 3W78A 2A5LA 2GF2A 4ENWA 1JR3D 2ZYUX 3LQ4A 5BWNA 5IDWA 4N8SA 4AUEA 3SHVA 3VR5A 4UZSA 2V58A 1KKUA 3IDZA 1C7QA 3UKJA 2V4ZA 2Q9BA 3FJYA 4G0UA 4KN9S 1QQTA 3GW8A 5CNIA 1V6SA 2N1BA 1WBDA 3PDUA 3GZ4A 4L9WA 1ORWA 2F3PA 1PQWA 1M6YA 3AETA 4TLDA 2A9KA 4HWRA 3TB6A 2ZRLA 4DNOA 1KEPA 2OAGA 2YVLA 3FPLA 3CURA 3WGUA 5A4KA 3T99A 4CQMA 5B7NA 1R3DA 1YT5A 1P81A 2WOOA 4RJ2A 3WMWA 2K7FA 1QCCA 1TMYA 4OFXA 3GPCA 3R5JA 3UKOA 3PX7A 3K4QA 3RUPA 1ZU5A 1WDWB 4F84A 1GZDA 2QPAA 1L5RA 1VL6A 3ISVA 2M1XA 4MPDA 2QV0A 3OTHA 3PNYA 3FYUB 4FGWA 1VZ2A 5ITVA 2HEGA 1QF7A 1L5VA 1TAHA 3IHKA 4L8FA 3EDCA 3V97A 1AF7A 2ZSDA 2AWNA 1VSBA 2QI9F 3EGCA 5A02A 3GFOA 1FUIA 1NJ1A 3OCCA 2FFBA 2PWZA 4PYJA 2C1XA 4ZARA 2QT1A 1V2GA 2QU8A 3BTSA 4DIOA 3G2MA 2ZIUB 4ICIA 5K6AA 2WNSA 1PG5A 4HFJA 1RYZA 3I1JA 4B3BA 1IJEA 2E1PA 3PHBE 3CWZA 2I67A 3T9BA 3OAAA 3UAZA 1D8TA 2Q3FA 5HE8A 4KH1A 2G9NA 3SDBA 2R6FA 4MGYR 1SCBA 1Q0UA 1U28C 1YB7A 1L5QA 3RK1A 2YJ6A 2XTAA 4ESHA 3L1VA 3ZCTA 4NKRA 4IJ5A 2O59A 3DLPX 3E81A 2JLQA 4FMPA 2A8YA 2YBEA 3JD3A 1W76A 3H5IA 2OHVA 4G84A 1Z0ZA 4MS3B 4QGGA 3RUHA 1WETA 2UZ1B 3TMAA 1SUBA 1WHTB 4QWWA 1S8FA 3IAXA 3HYRA 3V4RA 5ARDA 5EFOA 4PEVA 1T2EA 2NZVG 1ZRMA 3DGEC 4KTTE 2IU3A 2RIPA 3OEEA 1NBOA 2JCGA 2WA1A 4LOHA 3PCRB 3O8BA 3FUWA 4HFMA 4D9JA 2QK4A 3GLHB 1IQPA 2QLLA 1JLKA 3Q11A 2CLCX 4KXUA 1XDDA 2EC5A 1UBGA 3M3PA 1SUFA 1P0PA 3I6QA 4LECA 1KMHA 3BTUA 3JAWA 3G9TA 3I9V1 3SF8B 3TQIA 5L6LB 4AJ2A 1QKJA 4MDEA 3UHPA 3EMBA 3KAPA 4NX2A 4TQ9A 2DQKA 1RPJA 3L7JA 4ML3A 1AE1A 3Q72A 3U31A 3CLUD 3M3DA 1RFLA 4D0LB 1K7CA 4DLVA 1YZKA 3AESA 1EM6A 3GUUA 3H86A 4H17A 2HSWA 3OM9A 3CF6R 3FJOA 5ALIA 2XA1A 4H9GA 4A5OA 4N0DA 1Y7HA 3FYCA 1EM8A 4GU5A 4X90A 2NUPA 3OZAA 1XZKA 1VCIA 1TT7A 4KXVA 4EP1A 3U16A 1PJRA 5KYVA 2VCEA 2R48A 1F0KA 4E08A 4V1CB 1Q17A 4EHKA 4EZBA 2G40A 3SEZA 2ZS7A 4LPKA 2XKJE 1N6IA 3BIXA 1ZH4A 4WCFB 2E5FA 5FWAA 5THXA 4DQUA 4BBPA 3JQEA 2FG5A 5A4DA 5D2CA 2PHZA 3QBDA 1QWOA 2VJNA 4YFYA 2AOUA 1XZIA 5KQMA 2OCPA 2QUIA 4GVXA 2JJ2A 3HI4A 2P5UA 3CLSC 3VAAA 4MWBA 2FSVC 3GFQA 1AHPA 5HK8A 1RCTE 2XD4A 2WIGA 3K8ZA 4HB4A 3WHIA 3BMNB 3ZZ1A 3QEBZ 4KPYA 1JT9A 1PR3A 3LVFO 1HT2E 1DQYA 2CXQA 4PLHA 4WXPA 1EB9A 5BUCA 3VKGA 1RWNA 3C3PA 5FLEX 1MC4A 1Z7BA 1N7JA 4E3ZA 3B12A 4GHWA 3E15A 3H5NA 2JCYA 3LQRA 4QPZA 3UYKA 3WLKX 4AS1A 3AR6A 4FZ3A 4IIJA 3DHWC 1WBJB 5DU2A 1KZ1A 4BZWA 5CXUA 2J3DA 4B3DA 1U3WA 4NF2A 4V0MA 4EMSA 5JI2E 3NORA 3JAMA 1P2TA 4LF5B 4E1VA 2A9QA 3PIRA 3BB1A 4RV5A 2J5KA 1TK3A 1NLZA 2R7NA 1XTRA 1W25A 1UKAA 3SZLA 4RAQA 4NTZA 2JI4A 1QS0B 1OD6A 1UWVA 2R66A 4QUIA 4NFSA 3RFUA 2BFFA 3UBMA 5FWNA 4ISCA 3NVAA 3B60A 4GMKA 4YRGA 1SU6A 3TECE 1ZY2A 4D4JA 5C46F 3AVUA 2Z3VA 2ZJBA 3EGVA 3GT7A 2H08A 1MIHA 2PKCA 3LUJA 3NBFA 3PGVA 3ZLUA 4XXHA 1QAQA 1X2BA 3LIPA 3KJNA 4D45A 3PF9A 3PTZA 2JGRA 4BRWA 1PFVA 1MV8A 2NZUG 3U5ZB 4ILEA 2EKDA 4OJQA 2J3MA 5AK0A 3RS8A 3JRXA 2H8KA 4G0XA 4X8OA 1UKVY 1HH4A 1M1NB 1XHLA 2JAXA 1M1UA 2Q2VA 2Q3EA 3C0KA 3EE6A 3IQFA 3UOGA 3EVZA 2H06A 1EK6A 1XD2A 2FVYA 2D2EA 4GS5A 3ZYZA 4CFSA 1KQ3A 4EG4A 3R1IA 3RIXA 4RTKA 4M9XA 4DA4A 4TZKA 5L7YA 1H3NA 1I2AA 1ZGCA 1OI3A 2OBFA 3JYLA 2ZULA 5KWEA 3EQ6A 1G6HA 2NT3A 3QYPA 4IV5A 3JQCA 4R5HA 1M5RA 1TTPB 4JLSA 1YFEA 5H02A 1E2IA 1LQTA 4Q3DA 2PKWA 3ORRA 3OOYA 4OBWA 2Y1GA 3GK3A 1L4BA 1T8TA 1LSJA 2PT6A 4PZZA 4V2IA 4ER0A 3MB8A 1G64A 4WUTA 3F7TA 4MP6A 3PEYA 1PT8A 2OFXA 2Z8YA 3C3JA 2RHMA 4B3RB 2WIJA 4PQYA 2QRPA 4J0CA 4LJ7A 2VT6A 2JF0A 1M0WA 3HYSA 4QPNA 4E7PA 4X54A 4IM7A 1YL5A 4P7KA 1CUUA 3PFKA 4R84A 1L1FA 3WRXA 4CDRA 3EVAA 3BSFA 4D3XA 1L7DA 3KOMA 4X94A 4BOYA 4EPTA 5CVVA 4NU5A 3MZ0A 2O0LA 1QKKA 1R8QA 2BFPA 3PNMA 3QE2A 4CIBA 1JFFA 1CEXA 2O0HA 5DP2A 2ONKA 3EY9A 2WJPA 1JW9B 2FRXA 3QZUA 4U4AA 1K8YB 4EF4A 5KDDA 5KREA 5FT9A 3TSZA 5ED4A 5DGIA 3ESRA 1NRJB 4H6PA 5F92A 4RABA 1D5CA 3SYNA 3G1UA 3MOSA 1GPDG 3K7EA 4YQZA 1POXA 1SQ5A 1R8YA 2F64A 1SOWA 2NXJA 3I72A 3NKLA 1K3FA 3SYKA 5CK4A 4LVOA 3W79A 5DN9A 3A6JA 