2D28C

Structure of the n-terminal domain of xpse (crystal form p43212)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
149
structure length
144
Chain Sequence
MEQRSAETRIVEALLERRRLKDTDLVRARQESGMGLLALLGRLGLVSERDHAETCAEVLGLPLVDARQLGDTPPEMEVQGLSLRFLKQFHLCPVGERDGRLDLWIADPYDDYAIDAVRLATGLPLLLHVGLRSEIDDLIERWYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords type II secretion ATPase XpsE
publication title Structure and Function of the XpsE N-Terminal Domain, an Essential Component of the Xanthomonas campestris Type II Secretion System
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Protein transport
total genus 42
structure length 144
sequence length 149
ec nomenclature
pdb deposition date 2005-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.70 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Ribonucleotide Reductase Protein R1; domain 1 2d28C01
3.30.300.160 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2d28C02
2D27A 4PHTA 2BH1X 2D28C
chains in the Genus database with same CATH superfamily
1Z4QA 1HR0C 3PESA 4APBA 1JOSA 1MXAA 4KTTA 1NY8A 2YWCA 2YV5A 2YX1A 4R1LA 3C8TA 3ETOA 1TJUA 2VZEA 5BSUA 1V26A 3G7SA 4LF4C 3LGXA 2PTSA 4PUGA 5A19A 4B3MC 2M5OA 1EGAA 3LAXA 1ZB9A 2ASBA 1MD9A 2UUCC 2P2BA 1IB8A 1FUGA 2Z51A 3NYQA 2XR1A 1ZB8A 4DR1C 1K7WA 2Y27A 4RVOA 4JI7C 1N34C 4HGVA 2OPLA 5KYVA 2OO4A 1WCJA 3BWVA 3IPLA 4L7IA 3RV2A 2F4VC 4R0MA 4EEIA 4JV5C 2P20A 1P4EA 2D28C 1MXCA 1XHJA 1HY1A 3T1YC 1PG4A 5A1IA 4FUQA 5CZXA 4NLEA 4GXRA 2PTRA 2CY1A 4LF6C 1KKGA 4IZ6A 1YFEA 1USPA 1V25A 3TDEA 3CQ3A 1FJGC 3RG2A 2YCBA 2CU6A 5GTDA 2E9FA 3OCEA 2UUBC 4R1MA 5K8FA 1QWIA 4JI4C 4I9FA 3CI0K 2FUSA 2WP0C 4DCSA 4WS9A 1N36C 1U15A 3IEVA 2JAOA 2QL8A 1VDKA 4DV0C 3RD8A 1PU1A 3T1HC 3S82A 4DCUA 4DV7C 5BUSA 1MH9A 2KDNA 3H2TA 5E7QA 2ZZNA 1VLAA 5T8TA 4RVNA 4LFAC 3LNOA 4JI0C 1Z4KA 5AE2A 4G1IA 2JAUA 1V60A 2VSQA 4D4IA 5CZVA 1U0LA 4DG8A 