2D28C

Structure of the n-terminal domain of xpse (crystal form p43212)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
149
structure length
144
Chain Sequence
MEQRSAETRIVEALLERRRLKDTDLVRARQESGMGLLALLGRLGLVSERDHAETCAEVLGLPLVDARQLGDTPPEMEVQGLSLRFLKQFHLCPVGERDGRLDLWIADPYDDYAIDAVRLATGLPLLLHVGLRSEIDDLIERWYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of the XpsE N-Terminal Domain, an Essential Component of the Xanthomonas campestris Type II Secretion System
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Protein transport
molecule keywords type II secretion ATPase XpsE
total genus 42
structure length 144
sequence length 149
ec nomenclature
pdb deposition date 2005-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.70 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Ribonucleotide Reductase Protein R1; domain 1 2d28C01
3.30.300.160 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2d28C02
2BH1X 4PHTA 2D27A 2D28C
chains in the Genus database with same CATH superfamily
3PROC 4JYAC 3F4RA 1UKKA 3TDEA 1YJ7A 4DR1C 2XR1A 4BSZA 4X64C 2D1SA 1MXBA 3NO9A 2ONFA 2RCNA 1TJVA 3DHVA 5CZVA 5BSTA 5CZXA 5DV9A 3R44A 3RRPA 5LMUC 1MDFA 2QVYX 3I08A 1QWIA 1O93A 4LF9C 1MKYA 5FLXD 4DV4C 4EATA 3PBKA 4WS9A 4LF8C 5KYTA 3FCCA 4NOZA 1K0RA 3GR1A 1U0LA 1XHJA 1WH9A 2PT7G 1BA3A 1O9TA 3T1HC 4B3TC 4NSLA 3BWVA 4DCSA 3BHGA 4X66C 3CW8X 4R0MA 4JI1C 1FUPA 4JI0C 2OBVA 4DR4C 1XRCA 4L2ZA 3J80D 5A1IA 4I9FA 2ZZMA 2JAUA 4GXRA 4BBYA 4XX2A 1Q92A 2CY1A 5K85A 3R9WA 4MX2A 1XS3A 1PU1A 4DR5C 4L57A 3CW9A 5IFIA 5BSUA 1O90A 3CI0K 2D1RA 4TPSB 2DYJA 3DLPX 4RM3A 2X75A 2HHHC 3AY0A 1ZB8A 2DHMA 1HNZC 2HVGA 3A26A 4DR3C 2PN2A 2CU6A 4JI5C 1T5DX 4GKJC 3LGXA 3AF5A 3A25A 4L6CA 2KZ0A 2UU9C 4FUQA 5AE1A 4OX9C 2D28C 4E88A 1ZB9A 4R1LA 2P2QA 2QL8A 1Z4KA 5ADZA 2PTQA 2JNVA 4NXNC 2ATWA 4D57A 4IZ6A 1J3UA 5IT9D 1Z4IA 3E04A 3LNOA 1LQLA 3JAMD 4KTVA 1LCIA 3U13A 