2D28C

Structure of the n-terminal domain of xpse (crystal form p43212)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
149
structure length
144
Chain Sequence
MEQRSAETRIVEALLERRRLKDTDLVRARQESGMGLLALLGRLGLVSERDHAETCAEVLGLPLVDARQLGDTPPEMEVQGLSLRFLKQFHLCPVGERDGRLDLWIADPYDDYAIDAVRLATGLPLLLHVGLRSEIDDLIERWYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords type II secretion ATPase XpsE
publication title Structure and Function of the XpsE N-Terminal Domain, an Essential Component of the Xanthomonas campestris Type II Secretion System
pubmed doi rcsb
source organism Xanthomonas campestris
total genus 42
structure length 144
sequence length 149
ec nomenclature
pdb deposition date 2005-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.70 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Ribonucleotide Reductase Protein R1; domain 1 2d28C01
3.30.300.160 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2d28C02
2D27A 4PHTA 2BH1X 2D28C
chains in the Genus database with same CATH superfamily
2OPLA 1NYEA 2CU6A 1WH9A 4ODJA 4MH4A 4RM2A 3J81D 5E7QA 1HR0C 3A9UA 4IQJM 4U5YD 4JYAC 4E88A 1QM4A 4L7IA 1HY0A 3NYQA 3A26A 1LCIA 1O93A 4LE5A 4L4QA 4B3SC 4EFCA 3L95X 1ML8A 4D56A 2E8CA 2KZFA 4DCSA 1Z4IA 1ZB8A 4MUMA 5AE3A 3SO4A 1VEHA 2UXCC 5K85A 2JARA 3CW9A 1XRBA 1PG4A 3R9WA 1USPA 4OX9C 1ULTA 1Q92A 4EEIA 3TQIA 4EATA 3F4TA 4DV6C 3PROC 1Z4QA 2EGTA 3A9VA 2JMPA 1FLOA 1FUQA 1TJVA 3I08A 3S82A 3CQ2A 2D28C 1P4EA 5BSTA 3TUFA 4G1IA 3GR1A 3TR3A 1XNRC 2P02A 2MMAB 5A1GA 2BH1X 1U16A 2VSQA 1N33C 1O92A 1MD9A 4D57A 2UU9C 4LFCC 4GXRA 5BUQA 1K62A 2PROA 3LGXA 4ZJZA 1UWDA 3LUSA 4JI3C 3NPDA 3OCFA 1JOSA 2MCQA 1T5DX 3GPCA 2HVGA 4JI0C 4LF9C 4RVOA 3L8CA 5K8FA 2M5HA 3GZHA 3BHGA 2E7GA 3CJEA 1K7WA 4I9FA 1YJ7A 4MX2A 1C3UA 2YX1A 4L6CA 2UUBC 3F4SA 2DHMA 2VQFC 2QVXX 2MM9A 2QW0X 3ETOA 3RG2A 1XRAA 5LMNC 3CI0K 3OCEA 1IB8A 4R1MA 1J3UA 1RG9A 1MH9A 