2JAUA

Crystal structure of d41n variant of human mitochondrial 5'(3')- deoxyribonucleotidase (mdn) in complex with 3'-azidothymidine 5'- monophosphate
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
194
structure length
194
Chain Sequence
RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-DEOXYRIBONUCLEOTIDASE
publication title Crystal Structures of Human and Murine Deoxyribonucleotidases: Insights Into Recognition of Substrates and Nucleotide Analogues.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 65
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 2jauA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2jauA01
2P69A 1FEZA 2C88A 3KZXA 3QLEA 3FPBA 3QUTA 3E84A 1Z5GA 3ZUPA 1U2SA 3KBBA 1LTQA 2JGAA 4YIHA 5ALQA 2QYHA 1YJ5A 3OCVA 2AH5A 4YGYA 1XPJA 3ZW7A 1ZRNA 2G09A 3N1UA 3QYPA 4EELA 4UARA 4EENA 3CZ4A 1EK2A 1JUDA 1YDFA 2GHTA 5AW4A 2W11A 3NUQA 2FPUA 5AI4A 5AKEA 5JJBA 2ZXEA 2IOHA 3ED5A 4UMEA 4B6JA 2ZG6A 3VAYA 4UATA 1ZOLA 4JB3A 2C9MA 2WF9A 4UMFA 2G0AA 2G07A 3U7EB 3P96A 1Z4KA 5ALJA 1ZRMA 1QQ7A 4EZEA 1T5SA 2FDRA 2G08A 3WGVA 4OFZA 4AP9A 3QU9A 3QU7A 3L1VA 4Y2TA 3ONNA 4UAVA 2I34A 4L57A 1WZCA 3NANA 2EARA 3WK7A 4XOUA 1L7MA 5ALDA 4BX0A 3ZVMA 5AK5A 1L7PA 3RFUA 1O03A 3ZX5A 2GFHA 4ZEXA 4DW8A 4GXTA 3ESRA 3DDHA 5AW6A 3NRJA 4XPZA 1PW5A 3W5CA 4NV0A 4UM5A 4DWOA 4HGNA 2B1QA 5AM1A 1QH9A 4Y2RA 3IJ5A 4H1WA 5AW1A 2O9JA 4Y2QA 2WHEA 5ALWA 3CNHA 4KN8A 2D2VA 2ZBGA 1X42A 1RLTA 5AK6A 5AI9A 4L6CA 4HGPA 2G80A 3B8EA 1Q92A 4BEVA 3OCWA 4F72A 1J8DA 3EPRA 3R9KA 2CFSA 1K1EA 5AM5A 3I6BA 3WK6A 5AK4A 3N5KA 2YJ4A 5AW9A 2YJ6A 1Y8AA 4C4SA 2FPSA 4AS2A 3WK4A 2YBDA 5AIAA 5AVYA 5AW8A 3U7GA 4KX3A 1TJ3A 2PQ0A 2P9JA 3UMBA 3FGOA 5AVWA 3SKYA 3AR9A 2AUTA 3L5KA 5AIBA 3WKAA 1RDFA 4DCCA 2I55A 5T41A 2P27A 3L1UA 5AVUA 1RQNA 4Y2UA 3N8GA 2YMMA 3KOOA 4IFTA 1U2TA 5AKIA 5ALEA 2JAWA 4DFDA 5AKZA 5AKYA 4YCLA 3N07A 1ZD2P 2JAUA 3HYCA 1VJ5A 5AI5A 5AKJA 2GO7A 1TA0A 2WFAA 5A3QA 1QYIA 1Z4LA 3SD7A 1RMTA 1SWWA 5ALFA 2MSNA 3DNPA 3R4CA 1RKQA 3S6JA 3MMZA 3QXGA 2BDEA 2ODAA 1YMQA 2WM8A 4I9GA 5AI6A 3U26A 4C4RA 3AR5A 5AW3A 2WF8A 3W5BA 4UAUA 5AVTA 3UMGA 2C4NA 2R8XA 2WF5A 3K1ZA 1T9ZA 4YIKA 3QU5A 3OCZA 3B9RA 3M1YA 3WKBA 4Y2JA 2QLTA 3QU4A 5AKLA 3E58A 2W43A 5ALNA 4G9BA 3AR4A 4EEKA 1TE2A 3AR7A 3FM9A 4RETA 4Y2YA 5AKHA 5ALLA 1RRCA 4XE5A 2VKQA 3WK5A 2C8KA 1NF2A 3KC2A 2B82A 2YN4A 3L8GA 3WKDA 2MU1A 1J97A 2YJ5A 3MN1A 2HF7A 3PDWA 2I6XA 1LVHA 2CN1A 3NAMA 3A1CA 2PKEA 5AM3A 3BWVA 1CQZA 1Z5UA 1O08A 1YV9A 1L7NA 3MC1A 4CNQA 2JAOA 2IYEA 2BDUA 5ALIA 3OPXA 2GMWA 1Z88A 3I28A 3M9LA 2R8YA 2CFRA 4Y3UA 3L0YA 4KYTA 2HF2A 4CE6A 3OCXA 2HOQA 3SF0A 4BX2A 3QUCA 2O2XA 2AMYA 4FE3A 3B9BA 2HSZA 2X4DA 4E88A 4KX5A 3GYGA 3AR3A 2W4MA 3U13A 1WPGA 3WKEA 1RLOA 2EATA 2NO4A 2G1AA 5AM2A 3QU2A 4AS3A 4QQFA 4NFLA 1IWOA 2ZBDA 1CR6A 2Q5EA 5ALOA 1T5TA 5IS2A 3ZU6A 3ZTYA 1RMYA 3AR6A 3PGLA 1U7PA 5E0OA 4CF5A 3WGUA 4CF4A 4HGOA 1ZS9A 2IOFA 5AW0A 2IA5A 5ALUA 4BNDA 4J2TA 3UMCA 4ZEVA 4JDPA 4BBJA 1L8OA 3E81A 3A1DA 3IRUA 3ZWKA 2FPRA 2ZBEA 1Z4NA 3F9RA 5AI8A 2FI1A 5AHXA 4YCNA 2GHQA 5ALVA 2HX1A 4CF3A 2AGVA 3FPSA 4MUMA 5A3RA 4KNWA 4Y2SA 5AESA 2YMPA 1ZD3A 1XVIA 1XP5A 2ZBFA 1Z4MA 3NIWA 2B8JA 5AVRA 1S2OA 4OCZA 2RBKA 5AICA 3DAOA 3KDPA 4MWOA 1RLMA 1L6RA 1YNSA 4NAVA 5AW7A 3I76A 1ZJJA 4F71A 2RB5A 2R8EA 1Z4JA 3I1YA 2OM6A 3ZWDA 5AVXA 1ZD5A 3OTQA 4YCMA 1YS9A 2I7DA 3IB6A 3J7TA 3A3YA 2NO5A 3ZVNA 1RKVA 1F5SA 4I9FA 5ALHA 2B8EA 2FEAA 3TLMA 4HYTA 1MH9A 2YMLA 5AKGA 1Z4OA 1NNLA 4NWIA 3D6JA 2FUCA 4ZEWA 3L8EA 3A1EA 3EF1A 2ZOSA 3ZVLA 2Q4TA 1RQLA 2DQSA 4FYPA 4HAIA 4QJBA 1RKUA 3UM9A 1EK1A 2FPWA 3QNMA 2P11A 1Z4PX 2Q4RA 4IG4A 5IT0A 3ZI4A 1Z4QA 1NRWA 3AR2A 5ALZA 2RAVA 3PGVA 2JARA 2EAUA 2HEGA 4UM7A 2HO4A 1N9KA 4G63A 3ZTWA 3L8HA 1SU4A 5FP0A 2R8ZA 4Y2VA 5AVQA 2HHLA 3SKXA 1ZD4A 2OBBA 2B1RA 1AQ6A 1VJRA 4C4TA 4UU1A 5ALGA 2OA0A 3MPOA 2RARA 5AVSA 2B30A 1TJ4A 4BYGA 3SMVA 3W5AA 4GIBA 3FZQA 5ALMA 2I54A 4NABA 3U7FB 1QQ5A 5ALRA 1RC8A 5ALSA 4EX6A 2C8LA 4L6AA 4FFDA 2IOFK 1VFPA 3EF0A 4UMDA 3DV9A 3HLTA 1TJ5A 4UASA 4HGQA 2WF6A 4BEWA 3ET5A 4OD0A 5AVVA 4UW9A 3BA6A 3E8MA 1SWVA 2I33A 1L7OA 3L0CA 3QUBA 2G06A 3EWIA 3ZX4A 5ALKA 5AVZA 3OCYA 2NYVA 3ESQA 5AW2A 1WR8A 5AKKA 1QQ6A 3RF6A 4J03A 3WKCA 3SHQA 4UU0A 2WF7A 2BY4A 3R09A 1RMQA 1U02A 5AKXA 4Y2XA 3PCTA 2CFTA 3WK9A 1KYTA 2YY6A 1N8NA 5AW5A 3L8FA 5AK3A 5ALPA 4EX7A 2YJ3A 2YFYA 1RPZA 2OYCA 5ALXA 4YH1A 2PR7A 3QUQA 3KD3A 3U7HB 5ALTA 3ET4A 2HDOA 2YMQA 3L0BA 3NASA 2B0CA 1WVIA 3QGMA 4KNVA 3NALA 5AM0A 1Q91A 4UMVA 4HGRA 1S8OA 4BNDB 1L8LA 2FPXA 3N28A 3WK8A 4O8CA 3SLRA 1Z4IA 4PNHA 5IT4A 3OCUA 2HCFA 4Y2PA 5ALYA 3FVVA 3L7YA 1U7OA 3AR8A 5AM4A 3W5DA 5AI0A 2FUEA 5A3SA 4OHFA 4XQ0A 3U19A 2HI0A 4BX3A 3QX7A 4BKMA 4RESA
chains in the Genus database with same CATH superfamily