3TR3A 1U15A 1VEHA 4DG9A 2JAWA 4DG8A 1YFEA 1P4EC 2VQEC 3ETCA 3GKUA 4YIHA 3NYQA 4D4IA 4PUGA 2D1QA 4ODJA 1J5EC 2BH1X 3EQ6A 4ADMA 3I07A 1XNRC 4NXMC 4WV3A 2D27A 2OPLB 4I9GA 3G7SA 2VSQA 1VLAA 1FLOA 1TJ7A 2P02A 4MWOA 4HPVA 2PTSA 4DV0C 4LF4C 1Q5NA 1USPB 4JI6C 3TUFA 5BSRA 4GS5A 1ML8A 4APAA 3RG2A 3EERA 1Z4QA 1O92A 3VNQA 5A19A 4BC9A 3L95X 4RLQA 3SO4A 4AQYC 2E8FA 2YWBA 5E7QA 2E8EA 1RG9A 1NYEA 3RV2A 4PUHA 5T8TA 1V26A 3OCFA 1I94C 5HW2A 1PA4A 4EFCA 3R6QA 4DCVA 2JMPA 1IBKC 1HNWC 1IW7D 2DPLA 2EGTA 3UX2A 1RY2A 1K7WA 5F91A 1ULTA 3CQ2A 4NLEA 1V25A 5F92A 4PROC 2UUCC 1VDKA 2PTRA 3FCEA 5BUQA 3R9XA 4R1MA 1FUQA 1MDBA 4LFBC 2MMAB 4L4QA 3N2QA 3NYRA 4L7IA 3T1YC 4BCAA 4YIKA 5D6BA 3UOWA 3C5EA 3ETOA 3UEBA 3NPDA 3NI2A 1DCNA 2ASBA 4DR7C 1HNXC 3U19A 1I0AA 3LAXA 4GXQA 3A4IA 2CXCA 3UZ0A 1XMOC 1RE5A 5BUSA 4B3SC 5BR8C 4LFAC 4GKKC 2M5HA 1PG3A 2KZFA 4DUYC 1WCJA 3K6RA 2E5LC 2BJOA 4ZJZA 2HJGA 2I7DA 4YHHC 1JOSA 1V60A 4RLFA 4MUMA 5LCIA 2P2MA 4DCTA 4IQJM 4IR7A 2WP0C 2P2JA 2PROA 2UUAC 1C3UA 2D1TA 4KTTA 1HH2P 4JI7C 1DOFA 2V7BA 1XWOA 1P7LA 1Z4LA 1XRBA 5BSVA 1YFMA 4APBA 4LF5C 1U16A 5K8FA 5BURA 1N2FA 4D4GA 1HY1A 1M6XA 4DR6C 5BSMA 4B3MC 4JI4C 3PESA 4FUTA 1KQ7A 2QGAB 3A9VA 2YX1A 4DUZC 2E8CA 1TH5A 4PHTA 1T5HX 4JI8C 2VZEA 3LUSA 3IPLA 4JV5C 4EEIA 3GZHA 4G36A 2JAOA 2ZM6C 3GR0A 2KDNA 1N36C 3UX3A 3B7WA 2Y4NA 2P2FA 3O2EA 1C3CA 2QVXX 3VNSA 2M5OA 2QVZX 3GPCA 2VQFC 4ZLPA 2OO4A 4K0BA 4RMNA 1P4EA 3CJEA 4DV3C 4K0KC 1L2FA 1FUGA 3N54B 1HY0A 1AMUA 1FUOA 1USPA 1T9HA 4DV6C 3L8CA 2P20A 4X62C 4NFLA 4B3RC 1JSWA 4RVNA 2FUSA 4DV5C 2UUBC 1MD9A 1Q91A 3IEVA 2E9FA 2UXCC 2NCLA 1Z4JA 3DAYA 2AYAA 4DV2C 3GTDA 2MM9A 4MTNA 4YY3C 1UWDA 1IBMC 1MXAA 5AE2A 1NY8A 3F4SA 4ADLA 2MCQA 2UXDC 1Z4MA 2E0GA 1QM4A 5H9UA 5GTDA 4G37A 5T8SA 5JRHA 4G1IA 2Z51A 2D7VA 3S82A 2YWCA 4RVOA 3KXWA 1XMQC 4LF7C 3LNVA 4LFCC 5KYVA 1XNQC 2YCBA 3E7XA 2QW0X 4DV1C 4DR2C 1TJUA 4KHPC 5KEIA 4L6AA 2Y4OA 4X65C 2WD9A 4U5YD 5IWAC 