5JRHA 1I94C 4L6AA 1TJ7A 3TV2A 4ZLPA 3I07A 2ZZNA 4K0BA 4JI1C 3R9XA 4NXNC 1IW7D 4APAA 1KKGA 3UX2A 3C5EA 1J5EC 1WCJA 1NY8A 2P2QA 3VNSA 1Z4MA 2JNVA 3NI2A 4JI8C 4TPSB 4DV3C 3FCCA 3FCEA 2D7VA 5H9UA 1DOFA 1EGAA 1FUOA 2JAUA 2ATWA 4DR3C 4BC7A 1PG3A 3DLPX 4YIKA 4RMNA 2PT7G 4DR7C 1XRCA 2YWCA 4NXMC 1PU1A 1MXAA 3VNRA 3N2QA 2Y4OA 3IEUA 2P2BA 3IPLA 1YFMA 4IR7A 4X62C 3EQ6A 1RE5A 4PUIA 5DV9A 4DV0C 4D4GA 5BUSA 1HH2P 2WP0C 1AMUA 1M6XA 3R44A 2HJGA 2KZ0A 4DV4C 1L2FA 4PUGA 5A2QD 3PESA 3R6QA 1VDKA 1IBLC 5D6BA 5T8SA 1MXCA 2QVZX 4X66C 2RCNA 4G36A 4R0MA 1O90A 1XS3A 4ADLA 2YCBA 2OO4A 4B3RC 3AF5A 3UZ0A 4KHPC 4KTTA 3OTOC 3LAXA 4JI2C 2JAOA 2Y27A 2AYAA 5KYVA 4JI6C 1TH5A 3UOWA 1QWIA 3TDEA 1Q5NA 1V26A 4DR4C 1N32C 4NSLA 3AY0A 5A19A 4FTFA 1MKYA 4NLEA 3DHVA 5AE2A 3JAMD 3CQ1A 3F4RA 4NOZA 4DR2C 2VZEA 4K0KC 4PZPA 2D1QA 4OXIA 3RV2A 2ZZMA 2DPLA 1U0LA 4LF6C 1HY1A 1BA3A 2X75A 3R6VA 1V60A 1XMOC 1HNWC 4RM3A 2PFMA 3U19A 2E0GA 1Q91A 4PROC 3QBPA 4KTVA 2UUAC 3E04A 1Z4PX 2PN2A 1P7LA 4OYCA 3GKUA 4GKKC 4LF8C 5BSMA 5BSUA 4JI5C 1N34C 2OPLB 4LFAC 1Z4KA 1XMQC 1Z4JA 3LNVA 4B3MC 4WV3A 1M6XC 4RLQA 4LF4C 1MDFA 2P2FA 1DCNA 2DYJA 2VQEC 5F92A 2YV5A 1Z4LA 4APBA 1XNQC 1ZB9A 3KXWA 4LF7C 4YIHA 4DCVA 1I0AA 3A25A 3LNOA 4PHTA 2UXBC 2CY1A 2P2MA 2E9FA 4YY3C 2P2JA 1VLAA 3H2TA 3DAYA 3EERA 2V7BA 4NDNA 4DV2C 1XHJA 3A4IA 4GS5A 1RY2A 3CQ3A 1HNXC 1T5HX 4RLFA 2F4VC 4DR6C 1USPB 5IT9D 4JV5C 3GR0A 2D27A 1P4EC 2E5LC 2PTSA 3GTDA 2Y4NA 4WS9A 2BJOA 2QL8A 4X64C 5FLXD 3PBKA 4HPVA 1T9HA 1C3CA 1V25A 4DR1C 3IEVA 3U13A 3J80D 5BSRA 5GTDA 4X65C 1O9TA 4MWOA 1FURA 5T8TA 2UXDC 2ZM6C 4G37A 3T1HC 1K0RA 1UKKA 3O2EA 4PUHA 1YFEA 2M5OA 2PTQA 3BWVA 5IFIA 4DV1C 2HHHC 1N2FA 2QVYX 3NYRA 4DUZC 4DG8A 4GKJC 4DCUA 5CZXA 4L2ZA 2E8EA 5AE1A 4AQYC 4DCTA 1JSWA 4LFBC 3UX3A 2D1SA 2KDNA 1AUWA 4IZ6A 4XX2A 5LMUC 4BCAA 2CXCA 3AF6A 2E8FA 4FUTA 4GXQA 5BURA 1MXBA 4ADMA 1LQLA 3K6RA 1KQ7A 2D1RA 4NFLA 5BSWA 3UEBA 2NCLA 2ONFA 4I9GA 