2IEDA 3EULA 3F9IA 3O3OB 1T36B 1EVLA 3P2YA 5T4FA 3P0HA 3FZGA 2QJOA 1ZK1A 3T7SA 4RPCA 3VH3A 3S1SA 1HFEL 1PZGA 1S89A 2ORED 1AA6A 2Y1WA 1CFJA 2JGRA 2XUZA 3PYLA 4K8RB 1AUQA 5FNVB 3UMRA 5JXHA 1EAMA 1JLRA 1P4HA 4C01A 1EUYA 4DMGA 1FDTA 1I1NA 2KS6A 2ZSIA 2ZW9A 1QLWA 1RAAA 3C87A 1DEXA 3JATA 2RCNA 4RVHA 3LX8A 2P3OA 1EU1A 4Y6SA 2GF2A 1JQJC 2J45A 2JLBA 3S44A 4PYKA 4UPDA 1MO3A 3LZCA 1J90A 3TCKA 2OG1A 3L6BA 4LJ8A 4K9OA 3EC7A 3RJMA 1WUIS 3M33A 4IDGA 1N77A 1PDOA 3DR5A 4XX0B 2D00A 5JD5A 2H0AA 3H87A 3K0KA 2ONKA 3FVWA 4LVOA 3M4ZA 4NY1A 4Q7LA 2Q9CA 3I04A 3H5IA 4UFNA 3RR2A 4EKNB 4MQBA 1YB4A 2H00A 3LECA 3HZHA 3MTDA 1HNXB 3V7WA 2CZGA 2DFTA 3L7NA 1QYDA 4HWPA 4ZMSA 1QTNA 3BGSA 3ODPA 4OKIA 2B0JA 4RGQA 2V3CC 4AP9A 2XT6A 4DMKA 3VHXB 5A9SB 1Q7GA 3BXHA 1VSTA 4FNAA 1V5WA 5C7IO 3ND5A 1W36B 3FLMA 5H3LA 2QTTA 1U15A 1JEJA 4PU0A 2VYVD 4HX2A 3ZU4A 3C3CA 1E8NA 1A2QA 3BL5A 1G8AA 1O95C 2W6ZA 2CYCA 1YZKA 5FA5A 2IIQA 3S99A 1L7PA 1PF7E 4O8ZA 5EIBD 4KPFC 1GILA 3HXQA 3HA7A 2BKUA 2HRQA 2X1LA 1TRKA 3M6XA 1DAKA 4J75A 4XIJA 1JHDA 3FZNA 4GXTA 4X3PA 5F91A 1H0SA 1AF4A 1C7FA 5CFMA 1DEHA 1VCNA 1G0NA 3LQQA 4WX2B 4PZUA 3P7MA 3WO1A 3U44A 3KL2A 1XTQA 5G02A 1JB1A 2ATVA 4M86A 6ABPA 2PEYA 2WVHA 4DSTA 3BMOB 4FT2A 3IVMA 4HGNA 3VUEA 1KEWA 3ICPA 3F5DA 1FJ2A 1K86A 4NKRA 1DQZA 1NBAA 2NO9A 3P1JA 3R5SA 4GEKA 4FSXA 2XECA 4JNKA 2YWJA 3ASZA 4P4NA 5F7JA 4EECA 2EGUA 3NU1A 4KREA 3M3HA 2F4NA 1NULA 4N0EA 3SNHA 5FUQA 1THZA 2CXTA 4Q6WA 3LUDA 3UANA 2IXDA 2PA3A 1YCHA 1P1KA 5T67A 3LIIA 2LP4Y 4TS9A 3B7PA 3LQKA 4PSVA 1QOPB 4M1QA 5UKDA 3TCNA 2RGGA 3B51X 3CMMA 4MKZA 1I5EA 3CCCA 5CRIA 3R20A 4WZBB 4E2FA 2DY1A 2R8RA 4HZUA 3BWCA 2MSCB 4EGFA 3VPFA 2G80A 5AQ1A 2E85A 2QRVA 3L6DA 2QTZA 3PP8A 3GPCA 2EFHB 3ANLA 1BFUA 1R2QA 2FA9A 3EPRA 4IRMA 1NONA 1B8UA 1T2UA 1YI8A 3LY7A 1Y7LA 5CFQA 2ZIUB 2JEZA 1TK3A 2JFPA 4EQZA 2I1WA 1GARA 5ITWA 4X7MA 5A7HA 5CHYA 1NIPA 2VHZA 1CUJA 1XEWY 5ADWA 5BR8B 1UMBB 4NI5A 3Q2KA 2LPMA 1ORHA 4OL0A 4UAJA 5EN4A 1NNI1 4BYMA 4MDHA 1CJVC 3R5TA 3SEZA 2BI7A 1EGHA 2XMCA 4AF6A 1KY4A 2PZFA 1P2SA 3MWDA 4KLAA 3W2HA 4JP1A 4UBLA 3PI7A 4C78A 5AIBA 5IC4A 2D7DA 1LPAB 2HLHA 4GI1A 4BB5A 1NW8A 3OA2A 3O8CA 4FCTA 3IP1A 5CA0F 1FUIA 5DOZA 3HEMA 2YTZA 3D8RA 1ONOA 4I55B 5KSWB 5HGJA 2GPBA 4JJ7A 1KYIA 2YMMA 2Z8YM 3RT1A 1U1FA 2NXCA 4I08A 3VTFA 3LQRA 3GD7A 1C50A 1Z2AA 1T2NA 1D0IA 3EFBA 4IM7A 2WUWE 3GAAA 4JHLA 5AKIA 5TVKA 3UVEA 4DLPA 4BMVA 4WT7A 4EKGA 5AKZA 3VPCA 4YJGA 1FQOA 4MULA 4YHHB 3Q8XB 4W5WA 4L73A 5LPNA 5CPBA 3ROTA 3ZY6A 4XW2A 3AVUA 7GPBA 5F78A 4MRSA 3T5DA 2I2AA 2IP1A 3QUAA 3MLAA 2RHLA 2VNHA 5I9SA 3AY6A 1W44A 3E2PA 4H08A 3STXA 4HVAA 3DNPA 1YBMA 5SYMA 1RWPA 4RQBA 1LBSA 2QORA 3T3GA 1JXQA 3PR2B 1V2HE 4QQKA 3STWA 2H1SA 4TZ0A 1UBKS 1LVGA 4Z1MD 2ODBA 5KOJA 5EWLB 1NRXA 4F3KA 4GE0A 3TB6A 3PDHA 3WLPA 3B6IA 2FKNA 2BBTA 4YJ3F 3KT0A 4IJ6A 2BR3A 4QLAA 4BGIA 2IBMA 5BWMA 2O1SA 3V1KA 3OCZA 3FPEA 2AFHB 1QFJA 4B45A 1XZDA 2A8YA 2YRWA 3M5WA 3AVVA 2HAEA 1WNFA 2XUPA 5KAMA 3U40A 4TT3D 3L07A 3IE0A 3UWMA 4D3XA 3EVCA 4EW1A 1BCRA 1MC8A 2AN3A 2P4SA 2WJYA 3C74A 3GNLA 5LB4A 2VBIA 2GNAA 1KMIY 4RETA 2PVSA 4NQRA 4Y2YA 2ZT6A 3NAQA 4AMBA 4BFWA 2WUEA 2AW3A 1N36B 5KB3A 2VKQA 1BD3A 2ERXA 4JP8A 1YBAA 5C4MA 1MJ5A 2MU1A 3MN1A 3DPUA 3KX2A 2I6XA 2HIGA 1RYNA 5CA0A 1R10A 4LV6A 3DDUA 4QDXA 4PG8A 4RD3A 3ZZNA 1RPJA 3P9RA 4NMMA 3AG5A 3BN3A 2O8EA 1POWA 1WSAA 5AM3A 2XB4A 1G5QA 2QL7A 1DDIA 1GDDA 5TQ2A 1K9SA 1L4GA 1T0IA 1KHHA 2V7VA 4B3HA 1GCGA 4NONA 1PU2A 4M22A 1P6UA 4CNQA 4RNCA 3GFQA 3H7IA 1JMKC 4NARA 1FRNA 4CQMA 3ELWA 1EM6A 2HA6A 2Z09A 4HTAA 4C08A 5BN3B 1IBMB 1NZJA 1P31A 3TL6A 2J3MA 1S3FA 3K1TA 1AB6A 1ZLYA 1NDQA 5HNKA 4WESB 3BE5A 3RSSA 2VH1A 3JYLA 3QWAA 4E33A 3HI6A 3IP3A 3MZ0A 2VIIA 2RGDA 3PSHA 2HZ7A 5CAEB 4ASUA 1U8FO 3BIXA 4MS4A 4AAYA 4H3KB 2NMVA 3B2QA 2CZCA 3UB4A 4CGZA 1U3UA 3H2ZA 3F3SA 4BLTA 1TI7A 1N2XA 4E88A 3QVLA 4F11A 4XQGA 2EYUA 1H2FA 4Q9DA 3ZU5A 1N6HA 4EGAA 3N7AA 3RS7A 3UMFA 2QLNA 3W78A 4RZ3A 3NBZC 2HK6A 4MXDA 1XZAA 2F1JA 5F21A 5K3DA 1AJEA 2HBRA 1Y3FE 4WI1A 2XNSA 3X2SA 1KGDA 3LVRE 4RE6A 1FRQA 2PA0A 2VDOB 1JRLA 2YR0A 3AEQA 5K0BA 2UZ1B 3ICVA 3H2YA 1DAFA 2QP4A 4G4GA 1JHVA 3UICA 1F3OA 2B21A 5BR7A 4HH3C 1CEYA 1KTVA 3STYA 4C7OB 4YFYA 1KI9A 2N1MA 3C14C 3JQAA 4I6EA 2C0CA 3AEKB 4EATA 3NWOA 3KB2A 1P2DA 3ZNPA 1E9VA 4G4SP 5DXJA 3KQNA 1UINA 5A4KA 1PEYA 2CHGA 4GRDA 4P38A 3JVDA 3IAXA 1I0IA 4CYMA 2RI0A 3IJEB 4CMJA 3Q3IA 1T0BA 3N70A 1TF5A 1CTQA 4J2TA 3CPSA 1G5PA 1YAHA 2JBAA 3HRKA 3BXEA 2QI9F 4RF5A 3Q2IA 4CKEB 3SYLA 2JFHA 2Z3ZA 1XI2A 3UC5A 2IS6A 3L1KA 2VDPB 3M2PA 1MW9X 4Q9IA 4CIAA 4YP0A 2CVPA 4A03A 4BRWA 3NLLA 2VN8A 2X15A 3P4YA 3NZEA 4AQDA 1UMKA 1E3IA 4BAGA 4D9GA 2MYUA 4P22A 4Q6BA 3JZDA 4YCSA 4Z53A 3K4QA 3PL1A 5DSXA 2EQBA 2I1VB 5IM4F 4YMSA 3BVPA 3GLQA 3SICE 1O6CA 3OUZA 4LY0A 4LKOA 4R0NA 2R6JA 3U3OA 3V33A 2BYTA 5AESA 1FW8A 2AMLA 3DHNA 1W85B 3Q1LA 4FC6A 3WHKA 1U7TA 4XR9A 2O7NA 1KJWA 3QPVA 1M74A 1GQFA 1B8VA 3OQHA 2C5EA 1L1FA 2ZI4A 1JIQA 3TQSA 4BO1A 4BDTA 4DZZA 4DSAA 5LMNB 2WMNB 3CGWA 4BCBA 3P9QA 5B1YA 5IDYA 2OCKA 1QSGA 5MDHA 3DZHA 1GQYA 3QPCA 4QDKA 1VDZA 2H4XA 3ILYA 4MWCA 4N8DA 2X77A 5KNCD 1YJQA 5LC1A 3FJYA 3LBAA 4FYMA 3RJTA 1J56A 2AWNA 3DAYA 1BXGA 3BTVA 1FLVA 1Y48E 2BEVA 1AK2A 3N74A 3E61A 2XEXA 2YOFA 4BIMA 1CF4A 1RXWA 1B14A 2FN7A 4U6NA 5EUQB 3RROA 4URXR 3OM1A 3HBNA 1W94A 4HYQA 3UFXB 3PVSA 5IC6A 3OQIA 1H69A 1SCNE 4HYTA 1BX0A 2C92A 2HSGA 3NBYC 1AX9A 1KFCB 3FF1A 3QRWA 1AZSC 3W7VA 1XJQA 1H1LA 4U4AA 5FLKA 5F9HA 1UXJA 