2D28C

Structure of the n-terminal domain of xpse (crystal form p43212)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
149
structure length
144
Chain Sequence
MEQRSAETRIVEALLERRRLKDTDLVRARQESGMGLLALLGRLGLVSERDHAETCAEVLGLPLVDARQLGDTPPEMEVQGLSLRFLKQFHLCPVGERDGRLDLWIADPYDDYAIDAVRLATGLPLLLHVGLRSEIDDLIERWYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of the XpsE N-Terminal Domain, an Essential Component of the Xanthomonas campestris Type II Secretion System
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Protein transport
molecule keywords type II secretion ATPase XpsE
total genus 42
structure length 144
sequence length 149
ec nomenclature
pdb deposition date 2005-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.70 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Ribonucleotide Reductase Protein R1; domain 1 2d28C01
3.30.300.160 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2d28C02
4PHTA 2D27A 2BH1X 2D28C
chains in the Genus database with same CATH superfamily
1TJVA 1XRBA 1FUPA 4DV5C 4EFCA 1TJWA 2D28C 2YWCA 1HR0C 3VNQA 3RG2A 2JAUA 2PFMA 3IEVA 2P2JA 1AMUA 4JI3C 4MTNA 4PUGA 4JI7C 5A19A 2JAOA 3GR0A 1USPA 2E5LC 4DUYC 4L6CA 2VQEC 1KQ7A 4B3RC 3OCEA 1RG9A 3AY0A 3VNSA 2UUCC 3I07A 3VNRA 3U13A 4G37A 5KYVA 3IEUA 4DR5C 1P4EC 2Y4OA 1MXBA 1N33C 3N54B 2E8EA 5IT9D 5JRHA 1HH2P 1BA3A 2E7GA 2QVXX 4K0KC 4LFAC 3B7WA 3LNOA 3H2TA 5AE3A 1Z4JA 3CI0K 1L2FA 1HNZC 1IW7D 3E04A 3RV2A 2M5OA 4GXRA 2ASBA 5K8FA 3BHGA 1MDFA 4DV7C 4B3TC 5A1GA 4BSZA 2MMAB 4BC9A 2Y27A 4LF8C 2PTRA 1O92A 1MXAA 4HPVA 5LMUC 1Z4PX 4JI2C 1MD9A 5HW2A 3R9XA 1U15A 3LNVA 1J3UA 1LQLA 2QVZX 2ZZNA 3R6VA 4KTVA 1J5EC 3CJEA 1M6XA 4NFLA 2DPLA 5CZXA 1N32C 2WP0C 2UXBC 5IWAC 3NPDA 1QWIA 2D1TA 4DV3C 1O93A 3EERA 2QGAB 2D1SA 2P2QA 3A26A 1T5DX 2F4VC 5T8SA 4X66C 4EATA 1N34C 3ETCA 1JOSA 1WH9A 1MDBA 4JI5C 2D7VA 4RM2A 3F4SA 1TH5A 3A4IA 4DR3C 1Z4IA 4EEIA 3U19A 5ADZA 1Z4MA 4I9FA 3AF6A 3L95X 4PROC 4IR7A 3F4TA 1IB8A 2KZ0A 2ATWA 5FLXD 3CQ3A 2P2FA 5BUQA 1XRCA 4L2ZA 1P4EA 1Q92A 4WV3A 3DLPX 1V25A 4YIKA 2UXCC 1AUWA 1N2FA 4IZ6A 4ODJA 3LAXA 2M5HA 2HVGA 3NI2A 5KEIA 1KKGA 2KDNA 4D4GA 2HHHC 4XX2A 4X65C 2QVYX 4BCAA 1N36C 4D57A 4RLFA 4DUZC 2P2BA 1WCJA 3CW8X 2KZFA 3O2EA 3AF5A 