1FUPA 1U15A 2ASBA 1PA4A 5BR8C 5KEIA 5LCIA 3IMLA 4L57A 4DV5C 2PTRA 3G7SA 4R1LA 3VNQA 4DG9A 1TJWA 4LF5C 1GPMA 4RVNA 4YHHC 3CW8X 4HGVA 5IWAC 2I7DA 4DR5C 1MDBA 5HW2A 1TJUA 4D4IA 4DV7C 2FUSA 4JI7C 2Z51A 5F91A 4MTNA 1XWOA 4BC9A 5KYTA 4DUYC 1WF3A 5A1IA 1HNZC 3E7XA 4BBYA 1N36C 2YWBA 2JAWA 2QGAB 3RD8A 2P20A 3T1YC 2WD9A 5ADZA 5BSVA 2UUCC 2OBVA 4BSZA 4JI4C 5CZVA 1IBMC 3N54B 2D1TA 4B3TC 1FJGC 4FUQA 3E7WA 3B7WA 4ISBA 1IBKC 3ETCA 3C8TA 4JM1A 3RRPA 3NO9A 2XR1A 1FUGA
chains in the Genus database with same CATH topology
2OPLA 1NYEA 1WH9A 4ODJA 4MH4A 4RM2A 3J81D 5E7QA 1HR0C 3A9UA 4IQJM 4U5YD 4JYAC 1QM4A 4L7IA 3NYQA 1LCIA 1O93A 4LE5A 4L4QA 4B3SC 3L95X 1ML8A 4D56A 2E8CA 2KZFA 4DCSA 1ZB8A 5AE3A 3SO4A 2UXCC 5K85A 3CW9A 1XRBA 1PG4A 3R9WA 1USPA 4OX9C 1ULTA 3TQIA 4EATA 3F4TA 4DV6C 3PROC 2EGTA 3A9VA 2JMPA 3I08A 3S82A 2D28C 5BSTA 3TUFA 4G1IA 3GR1A 1XNRC 2P02A 5A1GA 2BH1X 1N33C 2VSQA 1O92A 1MD9A 4D57A 2UU9C 4LFCC 4GXRA 5BUQA 3LGXA 2PROA 4ZJZA 3LUSA 4JI3C 3NPDA 1JOSA 1T5DX 3GPCA 4JI0C 4LF9C 4RVOA 3L8CA 5K8FA 2E7GA 3CJEA 4I9FA 1YJ7A 2UUBC 3F4SA 2VQFC 2QVXX 2QW0X 3ETOA 3RG2A 1XRAA 5LMNC 4R1MA 1RG9A 5JRHA 1I94C 4ZLPA 3I07A 4K0BA 4JI1C 3R9XA 4NXNC 1IW7D 1KKGA 3C5EA 1J5EC 2P2QA 3VNSA 3NI2A 4JI8C 4TPSB 4DV3C 3FCCA 3FCEA 2D7VA 5H9UA 1EGAA 2ATWA 4DR3C 4BC7A 1PG3A 3DLPX 4RMNA 2PT7G 4DR7C 1XRCA 2YWCA 4NXMC 1MXAA 3VNRA 3N2QA 2Y4OA 3IEUA 2P2BA 3IPLA 4IR7A 4X62C 3EQ6A 5DV9A 4DV0C 4D4GA 5BUSA 1HH2P 2WP0C 1AMUA 3R44A 2HJGA 4DV4C 1L2FA 5A2QD 3PESA 1IBLC 5T8SA 1MXCA 2QVZX 4X66C 4R0MA 4G36A 1O90A 2YCBA 2OO4A 4B3RC 3AF5A 3UZ0A 4KHPC 4KTTA 3OTOC 3LAXA 4JI2C 2Y27A 2AYAA 5KYVA 4JI6C 3UOWA 1QWIA 3TDEA 1V26A 4DR4C 1N32C 5A19A 4FTFA 1MKYA 3DHVA 5AE2A 3JAMD 3F4RA 4NOZA 4DR2C 2VZEA 4K0KC 4PZPA 2D1QA 4OXIA 3RV2A 2DPLA 4LF6C 1BA3A 1XMOC 1HNWC 4RM3A 2E0GA 4PROC 4KTVA 2UUAC 2PN2A 1P7LA 4OYCA 3GKUA 4GKKC 4LF8C 5BSMA 5BSUA 4JI5C 1N34C 2OPLB 4LFAC 1XMQC 3LNVA 4B3MC 