5IJXA 1GAWA 1FRFS 1P9RA 3OP1A 4RGVA 1IPFA 1PBNA 3BD8A 5ED4A 4QLOA 3TD9A 4Z5XA 1PL7A 5LYJF 1AN9A 3V8VA 1YQGA 1JU4A 1YUMA 2RKOA 1OYYA 2VBFA 2X19A 3N2EA 4AO7A 1JKFA 3MGGA 4KU4A 4B1FA 1NL3A 3GFRA 5B4UA 3CLRD 3OJ0A 4MA5A 4POOA 3LY9A 2VTEA 3IMFA 1RR6A 1Q14A 4I1YA 5DK6A 5IM4A 4CQNA 3THXA 1QH1B 2EBUA 3MSXA 2H1IA 5E7MA 3TEJA 1EQAA 1QZZA 4W6ZA 4G86A 3PPVA 3F7NA 3HDGA 3A3KA 3ZE8A 1C0PA 3K35A 2WZDA 4WKGA 1YQUA 4OQZA 4FLFA 1XFAA 1VLLA 2B1IA 2XIQA 1U3GA 2P62A 3DZBA 5GWXA 1OROA 4RL4A 1I2ZA 1JNXX 1OLXB 3DTYA 4X8MA 5F73A 2HF9A 1P1RA 3ICOA 1DCNA 5LM3A 3AB8A 4BJ5A 2VDNB 3IKMB 4D8UA 4MMYB 1QE5A 4DIDA 3EVBA 2D1TA 4ZCRA 2JGLA 1HY1A 2GEJA 3V55A 2XQVA 9LDTA 1G59A 2QXYA 4MS1B 1I2MA 4B7UA 5FWYB 4C4TA 4UU1A 2DB3A 4Q05A 4B76A 1Z47A 3B1VA 3GJXC 3IB3A 3N0RA 3N3BC 2D2XA 4IEFB 1E92A 3KQOA 3O8OA 4P3XA 1TM5E 4PLCA 4ZYTA 5FNZA 3I9OA 3LA8A 1K6MA 3PNOA 1SG9A 1KI7A 1FVHA 3AINA 3H86A 3ZBQA 1A7JA 2MYPA 1MC4A 2WTBA 4PAGA 4V03A 2OKCA 4DSZA 3GI1A 1XD2A 3FJOA 3IXQA 1G17A 4FZRA 5BMVF 3W5AA 2Q6OA 2H85A 4GIBA 5DSTA 3L7DA 2Q7OE 3LK7A 5D3KA 4RZQA 1QLJA 1W0JA 5HF6A 4R05A 5GZ3A 1CIJA 4OHWA 4QTZA 3CSUA 4V2IA 4V0MA 4TRMA 5ALMA 1C41A 1WUTA 2W6NA 3OZSA 3TTXA 3ZLVA 2BN4A 3WYBA 4BV9A 2HRBA 3K72B 5KYYB 1M6NA 4HUJA 5JRZA 4PQRA 3FG9A 3OLXA 3OTHA 3LH5A 2AN9A 1E4OA 2DSNA 4HLDA 5LYJA 2HXYA 3C4VA 2M9MA 3L6RA 1QBKC 4OO3A 4XSHA 1GPNA 4DSUA 2PCJA 1O94D 3HEAA 5KQRA 4LW8A 5D87A 4EJSA 4BNZA 5DGDA 1E4EB 4RGYA 3RU3A 3S2EA 1C1HA 3QWHA 1CS0B 2EOAA 5TMPA 2Y0BA 4ER7A 3V8EA 3CPJB 4QVKA 3F9CA 3I09A 4OUKX 4XRGA 2QHXA 1Q57A 2RB4A 1A7AA 3CW2A 4CEJB 1DIAA 1YJAA 2CHQA 1WXEA 3GJ7A 4OEHA 5LU8A 3K71B 4JUIA 3HA5A 3I04M 4I6GA 4OQYA 2ZE8A 3A0RB 1RFLA 3K2IA 1C7IA 5ULLA 4JNCA 4YI5A 4ZZIA 1ZJYA 4PGMA 4YV0A 2XDYA 2FRDA 3DKKA 3L4KA 3LY5A 2AEFA 5E7JA 1N2IA 2O1EA 3MW8A 3D2AA 4JH0A 2CLDX 3TR6A 1ZG3A 3P52A 4R69A 4Y2XA 4OHOA 2BLLA 1KYTA 4MKIA 1LSOA 1NVMB 2QTVA 4JFAA 1JEOA 4ZOLB 2V7PA 4YP6A 5CB8A 3JWEA 2C1XA 2GOYA 2AZTA 3BWEA 3R41A 5K3FB 1X39A 1KJIA 4OP1A 2OYCA 1W75A 2BGWA 3EDYA 2B2XA 4FMDF 2VYVA 2YW9A 3NNDA 2GH1A 4LK3A 3ZXXA 4HFJA 3C5CA 1A9PA 1B0PA 4TS3A 1GEGA 5F3DA 4ZN6A 5BN5A 4HFMA 2RJ3A 5L7YA 1KK2A 1GRVA 1XNRB 5E6RA 3A8TA 5GGYA 2FMTA 1JWBB 4FFBB 4HGRA 2BGKA 3CF4A 3NUGA 2VQFB 3QBVA 4RZUA 4XXHA 3CEPB 4K6MA 1Z4IA 3SLRA 3PRHA 3A2MA 3CUYA 5D84A 4WAUA 4RTLA 1YZNA 4IHJF 3L7YA 2ZWAA 3JR7A 3QXSA 4XGNA 4DJEC 3QJGA 1R0BA 1YIOA 3SLKA 5HMMA 3WQBA 3VPXA 3C7KA 3GO4A 4RDCA 2CZQA 4YUZA 5I7FA 1L4KA 1WZ2A 2CVHA 2HSEA 3QX7A 5E1BA 3V7YA 4C0HA 3GJSA 4FLMA 2KI5A 3C4JA 4TQ9A 4W6QA 4GR4A 2ZRFA 4E5KA 3BS4A 5AUPB 1G3RA 3I52A 2AWOA 4MZDA 5DIZA 1UPCA 2PZKA 1HFWA 3I6ZA 3OLWA 5EE1A 5FA8A 3WRXC 3ZHYA 2WJAA 3E84A 1IN6A 4XQEA 1PHPA 1E94E 1X8LA 1JWAB 1YE5A 2O3JA 3EGXB 4L75A 1LTQA 3VPGA 3WYGA 3I01M 3FBGA 4M9CA 3SZGA 5KS2A 4IBOA 4TKZA 1XHFA 1XEFA 5KKCA 5KI6A 3C5VA 3WQHA 1NFRA 1NXPA 2CE7A 1R37A 1CQJB 5E9AA 1JFFA 2W70A 3NUQA 1DXHA 3O8QB 4D0LB 1DRWA 5KIAA 1E2MA 2R5WA 3ESZA 2P9GA 1T5HX 4B3FX 6LDHA 1FX0B 1ZMRA 5EZQA 1ISGA 1AGXA 3AXTA 5B7NA 2WNSA 2V4UA 4M88A 4A1FA 1IBRA 4MWGA 3GZNA 2C9MA 3AF0A 3K9NA 2Y1OA 3VZQA 3HS3A 3RVKA 3H9QA 2LIPA 2WYWA 2B4KA 3IX7A 1QRAA 1BYIA 1OSNA 1KC3A 4KLNA 4YT8A 1RZRD 3DVLA 1TL7C 4I8XA 1ZXXA 1I6KA 2QPTA 2VJOA 4OFZA 3UJCA 4AIRA 4RLSA 1PEDA 4DQDA 1TNDA 4BMZA 4UAVA 1QK4A 1R9MA 2I8AA 1QXSA 4DF3A 3BOSA 2XSZD 2CKDA 3KEGA 3PLNA 3JRNA 4WZ6A 1D09A 3NANA 1DL5A 4IHJA 4KQGA 5AXDA 2R1ZA 2AEJA 4H6XA 4B4WA 4IFEA 1PQPA 3MB5A 3GFFA 4GPTA 2DR0A 1AN0A 4X00A 2QX9A 3PJDA 1Q7CA 4V0KA 1CYDA 3CF4G 1TDJA 1CFZA 1PT5A 3DVQX 1SBYA 3ZHTA 4OXXA 3HP4A 2VHEA 1G20B 2O59A 4ZEXA 1SC9A 2E3JA 1HDRA 1K5GA 1XLTC 3UJ9A 1WG8A 4RJ2A 3W2GA 4WXYB 1FDUA 4Z1MA 2HD4A 1UFRA 3LT4A 4JBLA 2QRKA 4ZALA 5HJEA 1J20A 4GOKA 2G63A 1JDBC 3VZRA 4UM5A 3DNMA 4MKFA 5HZHA 2IHBA 5ARCA 1C4OA 3L4BA 2QVLA 2XVAA 4M8IA 4XQCA 1G7RA 4MQMA 4OQ4A 3EIHA 2OXTA 4UDNA 2BL4A 3K5IA 3MJDA 5E6SB 4CHGA 2IU6A 1KQ3A 4OLHA 1PEAA 5C1BA 1TU4A 3QEMB 1Q20A 3F1LA 5A5DA 3IT3A 4TT3A 2CLIB 1N3IA 1MJNA 3RSLA 3VR3A 4BNKA 2NOAA 2XMQA 4KN8A 3WL3A 3GA7A 1AUPA 3OQMA 3THYB 2B4AA 3CA8A 4KFCA 1E9CA 2XYHA 1CY1A 2AJ8A 1IOZA 3KSRA 2RK4A 3DDNA 5I9MA 2ICAA 1XDGA 2D1QA 2UZ4A 3RBAA 3B60A 3ACBA 2Q8QA 4UNQA 1PJ3A 1ATZA 1L3BA 3WAJA 4B74A 1GR1A 4YPVA 1DX6A 5JQGF 3U6KA 5AVYA 4LZAA 5EIWA 5JO0A 5IUJC 4WRRA 1UBUS 1YCFA 2ZSEA 3H3FA 3B3FA 5KVQA 3L41A 5EIXA 1II8B 4G1FA 3ZBUA 4LN1A 5I9IA 2PRJA 3UENA 4EHHA 3L8MA 3B1YA 4DCCA 1O0CA 5EUBA 2FZLA 5BSVA 5T41A 3TZLA 2VJBA 4GQIA 1LX6A 2E48A 2HJSA 2P27A 4WFIA 5EPOA 3C6ZA 1RQNA 1IK6A 3T5TA 1P77A 1HXHA 1I4DD 2P2YA 3E7FA 2Q8PA 1HMYA 1Q7TA 1ZMTA 4NNOA 2WPNA 4G5YA 3PQFA 3ZEIA 1N0HA 2XNHA 3FI0A 2QG6A 2QNBA 2H4HA 2XPCA 2GF9A 2J7KA 2ZTHA 3GDGA 5G1OA 1HEIA 4KLZA 4ZVTA 4RPJA 1P4RA 3WG9A 4DLYA 4EGJA 2RFLA 4JBHA 1J39A 5A3VA 1YCGA 4YY3B 4BXOA 4C2AA 4HNAB 1QYIA 1Z4LA 2PZ8A 4ZP1A 2H5JA 1DC3A 4M1YA 5K20A 2WU3A 4AS1A 2IZZA 4MUXA 1LKZA 4RL6A 3ZY2A 2DWQA 3IBGA 1HE8B 2H2HA 2IZ5A 1YMVA 2PFSA 1ZNWA 2RGCA 3ZH2A 4F3NA 3IEPA 1RBZA 2QAGB 1DBWA 4UM9D 4BZZA 3UB2A 3GU3A 3W6PA 1D9ZA 1R8YA 1ESDA 3IEKA 3RS8A 2C2YA 1AKTA 4FFSA 4OHRA 3RT9A 2YV5A 1CK4A 2P9EA 3RUEA 