2JAUA

Crystal structure of d41n variant of human mitochondrial 5'(3')- deoxyribonucleotidase (mdn) in complex with 3'-azidothymidine 5'- monophosphate
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
194
structure length
194
Chain Sequence
RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Human and Murine Deoxyribonucleotidases: Insights Into Recognition of Substrates and Nucleotide Analogues.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords 5'(3')-DEOXYRIBONUCLEOTIDASE
total genus 65
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 2jauA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2jauA01
5ALJA 4Y2XA 3EF0A 4DW8A 2OYCA 3UMCA 1TJ3A 3BA6A 1F5SA 4JDPA 4XE5A 2PQ0A 3U7GA 2G09A 1LTQA 3SD7A 1YV9A 5AW8A 2BY4A 1RQLA 1JUDA 3MC1A 4OCZA 1Z4LA 2R8EA 4YCMA 3WK5A 5AKLA 3EF1A 2I34A 3ZI4A 4L6AA 4NAVA 5ALOA 2GFHA 4XQ0A 2MU1A 1L6RA 4EEKA 5ALMA 4UM5A 4JB3A 3WK4A 5AKZA 2G08A 5A3SA 2IYEA 3RFUA 3KZXA 3WK6A 4YIKA 3WGUA 4OHFA 2W43A 2HF7A 2GHTA 5ALLA 2FUCA 3IJ5A 2ZG6A 3UM9A 2HX1A 5AKYA 3KD3A 3L8FA 1U7PA 2AGVA 4Y2RA 3PDWA 4BX2A 3U13A 3NALA 1WZCA 1VJ5A 3MN1A 5AKIA 1LVHA 1Z4NA 3UMBA 5AICA 3W5CA 3L7YA 3U7HB 1NRWA 5AKXA 4YH1A 3ED5A 3N8GA 1AQ6A 2W4MA 1ZRMA 2PR7A 3UMGA 5AM2A 2I6XA 5A3RA 2B82A 2QLTA 3P96A 5AVYA 1L8OA 1Y8AA 3AR8A 3EWIA 1L8LA 1U7OA 1J97A 3QUQA 3AR4A 5E0OA 1YJ5A 2YY6A 3ZU6A 1Z4MA 1ZS9A 5ALVA 1Z4IA 3ESRA 2YJ5A 2I33A 2HHLA 1O08A 4ZEVA 3R4CA 2RAVA 3QU2A 4KNVA 2HO4A 2ZBFA 3OCYA 4UMFA 3ZX4A 2WF9A 3FVVA 3WKAA 2WF8A 1YDFA 4UASA 4BX3A 3R09A 4UARA 4XPZA 4UW9A 2HI0A 4CF3A 3L8GA 2C9MA 2FPXA 4NWIA 5AHXA 3ZUPA 2B8EA 3WKCA 3L1UA 4GIBA 3ESQA 3R9KA 5AVTA 4Y2PA 1U2SA 3F9RA 3U26A 3A1EA 3ZVNA 1TA0A 2OBBA 1Z88A 5AVRA 3U19A 5AVQA 3L5KA 1EK2A 2EAUA 3NANA 5AW7A 4KX5A 3SMVA 1Z4OA 2YMMA 2FPRA 5AKKA 3OCUA 1WR8A 1VFPA 4XOUA 3CNHA 1CR6A 2WHEA 2FPWA 4GXTA 3WKBA 3SKXA 5ALFA 2HDOA 2FPSA 3ZVMA 3L0CA 4CF4A 1RQNA 1N9KA 5FP0A 4BEVA 3OPXA 5AKEA 5ALKA 2IOFK 2P9JA 4Y3UA 3QU7A 3KBBA 5ALIA 5ALEA 5JJBA 3W5DA 5ALUA 3BWVA 1Z4JA 3A1CA 2CFSA 1RMQA 2VKQA 3GYGA 5AVSA 1O03A 2YJ3A 3OCZA 4EZEA 2ZBGA 4YCNA 3D6JA 3NIWA 5AVZA 3A1DA 4G63A 1PW5A 2ODAA 1RDFA 3ET5A 3E8MA 5AKJA 2YN4A 3ONNA 2G0AA 2FEAA 1ZD4A 2G1AA 3B9RA 2G06A 2X4DA 2C88A 3PGVA 3QLEA 5AIAA 1TJ5A 5AESA 5ALGA 2CFTA 1XVIA 3A3YA 5AI8A 5ALPA 1J8DA 2P27A 5ALZA 5AW9A 4QJBA 5AW4A 3QU5A 5ALYA 2B8JA 2EATA 3PGLA 4EX7A 5AK6A 4C4RA 4DFDA 4KNWA 5AM4A 5IT4A 1T5TA 3EPRA 1RLMA 5A3QA 4ZEXA 3KOOA 3ZWDA 3E58A 1XP5A 3L8EA 1QQ7A 4IFTA 2B1RA 2YMLA 2RBKA 3NAMA 3QUCA 3TLMA 1U02A 2DQSA 3N28A 4NABA 5AM5A 3DV9A 1YS9A 1T5SA 3B9BA 2PKEA 1QYIA 4EENA 5AVWA 2AMYA 2AH5A 3K1ZA 3HLTA 4UMDA 1IWOA 3WK8A 1ZOLA 4C4TA 4RETA 2I7DA 2RB5A 4EX6A 2ZBDA 3WKEA 4L57A 5AW2A 3I1YA 3WGVA 4EELA 4BX0A 4ZEWA 4OFZA 4J03A 4UATA 5AW3A 4MUMA 3E81A 5ALTA 1Q91A 4E88A 2OA0A 3AR7A 5AI5A 4Y2YA 4CE6A 5ALQA 1RLOA 3M1YA 2HEGA 3PCTA 5AW5A 3WK9A 2ZOSA 3KC2A 3NRJA 1YNSA 3U7FB 2YMPA 1Z5UA 3DDHA 4RESA 1VJRA 3L8HA 4FFDA 2NYVA 4BKMA 4DWOA 4FE3A 1RMTA 2EARA 2WFAA 2ZBEA 1Z4KA 1MH9A 3QX7A 4UAUA 2WF7A 4HAIA 2C8KA 3QNMA 5AIBA 2G07A 2HCFA 2O2XA 2JAUA 3W5BA 1XPJA 2FDRA 4DCCA 3MPOA 4AP9A 4I9GA 2FPUA 2FUEA 3DNPA 2RARA 3E84A 2R8YA 2JAWA 4NFLA 2YJ6A 1ZJJA 3QYPA 2HSZA 1TJ4A 5AK3A 2P11A 3SHQA 4Y2JA 5AKGA 1N8NA 2I55A 2YJ4A 3KDPA 1RC8A 3SLRA 4MWOA 2JAOA 2QYHA 2JGAA 4UU1A 3IB6A 1S8OA 4HGPA 5IT0A 3OTQA 4BYGA 4BNDB 3QUBA 1L7MA 4HGRA 1T9ZA 5IS2A 4UU0A 2ZXEA 2JARA 1ZD2P 3L0BA 2GO7A 3MMZA 1KYTA 5AI0A 2B1QA 4H1WA 3U7EB 4F72A 4UM7A 3W5AA 2C8LA 2Q4TA 2R8ZA 4Y2SA 3NASA 1TE2A 2YBDA 3OCWA 2G80A 1Z5GA 3N5KA 2WM8A 3ZX5A 4F71A 3FGOA 4HGNA 5AW0A 4UMVA 5AVXA 4Y2TA 2IA5A 3QGMA 2C4NA 2B0CA 4NV0A 4OD0A 3M9LA 4AS2A 4QQFA 5AM3A 2IOFA 3AR3A 3VAYA 4Y2VA 2YFYA 3FM9A 1K1EA 1NF2A 1QQ6A 1YMQA 5AK4A 3OCVA 5T41A 5ALRA 5ALWA 2B30A 1RKUA 1RKQA 4Y2UA 1L7OA 5AKHA 3N07A 3B8EA 2D2VA 3I76A 5ALNA 4J2TA 3N1UA 2Q4RA 1L7PA 4IG4A 1ZD5A 3AR2A 3RF6A 2P69A 5AI9A 1SU4A 3NUQA 4C4SA 4I9FA 3ZWKA 5ALXA 1Q92A 3SKYA 2IOHA 3SF0A 5AM0A 4FYPA 1RLTA 2FI1A 3AR5A 2NO4A 4AS3A 4CNQA 2BDEA 2GHQA 1WPGA 4HGOA 1EK1A 3HYCA 3IRUA 1L7NA 4UMEA 4BEWA 1NNLA 4HYTA 5AI6A 1RMYA 4PNHA 5AVVA 2I54A 3QUTA 4BNDA 3ZTYA 4BBJA 2OM6A 1ZD3A 3I6BA 3WKDA 1S2OA 4KYTA 3QU9A 3AR6A 5AI4A 5ALDA 1Z4QA 1RRCA 2HF2A 3CZ4A 3QXGA 3DAOA 1QH9A 3L1VA 4G9BA 2YMQA 3J7TA 2W11A 2WF6A 1Z4PX 4L6CA 5AM1A 3I28A 1SWVA 4Y2QA 3FPBA 1QQ5A 1RPZA 1CQZA 2GMWA 4O8CA 5AW6A 1U2TA 4YGYA 4KN8A 4B6JA 5AK5A 3L0YA 4YCLA 1ZRNA 4HGQA 3S6JA 3ZTWA 4KX3A 3WK7A 2Q5EA 4CF5A 4YIHA 1X42A 5ALSA 2WF5A 5ALHA 2HOQA 2CFRA 2AUTA 4UAVA 2R8XA 2MSNA 3QU4A 3ZVLA 2NO5A 5AVUA 3FZQA 1SWWA 2BDUA 2CN1A 2O9JA 3ET4A 5AW1A 3AR9A 1WVIA 3ZW7A 1FEZA 1RKVA 3OCXA 3FPSA
chains in the Genus database with same CATH superfamily