4WV3A 4RLQA 4LF4C 1MDFA 2P2FA 2DYJA 2VQEC 1XNQC 1ZB9A 3KXWA 4LF7C 4DCVA 4PHTA 2UXBC 2CY1A 2P2MA 4YY3C 2P2JA 1VLAA 3H2TA 3DAYA 3EERA 2V7BA 4NDNA 4DV2C 3A4IA 4GS5A 1RY2A 1HNXC 1T5HX 4RLFA 2F4VC 4DR6C 1USPB 5IT9D 4JV5C 3GR0A 2D27A 2E5LC 2Y4NA 4WS9A 2BJOA 2QL8A 4X64C 5FLXD 3PBKA 4HPVA 1V25A 4DR1C 3IEVA 3J80D 5BSRA 5GTDA 4X65C 1O9TA 5T8TA 2UXDC 2ZM6C 4G37A 3T1HC 1K0RA 1UKKA 5IFIA 4DV1C 2HHHC 1N2FA 2QVYX 3NYRA 4DUZC 4DG8A 4GKJC 4DCUA 5CZXA 4L2ZA 2E8EA 5AE1A 4AQYC 4DCTA 4LFBC 2D1SA 4IZ6A 4XX2A 5LMUC 4BCAA 2CXCA 3AF6A 2E8FA 4FUTA 4GXQA 5BURA 1MXBA 1LQLA 2D1RA 5BSWA 2ONFA 4I9GA 2ASBA 1PA4A 5BR8C 5KEIA 3IMLA 4DV5C 3G7SA 4R1LA 3VNQA 4DG9A 4LF5C 1GPMA 4RVNA 4YHHC 3CW8X 5IWAC 4DR5C 1MDBA 4D4IA 4DV7C 4JI7C 4MTNA 4BC9A 5KYTA 4DUYC 1WF3A 5A1IA 1HNZC 3E7XA 4BBYA 1N36C 2YWBA 3T1YC 2P20A 2UUCC 2WD9A 5ADZA 5BSVA 2OBVA 4BSZA 4JI4C 5CZVA 1IBMC 3N54B 2D1TA 4B3TC 1FJGC 4FUQA 3E7WA 3B7WA 4ISBA 1IBKC 3ETCA 4JM1A 2XR1A 1FUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D27 A;  4PHT A;  2BH1 X;  2D28 C; 
#chains in the Genus database with same CATH topology
 2OPL A;  1NYE A;  2CU6 A;  1WH9 A;  4ODJ A;  4MH4 A;  4RM2 A;  3J81 D;  5E7Q A;  1HR0 C;  3A9U A;  4IQJ M;  4U5Y D;  4JYA C;  4E88 A;  1QM4 A;  4L7I A;  1HY0 A;  3NYQ A;  3A26 A;  1LCI A;  1O93 A;  4LE5 A;  4L4Q A;  4B3S C;  4EFC A;  3L95 X;  1ML8 A;  4D56 A;  2E8C A;  2KZF A;  4DCS A;  1Z4I A;  1ZB8 A;  4MUM A;  5AE3 A;  3SO4 A;  1VEH A;  2UXC C;  5K85 A;  2JAR A;  3CW9 A;  1XRB A;  1PG4 A;  3R9W A;  1USP A;  4OX9 C;  1ULT A;  1Q92 A;  4EEI A;  3TQI A;  4EAT A;  3F4T A;  4DV6 C;  3PRO C;  1Z4Q A;  2EGT A;  3A9V A;  2JMP A;  1FLO A;  1FUQ A;  1TJV A;  3I08 A;  3S82 A;  3CQ2 A;  2D28 C;  1P4E A;  5BST A;  3TUF A;  4G1I A;  3GR1 A;  3TR3 A;  1XNR C;  2P02 A;  2MMA B;  5A1G A;  2BH1 X;  1U16 A;  2VSQ A;  1N33 C;  1O92 A;  1MD9 A;  4D57 A;  2UU9 C;  4LFC C;  4GXR A;  5BUQ A;  