2HGSA 2QTRA 1SVUA 4I3FA 4P32A 3FE2A 2BSQA 5LDDC 3ADOA 4KRYA 4EG5A 3TJZA 4NV3A 5JQGA 3THWB 1Y6ZA 3ONVA 4LXUA 1UK7A 1LS6A 4Z3DA 4CCYB 3PUVA 3TX2A 4YPOA 3KC2A 3U4GA 1AUOA 2B82A 3P26A 3H8VA 5FI5A 5JE8A 5FXMA 3E3AA 2GBPA 1K6XA 3EE6A 3Q9SA 4URHA 4IDDA 4KQMA 5D51S 3MWJA 4EPVA 2CSUA 2ZVQX 1A8SA 2NG1A 1NE2A 4PCUA 3TAXA 2PUVA 3ZR4B 3EGVA 2JJQA 1PT7A 4CLOB 1NG9A 1N1MA 4PYLA 1AG9A 4RIFA 1OC2A 1NSTA 3S8EA 2NAPA 4L7VA 3KVOA 4RTJA 3MJRA 4W8GA 4QEZA 5EG5A 5IUKC 1CUCA 1ZIYA 3E5MA 3DS8A 1JR3D 1SXHA 3DPIA 4R2HA 2E6UX 5B2ZA 2IZ1A 3A37A 3B52X 5EJFA 1VKNA 5EHIA 4BLPA 2BMAA 3G17A 4YJ2F 3JATB 3PFBA 3PCRB 4CE6A 1FVXA 3AEYA 5KNCA 3VPBA 5G41A 1A9RA 2AMYA 4HZGA 1R18A 5ILOA 4FIDA 4DIFA 1G19A 3H9EO 5G0WA 4ZEOA 2IZOA 2QT1A 1WCV1 4DLXA 4DAEA 1I0ZA 4LJKA 1EFLA 1OILA 1DUSA 4PSDA 2ZJ8A 4D9NA 3I34X 5FADA 1D7AA 1XTIA 2DC1A 2WJJA 3L49A 1RLIA 2JFFA 3WMRA 4KWEA 1O5OA 1VIMA 3PHJA 3RK1A 3NT2A 2ZE7A 4AJEA 2EHDA 3RSZA 4RE5A 2GTHA 16PKA 1GPBA 4H31A 5FO1A 2IYOA 1W8DA 5AJTA 1Q7BA 1UK6A 3Q9NA 4C9BA 5FDFA 4YT4A 1XZCA 1JSWA 1VL8A 2XKAA 1YA8A 3UQYS 4E2WA 2VCEA 4JBGA 3ZWAA 2IYTA 1WUKS 4ZRMA 4F9FA 4LGVA 4BLQA 3EEOA 2DHQA 5I7AA 1KXZA 1QAQA 3LT0A 3AUFA 4P53A 4BHTA 5A9TA 4JL8A 4F3CA 1WV1A 2FPKA 2FY8A 2ZDQA 3S5JA 1A69A 3TIGA 1A27A 8OHMA 5KNDD 1E1QD 2OB1A 2JLZA 3FNIA 1P18A 4NTZA 4AROA 1VP3A 2R3SA 2EZTA 2VA9A 3A1DA 1H0HA 3HPRA 3IRUA 4P9NA 5DYWA 3MG9A 2PQ2A 2NZXA 5M2QA 2JCYA 3MHTA 2VOJA 4S05A 1GPKA 3BK7A 3U44B 3EASA 1D03A 1NW3A 5EQJB 4ENTA 1IXYA 3I3SR 3I9FA 4H0CA 5GJCA 4DLTA 4M0PA 1L7QA 3M4YA 4YJ2A 1VSBA 4YCNA 1KO4A 3GNSA 1GD1O 5ALVA 1G2QA 2XCIA 4KQ6A 3ORHA 2HX1A 1SB8A 2J5BA 1X74A 2II6A 4F5YA 1V41E 1JDTA 1HDZA 1V43A 5FLEX 3UMYA 1YA6A 1KVTA 3CY6A 3IAM6 4ZKEA 3KVRA 3REFA 2VRBA 3U9SA 1AUVA 2I9KA 3S2UA 2VA8A 2OC9A 4HZUB 3F6SA 4QA9A 5H81A 1ADFA 3MQ2A 1H2RS 4XYGA 4CMGA 2QRVB 4WXHA 5EXTA 221PA 2IY9A 2RBKA 1DTSA 2Q6TA 3N59A 3E2IA 1I80A 3BMQA 4ENWA 4MB0A 3E22A 3NAZA 4MV3A 3WSTA 2GDJA 1TIBA 1VKJA 3QF4A 4Y6RA 2D5LA 4MRMA 3IUJA 2OV2A 4MUEA 4M0KA 3MUEA 2ON6A 2WU8A 3VC2A 2GBFA 2XMBA 4RCYA 4EARA 1GPUA 3GJ6A 2C4HA 1HF3A 3KJHA 4HNTA 4R54A 3U81A 2NO5A 5KWJA 1O94A 2FSUA 4RK6A 5LP6A 1F5SA 3LWDA 3PUYA 4QDUA 3MWDB 4X8LA 1MQAA 2WNIA 2ONZA 3OZFA 4QUHA 4EBBA 2JVJA 4M76B 3J81k 2R9VA 3Q5DA 3RJZA 3RWOA 4CMCA 5TPWA 3B48A 1E3LA 3ZE1B 3TNYA 3H1AA 3EAQA 4XWGA 5LDGA 3U56A 1OR8A 2H1LA 4Z86A 3NR2A 4YAFA 3MRTA 1AZWA 1IC6A 2MOKA 2NSLA 2YN2A 4KIJA 1KEKA 1KEZA 3D3QA 2IZ0A 4G84A 5JQWA 3RU2A 5IWCA 2ACKA 4BNLA 4DADA 4W9RA 3ROEA 3WQSB 2H1VA 4S2EA 4DJJA 4YJGB 1N5MA 2Q1YA 1LB1B 3EB9A 4U2FA 4JR0A 1SUSA 2P6MA 3LPLA 4JI5B 3ZLJA 2ZYHA 4IG4A 1WP9A 3GDOA 4MJLA 5J58A 1B2RA 1SCUA 2IF0A 3H2IA 4OH7A 4IG9A 5A4MS 2BP7B 5F51A 1ZC3A 3GJ4A 4NE2A 3G2PA 5E8RA 1TM3E 2CFCA 3N0WA 2QLJA 3JQPA 5EXXA 1YKSA 1AO3A 1CQIA 5CFLA 2QY9A 5FP0A 5KOJB 3EA0A 3WO0A 3D6NB 4D42A 1WPXA 3H4MA 3QHQA 1QYVA 4WDRA 3KJGA 2PEZA 3OBIA 4KE8A 4NCKA 1M34E 3USCS 3N53A 3I6IA 5IULC 2ZJ7A 1DJNA 3O9ZA 3PFNA 1PTJA 1JYFA 3VZCA 3VGJA 1VE3A 4KTTE 4Q9NA 3HJBA 5FCDA 3ZDXB 1BVHA 2XDQA 3NYWA 1YJCA 4D9BA 3CVYA 1BCRB 5DHTA 3UUFA 3TQHA 2FR1A 4AZTA 3OOEA 3W2FA 2EKQA 4L9WA 2UZIR 2DJIA 3GUZA 3M6WA 4IWXA 2F8TA 2IC5A 1DC5A 2PRZA 4X20A 3UJ7A 4DN6A 4I1VA 4IH1A 5SZKB 4BX8A 3AEXA 3QX8A 5EKDA 4BFVA 3BWMA 3HB7A 3NORA 4QDJA 4K9NA 3IOEA 1ND5A 3MS4A 5CA0B 3LPAA 2RONA 3ZXYA 1N2CA 3K0FA 2VG8A 1ZAYA 4D9HA 3E0QA 4RAQA 3IRVA 2PH1A 3ASYA 2TMGA 3FBWA 4KIFA 4NDNE 2O8EB 2QUHA 1P80A 4EWLA 1R0XA 4JA2A 1FP4A 2GEVA 3QOXA 5TQ2B 1WD5A 3LT5A 1VL6A 3LPDA 5D1NA 4BKQA 1HV8A 5JNUA 4HAVA 3AQ4A 2JFXA 3G13A 3TUJC 3UW3A 3E04A 3BA6A 1UH5A 1PT8A 1PWEA 1RIFA 1X8XA 4CQMB 1ORVA 2ZTVA 1J21A 2ODTX 4YUYA 4RANA 1X1EA 1IEWA 2PWPA 2RAUA 3ESQA 3HNPA 1KF0A 4MNTA 1FDOA 4LTMA 3E9NA 3TEMA 3VU3A 4MS4B 5LQSA 3AY3A 1E96A 2R2GA 2XCOA 3LNCA 1IQUA 1HDXA 2QTWB 2HRDA 4NMXB 2R85A 1N0VC 1Y82A 2UYOA 5FAXA 2J4FA 2GYYA 3H4VA 1JDSA 4MO2A 3T99A 4D80A 5HW0A 1RZRA 2H08A 3ZKWA 2VP3A 1JX6A 4G37A 2QI9C 1USIA 2R60A 1FTSA 1U5CA 2H9IA 4R1NA 4PYJA 1KEUA 2HUPA 5AW5A 3K8OE 3GP5A 5L4LA 3AEQB 3QITA 5HA5A 3TZKA 2IE8A 2XSZA 3ADPA 3DMRA 3L92A 4MX8A 4X63A 4LF7B 5JTTA 1X92A 3AUJB 1J5XA 3HB9A 5CHEA 1AD2A 3ZY4A 1F60A 4JL6A 3JQAB 3MF4A 3KWLA 3BWXA 1YT5A 4MW0A 3U4MA 4HWKA 3L0BA 1L1RA 1X1CA 1EVZA 2DBRA 2E6KA 1N8TA 2H11A 4E6PA 2IQIA 3OFSA 5F92A 4BFSA 4F4IA 1Q91A 2IXAA 2ZAYA 1WZEA 1GUDA 1E9SA 2QQFA 4H7HA 4EG4A 5JXWA 5K51A 4FGUA 3TSOA 4QTYA 2JBAB 2HCFA 2QIPA 1ECFA 3DBLA 4MH0R 5CT6A 5A1JA 2NSJA 1ZESA 3TFOA 4OQPA 4DMUB 4LGCA 1M76A 4LVNA 1F48A 3C6YA 2GDZA 4LXHA 4Y2HA 5AI0A 3FUUA 1OWMA 3SEFA 4AKHA 4OHFA 1YI0A 1DWPA 1JJFA 1MAAA 3EQ2A 2C03A 2J5XA 1Y3BE 1SAYA 3VSEA 3DL4A 2J9YB 1NMXA 3T95A 4YUAA 4MROA 3L1JA 1XPUA 2EKZA 1YZUA 4LJ6A 1MJGA 1HZZC 5AVJA 1UOPA 3FTCA 3WDMA 2P77A 4V0QA 1PJLA 2ZT8A 3WA6A 1EG7A 2JGAA 5CA1F 5A0FA 3OIGA 4TXLA 1NE7A 1WDTA 3G59A 2P7HA 2X42A 3QW2A 1VTKA 4GH5A 4F84A 7MDHA 1IBCA 1ZR4A 4Y6OA 4E4YA 4F1KA 4KR9A 2FG7C 3SDSA 4EFLA 1N5RA 4AY6A 5B4TA 5AKEA 3T9AA 5B6JA 2VJCA 3KHSA 3TTWA 1Q50A 4DABA 4YGXB 2PGOA 4AJIA 1IPHA 1XTJA 3AILA 4AN1A 2KB0A 2PBLA 4KHPB 3GJZA 1L5NA 3L79A 2ZZMA 5L7WA 3A6ZA 1EWRA 