1PG4A 4JI2C 3IEUA 2UXBC 3TV2A 3R6VA 1HR0C 3AF6A 1Z4PX 4JM1A 4LE5A 1M6XC 1WF3A 5LMNC 4JI3C 4DV7C 3VNRA 1MH9A 1IB8A 3H2TA 1TJWA 1FURA 3IMLA 1GPMA 1MXCA 4DCUA 2PFMA 4ISBA 4MH4A 5A1GA 3TQIA 3J81D 2OPLA 4PUIA 1XRAA 5A2QD 4LF6C 4RM2A 3A9UA 3CQ1A 3OCEA 2YV5A 4FTFA 5AE3A 3F4TA 1N32C 2F4VC 4NDNA 1N34C 4PZPA 5BSWA 2E7GA 4OYCA 4OXIA 4BC7A 1KKGA 1FJGC 1N33C 1EGAA 1IBLC 3E7WA 3RD8A 2ZZNA 4D56A 3QBPA 3C8TA 3CQ3A 2JARA 1AUWA 1K62A 4HGVA 3OTOC 2P2BA 2Y27A
chains in the Genus database with same CATH topology
3PROC 4JYAC 3F4RA 1UKKA 3TDEA 1YJ7A 4DR1C 2XR1A 4BSZA 4X64C 2D1SA 1MXBA 2ONFA 3DHVA 5CZVA 5BSTA 5CZXA 5DV9A 3R44A 5LMUC 1MDFA 2QVYX 3I08A 1QWIA 1O93A 4LF9C 1MKYA 5FLXD 4DV4C 4EATA 3PBKA 4WS9A 4LF8C 5KYTA 3FCCA 4NOZA 1K0RA 3GR1A 1WH9A 2PT7G 1BA3A 1O9TA 3T1HC 4B3TC 4DCSA 4X66C 3CW8X 4R0MA 4JI1C 4JI0C 2OBVA 4DR4C 1XRCA 4L2ZA 3J80D 5A1IA 4I9FA 4GXRA 4BBYA 4XX2A 2CY1A 5K85A 3R9WA 4DR5C 3CW9A 5IFIA 5BSUA 1O90A 2D1RA 4TPSB 2DYJA 3DLPX 4RM3A 2HHHC 1ZB8A 1HNZC 4DR3C 2PN2A 4JI5C 1T5DX 4GKJC 3LGXA 3AF5A 2UU9C 4FUQA 5AE1A 4OX9C 2D28C 1ZB9A 4R1LA 2P2QA 2QL8A 5ADZA 4NXNC 2ATWA 4D57A 4IZ6A 5IT9D 3JAMD 1LQLA 4KTVA 1LCIA 4DG9A 4DG8A 2VQEC 3ETCA 3GKUA 3NYQA 4D4IA 2D1QA 4ODJA 1J5EC 2BH1X 3EQ6A 3I07A 1XNRC 4NXMC 4WV3A 2D27A 2OPLB 4I9GA 3G7SA 2VSQA 1VLAA 2P02A 4HPVA 4DV0C 4LF4C 1USPB 4JI6C 3TUFA 5BSRA 4GS5A 1ML8A 3RG2A 3EERA 1O92A 3VNQA 5A19A 4BC9A 3L95X 4RLQA 3SO4A 4AQYC 2E8FA 2YWBA 5E7QA 2E8EA 1RG9A 1NYEA 3RV2A 5T8TA 1V26A 1I94C 1PA4A 4DCVA 2JMPA 1IBKC 1HNWC 1IW7D 2DPLA 2EGTA 1RY2A 1ULTA 1V25A 4PROC 2UUCC 3FCEA 5BUQA 3R9XA 4R1MA 1MDBA 4LFBC 4L4QA 3N2QA 3NYRA 4L7IA 3T1YC 4BCAA 3UOWA 3C5EA 3ETOA 3NPDA 3NI2A 2ASBA 4DR7C 1HNXC 3LAXA 4GXQA 3A4IA 2CXCA 3UZ0A 1XMOC 5BUSA 4B3SC 5BR8C 4LFAC 4GKKC 1PG3A 2KZFA 4DUYC 2E5LC 2BJOA 4ZJZA 2HJGA 4YHHC 1JOSA 4RLFA 2P2MA 4DCTA 4IQJM 4IR7A 2WP0C 2UUAC 2P2JA 2PROA 2D1TA 4KTTA 1HH2P 4JI7C 2V7BA 1P7LA 1XRBA 