5KYTA 3R44A 1XS3A 2E0GA 1Z4IA 3R6QA 4NSLA 4KHPC 4PZPA 3DAYA 2PFMA 3B7WA 1XWOA 1UKKA 5KEIA 3E7WA 3L8CA 4RM2A 2OPLB 4NDNA 1FUOA 1M6XC 2E8FA 3DLPX 4D56A 4MTNA 2D1QA 2P2QA 4L4QA 4PROC 4AQYC 1J5EC 1USPB 1RG9A 1MDFA 4RLFA 4FTFA 1C3UA 4DV3C 2JARA 3U13A 1O90A 5HW2A 2RCNA 3RRPA 2MM9A 3TUFA 3CJEA 3N54B 5BSTA 3TQIA 2JNVA 3A9UA 5LMUC 1XMQC 4OYCA 1MXBA 4X62C 4L2ZA 3GKUA 3PROC 2PT7G 1ML8A 2M5HA 3CW9A 1WF3A 2AYAA 5IWAC 2HHHC 1XRBA 3UZ0A 4LF5C 3A9VA 3FCCA 5AE3A 4DR3C 2UUAC 5F91A 4XX2A 2VQFC 5IFIA 1U16A 4EATA 5LMNC 2DPLA 2Y4OA 3A25A 4GKJC 2KZ0A 2NCLA 4JI2C 1FUPA 1TJWA 3IMLA 1Q5NA 4MWOA 4B3RC 5LCIA 2OBVA 2Y4NA 3CQ2A 1L2FA 3IEUA 4DV1C 2UXBC 4LFBC 3LNVA 5ADZA 5H9UA 1T5HX 4DUYC 3UEBA 4BSZA 3R9WA 2YWBA 4APAA 1FUQA 1Z4MA 2UU9C 3EERA 3OCFA 5FLXD 1XRCA 1Q92A 4JI1C 4FUTA 2JMPA 3I07A 4JI3C 2BH1X 1GPMA 2P2FA 4G36A 4DV2C 4MUMA 3VNSA 1HNZC 5A2QD 5JRHA 5A1GA 4GXQA 3N2QA 4ZLPA 3ETCA 4RLQA 4TPSB 3AY0A 3VNQA 1P4EC 2P02A 3E04A 4LFCC 1O9TA 1HH2P 4G37A 3F4SA 2WD9A 3SO4A 2UXCC 1IW7D 1C3CA 4B3TC 3UX2A 2QVYX 4DR6C 4WV3A 2D1TA 2QVZX 4LF8C 4MH4A 4ODJA 2E8CA 4YHHC 5BURA 2D7VA 3NO9A 1NYEA 3GTDA 4HPVA 4K0BA 4D4GA 4NFLA 1YFMA 1HNXC 5BR8C 4DR2C 1O93A 3GPCA 1DOFA 5BUQA 1AMUA 2JAWA 4BBYA 1LCIA 1JSWA 4L6CA 4ADLA 3AF5A 1KQ7A 2CXCA 4JI5C 3AF6A 5D6BA 4JYAC 1TJ7A 4X64C 1I94C 3C5EA 4IR7A 1UWDA 4EFCA 4BCAA 4NXMC 1FLOA 4PHTA 2BJOA 3GR1A 4RMNA 1VEHA 1HY0A 3NPDA 1DCNA 1IBMC 4GS5A 1XMOC 1Z4JA 4E88A 1MKYA 1TH5A 4DV4C 2D27A 2HJGA 4ADMA 1FURA 5K85A 2P2JA 5BSMA 4JI8C 3TV2A 4U5YD 4JI6C 3J80D 2P2MA 1P7LA 4DCVA 5AE1A 4D57A 3FCEA 2X75A 5F92A 1Q91A 4DR7C 1ULTA 3OTOC 3R9XA 2EGTA 1Z4LA 2QGAB 1T9HA 2ONFA 4ISBA 3GR0A 2D1SA 2I7DA 2HVGA 3UX3A 5BSVA 3L95X 4RM3A 2V7BA 1N2FA 1K0RA 4I9GA 2E8EA 3R6VA 4DG9A 4DR5C 2MCQA 3NI2A 1IBLC 3U19A 3J81D 2E7GA 4BC7A 4GKKC 3JAMD 4KTVA 4DCTA 3O2EA 3F4RA 2ATWA 1LQLA 4IQJM 5IT9D 1N33C 4YIHA 1XRAA 3BHGA 1O92A 3E7XA 5BSRA 4OX9C 4JM1A 3VNRA 1XNRC 4YY3C 