3KOZA 5DIFA 1PJQA 2BZGA 3UT6A 3U6BA 4DV1B 2RI1A 4G5SA 2WC1A 3B2EA 3IPCA 1RAHA 3FD8A 1RXEA 3OZWA 4C4ZA 1RZUA 2FSIA 3L79A 3K9WA 3DT8A 4L8VA 4KR7A 4UM8B 1DXQA 1GUAA 1ONPA 3MCAA 4EHIA 3IPXA 2GTIA 3MLAA 4RD3A 3OIGA 1QGAA 2FJPA 1M34B 2ZFUA 1BGXT 5G1OA 2JEYA 1W0KD 4KLCA 5B2ZA 5HE9A 4DV3B 3KQNA 3LUPA 3ANSA 3PKIA 1O89A 1R5BA 2FF5A 3NBUA 4KL8S 3C3MA 4E03A 1Z2AA 4NP6A 4LXTA 4L22A 4DV6B 1CIJA 3OFND 3EUFA 3KFXA 3I92A 4KFRA 4PG5A 4BZPA 3RVLA 4B84A 4GSKA 3TE7A 5BVHB 4CEIB 4RK4A 5KYXB 3AFMA 4I1PA 3B48A 4P84A 2V3VA 5EJ4A 2TRSB 2ORED 4KXQA 4QTUB 2Q5HA 3Q0EA 4HNTA 1U4NA 3SC6A 2YWJA 1MEJA 2ZXFA 2AHRA 1NTOA 3RW9A 5C52B 4QUKA 1E2GA 4EYQA 1GL7A 2YVQA 4OOEA 1EP1B 1KKLA 1YI8A 3SICE 3X1KA 5C3UA 3ZTYA 4LE0A 1P7WA 1WX1A 3A4MA 1X7XB 2H4ZA 4MTLA 5B30A 5JBQA 1EP3B 4BGIA 1CZLA 4BMYA 1PE0A 1WNTA 1ES9A 5DYGA 2HOQA 5BV0A 3ERCA 2AJLI 1J99A 1FOEB 2P2CA 2DR0A 3O8NA 3R2JA 5T4EA 1HDXA 4BKRA 4INAA 1IVNA 2B7LA 4R05A 1TGYA 1OI7A 1PX0A 4P34A 4PZDA 2Q46A 3U4GA 2R1ZA 1DP4A 4A73A 1OT3A 3RJMA 5EXDA 1X7HA 3AHDA 3WIEA 1W49A 4EA6A 2O8BA 2VDUE 4AP9A 4M21A 1A2BA 5J47A 2PUEA 1C8VB 2IF0A 5A9TA 4H16A 1P9LA 3H5RA 3BK1A 4KQGA 4WCVA 5CDFA 3SHQA 4QJIA 2LIVA 2R1VB 3V1TC 3L4SO 1RSZA 2DHQA 3N2YA 4BGVA 3LY7A 1O5TA 4YAWA 2ZDQA 1EFCA 3I37X 2G72A 1CJBA 3FWZA 1ZGHA 3KSZO 4BJ3A 3TR6A 3UN1A 1DFGA 1SXJE 1YS6A 4ED9A 2I7DA 2J9YB 3VH3A 5A5GA 1NYLA 4IIUA 4G65A 4PTLA 4BKOA 1UBEA 4GMDA 3ROXA 1CRQA 1YACA 2REXB 3LT0A 4PZCA 1VSTA 5HKBA 2B98A 2R65A 4MB2A 1UBSB 2B3TA 1KBZA 4X91A 1GTSA 5BYAA 1T13A 4UARA 3BDIA 3AR8A 3MERA 5DXJA 5K0NA 1XL0A 2QPOA 2WMYA 3RVMA 1F5SA 4D9HA 3T06B 3L4JA 1DADA 3WFZA 4Q6WA 3N39C 3H2HA 5A0FA 3UGJA 4CMEA 4WY5A 3MJCA 2X15A 4RYLA 4BO1A 2REQB 2WTBA 1TCBA 2YFKA 1M73E 4MXDA 4Z0PA 2ATCA 3IRVA 4YXWA 4X71A 1SBYA 3O3MB 4Q19A 4A8PA 3KJIA 1Z6YA 4UVIA 1KJ8A 1ZHHA 1I2BA 3H1EA 1LC0A 5JEDA 4I19A 4U2EA 3F1KA 3MUFA 1D04A 1PT7A 3I8SA 1PJCA 3GFGA 3NRJA 4L72A 4PM4A 2BJWA 2H1OA 4C6HA 3ZHOA 3JYOA 3WLSA 2DLNA 1HTWA 1PGPA 4CTKA 8GPBA 3EFOA 1OX6A 1AXEA 3OZRA 1EE9A 1CXZA 5E4TA 4F97A 4S1PA 1IULA 2DFLA 4EKDA 1QJCA 3IQXA 3LNCA 1PFQA 3VPBA 4HVCA 1C2TA 2IZZA 4OREX 4I1OA 2E37A 1T36B 4Y6LA 3RBAA 5K0CA 4B5LA 2LKCA 5IM4F 3HVJA 2VHVA 3EQ2A 3KKQA 3MJFA 2OXRA 5BO5A 2XMBA 2I8CA 1UR5A 1U0EA 3I2JA 3KFLA 3AJDA 3NZEA 3RYTC 3MTQA 4MIEA 1Q11A 2FUKA 4Q1AA 5JAPA 1MAAA 1NNI1 3EARA 4G01B 4R1PA 3L0ZA 4DJTA 2G25A 2O23A 1TW3A 3D4IA 1F8YA 1N2SA 3DBHB 2R11A 3OLVA 4QZVA 1XZGA 1M6VB 2YVKA 5TDHA 3KSMA 1NBMD 3RSCA 3P9ZA 1RP1A 2IHJA 2Z09A 3ZWVA 2O5VA 1USIA 4UEJA 4CMKA 1U0OC 5J2TA 5JRZA 3I5XA 4P5PA 1S8OA 1IEWA 1A95A 3QUAA 4ZTZB 4AU1A 2VC2B 3CJQA 2PXCA 2O7RA 3AHIA 3K09A 4II3A 4JR2A 5JATA 5K05A 3EBPA 3UG6A 2VHWA 1LPAB 3A27A 2EW2A 3EOAI 1RWVA 3G9XA 1HSOA 4FZ5A 1U8CB 2LTAA 4TTQA 3W5IA 4BQPA 1VL2A 2X8LA 3QI7A 4DZTA 5IG2A 1CERA 1NJ8A 3GLHE 1TJWA 1RBYA 1H85A 2BP7B 2FP3A 3GGGA 3A25A 4URYR 2BLNA 3HADA 1NXSA 4C4XA 1HA3A 3CEHA 1L5KA 4URHA 2HPVA 3O8QA 3K70D 5LMCA 2NUTB 5CDTA 2ZYRA 1L5HA 4FWTA 4E13A 5JPDA 1ZJWA 3GIDA 2YIDA 2ANCA 1NW3A 3A28A 2SECE 1BWRA 4D4IA 1IVYA 1UOQA 2NPFA 3ADOA 1II9A 4M9UA 2EFHB 2IEGA 2BKUA 3HKDA 5IT5A 2VSFA 2IUTA 1USVA 3IJEB 3HACA 3KAJA 1GR1A 2AJ8A 2YS7A 1G6KA 4WY2A 2QRGA 3UA3A 2HUPA 1PEYA 3F2IA 3TNYA 4BLSA 2M32A 1E0KA 2P2SA 2QXYA 2R8OA 2VDOB 3JSXA 3PFGA 4LGVA 3ZHQA 4JB8A 1G60A 1JXMA 2J87A 2GBLC 2F1KA 2WKRA 1AKTA 1QYXA 4FXOA 4HUTA 2IELA 2IE0A 3WRVA 4JQSA 3PCXA 2PXHA 3UG7A 4B09A 4CKEB 4KBGA 2GZSA 1Z7YA 2PS1A 1YJAA 5D5HA 4YBZA 2UXDB 1MAWA 4ND8A 3C15C 2DCUA 3C5HA 4OGWA 3KUXA 2A78A 2GETA 4I55F 2HAEA 4GPZA 2JGEA 5JCJA 3GLVA 3U9SA 3IE2A 1BCRB 1EB8A 1JEOA 4DLUA 3B1JA 3OPYA 4BNHA 4ZHQA 1DFHA 2CK3A 3C8MA 4HAXA 4LFBB 1PL0A 2QRVB 1A5ZA 4R3NA 2FEAA 2WJVA 3N74A 4LXUA 4UE2A 4EGJA 3K1AB 3A70A 1E7MA 3JD4A 2YJGA 4UHJA 1EXNA 4XWAA 4ZHSA 1UXIA 4F96A 3OTQA 4ENVA 2VYQA 3R3UA 2PQ2A 2DQYA 5T8KC 1ACMA 2ZJ1A 1NVFA 1V37A 2EKLA 5CDSA 4LRYA 3Q0TA 4FGJA 4TXNA 2V96A 1XU4A 3GFBA 3CE6A 5A4AA 3THRA 3B1ZA 2PLNA 2QRMA 1MG0A 4Q1DA 2QP9X 2VJKA 3KQVA 4CI9A 2R2GA 1NYRA 1XZLA 3CUYA 3PX3A 4CTOA 1P4RA 4OK3A 4DZRA 3USZA 3IDSA 3QKUA 3OIWA 4M1KA 4Z99A 1XZMA 3FKJA 3U44B 1G19A 1Q7CA 4N3BA 2OP0A 2JFYA 3HJRA 4BQSA 3RIEA 4BVEA 3GRRA 1OYVA 3G7NA 2EAUA 4QVGA 2LCIA 1ZDMA 2CVPA 3HVKA 4R98A 1XQ6A 1XKTA 3ZY3A 4IIVA 4B3HA 5C7OO 3T5BA 3I1FA 3GRPA 5JAHA 3GP5A 3TH5A 4J1QA 3OHPA 4HGPA 4JA2A 1U0NA 2B4YA 5B3LA 4JJ7A 1QE3A 5JR3A 1V1MA 3OOEA 4GGPA 1RAAA 3L77A 1QMPA 3RRZA 3VYRB 2VQDA 1O9HA 1SQFA 1Z5UA 3BJIC 3PHLA 1NRIA 4MUMA 1NE2A 3QXCA 5E1DA 4BE9A 2ZRGA 4N65A 4EEKA 2GVNA 3NEYA 4N7MA 4P22A 3FRIA 3IKMB 1ISHA 1V3UA 3OFSA 3RM3A 3KIPA 4S1VA 1CEQA 3L8YA 3HO6A 5F35A 4ZU3A 1M8GA 4FB4A 1S8NA 2YN2A 4Y8VA 1G1MA 1SCQA 2R85A 4PZLA 1Y3DE 2D2IA 3TTWA 2EGGA 3SQXA 2Q6TA 1WUIS 5K1ZA 3LF2A 2QZ9A 2NZ8A 1MAVA 2VBFA 3GEBA 3H7AA 1MBZA 4S3MA 4CLOB 3ABRB 1AUOA 1QNFA 4OM7A 3OQPA 2CB9A 5F73A 3NIGB 2WYOA 1BAPA 1QAMA 4L78A 1AZTA 1LZLA 2ZDGA 4UHKA 3AU9A 3KVVA 5LLDA 2AEMA 3I6BA 2O3SA 3CVUA 2R8ZA 4TRNA 2VHEA 3PR3A 3H3JA 3IEPA 2GASA 1VKNA 3EUWA 3FDJA 5FADA 1SBHA 2A88A 4D3FA 2QG6A 2Y0PA 2EW1A 1WLSA 1NRXA 2CN1A 1UMBB 1E3DA 1UWCA 2XCLA 3QVGA 4MA4A 2WWRA 1K4YA 2VHTA 4IOKA 3UJCA 1AGPA 1OX4A 3LVBA 3EIXA 1N2JA 3KPVA 3T3HA 3ZE7A 1CUIA 2JIRA 1WU8A 2IH4A 1YFKA 3Q3JB 5F76A 2JBHA 3FUXA 4L9RA 3I09A 4EJSB 1P17A 1KNQA 3WL8A 3I1IA 2FSFA 2X3FA 5CA1F 5LPNA 2Q27A 4CT4B 2PUVA 4DYVA 3T95A 2O8EB 2ECPA 2XADA 3E2IA 4AY6A 3BH0A 5G4KA 1DWPA 4HJRA 2VPXA 1EGAA 1LI7A 3ELWA 2XB8A 3BRSA 4O4IF 2FSUA 4A3SA 4CG1A 3BHJA 3AM4A 4WBXC 4QQKA 1PFWA 1Z75A 4Y0NA 4X41A 2J5XA 1XP8A 4IIFA 5F5LA 3D8UA 1KFEB 3K9FC 3UXHA 1H05A 2HKIA 2PLWA 1AGNA 1MH9A 2OQ2A 1BROA 2YR0A 3KR2A 4TQUS 4NCAA 4DQKA 2JIZA 4KCGA 2PZEA 4KGZA 3G5TA 1T8UA 3WTBA 5GONB 3ZNQA 3TKAA 4E6PA 1JEYA 2DRIA 4IICA 2AYZA 3RRMA 4RHUA 5KX5A 3S2IA 1ABFA 1U7PA 3AV3A 1YL7A 5TQJA 1G55A 3VISA 3AEKB 1SBQA 3E2MA 3EC2A 1RJ9A 4ABYA 3CBQA 2ZB8A 2RIRA 4IXNA 4EPRA 5J3JA 1HNWB 4FOOA 1IPFA 1DAGA 1QVRA 3AR2A 1L7RA 3V7WA 1OFTA 3VA7A 3HCRA 4DG9A 2ZSFA 4LNUA 3TD2A 3FAZA 4IOJA 1NJ5A 1CQPA 4EY4A 2G4VA 3P97A 4D3YA 5JASA 1NXOA 2ZJOA 2VTKA 4NMMA 4BL5A 3KD3A 5KU7A 4LZOA 1XCGB 2VWPA 3AZPA 3K4HA 4QE3A 2NADA 2P78A 3QVUA 1UQTA 3DL4A 1FNMA 2JFOA 3AONB 5JWRA 4G4IA 2RBEA 1BXGA 1NNUA 5CLFA 3DFIA 1CLEA 1XLTC 2R5WA 4L6AA 1V8DA 4YBRA 2I9KA 1TECE 2O3UA 4QOSA 3TNLA 3RUAA 5LIPA 4HEHA 3PFIA 5HOEA 2JLUA 4MUNA 1ADYA 1SZPA 1XALA 2O48X 4H0CA 4IP0A 4MS1B 3QGMA 5FI1B 1ZSNA 4WKOA 1DTWA 5CPBA 3KKLA 5ECGC 1D6SA 3SJ7A 1JR3E 2F9FA 2BR4A 2ZITA 4GGMX 3LYLA 4QFCA 5AJYA 3KETA 3WMXA 1V4BA 4TSFA 5H82A 1J90A 3V55A 4EITA 3GBVA 1K6MA 1PIWA 5GM1A 2WPDA 5BYKA 2FPSA 1RYYA 2IPXA 1XV5A 4O29A 4QL3A 3PQ8A 1I36A 1GYQA 1E2LA 3BMCB 3UMCA 1F8XA 1VYVA 2I8AA 3C3WA 3LDGA 1IE3A 4GP6A 4UHDA 5EZYA 1RZRA 1T1EA 2GYYA 4D4HA 2VTBA 1Z6AA 1AGRA 1SU4A 2EBWA 3GFFA 2BL4A 3JTEA 1MDFA 3MWJA 2X3YA 1GGNA 3GFPA 1DCFA 4EQ6A 4Z8XA 4CEHB 4JODA 4GWKA 1YF3A 1V95A 5M29A 5JNWA 1YXMA 5CB8A 4NPCA 4P4GA 4YLGA 5TMDA 4JXZA 4OGLA 2EX4A 2XYPA 5HMMA 2MT9A 4B2YA 4G0QA 3AEUB 4RHEA 5LP6C 4HQFA 1YFZA 2HH9A 4JQOA 4QPJC 1KRXA 4NEHB 4CKBA 5ADHA 4O4JF 1JDZA 1G41A 5FA6A 4MWOA 4HC4A 4ALNA 4QOGA 2ZCJA 3UT5B 3I5AA 3WBJA 1XWIA 4UC0A 1VG8A 1N0VC 3CUVA 1QB8A 1R2QA 1NJFA 1SCIA 2IHVA 2QZJA 3OTIA 2AN4A 4H7PA 4LJLA 3UAGA 1Y80A 3MELA 1RIIA 3CG4A 2XUHA 4J1TA 3TIFA 3BMOA 2H5IA 1O95A 3H83A 4PIPA 3WLOA 3ZW7A 2WLTA 4BMCA 4DLKA 1VPLA 1ECLA 4V0NA 1R66A 1Q0PA 4RZIA 4ACAA 2ASEA 2UYCA 4TYWA 2RCNA 1XIVA 1QCZA 5I9SA 3VR5D 3D6FA 3ZQUA 1FW6A 3EFEA 3T5AA 3C3YA 2X8WA 1EJ2A 1VPTA 5BV2P 1B73A 3NC4A 3VDRA 5IPFA 2UVQA 3IKTA 1W35A 3QITA 1N34B 1STOA 2FP4A 3GWGA 4XR9A 5ESRA 3EPPA 3HDTA 4YAKA 4Q1FA 2O2JA 5IVPA 3LP8A 3VH4A 1ISFA 4GBED 2A4MA 4R1LA 2I7XA 1O0BA 3QXSA 1LKZA 2CV2A 2X7XA 3DMHA 3H19A 1RWQA 5DRTA 3D3WB 2JGLA 1QANA 3VDMA 3NHAA 4WNAA 4DV5B 2CNDA 3VX4A 4HGZA 1XTBA 2BFDA 4H59A 1EK2A 1JPJA 