4TWIA 3ESYA 4GYKA 5ALJA 1CJSA 2NU7B 2HSJA 2WHPB 4PZUA 1IHUA 2ZPUA 3TW4A 3UZUA 2C3OA 1S2LA 1I3OA 2B9EA 2O8EA 5L4NA 1O3YA 2OMKA 2ZYVX 4E4YA 4PYRA 4IMPA 3ZXUB 3H5IA 4G1CA 2LD4A 3UCFA 5JFGA 2I78A 2IRWA 2C5AA 1RXEA 3M0EA 4BKOA 5FEUA 1A5BB 1SUIA 2G7ZA 3LM8A 4G81A 4E51A 5KINB 1XAHA 3HXMA 1V8PA 3I62A 1TUEA 5JDIC 4L51A 3UWMA 5BWOA 3TLJA 2WTNA 3LUPA 4H31A 4MI3A 3IIIA 3JZAA 1DJQA 3HA3A 4YJFB 1AN9A 1BWSA 4NBLA 3MNFA 3TUIC 1MLDA 1BTOA 4JKOA 5HMLA 4ZV7A 2VFAA 3TVTA 1G7CA 3HU5A 4ZCTA 2H16A 1N6LA 1E1QA 3I45A 4M6WB 4UUAA 1II8A 1MC8A 1JLSA 1U5BB 2UZAA 3ROGA 4ENRA 2IXDA 4QTUB 3WNDA 1G9TA 3K1AB 1ZN2A 3PUVA 1CJKC 4EBBA 3HXPA 5F5XA 2DBYA 3E7DA 2ZSIA 4OHFA 2W43A 1U2PA 2FWJA 1UJMA 5CB6A 1P8AA 1B73A 3LQFA 4CLXA 4L5JA 4X00A 1DEXA 3CZPA 2EXXA 4B3DA 4GZ3A 1OLSA 2J85A 1AK1A 1NZFA 1PS9A 3T34A 4QXQA 4BEJA 1JJBA 1NOJA 3ENWA 3PXDA 1JVSA 4RKYA 2AN1A 1PEYA 4KP7A 5CLGA 5KQLA 4B0OA 5FLKA 1BZYA 2IOQA 4JEMA 1FRQA 1KDZA 5JCJD 3LUJA 3ZNNA 5DRYA 1N2ZA 3MUNA 1D6SA 4H77A 4G8CA 2X8JB 4XSHA 4MS4A 2Q2NA 3V5NA 2G6BA 4PANA 2C7PA 3C3CA 1STOA 1WY5A 1WXWA 2HJHA 2IEIA 1XCOA 1SJ9A 2X0IA 4FHDA 4MO2A 3Q6IA 4G8DA 4MV3A 4ZAYA 1KE1A 2CLHB 1IEQA 4Y9UA 5L6LB 4QUHA 1PW7A 2GZSA 1QHGA 1NV8A 1RI1A 1ZRMA 2WUVA 1W0KA 4JR2A 1UR5A 1E66A 2NIPA 2QLTA 4KDCA 1UK6A 3DEIA 1MJ5A 1TMGE 5DTJA 2BHNA 5IMSA 5L3SB 2ZI3A 3AUJB 4XCVA 1KVTA 1U7OA 4J94A 5LXTA 2X5XA 3RJTA 1QOPB 1TMKA 3S99A 3CWZA 1V1RB 4LMRA 3HQ4O 3BC1A 3P9XA 4BNXA 4JT8A 1YJ5A 5CDFE 2CLDX 4C6HA 1XWFA 2ZRCA 3MJVA 4P4UA 1CIPA 5A4IS 1XLUA 3ROMA 1W5EA 1Z6TA 2W7TA 4WNAA 5LSAA 1PNQA 3CVJA 2N46A 4DM3A 2JLRA 1Y6FA 4PO8A 2RCYA 4Q7QA 2FP4A 2ZIWB 1T10A 1EBBA 1GNSA 1XLTC 2PX4A 1SOAA 2RBEA 4RXUA 4TGLA 1EUYA 4P7JA 2X3UA 4QX6A 1EQAA 2KSQA 4ZYZA 4W5HA 2WF9A 1RT9A 2P4EA 1U9ZA 2JGRA 3K8YA 3TRJA 4F5YA 1YDFA 3RSQA 3JWHA 4OHUA 1Y80A 4I99A 3JQRA 2H92A 4TYQA 4D8XA 4Q21A 3X1KA 1X86B 1AKWA 1JV2B 1E58A 2H1WA 3ILSA 4P4NA 4RHUA 1JNYA 1JKXA 5BOVA 4Q01A 2QX7A 1QIHA 1KO4A 1NMQA 2BKAA 3FVWA 5EHIA 3ZHSA 5ETJA 4RABA 5KOJA 5ILGA 3ZHXA 2OBFA 4LNUB 2C92A 1WMDA 4ARVA 1USWA 4C7VA 1UPUA 4PWZA 2EWMA 4EUHA 3S5UA 3UHFA 3C5WP 1A04A 2OKCA 1J0XO 4IO1A 4RH3A 4ZWNA 1D9ZA 4BRSA 4E7PA 4WE3A 3AI7A 4FOPA 4OXRA 2X1MA 3FOAA 3H97A 5G4LA 3U19A 5CPFA 2ZRNA 4LVOA 2XNJA 4Q3BA 1VPEA 1HFWA 5IBQA 1F38A 4DHEA 1ZWKA 4DUGD 2V6FA 1S3GA 5IVKA 3D6FA 4GDMA 5CCDA 3WZ2A 3CNHA 4ND6A 4M1SA 1OV6A 3DDZX 4Y0NA 3S28A 4DJDC 2XQVA 3KAPA 1Y8QA 3GBSA 1WRBA 3GZ4A 4FQ5A 3DXZA 4Q9KA 2GYVA 5A2QA 1MVLA 4A73A 2DR2A 3R74A 3OFVA 3TO5A 3J80A 1WAMA 1SY7A 2ZR7A 3GZNA 1KMMA 4G5QA 4W82A 1EWRA 4UVGA 3TZEA 3ICEA 2ZRPA 3WJ7A 3PGA1 3AJ8A 1T3GA 1C3EA 4PLVA 1O54A 3PWKA 2C1XA 1O58A 1DBQA 5JWRA 4DCUA 2FWBA 4REQA 3NHZA 3Q6NA 4NL4H 5TDHA 3ILVA 2R3SA 3A1CA 3OMXA 2DY0A 4LVNA 1NE2A 2YJ3A 4DIEA 2AFVA 4RMJA 4MPDA 1QS0A 3SQNA 3I34X 4LXIA 4EHIA 1W36B 2IPLA 4K2HA 3TF5A 2VUUA 4EG6A 2WAAA 2V4UA 1L1RA 4C4XA 2P0AA 2FQWA 4UQOA 2P3QA 3N2KB 1HZZA 4RZSA 5BSMA 2UDPA 1P2FA 4C9BA 1DC5A 4UAJA 4Q7JB 4HWRA 2VOEA 3T5GA 5EKDA 5AHKA 1UADA 3S4YA 1GL6A 1Y7HA 1NR7A 3IUSA 1XDBA 4X92A 1VKHA 5CVEA 3PUYA 1EJ0A 1IWPB 1YK1A 2H51A 2YIVX 4IM7A 1WL8A 3SSNA 1T4BA 2E87A 2GOYA 1XLTA 4ARBA 2O3UA 3GYBA 3WGKA 1L7EA 1M2OA 2Y2VA 5DIZA 2V58A 5JE8A 3ZLUA 4Y9RA 3ZCTA 4QZVA 1WETA 3E03A 4TS3A 4GRDA 4L3VA 2A9VA 4F97A 5A9RA 3SEAA 1NV9A 1LNQA 4W4TA 4RD2A 2UXBB 5AW9A 2JLYA 1GAJA 4MWEA 5FUQA 3QU5A 4MGZR 3W6NA 4CIBA 2HZBA 1WEKA 2QGNA 2QTMA 4YO7A 1L5LA 2D54A 4C4RA 4EA8A 3FOFC 4JP2A 2H3EA 2R7NA 4BNMA 1OXBB 4G25A 5BP7A 2ZJ2A 1J24A 1NVXQ 1GOTA 4JOCA 4O1IA 4I1PA 1CNMA 2G1UA 2C3UA 4HDCA 1OCEA 3KV1A 4DJTA 3VU3A 2I6UA 1SIBE 2G17A 2Q1XA 4GPBA 3STXA 3WYAA 2I6GA 2V7UA 2ZSUA 3K6RA 1NVTA 4XR9A 5AVWA 4ZICA 2B25A 1QZ3A 1V4BA 3K1JA 5DSXA 1GKIA 1W4AA 2ST1A 2G9RA 3HDYA 5TPWB 1DAIA 1FW8A 1RWWA 3CQ9A 2MJLA 2RGUA 5LZ4A 3PICA 4A3SA 3MSCA 1FTYA 1U16A 1ZK2A 1K75A 2ZBDA 3CIOA 4WECA 1FQWA 2J5BA 2PG3A 5E2AA 1F6WA 3IBSA 4GI3A 1I94B 1SXJB 5DN6A 1B93A 4IMRA 2PT9A 2FV8A 2Z5VA 4J03A 1L4HA 2B4TO 3RABA 5C9ZA 1UH5A 4M22A 4Y2YA 4XKJA 3GJXC 2XD4A 5IUKC 2OCGA 2FHPA 4URHA 5HPYB 2BP7B 4ZVTA 4MA5A 1RQXA 1U4NA 2CDNA 1G3RA 1YNSA 1NW7A 2Q6VA 3H2YA 1AZLA 1XF1A 2PRIA 1Z39A 3ELBA 1WNFA 3ETNA 3KSMA 2H9YA 4YRRA 3UW1A 3THWB 1XZMA 4EATA 4W5JA 3IBFA 1CUYA 2ZYAA 5JO9A 3ZPXA 1BOOA 4RX1A 1P5ZB 2GLTA 2WYHA 4MVJP 4RL6A 2VATA 3MQ2A 2N47A 3NBXX 5L4LA 3EMKA 4EB6B 3WLTA 1ODKA 1DMRA 1JT2A 1GXSB 3KFVA 1LLUA 1SK8A 1R6VA 1E3IA 1Z33A 3L7KA 4G89A 4WRRA 2V3WA 4COKA 5HG0A 3K71B 1T5OA 3FFWA 2Y1WA 3WGHA 2VNIA 2O14A 2RHLA 3PJGA 2L17A 3GLKA 5ENVA 3UUWA 2A5JA 3OLQA 1JHDA 4QXAA 2R8YA 1CF4A 3N8IA 1ZJJA 2BGTA 4XUEA 5D6BA 2B3DA 4N54A 4AG6A 2DVMA 4R05A 3IH5A 1HNZB 1EQUA 4MDHA 4CEJA 3GEDA 4H4DA 3BMOB 3WB9A 1VPWA 4CQLA 3QVOA 4FP9A 2EP8A 3VPBA 2ABWA 5H16A 1T1EA 1VE9A 3O73A 2BHTA 3OLCX 3QIAA 4HQFA 1MXFA 4UJ3A 1U15A 1ML4A 1XQWA 2JAOA 1YWGO 2VOJA 3HVHA 4LGMA 5DO9A 2HJSA 2D2XA 4C06A 4EGQA 1UAAA 2ZTHA 5B2ZA 3QE2A 3FRIA 1UXGA 1WO8A 4OSPA 4F2PA 4YAIA 1ZSYA 2X1HA 4D9FA 3D1JA 1Z2PX 4IUCS 1WDWB 3UOAB 4IX9A 1NPDA 2DE0X 4F21A 4W1QA 1DINA 1GRNA 2REOA 4PV7A 1Z28A 4XIFA 1Z06A 1PEKE 1ORHA 1EIWA 2HSWA 2PKQP 1T5LA 3MOSA 5IT9A 1QH1B 4ZZ3A 1UT8A 5TQVA 2NU7A 5D7BA 4RQAA 2FW1A 2P3SA 3V2HA 3ZDAA 4FKZA 4DJFC 4PC7A 3NEJA 4JJIA 2ZWOA 3D8BA 3OCWA 1QANA 3MIZA 1NW5A 4XVRA 3FMPB 4ZU3A 3L7BA 4U2KA 2WE7A 3U0VA 3EA5A 3I9FA 3V2IA 3UYLA 3MINA 5L51A 5L6MB 3IPXA 3FDXA 1U1GA 2C57A 2H2IA 5AW0A 2XF8A 5KNLA 4YB8A 1GZ5A 5IF3A 5EFZA 2PANA 5FI5A 3HJGA 1MU0A 4C88A 1BDIA 