2D1RA 1AUWA 4L57A 5DV9A 2KZFA 1I0AA 3QBPA 4X65C 1N32C 2DHMA 4NXNC 1YJ7A 2QW0X 4X66C 2PTQA 1TJVA 4ZJZA 1T5DX 2QVXX 4MX2A 2E5LC 1HNWC 4LE5A 4BC9A 1J3UA 4LF9C 4LF7C 3NYRA 3CQ1A 1PA4A 4YIKA 3DHVA 2ZZMA 3LUSA 1M6XA 3UOWA 1BA3A 3I08A 1K62A 2PN2A 3K6RA 4DUZC 1WH9A 1MDBA 1IBKC 1QM4A 3A4IA 3EQ6A 4PUIA 3KXWA 3TR3A 2ZM6C 5BSWA 3CW8X 1RY2A 3F4TA 4DV5C 1RE5A 2DYJA 5T8SA 4PUHA 3GZHA 2MMAB 2VQEC 4K0KC 4L6AA 4DR4C 4OXIA 2UXDC 2PROA 4NOZA 1XNQC 1PG3A 4DV6C 4B3SC 3PBKA 1Z4PX 3A26A
chains in the Genus database with same CATH topology
1HR0C 3PESA 1JOSA 1MXAA 4KTTA 2YWCA 4R1LA 3ETOA 2VZEA 5BSUA 1V26A 3G7SA 4LF4C 3LGXA 5A19A 4B3MC 1EGAA 3LAXA 1ZB9A 2ASBA 1MD9A 2UUCC 2P2BA 1FUGA 3NYQA 2XR1A 1ZB8A 4DR1C 2Y27A 4RVOA 4JI7C 1N34C 2OPLA 5KYVA 2OO4A 3IPLA 4L7IA 3RV2A 2F4VC 4R0MA 4JV5C 2P20A 2D28C 1MXCA 3T1YC 1PG4A 5A1IA 4FUQA 5CZXA 4GXRA 2CY1A 4LF6C 1KKGA 4IZ6A 1USPA 1V25A 3TDEA 1FJGC 3RG2A 2YCBA 5GTDA 2UUBC 4R1MA 5K8FA 1QWIA 4JI4C 4I9FA 2WP0C 4DCSA 4WS9A 1N36C 3IEVA 2QL8A 4DV0C 3T1HC 3S82A 4DCUA 4DV7C 5BUSA 5E7QA 3H2TA 1VLAA 5T8TA 4RVNA 4LFAC 4JI0C 5AE2A 4G1IA 2VSQA 4D4IA 5CZVA 4DG8A 5KYTA 3R44A 2E0GA 4KHPC 4PZPA 3DAYA 3B7WA 1UKKA 5KEIA 3E7WA 3L8CA 4RM2A 2OPLB 4NDNA 2E8FA 3DLPX 4D56A 4MTNA 2D1QA 2P2QA 4L4QA 4PROC 4AQYC 1J5EC 1USPB 1RG9A 1MDFA 4RLFA 4FTFA 4DV3C 1O90A 3TUFA 3CJEA 3N54B 5BSTA 3TQIA 5LMUC 3A9UA 1XMQC 4OYCA 1MXBA 4X62C 4L2ZA 3GKUA 3PROC 2PT7G 1ML8A 3CW9A 1WF3A 2AYAA 5IWAC 2HHHC 1XRBA 3UZ0A 4LF5C 3A9VA 3FCCA 5AE3A 4DR3C 2UUAC 4XX2A 2VQFC 5IFIA 4EATA 5LMNC 2DPLA 2Y4OA 4GKJC 4JI2C 3IMLA 4B3RC 2OBVA 2Y4NA 1L2FA 3IEUA 4DV1C 2UXBC 4LFBC 3LNVA 5ADZA 5H9UA 1T5HX 4DUYC 4BSZA 3R9WA 2YWBA 2UU9C 3EERA 5FLXD 1XRCA 4JI1C 4FUTA 2JMPA 3I07A 4JI3C 2BH1X 1GPMA 2P2FA 4G36A 4DV2C 3VNSA 1HNZC 5A2QD 5JRHA 5A1GA 4GXQA 3N2QA 4ZLPA 3ETCA 4RLQA 4TPSB 3VNQA 2P02A 4LFCC 1O9TA 1HH2P 4G37A 3F4SA 2WD9A 3SO4A 2UXCC 1IW7D 4B3TC 2QVYX 4DR6C 4WV3A 2D1TA 2QVZX 