4RVOA 3FCEA 2RCNA 5BR8C 4DV1C 1GPMA 4X62C 3QBPA 3IPLA 4R0MA 4DG9A 2ZZMA 2MCQA 3EQ6A 4PUHA 2Z51A 5K85A 3A9VA 3RRPA 5GTDA 4KTTA 3SO4A 1Z4KA 3UOWA 1FUQA 2OPLB 3CQ2A 4PHTA 1K7WA 4L57A 4WS9A 5H9UA 3JAMD 4OXIA 5BSUA 3C5EA 1ML8A 1FUOA 3E7XA 4JI1C 1NY8A 5A1IA 4DCSA 5AE1A 1FLOA 3A25A 1XNQC 3R6QA 3KXWA 4DR6C 1PU1A 4JYAC 2CY1A 5BSTA 5DV9A 4KHPC 3A9UA 2EGTA 3UZ0A 4U5YD 1TJUA 2JMPA 3I08A 4DV4C 4NSLA 4ISBA 5BURA 3TUFA 1T5HX 1O9TA 3T1YC 4E88A 1IBKC 4NXNC 4G36A 2ZM6C 1YFEA 3C8TA 1XRAA 2P2MA 4DR4C 4LF6C 2PTSA 2JARA 1T9HA 2OPLA 2YWBA 1U0LA 4B3SC 2AYAA 2XR1A 2MM9A 1O90A 1FURA 4FTFA 4DCUA 1ZB8A 3TDEA 5A2QD 1IBLC 1VEHA 5LMNC 3J80D 1C3UA 4AQYC 1HY1A 2NCLA 3TV2A 1I94C 1UKKA 5E7QA 4BC7A 5AE2A 4MX2A 1VLAA 3UX2A 2E9FA 2VZEA 4DG8A 1DOFA 3LGXA 1DCNA 2Y4NA 1MH9A 2QL8A 1C3CA 4RVNA 3S82A 1PG4A 4LFCC 4NDNA 3LUSA 2VQFC 1XWOA 5BSRA 3PBKA 3GTDA 4JI4C 3F4RA 4DCVA 3UX3A 4JI8C 2E8FA 4OX9C 5F91A 3TR3A 2D1RA 1MXCA 3NYRA 4GS5A 1U16A 1HNXC 1QM4A 1EGAA 1P7LA 4FUTA 4DV0C 3OCFA 1XS3A 2ONFA 3R44A 5BSMA 3NYQA 4FUQA 2UUAC 2DYJA 2OBVA 3RD8A 1HNWC 3L8CA 3K6RA 2P20A 1I0AA 1USPB 1K0RA 1WF3A 2WD9A 4JV5C 4L6AA 5BSVA 4RLQA 4GKKC 2E8CA 3OTOC 4DV6C 5LCIA 1RE5A 4LF9C 4LE5A 2YCBA 2YX1A 5CZVA 3IMLA 2PN2A 4RMNA 3CQ1A 4MUMA 5T8TA 2FUSA 4ADLA 4APAA 3J81D 4IQJM 2JAWA 1V26A 1Q5NA 1XNRC 2BJOA 2PROA 1ZB9A 4LF7C 3T1HC 1MKYA 1K62A 4PUIA 4LF5C 2DHMA 1FJGC 2D27A 4R1LA 2V7BA 1M6XC 1NYEA 5BUSA 1JSWA 4R1MA 4DR2C 4NLEA 2X75A 2UXDC 3DHVA 4I9GA 4LF4C 4DR7C 3E7WA 4JI0C 4B3MC 4RM3A 1Z4QA 4ZLPA 4NXMC 4DV2C 3N2QA 1PA4A 1XHJA 4DR1C 3TQIA 3FCCA 2HJGA 1IBMC 1VDKA 4D56A 4GXQA 4LFBC 3GR1A 4YHHC 2CXCA 3NO9A 2UU9C 4JM1A 1LCIA 1XMOC 2UUBC 2P02A 3GKUA 4ZJZA 4BBYA 2JNVA 2YV5A 4APBA 3CW9A 4L4QA 5BSWA 1RY2A 1HY0A 3PESA 3DAYA 3BWVA 2QW0X 4X64C 2OO4A 4K0BA 4L7IA 3G7SA 4YY3C 5KYTA 5D6BA 1TJ7A 1UWDA 1Q91A 2PTQA 3GZHA 1ULTA 3R9WA 4ADMA 4DCTA 4PZPA 4GKJC 4MWOA 3ETOA 3PROC 1V60A 3GPCA 2PT7G 1Z4LA 1YFMA 1XMQC 4JI6C 2E0GA 2I7DA 4OYCA 5F92A 1YJ7A 1FUGA 4G1IA 2CU6A 4HGVA 4YIHA 5IFIA 1PG3A 2BH1X 2D1QA 2VSQA 4MH4A 4TPSB 4D4IA 3UEBA 4NOZA
chains in the Genus database with same CATH topology