5BSVA 4LF5C 5K8FA 5BURA 1N2FA 4D4GA 4DR6C 5BSMA 4B3MC 4JI4C 3PESA 4FUTA 3A9VA 4DUZC 2E8CA 4PHTA 1T5HX 4JI8C 2VZEA 3LUSA 3IPLA 4JV5C 4G36A 2ZM6C 3GR0A 1N36C 3B7WA 2Y4NA 2P2FA 2QVXX 3VNSA 2QVZX 3GPCA 2VQFC 4ZLPA 2OO4A 4K0BA 4RMNA 3CJEA 4DV3C 4K0KC 1L2FA 1FUGA 3N54B 1AMUA 1USPA 4DV6C 3L8CA 2P20A 4X62C 4B3RC 4RVNA 4DV5C 2UUBC 1MD9A 3IEVA 2UXCC 3DAYA 2AYAA 4DV2C 4MTNA 1IBMC 4YY3C 1MXAA 5AE2A 3F4SA 2UXDC 2E0GA 1QM4A 5H9UA 5GTDA 4G37A 5T8SA 5JRHA 4G1IA 2D7VA 3S82A 2YWCA 4RVOA 3KXWA 1XMQC 4LF7C 3LNVA 4LFCC 5KYVA 1XNQC 2YCBA 3E7XA 2QW0X 4DV1C 4DR2C 4KHPC 5KEIA 2Y4OA 4X65C 2WD9A 4U5YD 5IWAC 1PG4A 4JI2C 3IEUA 2UXBC 1HR0C 3AF6A 4JM1A 4LE5A 1WF3A 5LMNC 4JI3C 4DV7C 3VNRA 3H2TA 3IMLA 1GPMA 1MXCA 4DCUA 4ISBA 4MH4A 5A1GA 3TQIA 3J81D 2OPLA 1XRAA 5A2QD 4LF6C 4RM2A 3A9UA 4FTFA 5AE3A 3F4TA 1N32C 2F4VC 4NDNA 1N34C 4PZPA 5BSWA 2E7GA 4OYCA 4OXIA 4BC7A 1KKGA 1FJGC 1N33C 1EGAA 1IBLC 3E7WA 4D56A 3OTOC 2P2BA 2Y27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BH1 X;  4PHT A;  2D27 A;  2D28 C; 
#chains in the Genus database with same CATH topology
 3PRO C;  4JYA C;  3F4R A;  1UKK A;  3TDE A;  1YJ7 A;  4DR1 C;  2XR1 A;  4BSZ A;  4X64 C;  2D1S A;  1MXB A;  3NO9 A;  2ONF A;  2RCN A;  1TJV A;  3DHV A;  5CZV A;  5BST A;  5CZX A;  5DV9 A;  3R44 A;  3RRP A;  5LMU C;  1MDF A;  2QVY X;  3I08 A;  1QWI A;  1O93 A;  4LF9 C;  1MKY A;  5FLX D;  4DV4 C;  4EAT A;  3PBK A;  4WS9 A;  4LF8 C;  5KYT A;  3FCC A;  4NOZ A;  1K0R A;  3GR1 A;  1U0L A;  1XHJ A;  1WH9 A;  2PT7 G;  1BA3 A;  1O9T A;  3T1H C;  4B3T C;  4NSL A;  3BWV A;  4DCS A;  3BHG A;  4X66 C;  3CW8 X;  4R0M A;  4JI1 C;  1FUP A;  4JI0 C;  2OBV A;  4DR4 C;  1XRC A;  4L2Z A;  3J80 D;  5A1I A;  4I9F A;  2ZZM A;  2JAU A;  4GXR A;  4BBY A;  4XX2 A;  1Q92 A;  2CY1 A;  5K85 A;  3R9W A;  4MX2 A;  1XS3 A;  1PU1 A;  4DR5 C;  4L57 A;  3CW9 A;  5IFI A;  5BSU A;  1O90 A;  3CI0 K;  2D1R A;  4TPS B;  