2R7MA 4KIFA 5DWQA 5FTJA 3RVOA 3DZKA 2LP4Y 2PS9A 3SZUA 1A98A 3FOZA 3R44A 3SU8A 3U4MA 1J22A 1MT0A 1EK1A 3OCFA 1A5SB 1NW7A 3AKEA 1JWLA 4EW1A 2QRUA 3EC1A 5H0IA 5HDQA 2IS4A 3MAAC 4QULA 1JJFA 4CKXA 1L4EA 3GN2A 3IQEA 2IGBA 4BU0A 1D0IA 1RYNA 3L1KA 4G2NA 4ETIA 4B71A 4J4HA 5KU1A 4QICA 4FT4A 5HDBB 3KQHA 4K05A 5CLGA 2X6TA 2FV8A 3PDWA 1N2BA 3LX4A 4O2BB 1CJKC 1JDTA 4UBJA 5TRTA 4Y2QA 2QN3A 3OAAD 5K0JA 1QIGA 1J8VA 1H2ZA 1N6LA 1P77A 3O2NA 4IDCA 4INOA 2WJIA 4AG5A 2G76A 2V59A 2X9LA 2X86A 4OMUA 3E9EA 1EJBA 1BFKA 1O6CA 4WE3A 2GKGA 4YDQA 5ICSA 4TKVB 4RA9A 3FOWA 1QFXA 2QB5A 3KU1A 1DZIA 1FTNA 2X0NA 5DYTA 3VPSA 2PSEA 2XUQA 4X9XA 3V1YA 5JU6A 4YO7A 1Z29A 3OQIB 3BL8A 4R0MA 2O2CA 4G0PA 3OEED 2WYHA 1TD9A 3F6SA 2H07A 4RTLA 1FX0A 3QE9Y 3ABOB 4JUAA 3OTWA 3R6LA 4E12A 1YNSA 1OE0A 2IYAA 4W82A 3QF4B 3T6KA 1N8KA 5EJGA 2NU7A 1V8OA 5LP6F 4TZ6A 4M99A 1LVUA 3CA8A 3O3OB 5AKIA 4JR1A 4I2VA 2J0UA 4C7OB 2LV8A 2CV1A 1Z2DA 3U4CA 1JMYA 1KHHA 1BW9A 4OK6A 2UUBB 4BLTA 2OCXA 4XCQA 1ISJA 1H93A 2NTYC 1DWOA 2I5PO 2GZ3A 3P2MA 5HBGA 2ONJA 5KOJB 1UC9A 4LOAA 3EPHA 1ICIA 4L57A 2C94A 2D0IA 2ZIXB 2J45A 3NVMB 3ZNNA 3U7GA 4P3XA 1U2SA 1Z4PX 3ILHA 5IM5A 5FAXA 4DQ0A 2FWRA 3BVPA 5FBVB 1B6TA 1E2FA 4NCXA 5LMUB 5TPWB 1DPFA 1T5BA 1K89A 1PWZA 2B9VA 4N03A 4CUZA 2DPMA 2JJ2D 5B5SA 4N54A 5KYGA 4Z3KA 2NGRA 1L7PA 3UENA 3B52X 4NY1A 4IDGA 1XA4A 2AFVA 3C87A 1T4DA 1NVDA 3FYDA 2ZAOA 1OPXA 2V3CC 4EPXA 4H1UA 1CU1A 2YWGA 1IYZA 1GVNB 4IIGA 4OHCA 1DU4A 4GXNA 1UEXC 1VMKA 4YX9A 4B43A 1EUDA 4W8HA 4OYYA 5DI3A 1SCJA 4F72A 4Q9LA 4RWZA 2PFKA 1U8AA 1TGVA 2GAJA 2O2EA 3D6NB 3K9QO 3RS5A 2WAAA 1NDHA 2VT3A 2ZR8A 4M22A 2QYTA 3RSOA 2C5SA 3LK6A 4J6EA 1U8EA 4RZQA 3RAJA 4MR9B 3EXFA 3A2NA 4AO7A 4DT1B 1FTSA 5K09A 1UJBA 5AVJA 5C8ZA 3TRHA 2NX2A 1E9VA 1OV4A 1XCBA 3ROKA 1MORA 3RF6A 3FOFC 3BXPA 3EZNA 4DR2B 1W36C 2NO0A 3PTLA 4YP5A 1P6XA 4WBNA 3TWOA 1E61A 4JVSB 4Q9DA 3N76A 4PSDA 3NLLA 3RJ5A 1X7WA 4GFDA 2OGSA 1N2HA 5CB4F 2C95A 2I2CA 2OBMA 4ID3A 4EUFA 2ZRCA 5CVUA 4YJ2A 1MKYA 3HJTA 1IB0A 1CFZA 1FFSA 2AMJA 3PXXA 1NI3A 2COEA 3MTAA 4I1UA 4M38A 5CT9A 5FB3A 1YRQA 3UWPA 3RS4A 4R6WA 2JPDA 2HUNA 4HPXB 2F3SA 4C7KA 3EB9A 3ORFA 3T0IA 1HETA 3S2SA 1W2WB 4NDAA 4IHJB 3K6SB 1QU3A 4ECEA 1NR7A 2JHCA 4H6WA 1U2TA 1BFDA 2QGFA 2J07A 4F1WA 3PQ4A 1WCIA 3AKZA 4F2GA 2C84A 2NO6A 5KSWB 4B2PA 1XNGA 2ECKA 2JCXA 3SPXA 7MHTA 2V03A 1DKLA 1X7YA 3KR9A 1VECA 4QTTB 4RZUA 1REQB 4J4TA 3C8TA 3PVSA 5BQPA 4HDSB 4ZV7A 4P83A 2Q62A 5JW6A 2VZ8A 4R69A 3SCZA 1OXTA 1R88A 1OSNA 3K30A 1ZW1A 1CUBA 2WVAA 2O2GA 3BGIA 3GJ4A 3N87A 1X1SA 1YJ5A 3VR2D 5J1SB 2WWWA 5EHQA 3ZZUA 1GU0A 2GZHA 4TUYA 5JARA 4AJJA 4PWYA 4KXWA 2YYZA 4DMMA 1P7ZA 3RABA 3AQ4A 2ZSKA 1MVNA 3DZ8A 1IEVA 1NLYA 3A9WA 3LUAA 2P7HA 4GOKA 3C6YA 2C78A 3G2IA 5HTKA 4OSPA 3ROEA 2PY6A 2IX9A 2ISCA 1BX1A 3IELA 3LLVA 3VC3A 4NCBA 1ISMA 4EFDA 4YTEA 1FU8A 1PSWA 1QIHA 2H31A 4PZEA 3O1JC 2NU9A 1QX4A 2IE8A 4C01A 3CZAA 3T1YB 4GE3A 5L3VA 1E9FA 3D2AA 3EIEA 3LXRA 4X3OA 4FKBA 2C9ZA 1VQ1A 1E6EA 4LVUA 5J9FA 4BNVA 4R71A 1TFUA 1ORDA 2NZYA 4OGGA 3VXKA 2HLNA 3NEJA 3K72B 4J8PA 5DCUA 4AZSA 3LUBA 3GMIA 3PX2A 2H0AA 3CW8X 5HFNA 4NH4A 1V3QE 2HXSA 1OFUA 1ORRA 5KKNB 3Q3CA 4OMDA 5DOZA 2O8DA 3RROA 2WAMA 2W37A 3GU3A 3O0DA 3P1JA 4Y2HA 3UMJA 3SZOA 3V32A 5MF6A 3RSLA 4Y6QA 1YZYA 3EWIA 3S2FA 1K75A 4MULA 821PA 4F4IA 1QTQA 4B4VA 1R6AA 2K87A 2O8NA 4ITRC 3H42B 4TTPA 3KVNA 4TXMA 5ITSA 1C81A 5C9ZA 4AURA 4DMRA 5B6JA 3TDKA 3E23A 2PKQP 3ZZTA 2Z58A 5LLTA 2RHLA 4HDKA 4K9PA 2XMGA 3EEYA 5HKAA 3Q8MA 4P36A 1OGYA 5DBOA 3FFTA 4BEWA 1H8EA 2FETA 4S0XA 5KAMA 3EXHA 1VE9A 2I55A 2OL4A 4G07A 4IQGA 5KSOA 2J3LA 5JG7A 1HYBA 1P0FA 1ENZA 1MQAA 2PS3A 4FYKA 2WHEA 4KR6A 1BOOA 3TX6A 4A2CA 5BWLA 2WJGA 3NUZA 4KQMA 3E48A 3S8YA 1JS1X 1H2HA 1KYYA 3PI6A 4NG5A 1HNNA 5IW8A 3ZV7A 3L6OO 4BRZA 1B43A 3GRUA 5AVKA 5LJLA 1E96A 5EZQA 4EGAA 4V03A 1CUCA 3STHA 4IJMA 1KR5A 3N2EA 1TA9A 1D1QA 1XU7A 4ESOA 5I7HA 2IXEA 2C4VA 4G9GA 1T2UA 