1BXGB 5CP8A 2BEVB 2CNLA 4FKZA 5GAJA 3CLTC 3MQ4A 5SY6A 2R48A 1FSGA 5ALJA 1EWKA 1K6JA 1XPOA 2IF2A 2EFYA 3ZJVA 3P0JA 4A16A 1ZCJA 3L7KA 5DX1A 3HBLA 3AOEA 4TM8A 4OI0A 3LRPA 3OQIB 1NTOA 2DFNA 2EP5A 4Y2TA 3OZGA 3OZCA 4RNDB 3SQXA 3NBMA 1X1BA 2NSYA 5CDFE 3MCVA 3C3PA 1H1LB 3G7NA 4CU2A 1A2KC 4DIOA 2EIXA 2X0JA 4D0RA 5FOSA 1JSLA 3OU7A 4OOEA 3R9XA 1BU5A 4U7HA 3VZSA 2K7ZA 2HZBA 2QJRA 1AMOA 5K6AA 4AQ7A 3UUEA 5GGXA 1Q0ZA 4LOJA 3BIFA 1PS0A 2GFHA 1NDUA 4KP7A 5B6PA 5F7OA 3H2HA 3GLFE 3GV0A 1KPGA 2GRJA 3QF7A 4U0JA 3B70A 3TSZA 1XQVA 4ETNA 2FF7A 4J0GA 3THXB 2PUAA 3A4VA 3E5RA 4PVDA 2WAOA 4N03A 1J0BA 5DGCA 4OJQA 4UD2A 5CA1A 4OQLA 2FQQA 4FOSA 3PNYA 2ST1A 4GMHA 3G5MA 1ND6A 2AYZA 2NADA 4LC0A 1ZI8A 4LYGA 2MHCA 4REMA 4IOJA 3KQWA 1YASA 1ZK3A 4IUBS 1WXQA 3HPQA 2CXNA 4RA9A 2VBGA 1XF1A 2CLHB 2G8LA 1N4DA 1FS5A 1SBNE 2PSJA 1BDBA 3DMFA 3RAGA 4EL5A 3M1LA 3F97A 3HHEA 2P0YA 1KZ6A 3SFZA 3AHFA 4L6CA 4IV8A 1CQPA 3SS7X 2BKEA 4RV5A 1U3CA 3VDMA 3O8OB 1U6IA 1KPHA 4Q7MB 3KJZA 4FBLA 1X87A 1YDMA 3GA0A 5HSGA 2GA9A 3TLEA 4C07A 1J2YA 5K3AA 2H0RA 4KXLA 1XD2B 1GLGA 2WKSA 3BJZA 2CXRA 4Q03A 2FFAA 5AW9A 3LPCA 4N48A 2WMOB 3PT5A 4EJFA 4QSMA 4U2BA 1QCZA 5DTRA 3H99A 3QLVA 4NDZA 4D97A 1U7ZA 3W06A 4ZXPA 3GFGA 4KX3A 4LDPA 4HQ6A 5C51B 1XQXA 1SRQA 4P36A 4RXMA 4UHDA 4Q21A 5AVWA 1XTZA 1CNEA 1FTGA 2Z1NA 3CX3A 3IKLA 1XKLA 4J3FA 4PSUA 1EGVB 2OTCA 3T7RA 3F8TA 4P7JA 1JR3A 4DYVA 2F17A 3R5HA 1KSJA 1OZAA 3A06A 5LYJB 5F3RA 4D4KA 1UWLA 2C4TA 1PJCA 5JCXA 2AC7A 2G9VA 2X5KO 3LDFA 4ADSG 3KZNA 1FXSA 3D64A 4R5MA 3UCFA 2WIDA 3K9BA 4EJSB 4O02B 1V95A 2FW7A 1Z5NA 1ZUNA 4IFTA 4JJ8A 4L15A 3VVBA 1TJUA 1DAPA 1M5UA 3CLSD 3Q3EA 3UKOA 2YRXA 5ALEA 1P19A 1Z0FA 4QGAA 2PSSA 3DOHA 4OFBA 4WLVA 3IA7A 4HQKA 4RLFA 4U1RA 3VXKA 4EF4A 1Y9ZA 4BNMA 5C9ZA 4LPKA 3HBAA 1UQUA 1YGYA 2D5BA 5FPSA 2WSSA 3SD7A 4Z2YA 1XZ8A 2C9YA 4IF4A 4QXPA 2CFOA 4CKBA 3QEBZ 2Z6AA 2CMDA 2P2ZA 1L5OA 1TM2A 3BCUA 4LCEA 2PMFA 4LWQA 3PG5A 1EJ0A 1K5PA 2ODPA 4MV1A 4O0LA 2RHGB 3AR5A 1RE0A 1AGPA 1KJ9A 4LMBA 4QJ5A 1B16A 2QTVB 2VQDA 4RENA 5AW3A 4B80A 4CFSA 3EPJA 4G26A 3FLAA 4OHCA 1NUSA 2MJLA 1VJTA 4ADLA 3KDAA 4LOHA 2YUIA 2H8KA 1EHYA 4O25A 1HG0A 2QLTA 3NC0C 4CMIA 4ZZ0A 4PC3A 5BN1A 1E98A 3EUEA 3RS0A 2J5KA 3V4LA 1WQ3A 4CU5A 2K7FA 4RUKA 2VPTA 1EM8A 1FY2A 3AT1A 4MI1A 4P4TA 1E1QA 5BN5B 2O50A 2VSNA 1JBQA 3KKLA 3N39C 2W90A 4H3VA 2YIVX 5E6RB 4CM6A 4DIKA 4EEKA 3AR7A 5BP7A 5I4CA 3DB1A 1PKEA 4HDAA 2NZVG 3BHIA 4FIZA 1LLFA 4HG2A 4HWOA 2NLOA 2EP8A 2PJDA 1BG6A 3DKVA 3B9QA 3H9UA 2B6HA 4L5AA 4ZT5A 4NEHB 4AYWA 3X2EA 4L5YA 1U7WA 2QN3A 3ND7A 1VKZA 5K8JB 1EP3B 2WTAA 3PC2A 2AI1A 1RD4A 2CUZA 3RD5A 1QO9A 4IJVA 1A7UA 2C3UA 4RH0A 3ZWXA 4UNRA 1CXZA 1ECBA 1RYDA 2B37A 1IY9A 2PKEA 3I9MA 1Y4UA 2X5OA 4A0HA 2FXVA 4DAOA 4PSCA 1ZVJA 3OO1A 5IFKA 1X0XA 3K2QA 1V26A 1XK6A 2DT8A 5CIWA 5B1IA 5C31A 3LVBA 3PYXA 1FUOA 2X75A 3DAHA 1RM4A 4ZTBA 1QO0D 1Z88A 3R6LA 3OX4A 3THOA 3PHBE 2VTBB 3LVQE 2FQ1A 1PR9A 5KWSA 5E7QA 2G36A 4MW1A 3L0YA 9ATCA 2HOQA 1KO1A 5FL3A 4RPKA 2LGJA 5JS8A 3NJ8A 3ZK8A 4IWNA 2G6TA 2Y1CA 1K8XB 1ZMBA 4AJOA 5JSUA 1XRPA 2Z2XA 2X1MA 3R7FA 4G0MA 3IPLA 1EKXA 5ICGA 4UU7A 1JFFB 1FUYB 2NO7A 4UU8A 3TR0A 1YF3A 1YDGA 1L5QA 2A0KA 3DHVA 4XARA 5H02A 2R8PA 3U31A 4LJRA 1WPGA 4HWGA 521PA 2NU7A 3Q7SA 4D56A 3RTEA 3RWMB 2ZJ6A 4KZPA 1RLOA 1QGZA 4Q7EA 3GZNB 4FMDB 4RWZA 5IDXA 2IVFA 1TKCA 4KI7A 3ZD8A 5JRJA 4F2PA 3T7JA 4DDTA 4QQFA 3FSGD 2I4MA 1JFVA 3PEEA 4LCBA 4OI4A 2WJ3A 1DAEA 5F5LA 1U0EA 5JD3A 4IAOA 1UJ5A 4HFRA 3AESA 1SBTA 1L5VA 1FYVA 4YWHA 2JZCA 4Y18A 2OCGA 1AMUA 1BE6A 3NOOA 1MO6A 3OTGA 3UWSA 2VVTA 3L0IB 4AX4A 5LFAA 5DCUA 2DULA 2IOQA 4IHJB 7MHTA 1U0RA 3LGAA 1JE1A 1NPYA 2DWOA 4OHVA 2O2GA 3JXEA 1QKJA 4YB8A 2IP4A 1CYEA 1EUDA 1DOFA 2I78A 2ZGVA 2YJNA 5K0SA 1L8OA 3A1FA 2Z08A 4K9RA 1V7QA 4JLSA 1QTIA 2IYUA 2ES4A 3ZI0A 3F0TA 3U09A 1KWKA 5DBIA 3ZWKA 1CJTC 2CJPA 3MBKA 1KMQA 2PY6A 1EJ6A 1UZMA 2HK8A 5JMWA 5KTTA 3WGYA 4IH9A 4RF3A 2GAAA 4RDXA 5K8CA 4GWLA 4OX9Y 1ZXLA 3UGTA 2OHHA 4N82A 2FUSA 1WKBA 3EC1A 4E5YA 4CF3A 2FPMA 4AKSA 3G0HA 2AX4A 4BKOA 1UDAA 2A3RA 2X0KA 4ME6A 1VIVA 1SVIA 2UVDA 4ZQEA 1FJGB 3HNRA 2VF2A 2QPOA 3REGA 1XP5A 4HO1X 1HM5A 4QU8A 4ZJPA 4NICA 1Y9JA 1MGOA 5HS6A 2C77A 3GMSA 3KSDO 1NM5C 2OZPA 1OOEA 1BTOA 5H70A 3UGQA 3DCJA 3HSKA 5C5IA 2H65A 3FLEA 3T7EA 4PZDA 4C3VA 2FHPA 3HN2A 3PGXA 1XIVA 2A67A 4BKUA 4YN3A 3VH4A 3CSSA 1ZJWA 5HGXA 4J9VA 4C6HA 4CGYA 1ZSNA 3VR1A 1SC3A 5EVCA 2VEDA 2OBXA 5ETJA 4AJHA 3UJHA 5JY6A 1FE8A 2ZR0A 1D7OA 4X9XA 3ZWDA 3RIHA 3QA9A 3EUWA 621PA 2BFEA 2AOTA 2PWBA 1VHJA 2J67A 4OV6B 1CE8A 3BK2A 3PEYA 4LV5B 1EIZA 1E3EA 1JVNA 3IIEA 2HPZA 5C80A 4F97A 4P31A 3AB7A 1WO8A 2C9OA 2AMFA 4EG7A 2XUFA 3MJVA 3S8MA 1BHQ1 1L8AA 2HJVA 3N7TA 1N2SA 1DBIA 4NC9A 2J5RA 2Q45A 3CZ9A 2DYKA 4P08A 3AB3A 3TZQA 1THMA 1TFRA 4BPRA 5FBLB 3U3MA 4BVEA 4JJFA 4CMEC 5JS7A 5JZVA 2FWNA 3EQ8A 4FBMA 3JQ9C 3KWMA 4HY3A 2Q4TA 1OZHA 1TO1E 1YFJA 3RHFA 4I81A 1V47A 2A0WA 3D3JA 1YHYA 4H7DA 4MW5A 4PX9A 4NFYA 1LH0A 1TQHA 3AJDA 2PTHA 1ZBQA 3FPKA 1O9HA 4F4UA 1AK9A 3UAWA 1D4FA 1TIPA 3PFFA 4UQOA 5IM5A 2HHAA 3ZLTA 5U1PA 2D8MA 2ZB2A 5A5FA 4BXOB 4NXMB 1RCFA 2I4RA 2RAVA 1IM2A 4AP6A 3L46A 3PQ5A 