2DYJ A;  3DLP X;  4RM3 A;  2X75 A;  2HHH C;  3AY0 A;  1ZB8 A;  2DHM A;  1HNZ C;  2HVG A;  3A26 A;  4DR3 C;  2PN2 A;  2CU6 A;  4JI5 C;  1T5D X;  4GKJ C;  3LGX A;  3AF5 A;  3A25 A;  4L6C A;  2KZ0 A;  2UU9 C;  4FUQ A;  5AE1 A;  4OX9 C;  2D28 C;  4E88 A;  1ZB9 A;  4R1L A;  2P2Q A;  2QL8 A;  1Z4K A;  5ADZ A;  2PTQ A;  2JNV A;  4NXN C;  2ATW A;  4D57 A;  4IZ6 A;  1J3U A;  5IT9 D;  1Z4I A;  3E04 A;  3LNO A;  1LQL A;  3JAM D;  4KTV A;  1LCI A;  3U13 A;  3TR3 A;  1U15 A;  1VEH A;  4DG9 A;  2JAW A;  4DG8 A;  1YFE A;  1P4E C;  2VQE C;  3ETC A;  3GKU A;  4YIH A;  3NYQ A;  4D4I A;  4PUG A;  2D1Q A;  4ODJ A;  1J5E C;  2BH1 X;  3EQ6 A;  4ADM A;  3I07 A;  1XNR C;  4NXM C;  4WV3 A;  2D27 A;  2OPL B;  4I9G A;  3G7S A;  2VSQ A;  1VLA A;  1FLO A;  1TJ7 A;  2P02 A;  4MWO A;  4HPV A;  2PTS A;  4DV0 C;  4LF4 C;  1Q5N A;  1USP B;  4JI6 C;  3TUF A;  5BSR A;  4GS5 A;  1ML8 A;  4APA A;  3RG2 A;  3EER A;  1Z4Q A;  1O92 A;  3VNQ A;  5A19 A;  4BC9 A;  3L95 X;  4RLQ A;  3SO4 A;  4AQY C;  2E8F A;  2YWB A;  5E7Q A;  2E8E A;  1RG9 A;  1NYE A;  3RV2 A;  4PUH A;  5T8T A;  1V26 A;  3OCF A;  1I94 C;  5HW2 A;  1PA4 A;  4EFC A;  3R6Q A;  4DCV A;  2JMP A;  1IBK C;  1HNW C;  1IW7 D;  2DPL A;  2EGT A;  3UX2 A;  1RY2 A;  1K7W A;  5F91 A;  1ULT A;  3CQ2 A;  4NLE A;  1V25 A;  5F92 A;  4PRO C;  2UUC C;  1VDK A;  2PTR A;  3FCE A;  5BUQ A;  3R9X A;  4R1M A;  1FUQ A;  1MDB A;  4LFB C;  2MMA B;  4L4Q A;  3N2Q A;  3NYR A;  4L7I A;  3T1Y C;  4BCA A;  4YIK A;  5D6B A;  3UOW A;  3C5E A;  3ETO A;  3UEB A;  3NPD A;  3NI2 A;  1DCN A;  2ASB A;  4DR7 C;  1HNX C;  3U19 A;  1I0A A;  3LAX A;  4GXQ A;  3A4I A;  2CXC A;  3UZ0 A;  1XMO C;  1RE5 A;  5BUS A;  4B3S C;  5BR8 C;  4LFA C;  4GKK C;  2M5H A;  1PG3 A;  2KZF A;  4DUY C;  1WCJ A;  3K6R A;  2E5L C;  2BJO A;  4ZJZ A;  2HJG A;  2I7D A;  4YHH C;  1JOS A;  1V60 A;  4RLF A;  4MUM A;  5LCI A;  2P2M A;  4DCT A;  4IQJ M;  4IR7 A;  2WP0 C;  2P2J A;  2PRO A;  2UUA C;  1C3U A;  2D1T A;  4KTT A;  1HH2 P;  4JI7 C;  1DOF A;  2V7B A;  1XWO A;  1P7L A;  1Z4L A;  1XRB A;  5BSV A;  1YFM A;  4APB A;  4LF5 C;  1U16 A;  5K8F A;  5BUR A;  1N2F A;  4D4G A;  1HY1 A;  1M6X A;  4DR6 C;  5BSM A;  4B3M C;  4JI4 C;  3PES A;  4FUT A;  1KQ7 A;  2QGA B;  3A9V A;  2YX1 A;  4DUZ C;  2E8C A;  1TH5 A;  4PHT A;  1T5H X;  4JI8 C;  2VZE A;  3LUS A;  3IPL A;  4JV5 C;  4EEI A;  3GZH A;  4G36 A;  2JAO A;  2ZM6 C;  3GR0 A;  2KDN A;  1N36 C;  3UX3 A;  3B7W A;  2Y4N A;  2P2F A;  3O2E A;  1C3C A;  2QVX X;  3VNS A;  2M5O A;  2QVZ X;  3GPC A;  2VQF C;  4ZLP A;  2OO4 A;  4K0B A;  4RMN A;  1P4E A;  3CJE A;  4DV3 C;  4K0K C;  1L2F A;  1FUG A;  3N54 B;  1HY0 A;  1AMU A;  1FUO A;  1USP A;  1T9H A;  4DV6 C;  3L8C A;  2P20 A;  4X62 C;  4NFL A;  4B3R C;  1JSW A;  4RVN A;  2FUS A;  4DV5 C;  2UUB C;  1MD9 A;  1Q91 A;  3IEV A;  2E9F A;  2UXC C;  2NCL A;  1Z4J A;  3DAY A;  2AYA A;  4DV2 C;  3GTD A;  2MM9 A;  4MTN A;  4YY3 C;  1UWD A;  1IBM C;  1MXA A;  5AE2 A;  1NY8 A;  3F4S A;  4ADL A;  2MCQ A;  2UXD C;  1Z4M A;  2E0G A;  1QM4 A;  5H9U A;  5GTD A;  4G37 A;  5T8S A;  5JRH A;  4G1I A;  2Z51 A;  2D7V A;  3S82 A;  2YWC A;  4RVO A;  3KXW A;  1XMQ C;  4LF7 C;  3LNV A;  4LFC C;  5KYV A;  1XNQ C;  2YCB A;  3E7X A;  2QW0 X;  4DV1 C;  4DR2 C;  1TJU A;  4KHP C;  5KEI A;  4L6A A;  2Y4O A;  4X65 C;  2WD9 A;  4U5Y D;  5IWA C;  1PG4 A;  4JI2 C;  3IEU A;  2UXB C;  3TV2 A;  3R6V A;  1HR0 C;  3AF6 A;  1Z4P X;  4JM1 A;  4LE5 A;  1M6X C;  1WF3 A;  5LMN C;  4JI3 C;  4DV7 C;  3VNR A;  1MH9 A;  1IB8 A;  3H2T A;  1TJW A;  1FUR A;  3IML A;  1GPM A;  1MXC A;  4DCU A;  2PFM A;  4ISB A;  4MH4 A;  5A1G A;  3TQI A;  3J81 D;  2OPL A;  4PUI A;  1XRA A;  5A2Q D;  4LF6 C;  4RM2 A;  3A9U A;  3CQ1 A;  3OCE A;  2YV5 A;  4FTF A;  5AE3 A;  3F4T A;  1N32 C;  2F4V C;  4NDN A;  1N34 C;  4PZP A;  5BSW A;  2E7G A;  4OYC A;  4OXI A;  4BC7 A;  1KKG A;  1FJG C;  1N33 C;  1EGA A;  1IBL C;  3E7W A;  3RD8 A;  2ZZN A;  4D56 A;  3QBP A;  3C8T A;  3CQ3 A;  2JAR A;  1AUW A;  1K62 A;  4HGV A;  3OTO C;  2P2B A;  2Y27 A; 