3NIBA 4RE5A 2CUNA 5ER6A 5BSVA 1XO1A 3OPQA 3OLQA 5JANA 1T9GS 1BN7A 2B3DA 4NPAA 4LY3A 5ECYA 4F12A 2C61A 3L7OA 4ZK6A 1LF0A 1YFLA 2UUAB 2O1SA 1VE1A 5BSKA 2DAPA 4KQ9A 1J9GA 2PUWA 4DE5A 4JUIA 4BFTA 2RH9B 5A6SB 3ONVA 1H1LB 1ZN7A 3CT6A 3GZTB 3KXIA 2VPQA 3WX0A 3KP1A 1TA0A 1HFKA 5K8CA 4LK2A 1YA8A 2FDRA 2YV3A 3N3AC 5K45A 4Q24A 3W5CA 1LVGA 1YKFA 5HZMA 3MMXA 2B4RO 5TXGA 3JZIA 4CF5A 1N5IA 4REQA 5IJ9A 4KMRA 1TNDA 4EUEA 2FMXA 3S1LA 2C4HA 5FOSA 3FPGA 2F4NA 3CE9A 3RWBA 3G0OA 4BNGA 3L8GA 5HKKA 3BERA 4YEDA 4B32A 3FPHA 2DB3A 1OLXA 2YOHA 4F5YA 3LQFA 1BN6A 4YH1A 4DBZA 1GG5A 1UZAA 4BFCA 3A36A 3PWZA 4DAEA 2GPSA 3WGQA 3EJ6A 3OZSA 3NHPA 4QEDA 5JE8A 4MPRA 1OXSC 2W4IA 3OP4A 3W8DA 3VTAA 4AYTA 1RWMA 5ERGB 1I3LA 5FO0A 1ZNZA 3BSYA 5JAMA 1FW8A 1C3VA 1NBME 3DR3A 3GGCA 1P74A 2PYIA 3H8VA 3IUPA 3Q98A 1CX9B 2Z1NA 3G82C 5AKLA 1JG7A 5EWLA 5L6MB 4BYMA 2ZBPA 4DR5B 3UMBA 5JS2A 2EBHX 3LYAA 3IOEA 2P2YA 3WLJA 2EEZA 2Y0DA 1U0RA 3OJLA 4CQMB 3VO8A 1QLWA 4XJSA 1X7GA 1M10A 2X13A 2I4NA 4DNFA 5JPIA 1GCOA 5F7OA 2WV9A 5LN1A 2OCYC 1T9GR 4S24A 5ITZA 4P2GA 3ZBUA 1OZGA 3KHKA 1B14A 1RFGE 3PI7A 4OLJA 2P1ZA 4PRZA 1SAYA 1TK2A 4YXWD 2EL9A 1KOLA 3IBFA 4OJYA 2CUKA 1XDBA 4ESEA 4EUKA 4YT2A 5JQGF 1E89A 2ZUCA 1WB4A 1A9TA 1C8BA 1WWKA 3IUNA 5FPSA 4RCZA 3PTAA 5AKGA 2IH2A 2Y71A 2D0PB 4I3GA 3DP7A 3JSAA 3CVWA 1ZNQO 4IL5A 2C2HA 2JKVA 4TTSA 4DIMA 3RSSA 2XNSA 3G1WA 4RDXA 5F77A 1CR2A 1PI3A 5LB4A 1JIXA 3QE0A 4J9UE 1AXRA 3HUFA 4P6VF 4PHHA 3KZKA 1QHHB 1P62B 3HBJA 3L9WA 2WD9A 2C2XA 3OWXA 5DSZA 4YRIA 1FFXA 3BD9A 4KIUA 5HFAA 5BRJA 4P4SB 2YKGA 1Y48E 4CF7A 2B8JA 3CTMA 2A14A 1DJMA 5CLHA 3CLRC 4RH0A 1F2UA 3A04A 3AM1A 4DPLA 1DC6A 4PZ0A 3KQTA 3SXUB 3L40A 1GQQA 4ZO6A 2RKOA 3B85A 3JQ6A 3B82A 4BLQA 4BVFA 3HKCA 3N86A 4BO2A 4D4GA 1AQYA 4YVFA 3JZFA 1G5QA 2X0EA 3E61A 4WZAA 3QHAA 4JI8B 2X0JA 1GQ2A 6CHYA 1EFLA 3AP3A 3AF6A 2PG3A 1N2CB 2NXEA 3AR4A 3D43A 4QU9A 5CDUA 1AK1A 2W2QA 4IPTA 4JDUA 1U28A 2A5GA 1KMHB 2G9UA 2QLFA 3D6AA 3JAWB 4NMXB 2GWHA 1GGKA 1HDIA 5FHQA 4BNXA 2XB2A 2RHCA 2CLSA 4NE7A 3MEQA 2OR3A 4CT5A 1X94A 4Y2RA 1RM0A 2Y92A 5A3QA 2QW0X 5JO0A 2QNRA 1T24A 2ZRMA 3AESB 1TCAA 1IOZA 4UM9B 3BJMA 4I50F 2E4VA 4X8HA 5FUWA 1WXXA 4XX0A 4AKGA 1KVTA 4FX5A 1TYCA 3R0VA 3GZHA 2NUPB 4BWYA 4AYXA 3AVXA 1ZBQA 3QVJA 4IH4A 3G13A 3LX5A 5B12A 4M7PA 3THYA 4TM8A 1ZRSA 1GRCA 1E6MA 1NVVQ 1T4GA 4YIHA 2QTZA 3WR5A 5LXTB 1LSUA 4Y6OA 2JLBA 1H0RA 4MI9A 1AO0A 5IT9A 1XTIA 2I6UA 2BMWA 1L7MA 4ZVNA 5K0LA 1E2QA 2HBZA 1Z4OA 1DI0A 1XKXA 2BHLA 3MJ4A 2CL7X 3PXGA 2FSHA 2OPBA 2GJ9A 2DQSA 3FYUC 2G7ZA 5AP9A 4D98A 1Z8HA 2MR6A 5I9LA 3OUUA 5FI0B 2FEXA 2Q41A 1G3MA 3H99A 1CDDA 4G0YA 2ARKA 4IVNA 2I3GA 3CJRA 2BUCA 2EZ8A 1UINA 3TZ6A 1UQUA 3PNKA 2FTKE 3O8LA 3PJFA 1C9NA 2GS9A 4M1EA 2Q7OE 4AWBA 3SC2A 4C14A 2HU7A 1ODKA 2MDTA 3LV8A 1JALA 4IIJB 4OA8A 3VZRA 3MXTA 1CEYA 5AVSA 5CG2A 1SB8A 1AVTA 1OC2A 2VF5X 4ERXA 1OH8A 3EQ8A 1XEXA 5KYUB 3IHWA 1M54A 2DZDA 1KZYC 4QGFA 2FSVA 4YRMA 2QTCA 1U31A 4RJLA 1JLLA 1AZSC 2H54A 4C0LA 3RAFC 3FM9A 4MLPA 4QG7A 4EGQA 1BH6A 2NZ2A 3ZWCA 2JGDB 2P9HA 2BFFB 2QLMA 1ZOPA 1E2UA 4R2WA 1OLSB 3VPFA 2IA5A 3PQDA 2HMVA 1RCFA 1K9VF 3N3BC 1SIUA 2CK3D 1NUHA 1JAIA 2Y6UA 4RU1A 1D3AA 4PS1A 4J94A 3OE7A 2GARA 5J40A 5JAQA 2CE2X 2LKDA 2PN1A 3QLUC 4GOND 3PWTA 1MB3A 1B42A 2PZ8A 4OHXA 2QIPA 3TLKA 2GD1O 1NXTA 3ZXXA 1MZPA 3PXCX 1CW2B 3VHLB 2RAFA 4K1LA 3RC1A 1I51A 5EQDA 3WK9A 2G6TA 3FOAA 3Q6IA 2JIQA 3KG2A 1XD2B 4U3JA 1Q92A 2OCDA 3WB1A 3NEAA 3WBKA 2ZK7A 1LTKA 2FH5B 2QWXA 3Q7QA 1PYDA 5DX1A 5EIBC 2ZXEA 1IPEA 1YZ3A 4WOCA 1T3TA 3QKRB 5NULA 2JEZA 2XWBF 3TQQA 3ROFA 3GJ8A 1YJQA 2ZVDA 4QUBA 4ZRMA 1EXWA 2EKBA 4QDTA 4EVIA 4RXMA 1P6UA 1FNNA 3D3KA 3OLCX 5A7FA 1CNMA 2WT8A 3P4YA 1E5LA 3V6MA 3OCYA 5FHRA 3H11A 1IRIA 3ER6A 5ECDA 2JFQA 3GMSA 2C7PA 1FVOA 6YASA 5EHGA 1GADO 5FBZA 3UHAA 2O8CB 4EY5A 4OJNA 3ZH9B 1ZA2A 5C5CA 2PD3A 3HCNA 2C5HA 1GPLA 3W04A 7REQA 1YFMA 1VA4A 1VHDA 1GSHA 1H2YA 1WVMA 3MWEB 4H7KA 4WN9A 