4YACA 1AC5A 3CG0A 2D3WA 3GLSA 4KO2S 1DXYA 4L3WA 3I12A 1FUQA 2VXCA 2WUFA 3OMXA 4EO4A 2ZI5A 5I3CA 1YGPA 1NJ2A 3FCUB 1VG9B 5KJFA 4KSBA 3W5IA 4ZMRA 1YTLA 2P2NA 2VTVA 1E9BA 2EKBA 3SJ7A 3O7WA 4DPMA 2ZWMA 1P44A 3PR3A 5TX7A 2NWQA 5E9JA 1CZRA 1IMJA 1C9DB 3R3HA 5DTMA 3HCAA 4XGIA 1Z29A 2OECA 3LBYA 4HRAA 1NW5A 3O75A 5ARDA 2QG9A 4MEAA 2FEMA 4ZCMA 3BQ9A 3TYXA 2XT0A 3H97A 2HDHA 1CY8A 2ZETA 3LUGA 5CFZA 3OSUA 5JQGB 2FTKE 4XJTA 3BJEA 5KSZA 3IMEA 2J3LA 3L40A 3PFKA 5KCZA 1YWGO 5CXXA 1DKMA 2EL9A 3ZJUA 2WE7A 4AWBA 2OBNA 2OV3A 2ZRKA 1R3UA 3FFTA 3KKPA 2Q4DA 1MJGM 3G02A 4GNRA 4RS3A 5D85A 2X0NA 1IQPA 1PP4A 1XTPA 4FU0A 1PJBA 4PGFA 3ZG6A 2CDCA 1KI3A 2EL7A 4KFTA 2C8LA 1NU6A 3I5AA 4H7IA 2ZJ5A 2IOFK 3N0VA 1V4NA 2E55A 4LCJA 4IHAA 3TM5A 5BQFA 1HNZB 1LZLA 2FSGA 1ZOSA 1T35A 1P61B 3DV9A 3LUFA 3HVHA 3EK2A 1XZGA 4F1WA 1PFYA 2DM6A 4DDMA 2I6GA 4FMCF 4DNQA 1C7RA 1JIVA 2F3QA 4KH1A 3WQQA 3BGOS 4O59O 1KTIA 1R0SA 1YU9A 4BNGA 2CVFA 3KFLA 4K05A 1UBSB 4YXFA 3BYZA 1FURA 4R1QA 5B53A 3CH5A 3SKVA 2HMYB 1SKMA 2XKBA 1J00A 2QX8A 3I0ZA 2W83A 4AZSA 2CLCX 1JDZA 3IE2A 3LKDA 4F5DA 1CUBA 4FEYA 4D82A 4RHCA 1SY7A 1U8YA 4L22A 4QYSA 1QPZA 4QD3A 2DECA 3OIUA 3LC1O 2HMUA 3O38A 4XA8A 2XF8A 1M2FA 3VVMA 5F1PA 4LRYA 3P0FA 1Q0TA 3O1IC 2YY6A 5FUVA 1D1PA 4ZYWA 1RYFA 2WK1A 1IUNA 2A6PA 2XMZA 4MVCA 1SUEA 2OL4A 2BTQA 5DWVA 1E66A 2OXEA 5G0VA 1Z8FA 2VZ0A 4CM3A 3PIIA 1VYUA 1UFQA 3R24A 4FMBB 2Q3HA 4GPBA 4MQFA 2GN2A 3CURA 3BORA 3QMVA 3CZMA 4YH1A 2LCFA 4AIIA 4CODB 4BQFA 1KZ1A 5A4FS 1E1MA 5HXAA 2BZ0A 2WAXA 4MV9A 3G2KA 3O1LA 4WY8A 5K0ZA 4URVR 2XE4A 3NIBA 1WSBA 1JIXA 2I6TA 2QTCA 3ES9A 2RGBA 3IVAA 5TC4A 2H92A 1BE0A 1G4UR 1MUUA 2JCVA 1HL3A 3IDAA 1WXIA 2QWXA 3GBVA 1R6UA 1BMDA 1L8LA 3DKRA 3N28A 5DLDA 1JA1A 2KPOA 3K09A 1PYOA 4QX6A 4P80A 5DGHA 3TRDA 3DEFA 3FVVA 4HNUA 3OX3A 4HYEA 2ZM5A 1QQAA 6PFKA 2UYHA 1NW6A 5JLAA 2XE6A 3PE4A 3F4RA 1VB5A 2AEMA 1QHEA 1Y1KE 3S8YA 4EIWA 3C2QA 4WNAB 5L4NA 1FPMA 2QRMA 5L3SA 3T7TA 4BX3A 2WOJA 3S2YA 4WCFA 3Q3VA 1X0VA 4O29A 1KSFX 2YOHA 3JD3A 4HQNA 5CU7A 2WLSA 3FDIA 1GQOA 2I5PO 4YJ2B 3VJKA 1DJMA 1GG2A 5F7XA 1PBTA 1ZHFA 2D74A 5DGTA 4YMUA 3VR5D 3WIVA 3KBBA 2PSDA 4YIHA 2TYSB 4D7AA 3RM3A 4CN8A 4O6VA 1M6HA 1DQPA 1LK0A 2CWDA 4LQDA 1ADYA 1ES9A 4DIMA 1G4HA 1Q84A 4J0JA 4HGVA 5JZSA 4CWAA 4F4JA 4DKXA 1YDFA 1DIBA 1E7QA 3N2GA 1XRQA 2LWIA 5AI4A 3KOUA 2CL0X 4C05A 2O3SA 5CDGA 3MBIA 1W5SA 3BMQB 1S02A 4B4DA 3F6BX 3CNQS 5TQJA 3LXRA 3SQLA 3E22B 3W3AD 1EFKA 4HX5A 1Y7IA 3GL9A 1EEXB 3QF4B 1ORWA 3P97A 5ABPA 4HP8A 4MRMB 3IVCA 4UCQA 2G07A 1RJWA 1HYHA 3C85A 1I9GA 2COEA 1KC1A 2I99A 2PWAA 4GBED 4PV7A 4AMGA 5JCPA 3TGPA 4XM0A 1KRXA 1XWIA 2ZQZA 3DE7X 1CUDA 1WABA 1XA3A 1YS2X 3QOYA 1IIRA 5E1DA 1GFSA 1UP7A 4BIIA 5LP6B 3E1GA 3KHKA 3EIXA 3QV1A 1QHYA 2XZTA 2QRHA 4JB2A 2GKGA 1XXLA 3RE1A 4BATA 3W5UA 3QTLA 3TIXB 3AY0A 1L4FA 2POQX 2AZ4A 2RBEA 2RBGA 5TPWB 2Y76A 1DKOA 1R8QA 4CKYA 3D6FA 3IT0A 4UULA 1YZQA 2VK1A 3LD9A 5I6DA 3WZLA 5LQJA 1SUIA 1H2WA 4BB0A 1SH7A 3QYJA 5LZ8A 4BMPB 4BN4A 2AIRA 1C0IA 1VSQA 3GVXA 1WL8A 3NPAA 1ZU4A 3QEJA 1EGAA 1JXAA 5A1TA 4DVJA 2BFNA 5CW2A 4ZXFA 3DWEX 4FR2A 2DOKA 1KR5A 5C8ZA 1JI3A 1HEUA 1WTCA 3MXOA 5CYFA 3TLAA 5JVDF 5KNDH 3ZGZA 1HQKA 4TYYA 4L4ZA 1Q3HA 4RY0A 3TRKA 4Q34A 3TVYA 1SCUB 1TW3A 4R1PA 5FR1A 9LDBA 4YAKA 3HQ4O 2B1QA 3WL5A 2H06A 3L8CA 1YOVA 1F2DA 4WY5A 4AF8A 2R7NA 3F4SA 5A04A 4BAUA 1A8HA 3NH9A 2GM9A 2A84A 4S1NA 5IU6A 1KYZA 2JGNA 3L43A 3L77A 4I8IA 1CQIB 4RD0A 3TAHA 2P6UA 2RGRA 1VSUA 3I3OA 1QHSA 3KE9A 1L7VC 1FMTA 1LA2A 3EDMA 3INGA 1K9VF 3IR5A 2WHEA 4Y2QA 4ER5A 5BSGA 5DN6D 4LXYA 3ROZA 3R23A 2VWGA 4AFNA 3TDMA 4LF8B 1Z0KA 2OGUA 5KQPA 2PGAA 2P91A 4MUGA 4IIXA 4EKYA 1V5GA 5JALA 2XDQB 3AIOA 4KQ2A 4ECEA 2UZ0A 3GBSA 2MWMA 1PT6A 2C83A 3ZOKA 2IKQA 2VAWA 5FFFA 3ZV7A 1TJNA 3UH1A 4V0OA 4P4LA 1WUYA 3HUTA 3MAAC 4L4XA 3W1EA 1W35A 4HMQA 4X20B 1YRYE 5AK4A 1U3FA 2PM8A 2ZQYA 3V1UA 2VCYA 2H6EA 4C14A 3LKVA 5CVEA 4E5UA 1S2MA 4AS2A 4XCXA 2QT9A 1MKYA 1G8GA 5CXSA 3U7GA 5ICCA 2X86A 4QNRA 2M2IA 4NPHA 4AUKA 4BP9A 1AO0A 1N2CB 3K0FB 3QSGA 5JWHA 1W59A 4ER3A 4I1OA 3OLVA 1QO0A 3WKAA 4MTLA 3ZCQA 5GVSA 2VHQA 1D5CA 3ASVA 4DQUA 1FP4B 1FCJA 1TCAA 3QHAA 2D27A 1NKVA 2J0UA 4IS2A 3WFZA 4MPPA 1EWYA 3I37X 3PK0A 1CF2O 4JODA 1OX4A 4DC0A 5AVUA 3D4OA 2RH4A 3E9RA 2R6GA 4LY3A 3EXHA 5EFZA 2XB8A 3OIYA 3OZEA 3WWOA 4A82A 3OECA 3PENA 4M9RA 3DL2A 4RK7A 4IVPA 4M0DA 3NHFA 2K2QB 2QD1A 4YRCA 1L9XA 1WOMA 4A2CA 2XYGA 1X2EA 4QRDA 4GLOA 2RD2A 4M1ZA 3OEWA 2Y1EA 3TIVA 4E94A 1HGXA 5E95A 4QPNA 3DFFA 1Z16A 1JT9A 2VAMA 3AOEC 4QXRA 3TRHA 4AJ1A 2QU7A 4QVIA 1M8PA 2PS0A 3SXJA 3CNOA 4GWKA 3QXGA 1IATA 1LPBB 1UFVA 2E4UA 2QRGA 3SI7A 3ZKWB 4DCVA 5MN5A 3TLZA 3LYLA 2PANA 4JBYA 5BSRA 4CL2A 1N4AA 3W5BA 4GKBA 1FL9A 2D2EA 4DIEA 4FOTA 1ESEA 3PXDA 5KX5F 5SYNA 4NENA 1GA4A 1VP9A 3VNRA 3CRNA 3RADC 1RI1A 1URPA 3PF8A 1EXDA 4PLWA 4Z9XA 4OF4A 4Q9KA 4X6XA 1NN1A 3T7KA 5KC8A 4IIJF 1GUBA 3GGOA 4ZQBA 2LKDA 4EO7A 4JKIA 3L7LA 2KE5A 2WTEA 1TE2A 1F4VA 1CJKC 1S5PA 3FM9A 4NH0A 4C2UA 1GTJ1 1RP7A 4RQTA 4HDRA 3EIQA 2PWYA 5ARBA 3WI7A 4XLLA 2JGMA 3DE5X 2VCHA 3DM5A 4OHMA 1XDZA 4QREA 3DBLB 4C0AC 5DNVA 4IDFA 1XYYA 3A4LA 5KNDA 1RI4A 