3JD1A 3Q98A 1YZGA 2P1RA 1R0LA 3IEPA 3IIKA 4NV0A 5TXGA 4N0EA 2OZVA 3LNCA 1QVWA 2HV9A 3BSSA 2X9VA 3LBYA 3RWBA 4W9NA 4RD1A 2XB8A 4KREA 4QOFA 3F1KA 2XRZA 1DOFA 1RI3A 2D3WA 2HIAA 2PBLA 4TYNA 4TWBA 3JQAA 5ALRA 2EZ9A 2IVFA 1FP4A 5JSUA 3FOBA 2Q41A 1ICIA 1RKXA 3FNIA 4S1WA 3ZY4A 5KPJA 4N76A 5FOQA 2DY1A 2BFNA 3WYEA 2H9AA 2E5LB 1IN8A 4UPVA 2YJTD 1DIAA 1OAOC 3DP9A 1NBOA 4AXBA 5JYDA 4XLTA 3LBNA 2Q4RA 3QHPA 2VJCA 1G3IA 4KNYA 2WWWA 3STWA 2I4TA 3UJ9A 1WCWA 2D3TA 3E9YA 4JP8A 2L2QA 5DCLA 4YEDA 3CPEA 4BWYA 1JLMA 2YVQA 3UMMA 3SLRA 4NEQA 4M9XA 2J5QA 1TAHA 4OOFA 3V8EA 1DQPA 4C0XA 2Q2QA 3MCUA 4NH0A 1PK8A 2ANCA 3W3AD 5EJ6A 2H2GA 3NAGA 2ZJYA 1YBFA 4M60A 3W77A 4FYIA 4EFDA 2QE7A 1SCUB 2PZGA 3RUFA 3WJ2A 5FPTA 1DCMA 3VNVA 2YIDA 5DEOA 4O4HA 4J9UE 4JUFA 4RVUA 1CFJA 2E0IA 4U3JA 1U0BB 2HWYA 3J81A 4JLKA 3E0XA 3WL6A 1DFIA 1SVLA 5LCXA 5HTOA 1T3LA 1YOVB 1QH8A 4YT2A 3KELA 1MFPA 1QGED 5KWSA 1P6XA 1EWTA 1ACJA 1GSIA 1N6OA 2C03A 3PL5A 4KPGA 4OQNA 1H23A 4J3NA 2C4VA 4BBJA 1L7BA 1OX6A 1V35A 5DTIA 4LHZA 2I3DA 3NH9A 4P80A 3IV9A 1PV1A 3HRKA 2CLCX 3HY4A 5DZSA 4D9IA 4EARA 4MW1A 1V6SA 3IA2A 1ZK0A 4DLZA 2EL9A 4I5EA 5KYYA 2IW3A 3DL0A 3MWDB 1DRWA 5LB4A 3WQHA 4YDHB 3A7DA 3CNBA 3REGA 2YZMA 1H8ED 2CHVA 5HUJA 4HYQA 4Q03A 4TMKA 3ZCSA 3HR8A 4NMLA 2X42A 1Q7RA 3PYXA 3H11A 4ZVMA 3BERA 4DCMA 4FE4A 4M1YA 1ZCAA 1UDRA 1KEEA 1KZGB 2PWZA 4CL8A 3QJ5A 4S24A 1D9XA 3BK2A 3P26A 1OX4A 2PFGA 3TD6A 4PPNA 3TZQA 1IC6A 1K6JA 2DOKA 5THXA 3OKFA 4BNVA 2BFEA 3I53A 1NRIA 3KR1A 2QBYA 3WB0A 4G4GA 1SXJE 3B6EA 1SC3A 3OIFA 2FN9A 3MMSA 1WDKA 5ALHA 3ILYA 3RARA 2EW2A 4F4FA 4KZKA 1V2GA 1VM6A 2V6JA 3K9FC 1XZNA 3AGQA 3JQ8B 4OB6A 5FWDA 1NP7A 1Z3CA 3QU4A 2I3ZA 4PSCA 3FAZA 3NWEA 2QIPA 3PGXA 5D3ZA 3WOHA 4DRXA 4F8YA 5A5VA 7YASA 2DFLA 1UFRA 5IG2A 1GSAA 1SXHA 4MUKA 2K6GA 4QNNA 5C8YA 1I4LD 1MC4A 2Q2VA 3B1ZA 4XYGA 4NBNA 4NRDA 4W99A 2O2DA 2QRUA 5EC8A 5KNCA 3ZVKA 3O8QB 4FOTA 4ENVA 3RT7A 4N18A 3KWFA 1UWLA 2JGKA 4BZPA 3R3VA 5D3QA 2R1TA 3UMJA 5BW6B 1A8QA 4YMSA 4P3XA 4MUXA 4IW3B 1MZVA 2FEKA 3JYNA 1P4HA 3WTBA 5EWMA 4F4JA 3AU9A 2VG8A 2GLXA 3W7VA 5DP2A 2J5XA 3WA7A 3CW8X 4BMDA 5T5QA 4NENA 4EH1A 1YRBA 3BL6A 4BKPA 4WASA 4WBNB 2H4ZA 3EMBA 1DUVG 3O90A 4V38A 1E20A 2IYXA 4Q1VA 4ZDKA 2GSWA 2O8FA 1N6HA 2H1HA 2Z04A 3EZ2A 2Z3WA 4P5DA 3TZKA 4BQRA 4EG0A 5JASA 2A92A 3VH1A 3FSGD 4WN3A 1OT3A 1U0EA 5FBLB 4Q0MA 1SUAA 1ZHFA 3KOMA 1FOEB 2H1SA 3DWGA 5E6UA 1ODJA 3TE7A 2J67A 3K9NA 1ZIXA 4Z9XA 1V0JA 4FLMA 1J42A 3E4CA 1BXRA 3GP5A 4MQEB 2GX6A 4QGSA 2IS4A 4I1IA 2NAPA 2KBFA 2W2TA 1FSSA 5ESRA 3JW8A 3UOWA 1M75A 3AJRA 5ESDA 1GQFA 1PR2A 2GD2A 3NKFA 2JFXA 3ZHYA 1V1JA 4CEIA 3O4RA 4RZXA 2P4HX 4I7EA 4KDEA 4F9TA 5AKYA 1SBHA 3TFWA 3WGYA 2NACA 3H5VA 4IBOA 1F0NA 2PKQO 2TMKA 4XGNA 3TX6A 2BFFB 1QE0A 2CVZA 4WMLA 1LS1A 1H2XA 4GQBA 2V7QD 2F1RA 2PTQA 2HZ7A 2ZJ0A 3CZRA 4OGKA 1OZGA 2E4AA 5JCOA 2IV2X 1F2UB 4PN3A 3TBFA 1K8ZB 2Z0MA 3DV2A 2HA4A 4LHWA 4DTCA 2HC9A 1SRRA 5K3DA 2IS6A 1JSRA 1YKGA 3KOXA 1HSZA 2ZK7A 3CE6A 3IKTA 1KVUA 4XVUA 2JVIA 4RGQA 4CMIB 3C3AA 1BXKA 1MABB 4LZJA 3UMGA 4IKEA 3K70D 2R96A 3RT9A 2AKEA 3BIFA 2HWKA 1C81A 4EG8A 4AMBA 5JXJA 2F1JA 1Y8AA 2JFQA 3L6CA 2D4HA 4LOJA 3H04A 4QPCA 4RLSA 3T12A 3T7IA 4AZSA 4QLBA 1ANKA 4B48A 1XWWA 1MO3A 1PTKA 3TCNA 4YYZA 3LLSA 4N9QA 4NCBA 1DELA 1JDTA 1Z35A 2XE8A 3KQOA 4NESA 1SUDA 4QTTB 4YACA 3RYHA 3ZU6A 4ASUD 3GFBA 1CT9A 4IQ8A 1QH0A 5C46F 3TGLA 1K6XA 3HXLA 5P8WA 1U11A 2H5JA 3MWLA 5FOSA 3EQ7A 1XZFA 3ROZA 3OH8A 5CGQB 3R9IA 1XZIA 4X91A 5L8VA 1N6PA 2QRLA 2VUTA 4Q7EA 4AYTA 4CG0A 4OHPA 2ISSD 3ELDA 4D42A 4O5AA 5JALA 2V96A 5EJ4A 3Q10A 4X3CA 2QMQA 3DKKA 3ZX4A 1QK3A 1JQEA 4H35A 1G21A 2FVXA 1GCUA 1HLGA 1VZ2A 2I62A 3I01M 2QUKA 3QVKA 4OV6B 3T0GA 5BURA 3CCFA 3B51X 3WL5A 1PVOA 2ZCUA 1SC4A 4DSUA 3CF4G 1UBJS 1P2DA 2CXSA 4NCIA 1S4QA 1U98A 4QL3A 4YLGA 1ORVA 3PQ8A 4B8ZA 1XZQA 4XPZA 4Z54A 1VTKA 1FVOA 4P31A 3L2OB 2ZROA 3UGTA 4WFKA 2ZUDA 3PNVA 3WHPA 4K6GA 2VZ8A 1R37A 4M0PA 2GK7A 1JILA 1QVRA 1U3VA 1Z47A 2DECA 3R3WA 4LYGA 4ZT3A 3KEFA 1Y63A 3L1UA 1EVJA 4DNOA 3RUIA 5DNWA 1VHQA 1PF7E 1U2SA 2WSLA 4ND3A 4QWMA 5E8JA 5C4GB 5M7EA 2KYRA 3M9XA 4M0MA 3ZVNA 4J16C 2ZDQA 4GDFA 1EK2A 1HT1E 3NIFB 2VT7A 1C7ZA 1Y7IA 1OC4A 4ZODA 1EVEA 1DQSA 1M34E 5E95A 3IUEA 4FQ7A 3Q3IA 2NZXA 1P2UA 2R44A 1ZH0A 2FMUA 4TRMA 3RHSA 3U3XA 3VPCA 3KCNA 1C3XA 1S3IA 3D4IA 3DPSA 2RG7A 1HNXB 2WHEA 1FSZA 4X1KB 2FP4B 2IKQA 2CMFA 4D82A 2C8JA 2XGSA 4GXTA 1TW3A 2J4CA 2Q46A 3KHTA 3O26A 3SKXA 5KYUB 3VC7A 1H8EA 3ZVMA 5IH3A 1SCJA 4DCPA 3PKIA 4KO1S 2JLBA 2FG5A 1G8PA 1D2NA 3OD1A 1H2WA 5FP0A 5H9WA 2V4ZA 2VWGA 2VBCA 4PYOA 4BLPA 5I7OA 4B3TB 4YJFA 4QJ4A 1PSDA 1V47A 2OSVA 2HF8A 2Q4DA 4Y6GB 5H7XA 3SIPA 4WLEA 3PB3A 3UGKA 4BWGA 4K81B 3F6BX 3VR5D 3VJRA 3RANA 1F4PA 2GI4A 2JBAA 4G4IA 2A2ZA 2X8WA 1EUDA 4LCEA 3EIFA 1D0SA 2P2YA 1RWXA 5CIWA 4D0RA 4YR7A 3EH2A 1K06A 1X9IA 2LW7A 1DQNA 1T35A 3NYWA 4PRYA 1TT7A 1VFNA 4GGOA 4C05A 4UE6A 4MRMB 2V6MA 3QBEA 1TM3E 4ARCA 1TM5E 2AR9A 1XF9A 1LX7A 4JLJA 3V8NA 2OCYC 3PQEA 1UBFA 5I4IA 5TMPA 3CZCA 4H17A 1PG0A 3NIWA 2WQ7A 2WFLB 4JYBA 1NNI1 2XQJA 3RG2A 4EY7A 1T5IA 2DHRA 3PDIA 4P3KA 4B1FA 4D9CA 4OXQA 3RM3A 4A2QA 4EP1A 1DJPA 