4LF8C 4MH4A 4ODJA 2E8CA 4YHHC 5BURA 2D7VA 1NYEA 4HPVA 4K0BA 4D4GA 1HNXC 5BR8C 4DR2C 1O93A 3GPCA 5BUQA 1AMUA 4BBYA 1LCIA 3AF5A 2CXCA 4JI5C 3AF6A 4JYAC 4X64C 1I94C 3C5EA 4IR7A 4BCAA 4NXMC 4PHTA 2BJOA 3GR1A 4RMNA 3NPDA 1IBMC 4GS5A 1XMOC 4DV4C 1MKYA 2HJGA 2D27A 5K85A 2P2JA 5BSMA 4JI8C 4U5YD 4JI6C 3J80D 2P2MA 1P7LA 4DCVA 5AE1A 4D57A 3FCEA 4DR7C 1ULTA 3OTOC 3R9XA 2EGTA 2ONFA 4ISBA 3GR0A 2D1SA 5BSVA 3L95X 4RM3A 2V7BA 1N2FA 1K0RA 4I9GA 2E8EA 4DG9A 4DR5C 3NI2A 1IBLC 3J81D 2E7GA 4BC7A 4GKKC 3JAMD 4KTVA 4DCTA 3F4RA 2ATWA 1LQLA 4IQJM 5IT9D 1N33C 1XRAA 1O92A 3E7XA 5BSRA 4OX9C 4JM1A 3VNRA 1XNRC 4YY3C 2D1RA 5DV9A 2KZFA 4X65C 1N32C 4NXNC 1YJ7A 2QW0X 4X66C 4ZJZA 1T5DX 2QVXX 2E5LC 1HNWC 4LE5A 4BC9A 4LF9C 4LF7C 3NYRA 1PA4A 3DHVA 3LUSA 3UOWA 1BA3A 3I08A 2PN2A 4DUZC 1WH9A 1MDBA 1IBKC 1QM4A 3A4IA 3EQ6A 3KXWA 2ZM6C 5BSWA 3CW8X 1RY2A 3F4TA 4DV5C 2DYJA 5T8SA 2VQEC 4K0KC 4DR4C 4OXIA 2UXDC 2PROA 4NOZA 1XNQC 1PG3A 4DV6C 4B3SC 3PBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D27 A;  4PHT A;  2BH1 X;  2D28 C; 
#chains in the Genus database with same CATH topology
 1Z4Q A;  1HR0 C;  3PES A;  4APB A;  1JOS A;  1MXA A;  4KTT A;  1NY8 A;  2YWC A;  2YV5 A;  2YX1 A;  4R1L A;  3C8T A;  3ETO A;  1TJU A;  2VZE A;  5BSU A;  1V26 A;  3G7S A;  4LF4 C;  3LGX A;  2PTS A;  4PUG A;  5A19 A;  4B3M C;  2M5O A;  1EGA A;  3LAX A;  1ZB9 A;  2ASB A;  1MD9 A;  2UUC C;  2P2B A;  1IB8 A;  1FUG A;  2Z51 A;  3NYQ A;  2XR1 A;  1ZB8 A;  4DR1 C;  1K7W A;  2Y27 A;  4RVO A;  4JI7 C;  1N34 C;  4HGV A;  2OPL A;  5KYV A;  2OO4 A;  1WCJ A;  3BWV A;  3IPL A;  4L7I A;  3RV2 A;  2F4V C;  4R0M A;  4EEI A;  4JV5 C;  2P20 A;  1P4E A;  2D28 C;  1MXC A;  1XHJ A;  1HY1 A;  3T1Y C;  1PG4 A;  5A1I A;  4FUQ A;  5CZX A;  4NLE A;  4GXR A;  2PTR A;  2CY1 A;  4LF6 C;  1KKG A;  4IZ6 A;  1YFE A;  1USP A;  1V25 A;  3TDE A;  3CQ3 A;  1FJG C;  3RG2 A;  2YCB A;  2CU6 A;  5GTD A;  