1XRBA 4DV5C 2D28C 2YWCA 1HR0C 3VNQA 3RG2A 3IEVA 2P2JA 1AMUA 4JI3C 4MTNA 4JI7C 5A19A 3GR0A 1USPA 2E5LC 4DUYC 2VQEC 4B3RC 1RG9A 3VNSA 2UUCC 3I07A 3VNRA 4G37A 5KYVA 3IEUA 4DR5C 2Y4OA 1MXBA 1N33C 3N54B 2E8EA 5IT9D 5JRHA 1HH2P 1BA3A 2E7GA 2QVXX 4K0KC 4LFAC 3B7WA 3H2TA 5AE3A 1L2FA 1HNZC 1IW7D 3RV2A 4GXRA 2ASBA 5K8FA 1MDFA 4DV7C 4B3TC 5A1GA 4BSZA 4BC9A 2Y27A 4LF8C 1O92A 1MXAA 4HPVA 5LMUC 4JI2C 1MD9A 3R9XA 3LNVA 1LQLA 2QVZX 4KTVA 1J5EC 3CJEA 2DPLA 5CZXA 1N32C 2WP0C 2UXBC 5IWAC 3NPDA 1QWIA 2D1TA 4DV3C 1O93A 3EERA 2P2QA 2D1SA 1T5DX 2F4VC 5T8SA 4X66C 4EATA 1N34C 3ETCA 1JOSA 1WH9A 1MDBA 4JI5C 2D7VA 4RM2A 3F4SA 3A4IA 4DR3C 5ADZA 4I9FA 3AF6A 3L95X 4PROC 4IR7A 3F4TA 2ATWA 5FLXD 2P2FA 5BUQA 1XRCA 4L2ZA 4WV3A 3DLPX 1V25A 2UXCC 1N2FA 4IZ6A 4ODJA 3LAXA 3NI2A 5KEIA 1KKGA 4D4GA 2HHHC 4XX2A 4X65C 2QVYX 4BCAA 1N36C 4D57A 4RLFA 4DUZC 2P2BA 3CW8X 2KZFA 3AF5A 4RVOA 3FCEA 5BR8C 4DV1C 1GPMA 4X62C 3IPLA 4R0MA 4DG9A 3EQ6A 5K85A 3A9VA 5GTDA 4KTTA 3SO4A 3UOWA 2OPLB 4PHTA 4WS9A 5H9UA 3JAMD 4OXIA 5BSUA 3C5EA 1ML8A 3E7XA 4JI1C 5A1IA 4DCSA 5AE1A 1XNQC 3KXWA 4DR6C 4JYAC 2CY1A 5BSTA 5DV9A 4KHPC 3A9UA 2EGTA 3UZ0A 4U5YD 2JMPA 3I08A 4DV4C 4ISBA 5BURA 3TUFA 1T5HX 1O9TA 3T1YC 1IBKC 4NXNC 4G36A 2ZM6C 1XRAA 2P2MA 4DR4C 4LF6C 2OPLA 2YWBA 4B3SC 2AYAA 2XR1A 1O90A 4FTFA 4DCUA 1ZB8A 3TDEA 5A2QD 1IBLC 5LMNC 3J80D 4AQYC 1I94C 1UKKA 5E7QA 4BC7A 5AE2A 1VLAA 2VZEA 4DG8A 3LGXA 2Y4NA 2QL8A 4RVNA 3S82A 1PG4A 4LFCC 4NDNA 3LUSA 2VQFC 5BSRA 3PBKA 4JI4C 3F4RA 4DCVA 4JI8C 4OX9C 2E8FA 2D1RA 1MXCA 3NYRA 4GS5A 1HNXC 1QM4A 1EGAA 1P7LA 4FUTA 4DV0C 2ONFA 3R44A 5BSMA 3NYQA 4FUQA 2UUAC 2OBVA 2DYJA 1HNWC 3L8CA 2P20A 1USPB 1K0RA 1WF3A 2WD9A 4JV5C 5BSVA 4RLQA 4GKKC 2E8CA 3OTOC 4DV6C 4LF9C 4LE5A 2YCBA 5CZVA 3IMLA 2PN2A 4RMNA 5T8TA 3J81D 4IQJM 1V26A 1XNRC 2BJOA 2PROA 1ZB9A 4LF7C 3T1HC 1MKYA 4LF5C 1FJGC 2D27A 4R1LA 2V7BA 1NYEA 5BUSA 4DR2C 4R1MA 2UXDC 3DHVA 4I9GA 4LF4C 4DR7C 3E7WA 4JI0C 4B3MC 4RM3A 4ZLPA 4NXMC 4DV2C 3N2QA 1PA4A 4DR1C 3TQIA 3FCCA 2HJGA 1IBMC 4D56A 4GXQA 4LFBC 3GR1A 4YHHC 2CXCA 2UU9C 4JM1A 1LCIA 1XMOC 2UUBC 2P02A 3GKUA 4ZJZA 4BBYA 4L4QA 3CW9A 5BSWA 1RY2A 3PESA 3DAYA 2QW0X 4X64C 2OO4A 4K0BA 4L7IA 3G7SA 4YY3C 5KYTA 1ULTA 3R9WA 4DCTA 4PZPA 4GKJC 3ETOA 3PROC 3GPCA 2PT7G 1XMQC 4JI6C 2E0GA 4OYCA 1YJ7A 1FUGA 4G1IA 5IFIA 1PG3A 2BH1X 2D1QA 2VSQA 4MH4A 4TPSB 4D4IA 4NOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PHT A;  2D27 A;  2BH1 X;  2D28 C; 