4EG7A 4ZMRA 1CV2A 4DPMA 4MQEA 1NQOA 5B7PA 4CG3A 4BWFB 2YJ5A 2W6IA 3TYXA 1ZJJA 2ATVA 1TDJA 4H7JA 2QD4A 3I12A 3N2GA 4IVQA 1L4NA 4D99A 1U2RA 1JFFB 4S1OA 4DY6A 4PX5A 2L69A 5FQNA 2OQIA 3F5QA 1A7UA 1TADA 3A1FA 3UC9A 3LUGA 1N78A 1GA6A 3D3EA 2BEUB 3P9CA 1JAXA 1QE0A 3OM8A 2G9VA 2RKWA 3ZWXA 2DPHA 4OI4A 2R751 3GGOA 2H11A 3ZU2A 4ZO4A 4MGZR 1TZMA 4YHHB 1MDBA 4XQGA 1SVNA 2BELA 2I7VA 4DG5A 1EXDA 4HATA 5BQXA 5IXSA 3A6EA 4XQCA 2D1YA 3P9SA 4LZJA 4HGVA 1SHTX 2GXSA 1DQZA 5BXQC 4UAVA 3PQ5A 3GEGA 4KAAA 1E7YA 2HXYA 1X15A 4A7PA 3U1BA 1VIYA 3CEMA 5G0SA 1Y34E 4FCVA 1H2EA 2D13A 3RRNA 5JXGA 1O94D 3IT0A 4G4SP 4INZA 3CI0K 4EKNB 1UK8A 2O2ZA 3ZK8A 3WWZA 1ECPA 2CLLB 3LTEA 3MFYA 4ACBA 1CJUC 1T15A 3H6HA 1SIWA 5KYUA 1JBKA 2Z2YA 2EZ4A 2CFCA 3DAYA 1FDSA 1N7IA 1ZXBA 4JLDA 1SVMA 1KZ7B 1VKZA 1YIAA 3DFKA 3EIHA 3QPAA 1XRRA 3K73O 3ONFA 3ZZ0A 3JD1A 1QO7A 1N6PA 2XUAA 4RHCA 1T3SA 2VK8A 2XMQA 3CY6A 3EFHA 4MUGA 4K81B 2HZBA 1U7WA 2VDWA 3C8DA 3PICA 5K3SA 2P0AA 4XDZA 3F4SA 1RPNA 2PIAA 2VP5A 3R6GA 4UPDA 2PIDA 3DMDA 5AKKA 4F91B 4UEOA 3LQ1A 4Y9DA 4YFVA 3AVTA 5CFRA 2IF2A 3ZLVA 4GBMA 1LU9A 1US8A 5KNCA 3M6XA 3VFDA 1P39A 2FOIA 3C7AA 3KQOA 3V8NA 3JZAA 1KJ9A 4Z9AA 2VWGA 2I2AA 4BWVA 1OWMA 2GHIA 1IUPA 3GY0A 3BZWA 3RTEA 4CBVA 3EGXA 3WFJA 3PUJA 1P1FA 2YCLA 4LCEA 4RY2A 3HEMA 4U7FA 3CX7A 4KGDA 3GO4A 4MDHA 5JY1A 4RTSA 2GYUA 2YJ3A 5IHPA 3HFSA 1JXQA 1XLUA 3KTFA 5C4MA 1HF3A 1YOVA 1GU7A 4CV0A 3DUFA 5IM4A 3BGVA 1AS3A 4KO2S 4JT4A 3TUJC 1RHQA 1Z17A 2H92A 3Q2IA 1XMOB 4XIYA 5A03A 5G40A 5A7HA 2ZE8A 4HMOA 4NBKA 2EW8A 3EEIA 5DNEA 2AN9A 1R0RE 3L7NA 2EU8A 1EVIA 1R0BA 2EATA 3GCDA 3VNRA 3G3EA 4C9BA 2WWHA 4NI5A 4Y98A 1CZUA 2G0AA 3PPIA 2O8BB 4RLQA 3T5PA 2WT9A 3CIFA 3FXAA 2VJYA 2P3OA 1IJKA 2LDBA 3DV0A 2KSQA 1ZOOA 3H5LA 4XQ9A 3TNDA 1BX0A 4FHCA 4DLSA 1JSZA 4IQJM 1DX4A 1ZSVA 2GMWA 2KHZA 2QTMA 5DDIP 1Z2CA 3WXMA 4ZAWA 3ZS9A 1KQGA 5BVGB 5F2OA 1JN0A 1WCV1 1S2NA 1C7FA 1Z47A 4NZYA 1Z74A 1CPYA 4OKIA 5ERYA 4ZKEA 3DHEA 1S4QA 4E94A 1J49A 4IVRA 1D0VA 2JDIA 4FCCA 2ZRBA 4JROA 3BILA 3FZGA 1AN0A 3B9RA 3I9KA 2H29A 2PMCA 4LJAA 4YI3A 4RHFA 2ZIGA 2V6IA 4QQ8A 1J20A 4BBJA 2QEQA 3HU5A 3KHUA 1Y89A 4RGQA 4NCIA 2RH4A 3WBBA 4R2IA 4TSFD 3QA3E 4TQGA 3OCEA 3FMVA 2FA9A 4L3WA 2ECQA 7AT1A 2REBA 5EWMA 3ROTA 3LNTA 2JFVA 3LPNA 3ET5A 3DVQX 3BHGA 2WPDD 1NOJA 4R1SA 1K8QA 3THWA 3MT9A 1GVHA 1FRNA 3GCGA 4FYJA 3R7LA 3N6RA 1YRLA 4X1KA 3OQVA 2QBYA 4BVHA 2BMDA 3QLTA 1RZRD 1U7XA 2L2QA 1V9LA 2XGMA 3WGNA 2GEDA 3JASA 4TN1A 5JJKA 2Q2OA 4TROA 1UANA 1B23P 5FPPA 2R0QC 3ND8A 4M1ZA 3H18A 1NUUA 3I4FA 3JQAA 3WWDA 1FFGA 4Y18A 3HB5X 3RVPA 3PJEA 5IS2A 1UBTS 3AYZB 1M0EA 3EFOB 3VO2A 4A1FA 2F3UA 2RE8A 1T8PA 2AX4A 2J0EA 1G16A 3AB3A 3PYMA 4HWSA 3TLZA 8ADHA 5HIKA 1EVKA 1U02A 4HAWA 4I55A 1N8TA 4ND4A 2XQJA 1Z0UA 1JIUA 2VJLA 3DXFA 4F93B 5I7AA 2JH3A 1UWLA 3IERA 3T9DA 1AJEA 3PHHA 4OGFA 3H5TA 3R3XA 4IFIA 2ZJ6A 1K6JA 4ZZ2A 2ZB2A 4B35A 5JZ9A 5JTTA 2FMTA 2IZ1A 2UXCB 1CFJA 4BIMA 4U9IS 5DHAA 1UPAA 1R9GA 2ZKIA 4OLHA 1E3WB 5KMGA 3D2LA 1CUVA 3TZKA 1XYYA 3CPEA 3IQGX 1O95D 3P0RA 2IK8A 2HK7A 1L3CA 1MB4A 1V11A 1SG9A 1VG9B 4MI3A 1G8PA 3RVBA 4KRGA 3VPGA 4ZVPA 5ALDA 3CXRA 5ILOA 5J2TB 3A3OA 4KO3S 1BNCA 3EQ9A 3HE3A 4B7CA 2GSWA 2FUSA 5TF0A 1YDMA 2RK4A 2YOFA 3TQOA 4EOGA 1U0HC 3S7TA 1Z0KA 2G8LA 4W7IA 3STWA 3SVZA 5BNZA 5KIAA 3G0IA 1E4VA 4AT1A 4YQYA 2RC6A 2OQRA 4UHBA 3EVNA 3QENA 3NYWA 3CT4A 4HDQB 3PXBA 2J48A 1YQGA 1OWLA 5EUCA 2NV2B 1P29A 1FUEA 2I4OA 4ZKDA 1VG0B 2QQEA 3O8QB 3QXGA 2YYYA 4PGMA 2JAWA 3L3BA 3LLCA 2E4AA 1J00A 2WNHA 4N6OA 1CZOA 4OHRA 1E1KA 2FE1A 3JZMA 2Z4RA 5IKMA 2SCUA 1UIRA 3LYUA 4RF4A 3FPAA 1I9GA 1B0AA 4G63A 5BR8B 4MCAA 4EHAA 1PKEA 1LGYA 2IEBA 4HQOA 1GZ6A 3IX7A 4JAVC 2H2AA 4U7WA 2GNOA 5CBKA 3ZIAA 2M98A 2D2VA 3M34A 9LDBA 3OT5A 4LY0A 3LF1A 1ZI8A 2ZXUA 1TQ6A 2GFIA 3DEAA 4GX5A 2C42A 2WYUA 3AUKA 3CB4A 4QFDA 1HORA 1FDWA 3LYHA 4TRMA 3HBNA 4D4KA 1Q0SA 5C0OE 3AUYA 2E89A 3CRZA 3KPYA 1W2HA 3T41A 3ZVMA 1ZA1A 