2E9F A;  3OCE A;  2UUB C;  4R1M A;  5K8F A;  1QWI A;  4JI4 C;  4I9F A;  3CI0 K;  2FUS A;  2WP0 C;  4DCS A;  4WS9 A;  1N36 C;  1U15 A;  3IEV A;  2JAO A;  2QL8 A;  1VDK A;  4DV0 C;  3RD8 A;  1PU1 A;  3T1H C;  3S82 A;  4DCU A;  4DV7 C;  5BUS A;  1MH9 A;  2KDN A;  3H2T A;  5E7Q A;  2ZZN A;  1VLA A;  5T8T A;  4RVN A;  4LFA C;  3LNO A;  4JI0 C;  1Z4K A;  5AE2 A;  4G1I A;  2JAU A;  1V60 A;  2VSQ A;  4D4I A;  5CZV A;  1U0L A;  4DG8 A;  5KYT A;  3R44 A;  1XS3 A;  2E0G A;  1Z4I A;  3R6Q A;  4NSL A;  4KHP C;  4PZP A;  3DAY A;  2PFM A;  3B7W A;  1XWO A;  1UKK A;  5KEI A;  3E7W A;  3L8C A;  4RM2 A;  2OPL B;  4NDN A;  1FUO A;  1M6X C;  2E8F A;  3DLP X;  4D56 A;  4MTN A;  2D1Q A;  2P2Q A;  4L4Q A;  4PRO C;  4AQY C;  1J5E C;  1USP B;  1RG9 A;  1MDF A;  4RLF A;  4FTF A;  1C3U A;  4DV3 C;  2JAR A;  3U13 A;  1O90 A;  5HW2 A;  2RCN A;  3RRP A;  2MM9 A;  3TUF A;  3CJE A;  3N54 B;  5BST A;  3TQI A;  2JNV A;  3A9U A;  5LMU C;  1XMQ C;  4OYC A;  1MXB A;  4X62 C;  4L2Z A;  3GKU A;  3PRO C;  2PT7 G;  1ML8 A;  2M5H A;  3CW9 A;  1WF3 A;  2AYA A;  5IWA C;  2HHH C;  1XRB A;  3UZ0 A;  4LF5 C;  3A9V A;  3FCC A;  5AE3 A;  4DR3 C;  2UUA C;  5F91 A;  4XX2 A;  2VQF C;  5IFI A;  1U16 A;  4EAT A;  5LMN C;  2DPL A;  2Y4O A;  3A25 A;  4GKJ C;  2KZ0 A;  2NCL A;  4JI2 C;  1FUP A;  1TJW A;  3IML A;  1Q5N A;  4MWO A;  4B3R C;  5LCI A;  2OBV A;  2Y4N A;  3CQ2 A;  1L2F A;  3IEU A;  4DV1 C;  2UXB C;  4LFB C;  3LNV A;  5ADZ A;  5H9U A;  1T5H X;  4DUY C;  3UEB A;  4BSZ A;  3R9W A;  2YWB A;  4APA A;  1FUQ A;  1Z4M A;  2UU9 C;  3EER A;  3OCF A;  5FLX D;  1XRC A;  1Q92 A;  4JI1 C;  4FUT A;  2JMP A;  3I07 A;  4JI3 C;  2BH1 X;  1GPM A;  2P2F A;  4G36 A;  4DV2 C;  4MUM A;  3VNS A;  1HNZ C;  5A2Q D;  5JRH A;  5A1G A;  4GXQ A;  3N2Q A;  4ZLP A;  3ETC A;  4RLQ A;  4TPS B;  3AY0 A;  3VNQ A;  1P4E C;  2P02 A;  3E04 A;  4LFC C;  1O9T A;  1HH2 P;  4G37 A;  3F4S A;  2WD9 