2GBLA 1ECBA 4ZVRA 1THGA 1WF3A 1FYDA 3AX6A 3GI1A 3VR4H 1N34B 4O1MA 5LQJA 3ZGZA 3GARA 2WYOA 3L0DA 3TWOA 2AXQA 2EGHA 3MQFA 4IXNA 1BRTA 2NWQA 1VLMA 5AESA 3K0BA 3BHMA 4BIIA 1VPTA 1ITZA 3PUHA 3RK4A 4DMGA 3ONDA 3F96A 3LY8A 5IVHA 1TLTA 2VHEA 4K6FA 4C4PA 3OP4A 3KS9A 2KPOA 5FOXA 1HEYA 2CZCA 1KEZA 2BHRA 3KXLA 4C1NA 2H1OA 2BD0A 3V1UA 1JE0A 1XA3A 4QXMA 5IKMA 3O2SB 1KH3A 3ZDDA 3BMNB 1OTYA 5ES3A 5HCIA 2XE7A 2XYVA 4WOPA 5DBHX 3KR2A 4Y6LA 3TQHA 4HBGA 4BJ3A 2Z8YM 2GXQA 2Q4OA 3FSGA 2I67A 2CBGA 2WBLC 2H52A 2AHOA 3MMPA 3PCRB 4QELA 4M1ZA 1C30B 3T38A 1CUJA 1SH7A 2QENA 3WQQA 4B3MB 3JALB 4TYYA 1QS0B 4XM0A 3LQ1A 2C4WA 3EJ6A 3VZSA 1V9LA 2CHFA 2O1XA 4YRTA 1VCHA 2OTCA 4FDLA 3DJYA 5I7AA 3M6LA 2EJTA 3VO9A 4QECA 3WIVA 4BVGA 4EGCB 3ZGXA 1II0A 1P91A 2NVOA 2O8VA 2ZANA 2VR1A 4RY8A 1T0PA 2PT6A 2VSQA 1Y1LA 3DFIA 3QWFA 5MN4A 3U6BA 5K6RA 4DMUB 3AKDA 4ATNA 2WNHA 4R16A 5JROA 3CZMA 5AUNB 2EJBA 2PGOA 5EWJA 4ZEWA 5TQJA 1RZRD 1XPRA 3DYBA 3JARA 1YONA 1DAEA 2GCGA 5C37A 2VHUA 2OA0A 3VM6A 1NXWA 5MN6A 2Q3MA 3S2UA 4KHZA 3G3EA 1VHWA 1DTSA 1Y3HA 1V16A 3JQCA 521PA 4RK0A 1XX6A 2WTAA 1WBJB 3CM0A 4HXYA 2ZJ6A 3RH0A 3FKJA 1CY1A 3DDHA 4KW7A 4BGDA 2CT8A 4RK5A 1LY1A 2OBLA 1NLYA 3RLFA 4IUBS 3RVSA 5HFJA 3DYIA 3MRXA 3DG9A 4UDNA 3OFSA 2CCJA 5EJEA 1E0AA 3FUWA 5BQXA 1C7EA 2AYZA 4OFXA 4ALLA 1KAQA 1YUNA 4IKOA 2PAFA 4ENTA 1ECLA 1E1RD 5JOQA 3EDRA 1PT7A 1Q3TA 2PS9A 1ZGJA 4TM8A 3VNUA 1VJTA 3A1TA 3EWNA 4ZCMA 3VOAA 2FQXA 4ER3A 1OXUA 2GPJA 1X9GA 4RFSB 3MPOA 4KWIA 5G3ZA 2R85A 1NIJA 1ZRSA 3DF7A 4GLJA 2UZ3A 1AKUA 1MG0A 3LIIA 3N2EA 2Q5OA 1IBRA 3FWKA 5F21A 3T54A 4P93A 2MMCA 4AYXA 2VH5R 1GA4A 1N2IA 2QVXX 3CGWA 4IOKA 5LU9A 1QHHA 1E9VA 1MB9A 4OJNA 1Z9BA 3EFHA 2QJRA 1ZICA 4YT8A 1KGDA 5FTMA 1M83A 1M3SA 3F47A 4LSZA 2GA9A 1DWQA 5BN3B 1OZAA 3D5QA 2V8BA 4ZCRA 3FN4A 3E3MA 4OSOA 2PWYA 5EIEA 1ZM7A 3VSBA 1QGOA 3BF7A 3JSXA 1HYBA 1EX7A 1VBMA 3P32A 2D1TA 2AI2A 4E30A 3WV4A 2G5PA 2EERA 4FE7A 1I7DA 1P29A 3U7RA 2WA2A 2NVBA 1WUKS 4HP8A 2HL6A 4DCGA 5A9SA 5JARA 1RCFA 4TLAA 2QTWB 2ZXEA 1V7PC 1R4MA 2H85A 1C30A 1D2MA 3OC6A 2NMVA 3CEPB 1GRVA 4N47A 4UM7A 3B70A 2ZBUA 1NT4A 3AETA 1QDUA 5CCBA 1LQTA 3SICE 3W3AA 2Q0HA 3NASA 5JC8A 1YIAA 1VLHA 3NNNA 4MYRA 2CHQA 3KPVA 2BEWB 2DAPA 2H3HA 5EXDA 3OBBA 3WAJA 2WUDA 3EHDA 3U0BA 5EN4A 4PRZA 1E2EA 2R6JA 3AHEA 2XA2A 1TZKA 3LL4A 4RCYA 1G98A 4IQJM 1K8YB 3GJYA 3THXA 4I19A 3C7CB 2C4NA 1ARZA 3NNSA 4KCGA 2XY4A 1YJBA 5JMPA 4BOYA 4UJ5A 4ESVA 4J07A 4CEJB 5FBQB 2R1VA 3I9V6 5HIAA 1H9CA 2EKPA 2O5VA 2JEZA 1TCVA 4FKBA 3K2BA 4DTIA 5KZMB 3TQIA 1XNHA 3RFCA 4A0GA 4YR9A 1V3TA 4OU4A 4NHOA 4RTQA 1OWOA 5GV7A 1XDGA 4YMIA 1KK3A 1V8FA 3RW9A 1TQ2A 5ALWA 2EJUA 4B7XA 4KC0A 4RV4A 1L7OA 4HWPA 5EZYA 4X6XA 1GZSA 2D2VA 3KQLA 2XKKA 1OI4A 3T7AA 4J2TA 5BMVF 1QR6A 1UPAA 2IYNA 5G0UA 4EENA 1P4GA 2ZS9A 5FEMA 1FYEA 1EVYA 1AUOA 1LCIA 1P4SA 3EOAI 3QVVA 2DETA 3JZMA 1SK9A 4BVJA 3EAFA 1CVRA 2FXIA 4JBIA 4BXOB 3L4SO 4ZI5A 4LVUA 4NMMA 1E4EB 1OGIA 3DHNA 4KQWA 1VA4A 3WLSA 2OP0A 4U2CA 4TYWA 1R5OA 2ECKA 1ZK3A 1CRPA 2O2IA 4FYWA 5JDCA 1SULA 4OA5A 4J7UA 2PD3A 4DREA 3U56A 2C04A 3C1UA 1M1NB 5H83A 1NVUQ 5G0WA 4JP5A 4X7PA 1T8RA 4CU2A 4UTRA 1CNFA 2QN7A 2JH3A 2GBIA 1U4OA 3V8PA 1B8NA 1TF2A 4HVAA 4FT2A 2ZUCA 4HX9A 3JAMA 1UKEA 1TDJA 3EDCA 1M8PA 3ZDEA 4AB1A 1SA0B 2CL0X 5LQMA 2DEUA 5HMMA 1FJ2A 1CC1S 2X0EA 4AJPA 1TQ6A 2N1BA 4G86A 1TJWA 3DXXA 4UMEA 5BWLA 4IIDA 1YTLA 3BJMA 4YT5A 4ZTZB 3CSDA 1NSTA 1HQKA 1HOTA 1R0WA 1V3UA 2CUTA 2BEVA 3NHBA 3GMDA 1O6FA 1UFVA 1QZTA 5A03A 5K8JB 3EPJA 2VTEA 2H4FA 3HSKA 4BNDA 4DV3B 3A7EA 1OIVA 3GEMA 3JALA 4EHBA 3I6BA 3O31A 5KTKA 1TQ8A 3CLSD 4BUZA 3K5HA 4IIVA 4BUCA 3NI2A 4TMVA 3D7KA 4NPAA 2NADA 3A05A 3R75A 5CA1A 4C14A 3Q41A 4YREA 1DOZA 3EXFB 1O4WA 4GX2A 2QPOA 2OVFA 2GPNA 2HHCA 3A1VA 3THOA 2PTSA 1S8FA 5CK4A 5DXAA 4XW2A 4CUJA 4ARIA 5I7HA 2J7PA 1OBVA 1W35A 3ACCA 1TCCA 4WZBE 5EZ5A 1N1EA 2C2MA 2QTVA 3V1YA 4EPXA 4PIPA 1H9AA 2YCLA 3BGIA 4URYR 4XXHA 3T1VA 4E6EA 1IBKB 4Q9JA 3DVRX 1YC2A 5H3LA 1VCNA 3AONB 3HZHA 2JA2A 4JZYA 1OVGA 2QN3A 3R6WA 5GJVC 2V9ZA 4PX2A 4J1SA 2CKDA 4CF5A 2AYYA 1OZ0A 1PEDA 1A50B 2XT0A 3MCTA 4OGGA 4BMSA 3EGXA 4WZAA 1CS4C 2UUBB 2Q3LA 5A5EA 1UK9A 5ITZA 2FSFA 4U2GA 4FFBB 3DT6A 1YFMA 1U1EA 2PD6A 1KIAA 3DUWA 2V3VA 1HT2E 3AL2A 4PG6A 3P0HA 4CDMA 1N9GA 4PC6A 1EXMA 1U31A 4FIDA 4GMXA 2QNIA 2F6RA 4YJDA 2TMGA 5EYPA 2HM7A 2W93A 4K9LA 4MXDA 3J7AC 4Z7JA 1KVRA 2V6BA 1J8FA 3BGVA 5CW1A 2IOYA 3KYIB 1CUZA 3G8CA 4B43A 2GRUA 1QH1A 1EXNA 4YPFA 5K4HA 1CUXA 1FMCA 2BTQB 2FPPB 2IZ7A 3CH6A 4DLUA 4AZ3A 3I32A 5AD1A 3N2KA 2P9HA 1M6HA 3A6KA 4I9UA 5BY2A 3LO8A 4UQLA 1P7VA 3U48A 5BNIA 4RAQA 4R2JA 4YV2A 1F5SA 3SZ3A 2AXNA 2H48A 1AQUA 4RY0A 1UT6A 1GQYA 4GNRA 3U3JA 3WWOA 5GPBA 1M1NA 2ZT6A 5FPSA 2QYOA 3PEVA 5BN4A 1M0TA 3D5EA 4DCJA 1XV5A 3V46A 4YCMA 1OBFO 5CYPA 3ANLA 2G5TA 3OTGA 3ZVRA 2AX4A 2PS3A 1Y3CE 2FSPA 5JLAA 3T6KA 2UU9B 3BWDD 4PFJA 5FV4A 4KGDA 5A5FA 5ALOA 2GFHA 2TS1A 1P81A 1QBKC 3DZFA 3HCOA 5I4CA 5JAUA 2BFEB 2PVPA 4G5HA 4D0LB 4EEKA 2YOFA 3WK4A 1UBLS 1MJGM 4MYUA 1JFFB 3URMA 2X40A 1TW2A 2WYIA 5BQOA 2YYZA 2YN0A 2ZI4A 2GGSA 3MWEB 1QJCA 5EAIA 3E2MA 1K66A 3AEUB 5CDHA 2H65A 4PLZA 5E3IA 