4CM5A 2Q1YA 4UBOA 3L49A 4RWEA 3ZDYB 5FNVF 1F60A 2X77A 5DHTA 3S7ZA 3IE1A 1XHFA 4V3BA 3F90A 2R7KA 4KSYA 3BKXA 2VNKA 1J06A 2YWBA 1T34A 3E7XA 3VAZA 2NV0A 1IONA 4ZHQB 3OPYB 2C54A 1OFIA 4DLWA 4LXHA 1JHZA 2PD6A 4FKMA 5EHNA 1FUOA 1U0SY 1EK0A 2GBLA 3KYBA 4MP8A 1ZC3A 4V0ME 2BGNA 1TVKA 2R7LA 2YN4A 1YH3A 1XR3A 3CRRA 3CZMA 1OF1A 3B3AA 3PR1A 1LLQA 4K3UA 2O52A 2CNKA 2I4LA 5D1NA 4ZQFA 4E07A 5HKOA 4OI0A 3AT1A 3SJAA 5CA1A 1Z8NA 2JLSA 1B8OA 5HUQA 4U2DA 1JEEA 3BD8A 5KB3A 3F8SA 1OH7A 6AT1A 5IWAB 3F96A 1NTRA 2QMEA 5ALNA 1JQ5A 3DSRA 4O4IA 4AP5A 2ZBGA 2BMVA 2C9DA 3PUKA 3TQRA 1EFRA 3KQQA 5DNDA 5ADVA 4Z4FA 4HT3B 4NFLA 3UATA 5DM70 2XUIA 4D56A 1TEHA 2JHGA 2GCOA 2ZIWB 3OJEA 2ZREA 3FG9A 5ESWA 1SK9A 3Q1KA 3TZCA 1XCMA 1GG8A 4K6CA 5I4CA 1RRCA 1Y6JA 3IO5A 5H5JA 5FPYA 5T8KA 1B00A 3MFQA 3EZ7A 3NH6A 4R8VA 3L46A 2YZKA 4P08A 4RHYA 4D74A 4KOAA 4EI8A 2V5UA 4CVNA 2WSSA 5HF9A 4HZUA 4G4JA 4JSRA 4AS3A 1V1MB 5F3RA 3OJWA 3AI2A 4WXRA 1A9XA 1DAEA 4Z5XA 2N0SA 3ER8A 4MX8A 3NOXA 3A2LA 5JADA 1K7EB 3F6YA 1DEXA 3BRQA 4MCIA 4WI1A 3WYDA 3O8OA 4E0BA 2H18A 3R5FA 3SZMA 4OLBA 1IHPA 1F9EA 4J0KA 4RIHA 4DWVA 4PVCA 1ZM7A 3BQMB 3DLHA 4N0MA 1UBUS 2RHWA 4GPTA 4OPMA 3FBTA 3EISA 3NTUA 5HR5A 1W48A 1Q0ZA 2O7VA 2R1UA 1ZH0A 1SB9A 3K9BA 1XFAA 1UBFA 4UOEA 2F43A 2Z3ZA 1L1EA 3HU1A 3R77A 1WW8A 3DNMA 1SH7A 1HG1A 3AKDA 2A9PA 4XUGB 2JL1A 4BTVA 4DV2B 4K87A 2PTSA 1F0PA 4K6KA 4KJZA 4X6LA 5IVDA 1OPRA 4AJHA 1V7PC 3QFTA 1OH5A 3IMFA 3KLPX 4B6QA 5JVDF 2I4IA 3ASZA 2AR9A 2BFMA 2X19A 3C3KA 4PNPA 2PTRA 1FMJA 3CMMA 5EY5B 4GE0A 3CKYA 3RRBA 4JGIA 4RO0A 2AUMA 3GZJA 3HP4A 2SKDA 4IIYA 4PAMA 3QVGB 3ILYA 3TCNA 3WL3A 1A8SA 5D87A 4ZDWA 2CVOA 3LVQE 1SOVA 4P58A 3MMZA 3E9NA 3GRZA 3QEMA 1W6RA 3ZCVA 421PA 2NWQA 4EG8A 1W46A 4XTRA 3LO5A 2FSPA 4WK2B 1MFZA 3CN7A 1ANKA 1X7ZA 2Y68A 1U9YA 3Q15C 4D8WA 4MYUA 3I2GA 5AKHA 2W9XA 4ZCQA 3ESXA 5G4KB 3LW7A 1HQKA 4DS3A 1UDBA 4EFNA 4WGGA 4DNPA 4YR7A 4TZTA 4QVKA 2PL5A 2ZTVA 4L4RA 1J1ZA 3QVSA 4PX3A 4KSCA 2FPPA 3THXA 3KV1A 3DR5A 5EP4A 4DMHA 2PZBA 4X20A 4NR0A 3I01M 2ANBA 3C6MA 2V0GA 5KSPA 1J0EA 1OIVA 3GZNA 1SC4A 2I1VB 4A0GA 1MD9A 5LZ8A 4CM1A 2N47A 5G3ZA 3G0BA 3MCVA 1GILA 3ISJA 4E46A 3QPVA 4MV0A 2PGLA 5GIPE 1Z82A 2XLBA 3A11A 3AF5A 3LBHA 2FN3A 5F9MA 4KLZA 3VPDA 3ZGXA 2HQSA 1T26A 3QK7A 2R86A 5EQFA 3SFZA 5JDIC 3ZCRA 3DZHA 5KX5B 2A0UA 3AGQA 6ADHA 3JVIA 1NBIA 4O4JA 5LKRA 2YXEA 4JXXA 4C6TA 5HQTA 4QBGB 1V6CA 3PFHA 3CR3C 1RJ9B 4WIAA 4R7TA 2ROQA 2ZYSA 1AQIA 3QTTA 2F4VB 2H9YA 1NPYA 4N82A 4GRIA 1MHTA 1ZMTA 3QPCA 1VHLA 5BW5A 1D1PA 2JD1A 3BXGA 1IZYA 3U4QA 1SCDA 1AQNA 1TIBA 5B4VA 4M37A 2VQ3A 3SJZA 2LWIA 2F8MA 5B64A 2KX7A 2G83A 4EDFA 4WFKA 1T3HA 4B8ZA 5EQTA 4ZI7F 2DQZA 3NUQA 4MVJG 3M6LA 4J3NA 1TIPA 3V46A 1QTNA 5CFPA 2WINI 1B15A 2C1EA 3W2EA 1EWYA 1VZ3A 1I5EA 1CUEA 3C7TA 2OBNA 3A9TA 1N0UA 3HSYA 2NM0A 5KKAA 1TM2A 2H1RA 4QX6A 1ZR2A 3LMKA 3TXYA 1Y3HA 4WJLA 4KRYA 4UCQA 4XSGA 3WMEA 4OIFA 1VIDA 4QXMA 1YMVA 1YQTA 1MJFA 2P9ZA 1I5RA 4IJQA 2PSFA 3O4HA 1YQEA 4YCLA 1DTWB 4BUJA 1NA5A 1UOPA 2F1JA 3E3MA 5CDFE 2VWHA 5DTRA 2A5DA 1V47A 1CY8A 1ESMA 1Y1SA 4TLLB 2CLIB 3L5KA 4PC2A 1KBQA 3WS7A 4RD1A 5GADl 2P6MA 1RXYA 3UCFA 1A5BB 2FSGA 1H8ED 2QENA 3QVMA 1XLTA 2H2FA 5ALKA 5JYEA 2HDWA 4L3VA 5EA2A 4FJ1A 5B4TA 1JTEA 2V7XA 2NT4A 3TLJA 3CWCA 1RRFA 1T0BA 4KFUA 4MGEA 4LK3A 3DB1A 5EZYB 2I2WA 2EG9A 3BA6A 4HG2A 3H9UA 4KE8A 3QU4A 4LJ6A 3DA8A 4TWRA 4EPWA 1QIEA 1VIMA 5C1DA 5IKXA 4RJJA 3MSCA 3ORSA 4AG6A 1I30A 1WRBA 3MJSA 1TQDA 2ODWA 5I48A 4X65B 1VJCA 4EQ6B 4J0HA 5ILGA 2FDCA 3REQA 1TF5A 3FKSD 3LUFA 3ZDXB 4QPDA 4RS4A 1E2KA 4TSKA 4URZR 1CUSA 3HY6A 1RIFA 3MOGA 5AVWA 4L5BA 3IGFA 3GEEA 5AJTA 2OA0A 4EKEA 5AJXA 1NBEA 4GXTA 4LYYA 3TOCA 1KZ4A 1EEHA 1PJSA 2CZCA 3MJRA 3DTYA 4IQFA 3M83A 1U1FA 1PQPA 3HJAA 4MYRA 5DNYB 3H17A 3EBLA 1FFYA 4KX5A 2CMDA 5KTRA 1W52X 4Y9UA 3I05A 2X2EA 5GV7A 1RLMA 1E94E 3O4FA 1SHJA 2YDYA 4O4HB 5AUPB 1QQBA 2GUWA 1P7CA 1UKCA 3DVSX 3FMPB 4X61A 2BDEA 3O1HB 