A;  3SO4 A;  2UXC C;  1IW7 D;  1C3C A;  4B3T C;  3UX2 A;  2QVY X;  4DR6 C;  4WV3 A;  2D1T A;  2QVZ X;  4LF8 C;  4MH4 A;  4ODJ A;  2E8C A;  4YHH C;  5BUR A;  2D7V A;  3NO9 A;  1NYE A;  3GTD A;  4HPV A;  4K0B A;  4D4G A;  4NFL A;  1YFM A;  1HNX C;  5BR8 C;  4DR2 C;  1O93 A;  3GPC A;  1DOF A;  5BUQ A;  1AMU A;  2JAW A;  4BBY A;  1LCI A;  1JSW A;  4L6C A;  4ADL A;  3AF5 A;  1KQ7 A;  2CXC A;  4JI5 C;  3AF6 A;  5D6B A;  4JYA C;  1TJ7 A;  4X64 C;  1I94 C;  3C5E A;  4IR7 A;  1UWD A;  4EFC A;  4BCA A;  4NXM C;  1FLO A;  4PHT A;  2BJO A;  3GR1 A;  4RMN A;  1VEH A;  1HY0 A;  3NPD A;  1DCN A;  1IBM C;  4GS5 A;  1XMO C;  1Z4J A;  4E88 A;  1MKY A;  1TH5 A;  4DV4 C;  2D27 A;  2HJG A;  4ADM A;  1FUR A;  5K85 A;  2P2J A;  5BSM A;  4JI8 C;  3TV2 A;  4U5Y D;  4JI6 C;  3J80 D;  2P2M A;  1P7L A;  4DCV A;  5AE1 A;  4D57 A;  3FCE A;  2X75 A;  5F92 A;  1Q91 A;  4DR7 C;  1ULT A;  3OTO C;  3R9X A;  2EGT A;  1Z4L A;  2QGA B;  1T9H A;  2ONF A;  4ISB A;  3GR0 A;  2D1S A;  2I7D A;  2HVG A;  3UX3 A;  5BSV A;  3L95 X;  4RM3 A;  2V7B A;  1N2F A;  1K0R A;  4I9G A;  2E8E A;  3R6V A;  4DG9 A;  4DR5 C;  2MCQ A;  3NI2 A;  1IBL C;  3U19 A;  3J81 D;  2E7G A;  4BC7 A;  4GKK C;  3JAM D;  4KTV A;  4DCT A;  3O2E A;  3F4R A;  2ATW A;  1LQL A;  4IQJ M;  5IT9 D;  1N33 C;  4YIH A;  1XRA A;  3BHG A;  1O92 A;  3E7X A;  5BSR A;  4OX9 C;  4JM1 A;  3VNR A;  1XNR C;  4YY3 C;  2D1R A;  1AUW A;  4L57 A;  5DV9 A;  2KZF A;  1I0A A;  3QBP A;  4X65 C;  1N32 C;  2DHM A;  4NXN C;  1YJ7 A;  2QW0 X;  4X66 C;  2PTQ A;  1TJV A;  4ZJZ A;  1T5D X;  2QVX X;  4MX2 A;  2E5L C;  1HNW C;  4LE5 A;  4BC9 A;  1J3U A;  4LF9 C;  4LF7 C;  3NYR A;  3CQ1 A;  1PA4 A;  4YIK A;  3DHV A;  2ZZM A;  3LUS A;  1M6X A;  3UOW A;  1BA3 A;  3I08 A;  1K62 A;  2PN2 A;  3K6R A;  4DUZ C;  1WH9 A;  1MDB A;  1IBK C;  1QM4 A;  3A4I A;  3EQ6 A;  4PUI A;  3KXW A;  3TR3 A;  2ZM6 C;  5BSW A;  3CW8 X;  1RY2 A;  3F4T A;  4DV5 C;  1RE5 A;  2DYJ A;  5T8S A;  4PUH A;  3GZH A;  2MMA B;  2VQE C;  4K0K C;  4L6A A;  4DR4 C;  4OXI A;  2UXD C;  2PRO A;  4NOZ A;  1XNQ C;  1PG3 A;  4DV6 C;  4B3S C;  3PBK A;  1Z4P X;  3A26 A; 