2OV1A 2FUCA 1GWNA 2VQ6A 5H68A 1OROA 2HJ9A 2R6AA 2GDZA 4JODA 4TVBA 2AOXA 2HX1A 2JVKA 1GKYA 3NIDB 4JQCA 3UJAA 4CKXA 4UDXX 5HBRA 2Y67A 2X19A 2BBOA 5C3MA 5C51B 1EDDA 2H57A 1J9ZA 1M0WA 2W6JA 1IE3A 3OTIA 1J99A 3PGJA 5EKUA 1IHOA 4LZWA 4ISBA 4BAUA 3AM3A 1NIPA 1ZN9A 2HBZA 2NZYA 1PR5A 4CMJA 3EY4A 3IS3A 5HZMA 4KAXA 4QBTA 3L7YA 3FNFA 3TOXA 3KM0A 4HWKA 2DUMA 1W0JD 4JEHA 2NXJA 2VHXA 3IUPA 4L5BA 4R84A 3AKZA 1Z0FA 1KYIA 2B2CA 1JQ3A 1WM1A 4H1UA 4LBZA 4OHZA 1AQ6A 3KU1A 1Y82A 3HI6A 1JW9B 1C1DB 4IMIB 2DLNA 2QYTA 4L15A 4E03A 5KQGA 2Z9BA 3KCQA 5ER9A 1WW2A 3E18A 4N5IX 4U7HA 2W2OA 1YDEA 2Q50A 4TUYF 5REQA 3DQZA 2PU7A 5EZYF 2XXAB 4MH0R 4WK6A 3E27A 1J97A 3IKJA 4R31A 5FUVA 3HN2A 3VXKA 3ZC3A 2J9FA 3L0SA 4YP9A 3H9UA 1MP0A 1O96B 3FNQA 3WYFA 2K4MA 1YUBA 4O08A 1G2OA 5DSZA 3LHFA 5FYDA 3LF1A 1Q1QA 3ICQB 3MGKA 1CQJA 2ZRAA 4QRHA 7AT1A 1IZ0A 3TVYA 1NY6A 5EE1A 3R4CA 3N7AA 4YCCA 3OCYA 3EAGA 4MLDA 3MYRA 4A8JA 3BRWA 4D8TA 3KK0A 1Z5NA 4BN0A 4YRFA 4TRJA 3X44A 1S1CA 3ABZA 4FQ8A 1LF0A 1UUFA 3WBJA 5G41A 3ZBQA 1W4BA 1JE1A 1GUBA 5B64A 1PI3A 3UHPA 2FP3A 1AUXA 3NBYC 4DA4A 4JB8A 2YYAA 4ARZB 4IMJB 4Z5XA 5GADl 2CWWA 2ZRQA 2A8YA 2DR0A 2JFHA 3OWOA 1VBKA 2LNDA 2Z3ZA 1VYHA 3GJZA 3H84A 4K87A 1BEEA 2PM8A 4C0KA 2Y92A 4LG1A 2VP0A 3I6ZA 2ZI6A 5JNTA 2VAPA 2W2XA 4QUAA 2E4UA 2X4LA 1CUSA 1K6EA 1S8AA 2GJ4A 3R6LA 1NVBA 2AQKA 4YJKA 1FTGA 4INOA 2HK7A 2QD4A 3AJAA 4X7RA 3IO3A 4B7CA 3H16A 3MTEA 3HZRA 2Q1WA 3MJEA 4KX5A 4TKLA 5CNKA 2OHIA 5K0TA 3MRTA 3FPCA 1Z4OA 3PLRA 3X1ZA 3W9SA 4M37A 4DYVA 2JKVA 1G2IA 4DLNA 4HRAA 4TYMA 3LZ6A 4A6EA 3HM9A 1GG2A 4YWJA 4X8MA 3NOOA 2HLPA 4OHBA 5HKBA 2VP6A 3DEKA 4OHWA 2RGXA 3INYA 1UXHA 2X3YA 1M2VA 4EJ2A 3WSWA 1ZHOA 4WBNA 3M6VA 1I1OA 4UUBA 5GIOE 2ODNA 2VDNB 1QOZA 4RO0A 4BEVA 3AB8A 3OEYA 4RF3A 5ALKA 4EY6A 2VJKA 2PUHA 3BCHA 3I5AA 2O48X 3RV3A 1NNEA 1IG3A 3MJCA 4F2HA 2EKZA 3WMXA 5JJBA 1XNRB 3GLIA 1E3SA 2VF2A 2JZOA 3C5VA 3IOCA 2W2QA 1BFUA 3DS8A 5T3YA 3KJQA 5B4VA 4JIMA 4JUAA 4MS1A 3L7MA 4LE1A 2FR1A 1AG9A 5IXYA 3C7AA 1MOPA 4HBZA 1U4SA 5LOVA 1EDEA 3LW7A 2NYAA 4WWHA 2P8JA 2ZCJA 1TAGA 3T7TA 2PYZA 3AFHA 3JQEA 3TQCA 4ZV4A 3C3EA 3HR7A 3L77A 2GZHA 3VHXA 4IDGA 4RVOA 1QV9A 3RUDA 1M2KA 3ZHRA 1GFZA 4Q4HA 5EJ2A 3QLTA 1RRFA 4DEVA 1D4FA 2PTGA 3K53A 2OMEA 1KWKA 5JDCC 1JHMA 3ORFA 3A6ZA 4MV0A 3TQQA 2GUWA 1N3BA 1IL0A 1TX4B 1D8AA 2ODWA 2CYCA 1UK7A 2Z8XA 3K0KA 4FCCA 4CM3A 2C1EA 4G26A 4YMUA 1C8BA 2ZR0A 3LUGA 2X4DA 2I65A 1UZAA 5DISB 3SY8A 1L5HB 3DH0A 4LRQA 1Q77A 1UK8A 1NQWA 3BREA 4WUTA 4EA6A 1DQRA 1UOOA 2P9ZA 2O3JA 2XWJI 1AK2A 1T6BY 1V16B 3NWJA 5CHYA 4B3IA 3SC4A 1ZSNA 2XSZD 3VO2A 1OW3B 2R5NA 5ALZA 1JHZA 3UVEA 4EAQA 5EJ8A 2ZRMA 2GILA 2JS7A 1JFFA 2EG5A 3CKMA 4XJVA 3R3XA 3IVCA 3N58A 3O3CA 1VRCA 4DS3A 3FLEA 2O20A 1RWBA 3CX8A 4HB3A 1AH2A 1CQPA 3AMVA 3KOOA 5EINA 4D80A 2WLSA 1QQ7A 4RHTA 3WQBA 1UKZA 3C14C 3Q2IA 1D3AA 3GWZA 3EXHA 1JDSA 1XBTA 4LGYA 3RROA 3S7ZA 2ZVDA 1P8JA 1PP4A 5DPMA 4V02A 2IF2A 3HB7A 3FLMA 4ND5A 3SWWA 1FNDA 4W1PA 4Y6OA 2BHSA 1RLIA 3RC1A 1I0ZA 4RPIA 3A9UA 2AH5A 3QVUA 1NC1A 1W87A 3U60B 3FUTA 4RETA 1JLRA 3C1OA 3ZGLA 3E9CA 1E98A 4GF5A 4Q1DA 4HXGA 1XD2A 4QREA 1G60A 2P6UA 4XQEA 4UVDA 5CTJA 2D2IA 3OQIA 1FQJA 3Q2KA 4EI9A 4B2YA 2C31A 1SUEA 3OX2A 4I1OA 4MR7B 1KXZA 1GPAA 1SBTA 2EZUA 4PFKA 5BN3A 3HHPA 1CUBA 5DNYB 1WDLA 1WQ3A 4WCFB 3SVTA 3FTNA 1BCRA 3IKLA 5LMUB 3KZKA 5ALQA 4PZ0A 4HPJB 5CVVA 4YECA 3IRVA 1NPTO 2QN1A 1YFLA 3GD5A 1GCAA 2R62A 1CUHA 1DLIA 2JRLA 2QR5A 3H42B 3IQDB 2F00A 1VB5A 1UMCB 1IY9A 1L1EA 1RAHA 2YVKA 3SOZA 1ENZA 1IB6A 2D0DA 3Q12A 4Q4AA 3SX4A 3W4IA 3W79A 3TX2A 3TUZC 1UOEA 2FDCA 2J59A 3VVCA 1J7JA 1ZCBA 3CF4A 3K92A 5JADA 4DLBA 4X90A 4FE3A 4JUCA 2ZJZA 1J33A 1LC3A 5I8ZA 3ZQUA 5B30A 4NECA 5CBPA 1MNAA 2ASEA 3CU5A 3P0RA 1CJCA 4BZZA 4BFTA 4ERNA 1IM2A 2CDRA 3QELB 3P20A 4HAIA 5JJKA 1OPXA 3IVRA 1LW6E 3LP8A 3OZFA 1TIBA 2JFPA 5JMWA 2D7DA 1JU9A 2EYQA 3OKAA 3OQVA 4ZGBA 4FMBB 1B26A 2OXRA 1Z16A 3WDMA 2GB4A 3VDMA 1NM5A 4EL0A 3KUXA 1JDNA 1I30A 5SV2A 1XCPA 1XZJA 2B8NA 1N1MA 2P8SA 1YQDA 3E61A 2V45A 2JIBA 2ETVA 4PFSA 4H16A 1E77A 2GZRA 4DY4A 3OEHA 2ZE5A 3GUHA 3U3MA 2QRHA 2HCTA 4IUYA 1YZQA 2CWDA 4PR0A 5CJPA 4YWHA 3RDPA 1RNLA 2BCEA 4MRAA 4P54A 1E1DA 2EX4A 3PBKA 4Z8XA 3VH2A 4R2HA 3IB6A 3R0IA 1JKJA 1S8OA 2VRBA 2P6OA 3AC0A 2OAP1 4H18A 2XBMA 3PUWA 2D1SA 4KGVA 4EAAA 1G66A 1Q2XA 4ILEA 2Q8QA 3S7TA 1ISRA 1U3WA 2ODTX 1TKBA 1ZXLA 3PC3A 4QDXA 3Q88A 3VR6A 4MUEA 2Q7DA 2IDZA 4UU0A 4J1TA 2F9MA 1E3JA 1MENA 3L01A 2IEZA 1QHYA 5LA6A 3WGTA 1Z2CA 3QPVA 2Z1NA 4UU8A 3WDSA 1R0RE 1BDBA 3BMXA 3ND8A 3T7DA 2F3TA 3JD2A 2Q4TA 1I2CA 2YWGA 3AZOA 3Q3CA 3GLFB 5KC8A 2PH1A 3HB4X 1U3GA 2YWBA 1GP2A 1Q95A 3A70A 1DXQA 1UC8A 1Z5GA 2A9FA 2DGDA 2HMTA 4D4LA 2WM8A 4CHTA 3Q7PA 1I3MA 3IQZA 1ZVKA 3EZ9A 4HGNA 4S1OA 4Z4HA 1FRVA 4WBNF 5IRCD 3AG5A 3KBOA 4XB1A 5KQPA 1B0AA 4WK2B 3I1FA 5JD4A 4JQSA 2V7VA 3KQYA 2A9JA 2YZ7A 4E6PA 2RHGB 2ZXUA 1KRXA 1X19A 3DOFA 1MAHA 2ZB7A 5CNJA 5AM3A 5JH7F 2R0QC 1XTZA 4TLLB 3P9PA 5HJEA 2PZFA 4MB0A 4W5OA 4Q9NA 1ESZA 1A0OA 4CI9A 1XMIA 2P65A 3VI3B 1SG0A 5CXXA 5JCPA 1AGYA 4QYWA 4RPGA 2DRIA 2ZSBA 4U6QA 5EJMA 3ON5A 3BOSA 1ADYA 1RKUA 2E85A 3NDRA 4PZLA 5AVOA 4XAQA 