2B2CA 4XEUA 5I47A 3VR4H 4Q00A 3G88A 4FOPA 3M6MD 3WV4A 2PPVA 3KLOA 4J16A 1IZ0A 1U5BA 3MUFA 2QX7A 4MB6A 3ZWWA 1O08A 2XTZA 3S2IA 3WDSA 4ZI3A 3HDVA 3BRCA 5JXIA 1NFQA 1ZHHA 3DXXA 5D7BA 5IDWA 2JIZD 2X22A 3OOJA 3QE4A 1NBHA 3OPXA 4A7PA 4WXRA 1H93A 1C0KA 4DM3A 5KSOA 3HJNA 1WU7A 3F4KA 4Y3UA 1DWOA 5M04A 5KC9A 4WJLA 4MGIR 3WR5A 3ITDA 4A0QA 4AUMA 3BL8A 1E7MA 1YDWA 1KGSA 3EQ9A 3OOHA 3NDJA 5FBQB 4IQJM 3FDXA 1HNWB 1X1RA 3U3KA 4P98A 1RI3A 2ID7A 3MJHA 3WICA 1IBLB 3GZ4A 3ED1A 3RVRA 3HJHA 2QL5A 1XCOA 3TQFA 4ZYZA 5KTNA 3FB1A 3K05A 4OHPA 1JGTA 4BVGA 4URZR 5LBUA 2V4MA 4DG9A 4JSRA 1BH6A 2RGXA 1L4LA 1GIAA 1JSXA 2V96A 2FMUA 2ZJYA 1OJ7A 3A3NA 4OI2A 2RH5A 2BFWA 4IIJA 3OF5A 2NNWB 1FFEA 2TMKA 2SCUA 3OJOA 4ZU1X 1CZOA 4MIEA 4NBWA 5IS2A 2WTMA 2F4VB 1EWQA 3JQFC 4UD6A 5FBKA 3GWGA 1JT2A 2JK1A 1TQ2A 1F0YA 4KUGA 3LLUA 1I94B 3M70A 4D0NA 4F4FA 3ZLUA 3TWOA 1NFFA 2BGUA 2UYGA 4HSGA 4AG6A 5KTRA 4ARIA 3SHOA 4UNIA 2NAFA 4F7WA 1AK1A 5A05A 3VV2A 3OH8A 3R9XB 4FFMA 2D1YA 1GGVA 2H1RA 1I0AA 4P33A 3ZW9A 4GOOD 4LY9A 4FFRA 3AP1A 3ZHBA 2P2GA 4D8XA 1UP4A 3OT4A 4YVFA 1TMYA 2JLWA 1ISRA 1T2EA 3VOSA 3M49A 4XVRA 3QPDA 4DCSA 2W6QA 4JXJA 1AHNA 1ZOIA 2ZBEA 4BRUA 4BFUA 4YAUA 3DF9A 3PUZA 1U28A 4P7FA 4ARVA 4LZNA 3C8DA 4UM9B 4E07A 3DD5A 4WK0B 5CA1B 3CISA 1N3LA 2QLBA 1HOTA 3GF4A 3FUXA 3V1TC 1XR3A 2PZLA 4ZDKA 2DXIA 1MVNA 1PNTA 1GYQA 4KITB 4OXNA 1ML4A 1BH2A 2VZEA 3PGJA 3RJ9A 4LHYA 3WBBA 2GILA 4PC2A 2TRSB 1AGNA 2ZCVA 4A2QA 4XGQA 4RA9B 4GOJA 4EVRA 3W2EA 4D9EA 3ABSB 1OAOC 5ECYA 2PSEA 1KE2A 3ANYB 3C5WP 3CVUA 2GM5A 3F47A 2ADMA 1G5HA 3HWRA 3K4PA 3F8WA 3KT6A 3L9WA 5KUTA 2AD1A 5CFNA 5JSZA 3ZJ5A 4F86A 2I3ZA 2FSVA 1XCJA 1JN0A 5CT8A 3PR1A 4ZRNA 4LUCA 3Q2OA 4X6LA 1RLMA 2FQWA 2JJ8A 2VPXA 1A4IA 5AXAA 1KARA 3I76A 3RVOA 1XWOA 4H7EA 4QGHA 5A6VA 1BDJA 5FORA 2A9PA 1XDDA 2XNJA 3K70C 1ST3A 2FZVA 3O6VA 2V54A 4PAQA 2VLIA 2UDPA 4FM9A 3DOEA 3RIGA 3TLJA 3INTA 4B48A 1G7TA 2H31A 3J7TA 4H1UA 5B36A 4KNYA 3ZVNA 2CL6X 3GELA 5FQOA 3O03A 2WHYA 4U39A 4I5DA 2WICA 2VPIA 4MGKR 3TLMA 4ZGWA 3PX7A 2PKCA 1G2OA 2JLVA 1ZRHA 3B82A 5DX0A 3I58A 3B6EA 4Q24A 1SCAA 4KSCA 1NNLA 2OILA 1Q0UA 4Z8XA 3ENZA 4GZ5A 3CZCA 2JAXA 5T3YA 1Z2DA 1ZUNB 3TPZA 2QZPA 2YVKA 1QF6A 3F8SA 4Q12A 4GD3Q 4U5XA 1JFLA 1QS0A 4HVTA 1X7XA 3ISTA 2O8DA 1RKXA 1XE3A 1L8QA 1LK5A 2X5JO 4XZ3A 1EK1A 2EQAA 3TZCA 4EY5A 1SGWA 3KOYA 5JCOC 2O5CA 2IQ5A 2P11A 5TPZD 1YB5A 3QFFA 1G5RA 2YC2C 5C18A 1X9HA 1OC4A 2GVZC 1Q16A 3PGVA 4DBVO 4FPXA 4CKBB 4F2HA 1XAJA 4EL0A 4Q3BA 4UM7A 2IV7A 1F14A 1VHQA 2PL1A 2ID9A 4YK7A 1I7SB 1RCTE 4JC4A 4OLFA 2FR0A 4EPRA 3L8HA 5G40A 1VCMA 2PUBA 4TSKA 3ND8A 4LE1A 2O2SA 2ZYDA 5T4HA 3HCDA 1EUQA 1NU8A 3O95A 3G8YA 1ZD4A 3OEEA 3VSBA 3WLRA 2IBTA 3KPUA 1GKUB 4KRGA 1UXHA 4JBWA 1VJRA 2TECE 3GRUA 2RGWA 2ZM6B 2J3EA 4CMIB 3IDSA 3SX4A 3K8YA 2B9EA 3OPYI 1P2VA 1EM8B 3NV9A 1MD9A 4PZAA 2EX0A 2YWGA 5BW6B 4D57A 1IL0A 5DNCA 1NURA 1NX6A 3HV0A 3HZZA 3I64A 2HJWA 3LRXA 3AVXA 3PKZA 5E2IA 2A9VA 3RRXA 1FMJA 4PFSA 1RVV1 4KLRA 1Q5PA 5AR1A 3HXMA 1E6WA 1T1SA 4Q3AA 3D5TA 4WASA 1Y7PA 3OTWA 5JAIA 4WOKA 1DCKA 3C3DA 2OD7A 3KELA 4TTRA 2C4KA 2FEXA 1C2TA 4PPGA 2GNOA 3FGNA 1TF2A 3FPHA 2UUOA 2EZ8A 2DR3A 3DG9A 3R5KA 4L1KA 5LBIA 3RQSA 1ANKA 5IZ4A 1AA9A 1O5IA 2O4CA 3FHJA 3GXOA 3UBMA 3VNQA 2A0XA 1TU0A 3CLHA 4R31A 3TW4A 4HGQA 3CH4B 4HOYA 1OI2A 1CULC 4FUTA 4HXYA 2J3HA 4ND4A 2J32A 4S2UA 4EUHA 5BXQC 4TROA 1KYQA 4EFNA 1L7OA 2E89A 3L02A 4Q4LA 2E4AA 3P32A 4GGPA 1ISIA 1QFXA 2OLEA 3VO8A 3ZQJA 3PVZA 3MA0A 4Z7JA 2NQTA 3ITEA 4NYMQ 4PCLA 1G3IA 3H0EA 5DHUA 2JRCA 5AVZA 4IFBA 4MUIA 2E9SA 3GHHA 3HDQA 3TECE 4ZYYA 3HDTA 5AKKA 2O8FA 3W3AA 5DM4A 5BUSA 1E7RA 1RHRA 4KDRA 3NHJA 3CX4A 2NUTA 1E4VA 2REXB 2B7BA 5TJ9A 5CT4A 5EJ4A 1GPAA 1I4OA 2QX4A 2W00A 1XYGA 3EBLA 2QPLA 3O3NB 3JWHA 4RHFA 3VOTA 3TUZC 1USWA 1BN6A 3ON5A 4JLWA 2GD0A 5C3UA 2RH9B 5DB4A 3CVVA 4KR7A 2NU7B 2OFPA 3FSJX 3UAXA 2IODA 2QDKA 3F4TA 2SICE 4C7KA 5FBVB 1IU9A 4MQEA 4J0KA 1N1EA 5HTKA 3KCQA 3L8FA 2AD5A 2QP9X 3NIDB 2B9VA 2GCGA 1OD6A 1UBLS 1XWFA 2NT4A 2Y67A 3O93A 1GG9A 1J6UA 1GT91 1P2BA 1R16A 1DKRA 1JHPA 3BDAA 2PR7A 3PPYA 4P0QB 1QHHA 2HV9A 4CIVA 8ADHA 3U7HB 3GPLA 1RXEA 1P6XA 1MCZA 3A36A 3AESB 4PXYA 4MHSA 4MV5A 2VDLB 1TECE 3F3MA 4Q47A 4GEGA 1B4DA 1R0LA 1U9IC 3ITKA 1TZMA 2WSIA 4II3A 4O33A 3T35A 4BE7B 1WVIA 3BEOA 3FXAA 3NT4A 4UPVA 4CMBA 3AZQA 2ZCJA 2WV7A 3F4LA 4YREA 1ZEJA 2V7QD 3KJIA 4G65A 4E1VA 1H0RA 2DPHA 1BCSA 3IUNA 4J0IA 1JIIA 4OY3A 3RAPR 2XQIA 3JV7A 1ZO8A 3G2LA 2AR0A 4KI0A 2CHVA 1A7KA 3LSTA 3JRWA 4GOLD 3C3EA 4GVLA 4US2R 1EUDB 3D1JA 5ED0A 3QPBA 1XDSA 3AJAA 4BWFB 2J6CA 4IVRA 1UQRA 1TJ7A 3FJ1A 3E7PA 4D02A 3DKIA 2GXSA 3ORSA 3DEIA 1E5QA 1EDDA 1S3SA 1K0UA 2Z8XA 2W71A 3JSAA 4LHZA 4S1VA 5SICE 3VM6A 2FP3A 3W34A 1XD9A 2EKPA 3DAGA 1TJWA 5DN6A 2JCSA 1I6LA 2YASA 1XLUA 4R8RA 1H4SA 4RH3A 3A1NA 1OTYA 5IF3A 1XZJA 4J3NA 3WLTA 3DHWC 4U2KA 3KZXA 5DCYA 4EYQA 4E14A 4GPEA 1MX5A 3TK1A 2DAPA 2QN8A 2FF5A 3FPBA 3IT2A 3KKEA 4WKBA 2CL5A 4HQLA 2ZRCA 3A1VA 1RT9A 5JS6A 3HY6A 3OD1A 3OCVA 1UDRA 3D7MA 1I4EB 3BZBA 4I1SA 3V8NA 4GKKB 1RNLA 2JEOA 3CCBA 4TMZA 1JDNA 2CXSA 3N1UA 3S55A 3SM3A 3DMNA 4OYLA 4M9SA 3WBKA 4D9KA 5IXJA 2QSZA 2ZAMA 