#chains in the Genus database with same CATH homology
 1HR0 C;  3PES A;  1JOS A;  1MXA A;  4KTT A;  2YWC A;  4R1L A;  3ETO A;  2VZE A;  5BSU A;  1V26 A;  3G7S A;  4LF4 C;  3LGX A;  5A19 A;  4B3M C;  1EGA A;  3LAX A;  1ZB9 A;  2ASB A;  1MD9 A;  2UUC C;  2P2B A;  1FUG A;  3NYQ A;  2XR1 A;  1ZB8 A;  4DR1 C;  2Y27 A;  4RVO A;  4JI7 C;  1N34 C;  2OPL A;  5KYV A;  2OO4 A;  3IPL A;  4L7I A;  3RV2 A;  2F4V C;  4R0M A;  4JV5 C;  2P20 A;  2D28 C;  1MXC A;  3T1Y C;  1PG4 A;  5A1I A;  4FUQ A;  5CZX A;  4GXR A;  2CY1 A;  4LF6 C;  1KKG A;  4IZ6 A;  1USP A;  1V25 A;  3TDE A;  1FJG C;  3RG2 A;  2YCB A;  5GTD A;  2UUB C;  4R1M A;  5K8F A;  1QWI A;  4JI4 C;  4I9F A;  2WP0 C;  4DCS A;  4WS9 A;  1N36 C;  3IEV A;  2QL8 A;  4DV0 C;  3T1H C;  3S82 A;  4DCU A;  4DV7 C;  5BUS A;  5E7Q A;  3H2T A;  1VLA A;  5T8T A;  4RVN A;  4LFA C;  4JI0 C;  5AE2 A;  4G1I A;  2VSQ A;  4D4I A;  5CZV A;  4DG8 A;  5KYT A;  3R44 A;  2E0G A;  4KHP C;  4PZP A;  3DAY A;  3B7W A;  1UKK A;  5KEI A;  3E7W A;  3L8C A;  4RM2 A;  2OPL B;  4NDN A;  2E8F A;  3DLP X;  4D56 A;  4MTN A;  2D1Q A;  2P2Q A;  4L4Q A;  4PRO C;  4AQY C;  1J5E C;  1USP B;  1RG9 A;  1MDF A;  4RLF A;  4FTF A;  4DV3 C;  1O90 A;  3TUF A;  3CJE A;  3N54 B;  5BST A;  3TQI A;  5LMU C;  3A9U A;  1XMQ C;  4OYC A;  1MXB A;  4X62 C;  4L2Z A;  3GKU A;  3PRO C;  2PT7 G;  1ML8 A;  3CW9 A;  1WF3 A;  2AYA A;  5IWA C;  2HHH C;  1XRB A;  3UZ0 A;  4LF5 C;  3A9V A;  3FCC A;  5AE3 A;  4DR3 C;  2UUA C;  4XX2 A;  2VQF C;  5IFI A;  4EAT A;  5LMN C;  2DPL A;  2Y4O A;  4GKJ C;  4JI2 C;  3IML A;  4B3R C;  2OBV A;  2Y4N A;  1L2F A;  3IEU A;  4DV1 C;  2UXB C;  4LFB C;  3LNV A;  5ADZ A;  5H9U A;  1T5H X;  4DUY