1K62 A;  2PRO A;  3LGX A;  4ZJZ A;  1UWD A;  3LUS A;  4JI3 C;  3NPD A;  3OCF A;  1JOS A;  2MCQ A;  1T5D X;  3GPC A;  2HVG A;  4JI0 C;  4LF9 C;  4RVO A;  3L8C A;  5K8F A;  2M5H A;  3GZH A;  3BHG A;  2E7G A;  3CJE A;  1K7W A;  4I9F A;  1YJ7 A;  4MX2 A;  1C3U A;  2YX1 A;  4L6C A;  2UUB C;  3F4S A;  2DHM A;  2VQF C;  2QVX X;  2MM9 A;  2QW0 X;  3ETO A;  3RG2 A;  1XRA A;  5LMN C;  3CI0 K;  3OCE A;  1IB8 A;  4R1M A;  1J3U A;  1RG9 A;  1MH9 A;  5JRH A;  1I94 C;  4L6A A;  1TJ7 A;  3TV2 A;  4ZLP A;  3I07 A;  2ZZN A;  4K0B A;  4JI1 C;  3R9X A;  4NXN C;  1IW7 D;  4APA A;  1KKG A;  3UX2 A;  3C5E A;  1J5E C;  1WCJ A;  1NY8 A;  2P2Q A;  3VNS A;  1Z4M A;  2JNV A;  3NI2 A;  4JI8 C;  4TPS B;  4DV3 C;  3FCC A;  3FCE A;  2D7V A;  5H9U A;  1DOF A;  1EGA A;  1FUO A;  2JAU A;  2ATW A;  4DR3 C;  4BC7 A;  1PG3 A;  3DLP X;  4YIK A;  4RMN A;  2PT7 G;  4DR7 C;  1XRC A;  2YWC A;  4NXM C;  1PU1 A;  1MXA A;  3VNR A;  3N2Q A;  2Y4O A;  3IEU A;  2P2B A;  3IPL A;  1YFM A;  4IR7 A;  4X62 C;  3EQ6 A;  1RE5 A;  4PUI A;  5DV9 A;  4DV0 C;  4D4G A;  5BUS A;  1HH2 P;  2WP0 C;  1AMU A;  1M6X A;  3R44 A;  2HJG A;  2KZ0 A;  4DV4 C;  1L2F A;  4PUG A;  5A2Q D;  3PES A;  3R6Q A;  1VDK A;  1IBL C;  5D6B A;  5T8S A;  1MXC A;  2QVZ X;  4X66 C;  2RCN A;  4G36 A;  4R0M A;  1O90 A;  1XS3 A;  4ADL A;  2YCB A;  2OO4 A;  4B3R C;  3AF5 A;  3UZ0 A;  4KHP C;  4KTT A;  3OTO C;  3LAX A;  4JI2 C;  2JAO A;  2Y27 A;  2AYA A;  5KYV A;  4JI6 C;  1TH5 A;  3UOW A;  1QWI A;  3TDE A;  1Q5N A;  1V26 A;  4DR4 C;  1N32 C;  4NSL A;  3AY0 A;  5A19 A;  4FTF A;  1MKY A;  4NLE A;  3DHV A;  5AE2 A;  3JAM D;  3CQ1 A;  3F4R A;  4NOZ A;  4DR2 C;  2VZE A;  4K0K C;  4PZP A;  2D1Q A;  4OXI A;  3RV2 A;  2ZZM A;  2DPL A;  1U0L A;  4LF6 C;  1HY1 A;  1BA3 A;  2X75 A;  3R6V A;  1V60 A;  1XMO C;  1HNW C;  4RM3 A;  2PFM A;  3U19 A;  2E0G A;  1Q91 A;  4PRO C;  3QBP A;  4KTV A;  2UUA C;  3E04 A;  