2H3HA 2XMDA 1AURA 2X6TA 3DW1X 4UUPA 4U02A 3TOXA 5CR9A 1T0UA 3IP5A 2YIJA 5TDHA 2QRQA 1L7AA 1NI5A 3U3JA 3QXHA 1PSZA 3GLGE 3I05A 3ZHSA 2JFGA 2B3DA 5CYPA 3W1VA 4MDFA 1WBBA 4KQ9A 4L9SA 1DMSA 3D6VA 2PL9A 4UQPA 2OSVA 4GMXA 3HKDA 5AK3A 2Y68A 2WZQA 4KYUA 1T9KA 4LSZA 4J0QA 2VSXA 1BE1A 3M6VA 4AJLA 2BFEB 4L74A 1SIOA 2AOTB 4PYQA 1QQ7A 1X7ZA 4ZO4A 9MHTA 5IAOA 1CE8B 3C98A 2YW2A 5F2KA 3ADKA 4ZAZA 3Q3HA 5A06A 4A36A 3FWZA 3I92A 3CQ9A 1JAHA 1IK4A 3IAUA 2QU8A 1UM9A 4KIWA 5KDLA 1XTTA 1EWTA 1FP7A 2A0UA 3CE9A 2DPGA 1DFIA 3ZKAA 3UAVA 2A59A 1D8TA 1GPLA 1G8PA 4FKBA 4JZYA 4KIUA 4EPTA 1H8HD 3AJ8A 3R75A 3HDHA 3CF6R 2R62A 3IHLA 4FXPA 5LZ5A 4CPDA 3ZE0B 1YHZA 2IYXA 3JQGA 4LTNA 4ID3A 4PINA 1ZGZA 3I5UA 1UWCA 5H7XA 3IELA 1L7BA 1UK8A 3D31A 1K97A 4H77A 1D0VA 1O03A 4C4XA 2YRFA 3C3YA 3KTAA 3G0CA 2XZLA 1PWXA 1FU7A 2VPPA 2BBOA 2M98A 3KVVA 4QATA 5EE0A 3TSCA 3EPLA 2P9HA 1WW8A 5PNTA 4DYDA 4WIAA 2QENA 3CR8A 3AL2A 4Q48A 4RK0A 5KVSA 5F1KA 5KTKA 1GQ2A 2ECOA 2A5YB 3WL7A 3B89A 2EXXA 3P9SA 1E2IA 1KAQA 1SG0A 2AV6A 2IPNA 4Y2RA 4HBZA 5CW1A 4ZAWA 3CRW1 5B30A 3C1TA 5AW1A 1JAZA 4JFRA 2ETXA 3TF5A 3Q11A 5CPFA 2J31A 4F2GA 4CLHA 1S4QA 3G8CA 2DGDA 3D7KA 3JTEA 4DQVA 3BXFA 4M1SA 1AS0A 3AWIA 3HJTA 3QJ5A 4QOJA 3TH5A 3T3HA 3VR2D 5JYEA 1QK3A 1RLTA 2R97A 5C8XA 1R6VA 1J0EA 4J2OA 2H4JA 3BXXA 1BDIA 1I7QB 1ACJA 3B8EA 3QX9A 1WDKA 3NM4A 3TNFA 4BEVA 1E6KA 5B3AA 1SIBE 3O3MB 1DWUA 3GH3A 4TLCA 4LXXA 4NS4A 4NU0A 4LQLA 2AYXA 5AM5A 3IQFA 3JAMA 4JYBA 3WK6A 3H0CA 4INAA 2JKVA 4C4SA 2RHRA 3VNVA 3FUVA 1YR1A 5HJ2A 1E9FA 4RZXA 5AIAA 4GZ6A 4OYYA 1YOBA 5AW8A 3AQIA 4MJXA 4BC0A 4IDBA 4FHFA 1Q11A 1JPVA 2JIZA 2BMWA 2PUWA 3QFCA 4OXIA 3V34A 4C7XA 4F9EA 1KOGA 1LLQA 1E2KA 2VDRB 3DDCA 4CG3A 1PNQA 1RDFA 2YDXA 4DS3A 5C5CA 4QZVA 4JOQA 1MB2A 2JJ2D 1XWWA 2AMJA 1QGAA 1E60A 1TF7A 3DR3A 4AB1A 2JIQA 1XZHA 4OLAA 4GECA 4DA9A 3L4EA 2W48A 4RFLA 2IP2A 1TPYA 1XV5A 4J9UE 2XCUA 3BFXA 3H6HA 2V7XA 1G21A 2BGRA 1T5LA 1GPWB 1HY3A 2JKYA 5AKYA 1LW6E 3NHAA 4ZVNA 2A78A 3CIOA 1NLMA 3VO1A 3U2QA 2Q46A 2REQA 4HNSA 1U2PA 5FRDA 5FWDA 1Q0QA 4ZZ1A 1LBEA 3HMQA 1JEDA 5MFPA 4WCDA 2H1OA 5HX7A 2C3OA 2TMDA 4HNGA 4CIWA 1XG5A 2A0YA 4P5PA 1SWWA 3D6UA 5K0JA 2FDCA 1PQYA 2MSNA 4G9EA 4IKEA 4ZVQA 3PS9A 5JMOA 2LE0A 2QQEA 4JGBA 1A9XA 1NQUA 2E82A 4IGKA 4YUWA 5EAIA 4MAAA 1OCEA 2WF8A 5H80A 3AFNA 2Q9BA 2PN1A 4M4SA 2BTQB 1RBMA 2C4NA 4K8OA 4EHJA 3NP9A 2SECE 5DM0A 3SJZA 3TBKA 4CUKA 3BSWA 3K1ZA 4CM8A 5M34A 4TVBA 5CCXA 1C3XA 3DM9B 2ZI6A 4HEHA 4MQFB 4PXSA 5L3RA 1RE5A 3DCNA 1IY1A 2VAVA 4Q7JB 2HADA 2YKGA 1U9YA 1ZL0A 3M83A 3WIEA 1K3TA 3ZHVA 3GT3A 1C29B 5AMXA 4EUSA 1R15A 3C6MA 2ATEA 1NC1A 3A9CA 4KQFA 4AN4A 3BGDA 1C7EA 2BHSA 4YV1A 9ABPA 2J6HA 2LDXA 5ALNA 1LI5A 1EGMB 1ZFNA 2XE8A 3BRQA 3GZTB 2Z2KA 3JQ6A 1V37A 5JO9A 3ZWMA 4I5GA 4NMWA 3MCZA 1WW2A 3AUXA 3WZ2A 2CK3D 3FGZA 3TB4A 4LKRA 1BYUA 1W6RA 2Q5HA 4GVPA 1TYBE 2P3LA 1H8ED 3UT6A 3RG2A 1OASA 1K7YA 3EIEA 4CM5A 2YJ5A 5KTMA 1SUWA 4CV2A 3KQHA 4N5NA 2QRLA 1CY2A 1LVHA 3OZXA 4KE9A 1X86B 4ZCLA 1D2NA 1DBRA 4DR2B 5T4EA 3D8HA 4GL4A 4G56A 5L3SB 3K16A 2ZB7A 1MN6A 3VZBA 4Q4AA 3D59A 1I6MA 4HGZA 4WCFB 4KPGA 5TR9A 3CTMA 3PJRA 3MCWA 1P73A 2GVNA 3ZN2A 2YXEA 2CYAA 1LCIA 2PYZA 1ONPA 4NYMR 3ISVA 3T9BA 1U2GA 3BCRA 3OOWA 4OAPA 1B0UA 5HJ5A 1JFRA 1OGYA 2EW8A 4FEEA 2N3ZA 3W4JA 5KYXA 3MS7A 4RA6A 5EUCA 1XZPA 3CVJA 4BNIA 3KB6A 4IEIA 2ZJ0A 1OFUA 1UDBA 5GV7A 4BWYA 1EZ1A 5CNMA 1IZ9A 2QBYA 2QM0A 1PR3A 4EI7A 1M8JA 3PZBA 3IPAA 5MGBA 2RK6A 1X2BA 1W93A 3OWHA 3C6QA 1D6JA 3N2GB 4XM1A 3GGDA 3CB2A 4IIYA 1I3OA 3D3KA 5I51A 4Z7OB 3U13A 2PGIA 4KN6A 4K0KB 2GEUA 3D5QA 1QX4A 5JCJD 2QE6A 4Q3KA 3TXXA 4E46A 2QZSA 5JV5A 4PLTA 3UXMA 1OVMA 3QIVA 4LX8A 2CD7A 2FLWA 2X8JA 2QRNA 3SC3A 3UAOA 3ZI7A 3T7DA 3M5DA 1RAIA 4ND6A 1UZUA 2XUAA 2FOLA 4RJJA 2ZBDA 4MMZB 4QYMA 3K0BA 2XCQA 1D1TA 5CM9C 1HDOA 2EG9A 4WD3A 5L7TA 4WINA 2ZULA 1CERA 3DF7A 3I8OA 5JG7A 2WA1A 4N18A 2GAOA 2BBSA 3N75A 3R7AA 1ZK0A 5B3JA 1L2TA 2H4WA 2DP4E 1G55A 5BUCA 1T0JB 2IA5A 1UPBA 3DUWA 1AKVA 5EE5B 2O0KA 2RGNC 1F5NA 4MLPA 1O8BA 1L5RA 4FK8A 2I1LA 1LW7A 1YC2A 4X62B 2CV0A 2BCGY 2HYDA 1O57A 3UJBA 2FCRA 4ND3A 1V2GA 3EVAA 1DAOA 2HPAA 1EE2A 5C1IA 2ZATA 5LMUB 4M6WA 1A9QA 2JASA 4LRXA 4D9MA 2UXBB 3P9CA 1N25A 4GHWA 1YS1X 4ND7A 3T0IA 1LWNA 2FI1A 1F4PA 4YUXA 2NZ8A 1YOVB 5LQAA 3DO5A 4P84A 3SOZA 5HYVA 4ZO8A 4NFSA 2ASVA 3IQXA 3T4PA 4GM4A 4MV0A 4CEHA 5DTEA 3CNLA 1Y42X 1Y6JA 3Q40A 3DEZA 2DQ4A 4V1CA 2P6NA 2PXCA 3K5HA 2XQJA 1IJBA 1L4HA 2WBLC 4KMRA 1RXSA 1DOHA 1FX1A 2ZUDA 4XB6B 2J59A 5DMHA 1TKRA 5EJAA 1TKBA 3H84A 1D6NA 5TS3A 3IPCA 3UK0A 3RRZA 3QG1A 2UUAB 4HDSA 1LC3A 4KFUA 3X1JA 4UBOA 1HLDA 4D25A 3GGGA 1HE1C 1E0JA 3FMGA 3KR9A 3LQ2A 4FGKA 4ZREA 2GK7A 4ALLA 2GD1O 1IJKA 4XJXA 4P6VF 5FT9A 2O2JA 5G0TA 4WVLA 4KPYA 2HW8A 4E09A 3O74A 1ITZA 1WXWA 2JIMA 3D1VA 3EUFA 2R8EA 2QZJA 5CXUA 5NULA 5JJCA 3QQPA 3KKQA 1W4AA 3NX4A 2G8NA 1SVOA 4ZU6X 1H5NA 3QBPA 2B7CA 2ZKLA 3RBVA 3R5JA 1FS4A 1QJCA 3IB6A 3SMQA 4WV3A 4KXVA 1RWMA 3S3TA 4V3BA 4Q19A 1FP6A 4ZOCA 4DMLA 4LVCA 5LP1A 5I5EA 3M4NA 4Q7QA 4Z4IA 3FROA 4KK3A 4XWOA 3RKRA 2FZWA 4E5PA 5FUXA 1QAMA 2J0UB 2RKWA 1Q83A 1OX4B 3NXKA 4GKVA 4QBKA 2P5SA 4X8OA 2A7QA