5AKHA 2LE0A 1XWIA 3OIYA 4JXKA 4TV8B 1QFMA 3GCGA 3G2QA 2W71A 3TI9A 2CNWA 2IY8A 3N1UA 3R7NA 4EB6A 1L7PA 2F7SA 2HMSA 4F38A 5B5SA 3G79A 4ZREA 4ZTUB 4BVAA 3RC9A 4C4YA 4E13A 1O0CA 1PE0A 2AFIE 3A58B 3I6IA 1Z6GA 3TI7A 4ZQEA 2X13A 3UKJA 5LMCA 1NXXA 2VPIA 3Q3VA 4LKOA 1ZMOA 1U0GA 4M0EA 3KUUA 4MS3B 5EA2A 3WBFA 5EMLA 3EVDA 1Z6AA 3WGLA 1RC0A 3EHEA 2BEWA 2FSSA 3L05A 3JQ6A 2FWRA 5HOEA 5K3FB 5DLDA 2NO4A 4AS3A 1NJFA 4ZVLA 4C2BA 5CIYA 5DHTA 1JR3D 2I3BA 4CTJA 1I2DA 3BH7A 4Z4CA 2AB0A 3OQ1A 4YQFA 1UJ4A 4HPWA 3TQFA 2ZTSA 4L16A 1K62A 1S7CA 2JJQA 3BQMB 4X5OA 2IXBA 2IW1A 1PNOA 1BKYA 3L6RA 3PC6A 2ZI9A 4JUDX 3QF4B 4KBYA 4MKHA 2FJUA 3BIOA 2D5AA 2RB4A 1LLFA 3FUCA 1ACMA 1A9RA 4TX1A 4Y6SA 1NU6A 5GM2A 1R88A 4JLBA 5D6OA 5IDVA 3ZJUA 2AN4A 5SYMA 1SHUX 5LXTF 1YO6A 5K6TA 3VAAA 1XNQB 4V2IA 2M1ZA 4IVPA 5LMNB 5KOYA 1K7EB 1PCXA 4IDQA 3PLAE 3FGNA 1Y7LA 1JAXA 1UBGA 4V1CB 1WMEA 2XRFA 4KYTA 4Z2YA 1GU7A 1NF8A 5ALDA 3EEQA 5NULA 4IQ0A 1EVZA 2J9ZB 4G3XA 4BTVA 1JDBC 2IP4A 4LWQA 4G2NA 4R9RA 5BRJA 3O8RA 1TVCA 4ZYLA 2PEYA 2CJPA 4KR0A 3TIFA 1O95A 4DVJA 4Y2QA 1P3DA 4YMGA 4LJRA 2LXNA 3WIDA 4PX3A 5EERA 2JJMA 1AVTA 5EPEA 2CCKA 3FYDA 1IM5A 3B82A 4KXUA 4OLFA 1E7WA 1UM9A 1EZ1A 1SZJG 2HQSA 3IEMA 2EKLA 3QEBZ 4UHKA 1Q19A 4MSUA 5I7WA 3L0YA 4R1UA 4DVGA 3HDTA 2OCPA 4FX5A 4Q1FA 4Y7DA 1F12A 4GWLA 3EUAA 2NX2A 3AKYA 5EJFA 1HURA 2QUHA 4LTNA 4A0RA 1V3VA 2JKYA 2IU6A 1ICEA 1JHXA 3FWYA 6NULA 3L49A 3OT4A 5BQ5A 1FS4A 1SM4A 3K72B 2KM1A 3UA4A 4AIRA 3ZIDA 2F1KA 1DKOA 1LJUA 3I8SA 1IRXA 1N36B 1E1KA 3OU7A 3ROXA 2FU5C 4C0JA 1G4HA 3SQOA 4L9RA 1E79A 3FTEA 4XSGA 4TOIA 3UJBA 4QWWA 1VL8A 4MGHA 1P1FA 3F7TA 2R5FA 3NBZC 3MJHA 1JMKC 4M1MA 1DIRA 4IV0A 3UUEA 4AC9A 3NYRA 2A3RA 2AEFA 3GJ7A 4RSGA 2V5UA 1L4MA 1REQA 4QGGA 1XOIA 5AXCA 3QPUA 4Q1EA 2Y66A 3ZH2A 1P2GA 4IZIA 4CLRA 5LFAA 2HMVA 1B1AA 3QOFA 1LB1B 4DUZB 2OYCA 1Q12A 1QIMA 4H2DA 3EMVA 4L8FA 4A9AA 3U81A 1K4YA 1VMEA 1W96A 2BY4A 3FWZA 1XEAA 4L8VA 3TCKA 3GJ6A 2D5IA 2BE7A 2JIOA 2RGYA 3VYRB 4AFNA 4PHGA 4PG5A 4UUMA 5EFOA 4I4IA 4RJKA 4KODA 2P6NA 3HB0A 1WUJS 3IPYA 1WHSB 2IZ5A 3D8UA 4KSBA 4IOMA 3ZWNA 4AO8A 2X8BA 4P4SB 3D8TA 3MBOA 4ROTA 4ODIA 1E6KA 1F8XA 1XE3A 2G6TA 3C24A 4TT8A 3MLEA 4HYEA 2HCJB 3KQMA 3HXTA 3SP1A 4EVRA 2JA1A 1ULHA 1FB5A 3LW8A 4PC2A 1J1ZA 4JVNA 5BV0A 3NYIA 3BE6A 1ZH6A 4OIFA 3JQAD 1G0OA 5KYVA 4J0HA 3KG2A 3MGAA 3O8LA 2VDPB 2FOXA 3QIVA 2EF1A 5DHAA 2R1ZA 1AMUA 1TJVA 2IELA 4NU0A 5JW6A 1YRLA 3VGPA 3ADKA 4AL4A 1BO6A 5FWXB 4GSKA 3IJEB 1XC7A 3NG1A 3UB3A 4CU5A 2DT5A 2DCUA 1T2DA 4AG5A 1UPFA 3NHLA 5F3RA 3Q0EA 4EDHA 3WHKA 2Q4BA 5IJAA 3UM9A 4LY3A 3HL4A 4QGFA 1TUGA 2DPXA 1R0CA 2XT6A 4XRRA 2UKDA 2QNBA 3N5CA 5CLLA 4TL8A 3I2YX 2QYSA 1Z56C 5FBWB 4FB5A 4Z4EA 1WF6A 3QP9A 2WIJA 4J75A 3TLCA 2P6MA 4F06A 4BGEA 3LA8A 2WSMA 5C34B 1HRKA 3OZXA 1ZJWA 4ALNA 4YHHB 4IX1A 2PLNA 2RIRA 3R6QA 3D7NA 5L95A 2OFFA 3G1UA 2ETXA 1JHPA 3E9DA 1LI7A 3M1LA 1DO0A 4LHYA 5EE9A 4QOJA 1OU0A 1N7HA 5F1PA 3V00A 1PNVA 1J2UA 2PH7A 1L8QA 2G8NA 4L78A 5E2BA 1T2CA 5AOVA 1FDSA 3ZJ4A 4KRFA 2B82A 1NQ5A 2B37A 5IM5A 4EYKA 2FW0A 2PE5A 1OY1A 2EQBA 1NUQA 2CFIA 2IVZA 1KNQA 4PNPA 1IQUA 4PPYA 2YHAA 3RIXA 1J6UA 3TKLA 4MCJA 4HSGA 2F3PA 2Z5GA 4CQMB 4J0GA 1C8KA 5JHGB 2UXDB 4BMZA 3HJCA 2QORA 4FBGA 4NG4A 1EK6A 1Z8NA 2PUJA 4LJSA 1D4OA 2PO5A 4MI9A 2NSLA 2W6PA 3ZW8A 4W5QA 1ZJYA 3T1HB 1PV2A 1SC1A 4IWNA 4LCBA 3TSAA 1ZM4A 2ZSKA 1A2KC 2B5OA 3F6RA 2I33A 1X87A 2XIJA 3GEGA 4D0NA 3RFVA 1P0FA 5JO0A 5KVQA 2GD6A 3AHCA 3UXYA 1Y4UA 4A92A 3FHCB 3E0QA 4GM1A 2HB6A 3SYLA 1X7ZB 1J90A 3IEXA 4YPVA 1QMPA 1GLVA 2ATXA 5AP9A 2WF8A 1U3FA 1UMKA 4NJEB 4KEAA 4PAOA 3K16A 2B92A 1G6HA 1CDDA 3QW4B 1BE8A 4PZPA 2Q8NA 1QLWA 4LMAA 3U4MA 2EFJA 4WBSA 5LYJF 1DUSA 1EDZA 1WCIA 3TG8A 2IY9A 2QZJA 3PEFA 3S27A 5K3OA 4U7FA 4JI0B 1FYVA 3HWSA 1YZFA 1VGQA 2II6A 3C8ZA 1Y4DE 2JGMA 1EU1A 5F7XA 4CR8A 1QVVA 2VNJA 3I12A 4TL7A 4CLOB 1MAVA 5CLJA 1V1MB 4UTZA 1BX0A 4P3NA 3T3OA 2QMUA 4OHMA 2PHZA 4R01A 1U1IA 1IU9A 4GIBA 1NQUA 1ZKDA 3B3QA 3ESQA 4K9SA 1JG7A 1KMHA 2AG0A 4ZV9A 3GLSA 3IP8A 2EQAA 2JLCA 5BSHA 1Q21A 5FQNA 3W5HA 1EP3B 4N8DA 3BHGA 2P2NA 1E1RA 1L9XA 3JQFA 4DADA 1E32A 3BTOA 3UTDA 4NP6A 4W5WA 5C8XA 5BNWA 4IG9A 1IJFA 2KLBA 2W2PA 3W3AH 1E5QA 3TIVA 1FTQA 4PGMA 1ZQ9A 3R5KA 2BISA 4D8YA 1YFKA 1RXCA 2IDJA 3KSRA 4MZXA 1TK3A 2VJMB 1CR6A 1PJCA 4L8GA 4UM8B 3EFOA 4OPMA 1Q14A 1TIKA 1KK0A 1T4GA 3QG5A 5DOVA 4G1MB 3F6YA 1EDOA 5EWJB 4Z4GA 2BH2A 4G9EA 2AG5A 5KNDD 3IEKA 1EG7A 2WVJA 4MAMA 4C78A 1N9KA 4ZP1A 3FYTA 3SEFA 3U4HA 4B44A 1G18A 4CF7A 3RTAA 2QX6A 1SVSA 1YZVA 5EXXA 2E4VA 1M8FA 1YBAA 5ARCA 4A6XA 4BJ5A 4D8UA 4DMKA 1C9JA 4CTMA 4TKVA 1YZTA 1VPDA 3B6KA 2I4MA 3K7EA 1R8SA 4DC1A 1Q44A 2A0UA 4INAA 3FZYA 4RTSA 2GTPA 4R6WA 3OQOA 2BF7A 3SXJA 4DPKA 2B21A 1XQ9A 2FPOA 2P1ZA 4U6SA 5CAEA 5IJ9B 4BPRA 2PX5A 3A06A 3FPEA 3OCZA 4FI3F 2X5JO 5D5PA 1HEUA 1XDWA 1IBSA 5IM4A 1Y34E 3IIEA 2QHXA 1ZGAA 2WZDA 1PX2A 3LX8A 3D6JA 3ODGA 4WDRA 3WYNA 3OJWA 5TR9A 4AX8A 4BB0A 5BT9A 1PTJA 1GTL1 4O2RA 4BGVA 4G63A 4S1PA 3IUQA 1EFPA 1YKSA 2ORED 2WVAA 3WGQA 1JEOA 2J7KA 3RTGA 4EGSA 1VJDA 2HHAA 2Y27A 4HN4B 1ULAA 1RYHA 4LV6A 4DUGA 4PU0A 2VQEB 3ZDBA 3MTGA 3GO4A 2W37A 5K09A 