1Z4P X;  2PN2 A;  1P7L A;  4OYC A;  3GKU A;  4GKK C;  4LF8 C;  5BSM A;  5BSU A;  4JI5 C;  1N34 C;  2OPL B;  4LFA C;  1Z4K A;  1XMQ C;  1Z4J A;  3LNV A;  4B3M C;  4WV3 A;  1M6X C;  4RLQ A;  4LF4 C;  1MDF A;  2P2F A;  1DCN A;  2DYJ A;  2VQE C;  5F92 A;  2YV5 A;  1Z4L A;  4APB A;  1XNQ C;  1ZB9 A;  3KXW A;  4LF7 C;  4YIH A;  4DCV A;  1I0A A;  3A25 A;  3LNO A;  4PHT A;  2UXB C;  2CY1 A;  2P2M A;  2E9F A;  4YY3 C;  2P2J A;  1VLA A;  3H2T A;  3DAY A;  3EER A;  2V7B A;  4NDN A;  4DV2 C;  1XHJ A;  3A4I A;  4GS5 A;  1RY2 A;  3CQ3 A;  1HNX C;  1T5H X;  4RLF A;  2F4V C;  4DR6 C;  1USP B;  5IT9 D;  4JV5 C;  3GR0 A;  2D27 A;  1P4E C;  2E5L C;  2PTS A;  3GTD A;  2Y4N A;  4WS9 A;  2BJO A;  2QL8 A;  4X64 C;  5FLX D;  3PBK A;  4HPV A;  1T9H A;  1C3C A;  1V25 A;  4DR1 C;  3IEV A;  3U13 A;  3J80 D;  5BSR A;  5GTD A;  4X65 C;  1O9T A;  4MWO A;  1FUR A;  5T8T A;  2UXD C;  2ZM6 C;  4G37 A;  3T1H C;  1K0R A;  1UKK A;  3O2E A;  4PUH A;  1YFE A;  2M5O A;  2PTQ A;  3BWV A;  5IFI A;  4DV1 C;  2HHH C;  1N2F A;  2QVY X;  3NYR A;  4DUZ C;  4DG8 A;  4GKJ C;  4DCU A;  5CZX A;  4L2Z A;  2E8E A;  5AE1 A;  4AQY C;  4DCT A;  1JSW A;  4LFB C;  3UX3 A;  2D1S A;  2KDN A;  1AUW A;  4IZ6 A;  4XX2 A;  5LMU C;  4BCA A;  2CXC A;  3AF6 A;  2E8F A;  4FUT A;  4GXQ A;  5BUR A;  1MXB A;  4ADM A;  1LQL A;  3K6R A;  1KQ7 A;  2D1R A;  4NFL A;  5BSW A;  3UEB A;  2NCL A;  2ONF A;  4I9G A;  1FUP A;  1U15 A;  2ASB A;  1PA4 A;  5BR8 C;  5KEI A;  5LCI A;  3IML A;  4L57 A;  4DV5 C;  2PTR A;  3G7S A;  4R1L A;  3VNQ A;  4DG9 A;  1TJW A;  4LF5 C;  1GPM A;  4RVN A;  4YHH C;  3CW8 X;  4HGV A;  5IWA C;  2I7D A;  4DR5 C;  1MDB A;  5HW2 A;  1TJU A;  4D4I A;  4DV7 C;  2FUS A;  4JI7 C;  2Z51 A;  5F91 A;  4MTN A;  1XWO A;  4BC9 A;  5KYT A;  4DUY C;  1WF3 A;  5A1I A;  1HNZ C;  3E7X A;  4BBY A;  1N36 C;  2YWB A;  2JAW A;  2QGA B;  3RD8 A;  2P20 A;  3T1Y C;  2WD9 A;  5ADZ A;  5BSV A;  2UUC C;  2OBV A;  4BSZ A;  4JI4 C;  5CZV A;  1IBM C;  3N54 B;  2D1T A;  4B3T C;  1FJG C;  4FUQ A;  3E7W A;  3B7W A;  4ISB A;  1IBK C;  3ETC A;  3C8T A;  4JM1 A;  3RRP A;  3NO9 A;  2XR1 A;  1FUG A; 