2PANA 3TE6A 2O2SA 2QGZA 5A9RA 1DDGA 1A8HA 5G02A 2WSYB 4QDXA 5LP6A 2R5FA 1Y5NA 5HKKD 3WBFA 1XB2A 3EXEA 3KSDO 3DLBA 4DCSA 1BQ3A 2C5BA 4YAIA 5TJHA 2YY7A 3DEKA 1WDLA 2WD8A 4X1YB 1B8UA 4W9RA 1WPGA 3G68A 1T2CA 1W6UA 4DIKA 1MA3A 5DBFA 3RIYA 1WUJS 4MVJE 4XGQA 1DIBA 2FUG6 2Q07A 3FVRA 2LBPA 4R4JA 4GYKA 3VU9A 2NXNA 3ZDCA 3DDWA 1XD9A 2MSCB 1OREA 3RSZA 1N3YA 2NAFA 4NJMA 4E6EA 5AW1A 1EZ4A 2IEDA 3O31A 4YRRA 4O8ZA 4IFTA 4RACA 4ZMBA 1W5EA 4PCUA 2ISSD 4WNAB 1CQWA 4B75A 3FCYA 2GTPA 3NIDB 4Y2JA 4JZYA 1CF2O 2BFDB 3G2QA 1D2MA 3WLIA 2VTDA 5BRNA 4JC5A 3AOGA 3AEXA 4GL2A 4ZAYA 4DLRA 3HJBA 3PRHA 1GQFA 5KJFA 4FIDA 2AFHA 5COBA 1JKIA 3MTBA 4S12A 2VH2A 2V4MA 4FSHA 4BUZA 1K68A 5ISMA 4QT4A 1HOXA 3ESAA 4L5CA 2TMYA 3NHKA 4FMDB 4MGKR 3NETA 2CNWA 3UT0A 1KVQA 4BGDA 3TQCA 1FC0A 3VHRA 4UAJA 1XZQA 1EFDN 4LF8B 1GAQA 3TRFA 4U7DA 3OU6A 4PF1A 1XDZA 1ZJYA 3LPCA 5DYWA 2E9SA 4KFTA 3EAFA 3LCRA 4FIZA 3ZVLA 4E4TA 4M6WA 6NULA 3ZR4B 2BR3A 1MP0A 2XNKA 3D4NA 3F4LA 1QH9A 1WB6A 1Y5RA 1Y1RA 4DIEA 1QGYA 4QTXA 2WUEA 3IKJA 4HN9A 4AM8A 3W5UA 1ADJA 2I4MA 1WXIA 2RB5A 3D31A 3JALB 3PUXA 2VDPB 4RA9B 2WSLA 3OOWA 3S2YA 2NSLA 1W5TA 3AY0A 5CB4A 1OAOA 3U7FB 4DR7B 1LFDB 2W2PA 3T94A 1RI3A 4L0QA 4URUR 5CDYA 3A31A 2W2XA 2IYLD 2R8BA 2R5NA 3E70C 3K1TA 3OQBA 4NBLA 3D0KA 3UH0A 3CLHA 1SKMA 3OIFA 2QTFA 3W6UA 1BMQA 1FX0B 1X7DA 5LL6P 1ZN9A 3QQ5A 3TD9A 5KOIA 1FLVA 2HIHA 2QX9A 4KDFA 1FFBA 5LQAA 3PF8A 5E1OA 4GP9A 4DCPA 2A84A 2NU7B 4R0NA 3SQOA 5K2MA 2HSEA 3PWKA 2XZTA 3H04A 1V0JA 3SI7A 2J0UB 3GEHA 5B55A 3CU5A 1P61B 2PKYX 1BW9B 5DEOA 1CB7A 1K5PA 1U7ZA 4YUYA 1H9BA 4I9GA 2XCIA 3IVCA 1XU9A 2CJPA 4FUQA 3LX8A 5SZKB 2PRYA 2WK1A 4LQDA 4DBVO 3CIOA 4XD7A 1UM9A 1A04A 3DZIA 2XT9A 1IMJA 1VJRA 2IXBA 2VNAA 4EMTA 4UDYX 4RFSA 4N5IX 4YP6A 5H59A 1XP5A 4HZGA 2XE6A 5ALQA 3BMQA 3DV2A 3WDKA 3IIJA 1B6SA 1BX3A 4ITUA 1WP9A 2R6JA 4RADA 5EJ9A 5IU6A 1HE5A 5CNKA 2YIMA 3ELBA 4PLWA 2WJWA 3HXTA 3VHXA 2YINC 3K96A 4GBGA 2QW8A 2AD5A 3DNFA 1TUIA 3AI7A 3FR7A 3PNBA 4LGCA 3VYUB 3ZVKA 1KOFA 3MXOA 3PHIA 4RCYA 5I7WA 4Q3CA 2V0NA 3H9EO 3M6UA 4PE5B 2YWRA 3TVYA 5K3AA 5TNXA 2J9FA 2YV4A 3EMDA 5LZ4A 1JPNA 5BNTA 1EUDB 2FW0A 4I6GA 4Q16A 5DI3B 5KJEA 5C8YB 4F85A 1F48A 3QTLA 2DTDA 3QU5A 1D2NA 1FUKA 5K8LA 2EKPA 3ZYCA 4JR0A 5K5EA 4X62B 2QS9A 2II6A 3CLSD 1EUCA 3QFRA 1K08A 1RABA 2QXUA 1QAOA 3EXFB 1XMQB 2Q50A 1QZZA 1N9GA 1SUPA 1Z16A 4WEOA 1SR8A 1ZGJA 2IUFA 5DKFA 4F3CA 1XC7A 1YR1A 4EMBA 1VB3A 2FWMX 3DCIA 1JYFA 3BB4A 3OECA 4P31A 5BWCA 1VE6A 4Y1EA 3C1AA 1U3VA 2J67A 3HBFA 4WBNB 3LSYA 3ODPA 3ANTA 3LT4A 2IUUA 4AL4A 4DTCA 1WNFA 4TGLA 1DNPA 2QLJA 3OE7D 3CZCA 5DYNA 4BQOA 5AUOB 2IHYA 4YJ2B 4OQDA 1U7OA 4DOMA 3ORQA 4KZKA 2JGAA 3B7PA 4M9ZA 1IXSB 1U6IA 1GTL1 2IYVA 4Y30A 2FG6C 1P5RA 1SCNE 3M1AA 1UADA 3AFGA 1M7GA 4LZAA 1EX6A 3DE4X 3CFYA 3W7AA 4A6XA 1C3CA 5ALZA 2C5EA 5CJJA 1G4AE 4G8CA 2M6LA 2QKYA 3U37A 5IXYA 2V7TA 4PFQA 3GJ5A 2XCUA 3ZWMA 1RBMA 1WCIB 4BKUA 3V8EA 5LU9A 3NKVA 1CP3A 4WWHA 1Y5MA 2V6BA 5CUQA 4R31A 1NP6A 3KSRA 4PLCA 1X7YB 2Q8PA 4AD8A 4B6SA 2Z1MA 1LQ2A 1GFSA 3O8CA 1P4AA 2V7PA 1O1YA 1DOFA 2FCRA 2XVZA 1EBBA 1BXRA 5G0VA 3TAUA 3CPHA 5MGNA 1Q16A 2QL9A 4P4LA 3M1IA 4QUJA 2JI9A 4YJFA 3VPCA 1UBKS 2IHKA 3U80A 4NOKA 3NU1A 1A97A 3AJ9A 2C4NA 4WK0B 5AK6A 3GCWA 4M1OA 5CIYA 4OH7A 4EX7A 4PZAA 3M6WA 3D8BA 4IY1A 4RNCA 5ADUS 3EH2A 3C85A 3D4BA 1KK2A 3ST7A 2D8MA 4YT5A 4KE6A 4TUYB 1KYZA 1DEKA 1KDPA 4MUFA 3FCXA 2W6ID 1NR5A 5GMOA 3LDAA 3AG6A 1E8NA 1TZBA 2BFWA 2TS1A 2W8BB 2OQVA 4KP7A 3JYPA 5B2EA 5JMOA 1PR5A 4U7TB 2CKMA 1KSHA 4OB8A 3KJFA 2JVJA 3HXMA 4MUBA 5F4BA 1U65A 5K0SA 3P2JA 1FP7A 2HN9A 3S6JA 1SKBA 3DLAA 1U63A 4Q21A 4OSEA 5K3EA 2D27A 4B33A 1ABEA 3V4ZA 3AVPA 3OF2A 3HDVA 3LRPA 1WSWA 3GR6A 2GXAA 4ZAFA 1M2EA 1SIBE 1X1BA 4PAQA 3RCBA 3UB3A 1YA4A 3IBSA 4QLAA 4DIUA 5C1OA 2CUTA 2VATA 3I83A 1SA0A 3IMGA 4AY4A 2CDNA 2FYTA 4HEJA 3WGYA 4ZQCB 2J3IA 4H7EA 2SNIE 3HKEA 3FNFA 1M67A 3ZJVA 1QU2A 4CIYA 5AO9A 3DO6A 2GEFA 3VSAA 4