1CXZA 2QXTA 3LDFA 1UXIA 1S6YA 2G88A 3BXOA 3R3ZA 4PHTA 4BNLA 2ZU0C 3W5UA 2I9PA 5CRIA 4B40A 4OUDA 1K5HA 1MZPA 1HDOA 1FUYB 2FWIA 3PHJA 2NTEA 3TTWA 3DNMA 1CB7A 1TT5A 2IZ0A 3RVMA 2JEOA 2Q3EA 1SOVA 4JFAA 1UMCA 2PWBA 5AJVB 3C45A 2VLIA 3EIOA 1QRDA 4NCNA 5C4IA 2AZMA 2BUCA 2RAUA 5G4KA 3IDOA 1EBUA 4MKXA 4ND1A 1CRZA 1EFRD 3V1TC 1H2ZA 2WYWA 3VHRA 1TM4E 1ZUNB 3F78A 3OCJA 4DV2B 1I3KA 2BGWA 1SKQA 2GSDA 2LVBA 1RI5A 1I9CA 4FHZA 4L72A 1WZEA 4MWSA 5KYGA 1QYIA 3VOBA 2B78A 1G2PA 3AQ4A 2AVNA 3LZCA 4TLEA 4LSGA 5BRNA 5TT0A 1SBQA 3NBUA 4MUGA 3KB2A 3K1ZA 4NDAA 1IWOA 1E8NA 1RVV1 1V2HE 1Z73A 2V98A 3RTBA 3S70A 1RACA 3P9IA 2ZJ3A 3MOGA 5ANRB 4C6RA 1FMJA 1E3MA 2RB5A 4J29A 4P4LA 1KPHA 4UC0A 3UAGA 1PV4A 4E5KA 2W42A 4DQXA 3HL0A 4OM7A 3QITA 2J5RA 2A0YA 2V59A 5I9NA 9MHTA 3QENA 4WLOA 4K86A 4HQRA 2OHHA 2IPMA 1XP8A 1XWOA 1TMYA 3ZYZA 1N7IA 4M49A 3NGLA 3NUGA 2QVGA 1NN1A 2DUWA 3IELA 3L7LA 1WCV1 1VI6A 5T4EA 5CBKA 5KQRA 3D3WA 4F96A 1AUVA 1D4ZA 3KC2A 4RANA 1ID8A 1G21E 3T3HA 1JSZA 2CJWA 1DDGA 4YXWD 1USGA 1VJRA 3F46A 1DCFA 4ZIRB 1QP4A 1PT5A 1MPXA 4BU1A 1VHJA 4NOJA 2EARA 4FMDF 8GPBA 2XUDA 1XHEA 4MAFA 4NZMA 4XA8A 1C3UA 1F3OA 3GELA 2WF7A 3HP4A 2BFBB 5AJWA 3U3KA 3GFPA 5A4AA 2SKEA 3BPSA 2V0GA 1R00A 5FO0A 2CDBA 4EPYA 1YAHA 3WLQA 3HU2A 4P0QB 1W5AA 1P4AA 3H6HA 4DCCA 1GFSA 5GP1A 5JTUA 4Q3DA 3JU3A 3IE0A 1H1LB 3DPIA 4A8JC 2BJVA 5E3JA 1Z22A 3SYTA 3E3LA 4FFWA 2BZ0A 2WABA 4JAVC 4FYJA 1E2DA 3WBBA 1RM0A 2FFRA 1GNVA 1TJ4A 4JUBA 5AK3A 2B8TA 2F67A 3OQIB 3UK1A 1UBSB 4MPPA 3WSVA 2XBLA 3V48A 5FR2A 1JPJA 3VKVA 5HGXA 1S9HA 1G8YA 1U8XX 1Z7YA 1M5UA 4OHOA 1G8SA 4ON9A 3GT0A 1O77A 2H0AA 2I55A 2O2EA 3KDPA 4ZI7A 5CFOA 5JECA 5JXIA 3F7OA 2V55B 4MWOA 3DOHA 2BC9A 2ODEA 1G4AE 3PRYA 3EIWA 4B71A 5HR5A 2NZ8A 2FUKA 3SJ7A 3DB1A 4LF9B 1PZMA 3K20A 3DHYA 3A31A 1JN0A 4FHEA 2W98A 2ZRKA 2PMFA 3DBRB 3FGZA 3LDHA 3I3OA 1XEWY 4FYKA 4R9NA 3OAAA 3WWZA 1N1GA 3MOIA 4DE5A 4UPEA 5K0ZA 2AK2A 3ULKA 1IXSB 5M29A 1G42A 5LQSA 2XTAA 1JEEA 1YJ8A 4ZALA 1R9GA 1MA0A 4BASA 4HQ0A 2PD4A 1KYTA 3HKBA 4BN4A 4H1WA 5I5GA 4F72A 5KNCD 3FD8A 1C9NA 1H69A 2BW0A 3SEQA 4C7JA 4AG3A 5EWLA 3V9AA 3VO1A 4AJEA 1C1HA 3ZXSA 4NVRA 1VDZA 2AE1A 2IIBA 3OT1A 1XD9A 3PI6A 4UBMA 4DZRA 1C8LA 4A8TA 1HEIA 4D41A 1TD9A 2HHHB 2C5GA 1POXA 2WILA 3JQDA 1EE1A 3FUUA 1ORIA 1L5HA 4RCVA 5F92A 4K1LA 4GNKA 2OZKA 4QYIA 1FXWA 3I52A 4M21A 3FF4A 2QRPA 3KJFA 3KLPX 3KDSE 4J7CA 4RHCA 2RFLA 3VR1A 3T1NA 3STYA 4OD0A 2JGDA 2Y4OA 1UBUS 5CK5A 1X74A 3T3EA 4ZCLA 4TMZA 4KFUA 2ONKA 3DGEC 1Y9ZA 4L0MA 4M53A 4R7ZA 5CX1A 1PYOA 5DGXA 4AZ0A 4DCOA 2M2IA 4AAYA 4N3NA 1DXOA 5EEGA 5ADWA 3RS8A 2IYTA 4AN4A 1E1CB 4EA7A 1AB5A 1QPBA 3C3JA 3CLRD 4BNGA 1ZFNA 3D8RA 1VMAA 3NVMB 1QTQA 4M8IA 3M89A 3TFQA 1TRHA 1HTTA 3EGDA 2OPBA 3GXBA 2C2GA 3HKCB 4IGFA 4WKPA 4YJ2F 7MDHA 1ZI6A 2AS0A 3N07A 4DABA 2HLHA 3X2EA 4HB4A 1OFIA 4ID9A 3ANMA 3K8QA 3WLKX 1QAOA 3ZU2A 3ZZ0A 4ND2A 4LJ5A 5E1BA 4AU1A 1NYLA 2UYYA 3DZ8A 4XYLA 2ZJ4A 4R7GA 3UWPA 4FCTA 4XTRA 3E4DA 4P81A 2X4GA 1W19A 1ZYUA 1NAIA 1XD8A 5AI9A 4LXQA 1HZZC 4L9SA 2VPQA 3DFFA 1U5AA 3G68A 3NO4A 1Q92A 2MYNA 4EDFA 1G0NA 4PZZA 2Z09A 2Q21A 3VYTB 3FDJA 5IN5A 1CJVC 1BMTA 1YDWA 2POCA 4O4LA 4TWRA 2QW0X 4QGAA 2BYTA 1B76A 1TJNA 3EZLA 1II9A 4KIJA 4KQCA 3TINA 3F4BA 4LSWA 5FI0B 2OZLA 1I32A 4C7MA 1FUQA 3ZDQA 2XBUA 1NOKA 1TYZA 4RZ3A 1E0JA 1R8JA 1E69A 2OGZA 4FNAA 4HZIA 2M1XA 2JFUA 4ZI3A 3HYCA 4MCAA 1J4AA 3PX3A 4J1NA 3R9WA 1L7NA 4MVCA 3L92A 1EFRA 5FPYA 1TTTA 1GNQA 2V7QA 3PP8A 4D9JA 3SJUA 4U6NA 3V3KA 2ZKLA 3D2CA 2D2FA 2V5AA 4HLCA 4I4TF 4XRGA 3DEZA 5KVCA 1WD7A 4NCJA 2I54A 4HDMB 4Q6BA 4BVFA 4YV1A 4KYIB 1H3EA 2J9XB 3LKDA 1DDOA 4L0CA 4C87A 4ENPA 1O57A 5B2EA 4CIVA 3PNLA 3H1GA 1JI3A 2WE8A 4PX9A 2GWHA 1GT6A 1S3FA 1Z4QA 1UP4A 1Z36A 2NUPA 1QZZA 4MRNA 2P4QA 1OLSB 1UWKA 4LMPA 2F48A 4ZCSA 5JVDF 4LF6B 3FFTA 3IHLA 4B82A 1EP9A 4Z1OA 1RAIA 2YMQA 3OFND 3J7TA 3RAEC 1PVVA 4B83A 2O6HA 3I0ZA 1W5FA 3CYFA 5EIBC 1SUPA 4HUQB 4ZXPA 1QQ5A 2HGZA 3B48A 4HO1X 5AW6A 1SBZA 2ZWVA 1FDUA 3DHWC 3G85A 4WVLA 4EJMA 2Y76A 1YR2A 3M6AA 4FYXA 3DL2A 3DMYA 2RGBA 1GYPA 2ZT5A 3CUWA 5AK5A 3O2QB 5C7LO 1DO8A 4YCLA 2GNAA 1T4CA 1N5LA 5CVUA 2I99A 3TS1A 1P4JA 3L41A 5JAIA 1UOQA 2BEUB 3PXAA 1CJMA 3PQFA 1Q1GA 4HQ6A 4JBXA 1F7VA 1ZIPA 3LT4A 4GUAA 5FOVA 3N7UA 2C5LA 5F4BA 4IV5A 4DLTA 3S81A 1SUSA 2RGGA 1PFGA 3WLEA 2H2WA 2NO5A 3A14A 3NUZA 4GEKA 1K7YA 3SJCA 3IPLA 5JNLA 4BQPA 4R71A 3B3JA 3LK7A 1SG6A 4K5QA 2VTBA 1ZU4A 4ZO7A 4AICA 1RKVA 1GRQA 2I2FA 4KWCA 3RVDA 4W5NA 1Q3KA 1IN1A 1NFRA 4MRRA 1D6JA 2FLKA 3ZY6A 4E5PA 5I7SA 2FSUA 3RODA 1LWNA 2VDRB 1T8YA 2VZ9A 3ZDYB 2QLNA 4RZIA 5JJLA 4HJXA 2C99A 4X8OA 2BH9A 4KAFA 1W1UA 1SIUA 3WB1A 1W36D 3GBVA 5KBYA 2EJWA 1VSTA 2GAFA 2WSSA 4P7BA 4UXJA 4BJHB 2FW9A 1TD1A 1RQLA 4TWJA 4QBGB 4YYEA 4JLOA 5TNXA 4BFCA 1YB4A 1W0JA 1FSGA 2FOLA 1XK6A 1Y3AA 3C7TA 1DKMA 2DQ4A 5FBZA 1P9NA 2WJVA 5D87A 3LAWA 5FT9A 1G6KA 3X0DA 1M6VB 1ZPDA 1SKYE 2WJ6A 3QUAA 5AKLA 3KKQA 3UAWA 3V4SA 4H7EA 3LPNA 2WWVD 3CIFA 1CRWG 4LBWA 1KSGA 2KW5A 3K0AA 1B1CA 3SBOA 1QQAA 4HX5A 1I0IA 4XM2A 3MLAA 4OYYA 1U6IA 3GRCA 3H9CA 5E1DA 3IOYA 3DA8A 2W0SA 1KZ6A 3ZCVA 4HDKB 5IAJA 1K8XB 3MWFA 5K3EA 1A9XA 1T36A 