#chains in the Genus database with same CATH homology
 2OPL A;  1NYE A;  1WH9 A;  4ODJ A;  4MH4 A;  4RM2 A;  3J81 D;  5E7Q A;  1HR0 C;  3A9U A;  4IQJ M;  4U5Y D;  4JYA C;  1QM4 A;  4L7I A;  3NYQ A;  1LCI A;  1O93 A;  4LE5 A;  4L4Q A;  4B3S C;  3L95 X;  1ML8 A;  4D56 A;  2E8C A;  2KZF A;  4DCS A;  1ZB8 A;  5AE3 A;  3SO4 A;  2UXC C;  5K85 A;  3CW9 A;  1XRB A;  1PG4 A;  3R9W A;  1USP A;  4OX9 C;  1ULT A;  3TQI A;  4EAT A;  3F4T A;  4DV6 C;  3PRO C;  2EGT A;  3A9V A;  2JMP A;  3I08 A;  3S82 A;  2D28 C;  5BST A;  3TUF A;  4G1I A;  3GR1 A;  1XNR C;  2P02 A;  5A1G A;  2BH1 X;  1N33 C;  2VSQ A;  1O92 A;  1MD9 A;  4D57 A;  2UU9 C;  4LFC C;  4GXR A;  5BUQ A;  3LGX A;  2PRO A;  4ZJZ A;  3LUS A;  4JI3 C;  3NPD A;  1JOS A;  1T5D X;  3GPC A;  4JI0 C;  4LF9 C;  4RVO A;  3L8C A;  5K8F A;  2E7G A;  3CJE A;  4I9F A;  1YJ7 A;  2UUB C;  3F4S A;  2VQF C;  2QVX X;  2QW0 X;  3ETO A;  3RG2 A;  1XRA A;  5LMN C;  4R1M A;  1RG9 A;  5JRH A;  1I94 C;  4ZLP A;  3I07 A;  4K0B A;  4JI1 C;  3R9X A;  4NXN C;  1IW7 D;  1KKG A;  3C5E A;  1J5E C;  2P2Q A;  3VNS A;  3NI2 A;  4JI8 C;  4TPS B;  4DV3 C;  3FCC A;  3FCE A;  2D7V A;  5H9U A;  1EGA A;  2ATW A;  4DR3 C;  4BC7 A;  1PG3 A;  3DLP X;  4RMN A;  2PT7 G;  4DR7 C;  1XRC A;  2YWC A;  4NXM C;  1MXA A;  3VNR A;  3N2Q A;  2Y4O A;  3IEU A;  2P2B A;  3IPL A;  4IR7 A;  4X62 C;  3EQ6 A;  5DV9 A;  4DV0 C;  4D4G A;  5BUS A;  1HH2 P;  2WP0 C;  1AMU A;  3R44 A;  2HJG A;  4DV4 C;  1L2F A;  5A2Q D;  3PES A;  1IBL C;  5T8S A;  1MXC A;  2QVZ X;  4X66 C;  4R0M A;  4G36 A;  1O90 A;  2YCB A;  2OO4 A;  4B3R C;  3AF5 A;  3UZ0 A;  4KHP C;  4KTT A;  3OTO C;  3LAX A;  4JI2 C;  2Y27 A;  2AYA A;  5KYV A;  4JI6 