#chains in the Genus database with same CATH homology
 3PRO C;  4JYA C;  3F4R A;  1UKK A;  3TDE A;  1YJ7 A;  4DR1 C;  2XR1 A;  4BSZ A;  4X64 C;  2D1S A;  1MXB A;  2ONF A;  3DHV A;  5CZV A;  5BST A;  5CZX A;  5DV9 A;  3R44 A;  5LMU C;  1MDF A;  2QVY X;  3I08 A;  1QWI A;  1O93 A;  4LF9 C;  1MKY A;  5FLX D;  4DV4 C;  4EAT A;  3PBK A;  4WS9 A;  4LF8 C;  5KYT A;  3FCC A;  4NOZ A;  1K0R A;  3GR1 A;  1WH9 A;  2PT7 G;  1BA3 A;  1O9T A;  3T1H C;  4B3T C;  4DCS A;  4X66 C;  3CW8 X;  4R0M A;  4JI1 C;  4JI0 C;  2OBV A;  4DR4 C;  1XRC A;  4L2Z A;  3J80 D;  5A1I A;  4I9F A;  4GXR A;  4BBY A;  4XX2 A;  2CY1 A;  5K85 A;  3R9W A;  4DR5 C;  3CW9 A;  5IFI A;  5BSU A;  1O90 A;  2D1R A;  4TPS B;  2DYJ A;  3DLP X;  4RM3 A;  2HHH C;  1ZB8 A;  1HNZ C;  4DR3 C;  2PN2 A;  4JI5 C;  1T5D X;  4GKJ C;  3LGX A;  3AF5 A;  2UU9 C;  4FUQ A;  5AE1 A;  4OX9 C;  2D28 C;  1ZB9 A;  4R1L A;  2P2Q A;  2QL8 A;  5ADZ A;  4NXN C;  2ATW A;  4D57 A;  4IZ6 A;  5IT9 D;  3JAM D;  1LQL A;  4KTV A;  1LCI A;  4DG9 A;  4DG8 A;  2VQE C;  3ETC A;  3GKU A;  3NYQ A;  4D4I A;  2D1Q A;  4ODJ A;  1J5E C;  2BH1 X;  3EQ6 A;  3I07 A;  1XNR C;  4NXM C;  4WV3 A;  2D27 A;  2OPL B;  4I9G A;  3G7S A;  2VSQ A;  1VLA A;  2P02 A;  4HPV A;  4DV0 C;  4LF4 C;  1USP B;  4JI6 C;  3TUF A;  5BSR A;  4GS5 A;  1ML8 A;  3RG2 A;  3EER A;  1O92 A;  3VNQ A;  5A19 A;  4BC9 A;  3L95 X;  4RLQ A;  3SO4 A;  4AQY C;  2E8F A;  2YWB A;  5E7Q A;  2E8E A;  1RG9 A;  1NYE A;  3RV2 A;  5T8T A;  1V26 A;  1I94 C;  1PA4 A;  4DCV A;  2JMP A;  1IBK C;  1HNW C;  1IW7 D;  2DPL A;  2EGT A;  1RY2 A;  1ULT A;  1V25 A;  4PRO C;  2UUC C;  3FCE A;  5BUQ A;  3R9X A;  4R1M A;  1MDB A;  4LFB C;  4L4Q A;  3N2Q A;  