3I64A 3EEOA 3L9WA 3DD1A 1XHLA 2GF9A 3F3KA 1P18A 1B8VA 2BGKA 5K0SA 3PNBA 3KTAA 4I55A 4YDQA 4IFBA 4BPBA 3WLHA 5GWXA 1MGOA 2WU0A 3FROA 3WIOA 1T4DA 1QYDA 3LXXA 1E1YA 1ISFA 2FJ0A 2P9EA 4PC3A 3FPGA 3QOYA 3ZWWA 1UPCA 3C0KA 4TZKA 1HGXA 2M6KA 4PLTA 4P22A 4Y2RA 4HADA 2QTAA 2CNOA 4XJXA 3UWSA 5G1NA 2KMLA 3O8CA 1H85A 2H0QA 3WLRA 1FXWF 2DUUA 3SHFA 4JYCA 5LUAA 2D1YA 2HQOA 2F1IA 1W581 3COZA 4FNMA 3FZNA 4LE0A 5EWMB 4DKXA 3AW9A 3FCSB 4WGFA 1Q0PA 3GZNB 3L7DA 3OU6A 5AJUA 4AZWA 5KYTA 4X63A 2JC3A 3TZCA 2VP4A 2XRMA 3T1OA 1PS8A 2DHQA 2ZSFA 3CLKA 4KLRA 2YXEA 5COBA 5LQKA 5F91A 3UN1A 4URVR 4U7PB 1G20E 3L1KA 4AO6A 3G5MA 3NBFA 1Q11A 2O07A 3LL7A 3LT2A 1P17A 1VMKA 2AC7A 4OTZA 1O2DA 5JANA 1NKTA 3P96A 3QVMA 2XA1A 4DIDA 1T0UA 1D09A 5AVYA 4BQOA 2G4CA 3QFTA 2KJQA 4ZAZA 2FZ5A 2FEWB 1JIJA 1SKMA 1H1DA 2BFWA 4AECA 2PFMA 1DTWA 1FUOA 2IZOA 1U80A 3OQBA 4JY7A 4HS4A 1DCNA 1T9GR 3SQDA 3SFZA 3RPEA 2HYDA 4F3KA 1MORA 1IZ7A 2BKXA 3A9CA 4G9GA 4E32A 5A6VA 1Z4MA 1EK5A 3OT5A 3LC2O 4MVJA 1IAQA 2HNBA 2HWUA 4D8WA 1IN7A 4AS1A 3H4VA 2OK7A 2PRJA 3CRNA 2UZ1B 3B6MA 3AVYA 2I2AA 1J7KA 3EA4A 5K1ZA 2VP2A 1B8UA 1ZOPA 2P78A 4OMFG 4TN5A 3DWIA 4NU6A 5KTMA 1JIIA 2LRHA 4AWBA 1N2OA 3MLBA 4OATA 1VLQA 2O2YA 3ZN2A 2PZ8A 3B7PA 3GJRA 4UD2A 2BR4A 3ZU3A 1R8QA 1KORA 3G2IA 1HZJA 2W2LD 4D96A 3EPKA 3EMDA 4HNTA 4H3KB 5IDWA 4E4RA 4WA7A 3VKFA 1O6BA 3NHYA 4CRWB 2OCBA 2X3FA 5KYWA 4OQLA 1ISHA 3WO0A 1IHPA 4S3MA 5AHXA 3U9SA 3NHWA 3MJ4A 3ADBA 3IERA 3QBTA 3SHWA 4RIFA 2WDZA 2G7MC 2Y93A 3A9WA 2BGLA 2X41A 3HKDB 3AB3A 4BP1A 5BUQA 3LVBA 5JSQA 1GGVA 1TA0A 2R8OA 4J76A 4C30A 4BBAA 1NBIA 4OLBA 3KSDO 4LJKA 4LECA 1HLFA 5LQCA 3NZEA 5AJYA 2FPRA 4EF4A 4BAGA 1WR8A 1W48A 3T61A 1RQ2A 4E4TA 1W25A 2JRCA 2XXBA 2EOAA 3SR3A 1IK4A 1QRRA 1F2TA 2QP4A 2VBIA 3AVUA 1RJDA 2C9DA 2CHUA 1JZSA 2FRXA 2FR8A 1F60A 3ENKA 3LTEA 5GM1A 3R24A 4P2GA 3BA1A 4D8VA 1F06A 1TFUA 4EFKA 1F0YA 2OXFA 221PA 5LQAA 4Q7LA 1ZD9A 1WS6A 4CF4A 1O0BA 1W46A 4AM8A 1C9MA 5GONB 3C97A 1Y8ZA 3F5FA 4GZ5A 3EGXB 4AP5A 1CEXA 1DL5A 4ES6A 1BGXT 1M1YE 1E9FA 4LZOA 4MQFB 1AF7A 4N0PA 1JVBA 2IH5A 3CINA 2VP9A 4MV7A 5B1HA 3UAOA 1MGPA 3ZWXA 1WSDA 1DADA 4WKBA 2QR2A 1C14A 1JWAB 4PFQA 1LLCA 3A4MA 4MUBA 2GJKA 4K8OA 2QPLA 2QJOA 2B4RO 1DIBA 2WPDD 3GCXA 1SRQA 1IONA 2RD2A 3A25A 3PUJA 2D0PB 3QWBA 3VR3D 1FNCA 3BILA 4H0CA 2NG1A 2EKDA 4IF6A 3KPJA 4H1TA 4LRTB 5BN5A 3QWAA 1XZAA 4KI7A 2BAGA 1FK8A 3FPAA 3CX3A 4E2FA 4UCQA 4ZZ0A 1R3DA 1KQPA 1ZJ4A 4E21A 3TTSA 4O4JF 2IUUA 3TR0A 1C80A 4A5SA 2H7VA 3Q9SA 4UEQA 3D6NB 4BVHA 1PL6A 2C9CA 1A9ZA 4QRIA 2G06A 3VMFA 2AKYA 2MDTA 2VDWA 1UMDB 2XMRA 4UCXA 3MFQA 4E7OA 1VOTA 4CV0A 5BSTA 3GVPA 4MVJD 5B7QA 1OU4A 3BYZA 3ESCA 2ZREA 2IHBA 5J23A 3ZJYA 3P4YA 3UANA 1T91A 1CPYA 2JD2A 3N0RA 7ADHA 3GUZA 3ZDCA 4QA9A 1JB1A 2TECE 4E46A 2DKFA 1YVEI 2B5VA 2ZIAA 3GPDG 4Q7KA 4INJA 3FPKA 5DN6D 1E4VA 2X0NA 4IEIA 4J6FA 4KQHA 3DMFA 2X1LA 2QG9A 4HZUA 2O57A 4L76A 3RRJA 4JL8A 2UVQA 2O4UX 3PFCA 2O1SA 4J3JA 4UE3S 1TI7A 4OGFA 3V8QA 4GS5A 4GZMA 4HEJA 6YASA 2QN9A 1CDZA 4HDSA 5TMDA 5A1JA 2Z2XA 1FY2A 2ZITA 1EVKA 4GPIB 4R1OA 2OXEA 5KVVA 3DBOB 4MHOA 4ZAVA 4H7DA 3TLMA 3S2ZA 4O2BB 5DT9A 1NI4B 3HBFA 1RJFA 4Q9AA 1CULC 3K5WA 3L0PA 1WV0A 2TRSB 3L9XA 3P9ZA 1F17A 2VUIB 4P33A 1BYUA 1WABA 5EPOA 4J8PA 1X15A 5TV2A 4DZTA 5JYEA 2R2GA 2AMYA 5THQA 2D4AA 3ASUA 3HLTA 4KKVA 5CT6A 3HE3A 2R65A 3QYJA 1LV7A 4NBWA 4CM5A 1IB0A 3VTFA 4QU9A 3HSYA 2ACVA 2WZQA 3WNCA 4GI5A 4DNFA 4EX6A 1JJAA 2GT1A 5EZQA 3QNUA 3GT4A 1ESMA 4BGUA 5AW2A 3ESZA 4QNRA 1XRPA 1Y8QB 1BQ3A 4JJZA 4FVTA 4YN3A 1HM5A 5TEVA 3KQHA 2O5RA 1HFKA 4JEUA 4RYDA 3MTDA 3LPMA 3D7MA 2VT3A 3P0EA 4EG1A 3M1YA 1COZA 2Z9CA 3BEOA 1Q16A 3PQ6A 2VHZA 1KI7A 1K3FA 2VEDA 1FFHA 1PQYA 3L0ZA 4IIUA 1PDOA 2XCLA 1YBVA 1MJNA 3KKZA 3QEMB 4Q3OA 5ED0A 3UMVA 2I1WA 1UKAA 3AFMA 3LFTA 1A5ZA 1YRYE 3B1FA 1KZ9A 2AMVA 3PC7A 4WK4B 4I2VA 3TAUA 1JSWA 1DV2A 2XW6A 2P2LA 4XSVA 4AY2A 1AGXA 4EUKA 2VLBA 5HGJA 5I51A 1UODA 3BB3A 1G5RA 4DWJA 4M0FA 1ILEA 3AP3A 3O4JA 4WKNA 2VTVA 5KHOC 4C0WA 5JG7A 3PZBA 1IHYA 2WEKA 5CDUA 3AIKA 2FDRA 5TVKA 3FTCA 2XKBA 3HP1A 4P32A 4RIGA 2I7VA 3DNPA 3U62A 2W5UA 3ENVA 5EQDA 4XQCA 1PR0A 4ZZ1A 5I8PA 3E84A 2NXEA 3RUCA 2GK4A 4NYJQ 4O59O 4QPDA 4CKYA 1P4RA 4QYSA 4Z8YA 4YTEA 4BDSA 5I47A 4PBRA 1DS6A 2WAMA 1VHDA 3I2KA 5T8KC 5K45A 5AKGA 4CG2A 4DM4A 3QRWA 3LYUA 3F7MA 1DWOA 1HYEA 1ZJ5A 2P5TB 4CKEB 1KY3A 2C54A 4EYOA 3RHZA 2YJ4A 1A8HA 3RTDA 2JIPA 5JFOA 2G28A 4ETMA 1W4LA 3OE4A 4IFEA 4QYXA 4HMQA 1FZTA 4JJ8A 2O3QA 3AW8A 3M4YA 1YVPA 4DJAA 4YFYA 3FNHA 1ETHA 2WFZA 4O2BF 4ZPJA 1XJCA 4HDSB 4IZHA 4IXMA 3VJLA 4C0SA 3AUTA 3LHKA 4L73A 3WHLA 3D4OA 2CLLB 3BVPA 4ND7A 4BNHA 3FPJA 4F0JA 2XITA 4LYYA 4CQNA 4LDQA 4ZT2A 1CDOA 2NXWA 4M83A 5KNBA 1BN6A 4KMRA 2DFDA 3AGPA 4HLDA 4RK7A 5TSDA 1PHRA 1JGTA 3C6MA 2NPOA 2HSEA 2YBDA 3FBGA 5DX0A 4AJ1A 3KLMX 1M34A 1ZXBA 1LDYA 4RFSA 3PXXA 1YA8A 2H18A 2IX9A 4UREA 5DYTA 1A9TA 4DT1A 2HXGA 2ODPA 3LWZA 3Q11A 4ER5A 3A11A 2G8LA 4H7KA 4OK3A 3ZJTA 4M9QA 3EVCA 4K2AA 5A05A 3P2JA 3Q3HA 1ZM2A 2FTKE 1M7GA 2QI9F 3IDFA 3UG6A 4QQFA 1KEUA 1R0BA 3IP7A 1BCRB 1QLJA 1ZJZA 2EZ4A 5CLHA 5DH9A 5KNCH 3OPMA 2C0PA 1CY2A 5CIQA 5JSYA 5FBVB 2JIZD 2Y6VA