C;  4BSZ A;  3R9W A;  2YWB A;  2UU9 C;  3EER A;  5FLX D;  1XRC A;  4JI1 C;  4FUT A;  2JMP A;  3I07 A;  4JI3 C;  2BH1 X;  1GPM A;  2P2F A;  4G36 A;  4DV2 C;  3VNS A;  1HNZ C;  5A2Q D;  5JRH A;  5A1G A;  4GXQ A;  3N2Q A;  4ZLP A;  3ETC A;  4RLQ A;  4TPS B;  3VNQ A;  2P02 A;  4LFC C;  1O9T A;  1HH2 P;  4G37 A;  3F4S A;  2WD9 A;  3SO4 A;  2UXC C;  1IW7 D;  4B3T C;  2QVY X;  4DR6 C;  4WV3 A;  2D1T A;  2QVZ X;  4LF8 C;  4MH4 A;  4ODJ A;  2E8C A;  4YHH C;  5BUR A;  2D7V A;  1NYE A;  4HPV A;  4K0B A;  4D4G A;  1HNX C;  5BR8 C;  4DR2 C;  1O93 A;  3GPC A;  5BUQ A;  1AMU A;  4BBY A;  1LCI A;  3AF5 A;  2CXC A;  4JI5 C;  3AF6 A;  4JYA C;  4X64 C;  1I94 C;  3C5E A;  4IR7 A;  4BCA A;  4NXM C;  4PHT A;  2BJO A;  3GR1 A;  4RMN A;  3NPD A;  1IBM C;  4GS5 A;  1XMO C;  4DV4 C;  1MKY A;  2HJG A;  2D27 A;  5K85 A;  2P2J A;  5BSM A;  4JI8 C;  4U5Y D;  4JI6 C;  3J80 D;  2P2M A;  1P7L A;  4DCV A;  5AE1 A;  4D57 A;  3FCE A;  4DR7 C;  1ULT A;  3OTO C;  3R9X A;  2EGT A;  2ONF A;  4ISB A;  3GR0 A;  2D1S A;  5BSV A;  3L95 X;  4RM3 A;  2V7B A;  1N2F A;  1K0R A;  4I9G A;  2E8E A;  4DG9 A;  4DR5 C;  3NI2 A;  1IBL C;  3J81 D;  2E7G A;  4BC7 A;  4GKK C;  3JAM D;  4KTV A;  4DCT A;  3F4R A;  2ATW A;  1LQL A;  4IQJ M;  5IT9 D;  1N33 C;  1XRA A;  1O92 A;  3E7X A;  5BSR A;  4OX9 C;  4JM1 A;  3VNR A;  1XNR C;  4YY3 C;  2D1R A;  5DV9 A;  2KZF A;  4X65 C;  1N32 C;  4NXN C;  1YJ7 A;  2QW0 X;  4X66 C;  4ZJZ A;  1T5D X;  2QVX X;  2E5L C;  1HNW C;  4LE5 A;  4BC9 A;  4LF9 C;  4LF7 C;  3NYR A;  1PA4 A;  3DHV A;  3LUS A;  3UOW A;  1BA3 A;  3I08 A;  2PN2 A;  4DUZ C;  1WH9 A;  1MDB A;  1IBK C;  1QM4 A;  3A4I A;  3EQ6 A;  3KXW A;  2ZM6 C;  5BSW A;  3CW8 X;  1RY2 A;  3F4T A;  4DV5 C;  2DYJ A;  5T8S A;  2VQE C;  4K0K C;  4DR4 C;  4OXI A;  2UXD C;  2PRO A;  4NOZ A;  1XNQ C;  1PG3 A;  4DV6 C;  4B3S C;  3PBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...