3NYR A;  4L7I A;  3T1Y C;  4BCA A;  3UOW A;  3C5E A;  3ETO A;  3NPD A;  3NI2 A;  2ASB A;  4DR7 C;  1HNX C;  3LAX A;  4GXQ A;  3A4I A;  2CXC A;  3UZ0 A;  1XMO C;  5BUS A;  4B3S C;  5BR8 C;  4LFA C;  4GKK C;  1PG3 A;  2KZF A;  4DUY C;  2E5L C;  2BJO A;  4ZJZ A;  2HJG A;  4YHH C;  1JOS A;  4RLF A;  2P2M A;  4DCT A;  4IQJ M;  4IR7 A;  2WP0 C;  2UUA C;  2P2J A;  2PRO A;  2D1T A;  4KTT A;  1HH2 P;  4JI7 C;  2V7B A;  1P7L A;  1XRB A;  5BSV A;  4LF5 C;  5K8F A;  5BUR A;  1N2F A;  4D4G A;  4DR6 C;  5BSM A;  4B3M C;  4JI4 C;  3PES A;  4FUT A;  3A9V A;  4DUZ C;  2E8C A;  4PHT A;  1T5H X;  4JI8 C;  2VZE A;  3LUS A;  3IPL A;  4JV5 C;  4G36 A;  2ZM6 C;  3GR0 A;  1N36 C;  3B7W A;  2Y4N A;  2P2F A;  2QVX X;  3VNS A;  2QVZ X;  3GPC A;  2VQF C;  4ZLP A;  2OO4 A;  4K0B A;  4RMN A;  3CJE A;  4DV3 C;  4K0K C;  1L2F A;  1FUG A;  3N54 B;  1AMU A;  1USP A;  4DV6 C;  3L8C A;  2P20 A;  4X62 C;  4B3R C;  4RVN A;  4DV5 C;  2UUB C;  1MD9 A;  3IEV A;  2UXC C;  3DAY A;  2AYA A;  4DV2 C;  4MTN A;  1IBM C;  4YY3 C;  1MXA A;  5AE2 A;  3F4S A;  2UXD C;  2E0G A;  1QM4 A;  5H9U A;  5GTD A;  4G37 A;  5T8S A;  5JRH A;  4G1I A;  2D7V A;  3S82 A;  2YWC A;  4RVO A;  3KXW A;  1XMQ C;  4LF7 C;  3LNV A;  4LFC C;  5KYV A;  1XNQ C;  2YCB A;  3E7X A;  2QW0 X;  4DV1 C;  4DR2 C;  4KHP C;  5KEI A;  2Y4O A;  4X65 C;  2WD9 A;  4U5Y D;  5IWA C;  1PG4 A;  4JI2 C;  3IEU A;  2UXB C;  1HR0 C;  3AF6 A;  4JM1 A;  4LE5 A;  1WF3 A;  5LMN C;  4JI3 C;  4DV7 C;  3VNR A;  3H2T A;  3IML A;  1GPM A;  1MXC A;  4DCU A;  4ISB A;  4MH4 A;  5A1G A;  3TQI A;  3J81 D;  2OPL A;  1XRA A;  5A2Q D;  4LF6 C;  4RM2 A;  3A9U A;  4FTF A;  5AE3 A;  3F4T A;  1N32 C;  2F4V C;  4NDN A;  1N34 C;  4PZP A;  5BSW A;  2E7G A;  4OYC A;  4OXI A;  4BC7 A;  1KKG A;  1FJG C;  1N33 C;  1EGA A;  1IBL C;  3E7W A;  4D56 A;  3OTO C;  2P2B A;  2Y27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...