C;  3UOW A;  1QWI A;  3TDE A;  1V26 A;  4DR4 C;  1N32 C;  5A19 A;  4FTF A;  1MKY A;  3DHV A;  5AE2 A;  3JAM D;  3F4R A;  4NOZ A;  4DR2 C;  2VZE A;  4K0K C;  4PZP A;  2D1Q A;  4OXI A;  3RV2 A;  2DPL A;  4LF6 C;  1BA3 A;  1XMO C;  1HNW C;  4RM3 A;  2E0G A;  4PRO C;  4KTV A;  2UUA C;  2PN2 A;  1P7L A;  4OYC A;  3GKU A;  4GKK C;  4LF8 C;  5BSM A;  5BSU A;  4JI5 C;  1N34 C;  2OPL B;  4LFA C;  1XMQ C;  3LNV A;  4B3M C;  4WV3 A;  4RLQ A;  4LF4 C;  1MDF A;  2P2F A;  2DYJ A;  2VQE C;  1XNQ C;  1ZB9 A;  3KXW A;  4LF7 C;  4DCV A;  4PHT A;  2UXB C;  2CY1 A;  2P2M A;  4YY3 C;  2P2J A;  1VLA A;  3H2T A;  3DAY A;  3EER A;  2V7B A;  4NDN A;  4DV2 C;  3A4I A;  4GS5 A;  1RY2 A;  1HNX C;  1T5H X;  4RLF A;  2F4V C;  4DR6 C;  1USP B;  5IT9 D;  4JV5 C;  3GR0 A;  2D27 A;  2E5L C;  2Y4N A;  4WS9 A;  2BJO A;  2QL8 A;  4X64 C;  5FLX D;  3PBK A;  4HPV A;  1V25 A;  4DR1 C;  3IEV A;  3J80 D;  5BSR A;  5GTD A;  4X65 C;  1O9T A;  5T8T A;  2UXD C;  2ZM6 C;  4G37 A;  3T1H C;  1K0R A;  1UKK A;  5IFI A;  4DV1 C;  2HHH C;  1N2F A;  2QVY X;  3NYR A;  4DUZ C;  4DG8 A;  4GKJ C;  4DCU A;  5CZX A;  4L2Z A;  2E8E A;  5AE1 A;  4AQY C;  4DCT A;  4LFB C;  2D1S A;  4IZ6 A;  4XX2 A;  5LMU C;  4BCA A;  2CXC A;  3AF6 A;  2E8F A;  4FUT A;  4GXQ A;  5BUR A;  1MXB A;  1LQL A;  2D1R A;  5BSW A;  2ONF A;  4I9G A;  2ASB A;  1PA4 A;  5BR8 C;  5KEI A;  3IML A;  4DV5 C;  3G7S A;  4R1L A;  3VNQ A;  4DG9 A;  4LF5 C;  1GPM A;  4RVN A;  4YHH C;  3CW8 X;  5IWA C;  4DR5 C;  1MDB A;  4D4I A;  4DV7 C;  4JI7 C;  4MTN A;  4BC9 A;  5KYT A;  4DUY C;  1WF3 A;  5A1I A;  1HNZ C;  3E7X A;  4BBY A;  1N36 C;  2YWB A;  3T1Y C;  2P20 A;  2UUC C;  2WD9 A;  5ADZ A;  5BSV A;  2OBV A;  4BSZ A;  4JI4 C;  5CZV A;  1IBM C;  3N54 B;  2D1T A;  4B3T C;  1FJG C;  4FUQ A;  3E7W A;  3B7W A;  4ISB A;  1IBK C;  3ETC A;  4JM1 A;  2XR1 A;  1FUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...