#chains in the Genus database with same CATH topology
 1TJV A;  1XRB A;  1FUP A;  4DV5 C;  4EFC A;  1TJW A;  2D28 C;  2YWC A;  1HR0 C;  3VNQ A;  3RG2 A;  2JAU A;  2PFM A;  3IEV A;  2P2J A;  1AMU A;  4JI3 C;  4MTN A;  4PUG A;  4JI7 C;  5A19 A;  2JAO A;  3GR0 A;  1USP A;  2E5L C;  4DUY C;  4L6C A;  2VQE C;  1KQ7 A;  4B3R C;  3OCE A;  1RG9 A;  3AY0 A;  3VNS A;  2UUC C;  3I07 A;  3VNR A;  3U13 A;  4G37 A;  5KYV A;  3IEU A;  4DR5 C;  1P4E C;  2Y4O A;  1MXB A;  1N33 C;  3N54 B;  2E8E A;  5IT9 D;  5JRH A;  1HH2 P;  1BA3 A;  2E7G A;  2QVX X;  4K0K C;  4LFA C;  3B7W A;  3LNO A;  3H2T A;  5AE3 A;  1Z4J A;  3CI0 K;  1L2F A;  1HNZ C;  1IW7 D;  3E04 A;  3RV2 A;  2M5O A;  4GXR A;  2ASB A;  5K8F A;  3BHG A;  1MDF A;  4DV7 C;  4B3T C;  5A1G A;  4BSZ A;  2MMA B;  4BC9 A;  2Y27 A;  4LF8 C;  2PTR A;  1O92 A;  1MXA A;  4HPV A;  5LMU C;  1Z4P X;  4JI2 C;  1MD9 A;  5HW2 A;  3R9X A;  1U15 A;  3LNV A;  1J3U A;  1LQL A;  2QVZ X;  2ZZN A;  3R6V A;  4KTV A;  1J5E C;  3CJE A;  1M6X A;  4NFL A;  2DPL A;  5CZX A;  1N32 C;  2WP0 C;  2UXB C;  5IWA C;  3NPD A;  1QWI A;  2D1T A;  4DV3 C;  1O93 A;  3EER A;  2QGA B;  2D1S A;  2P2Q A;  3A26 A;  1T5D X;  2F4V C;  5T8S A;  4X66 C;  4EAT A;  1N34 C;  3ETC A;  1JOS A;  1WH9 A;  1MDB A;  4JI5 C;  2D7V A;  4RM2 A;  3F4S A;  1TH5 A;  3A4I A;  4DR3 C;  1Z4I A;  4EEI A;  3U19 A;  5ADZ A;  1Z4M A;  4I9F A;  3AF6 A;  3L95 X;  4PRO C;  4IR7 A;  3F4T A;  1IB8 A;  2KZ0 A;  2ATW A;  5FLX D;  3CQ3 A;  2P2F A;  5BUQ A;  1XRC A;  4L2Z A;  1P4E A;  1Q92 A;  4WV3 A;  3DLP X;  1V25 A;  4YIK A;  2UXC C;  1AUW A;  1N2F A;  4IZ6 A;  4ODJ A;  3LAX A;  2M5H A;  2HVG A;  3NI2 A;  5KEI A;  1KKG A;  2KDN A;  4D4G A;  2HHH C;  4XX2 A;  4X65 C;  2QVY X;  4BCA A;  1N36 C;  4D57 A;  4RLF A;  4DUZ C;  2P2B A;  1WCJ A;  3CW8 X;  2KZF A;  3O2E A;  3AF5 A;  4RVO A;  3FCE A;  2RCN A;  5BR8 C;  4DV1 C;  1GPM A;  4X62 C;  3QBP A;  3IPL A;  4R0M A;  4DG9 A;  2ZZM A;  2MCQ A;  3EQ6 A;  4PUH A;  2Z51 A;  5K85 A;  3A9V A;  3RRP A;  5GTD A;  4KTT A;  3SO4 A;  1Z4K A;  3UOW A;  1FUQ A;  2OPL B;  3CQ2 A;  4PHT A;  1K7W A;  4L57 A;  4WS9 A;  5H9U A;  3JAM D;  4OXI A;  5BSU A;  3C5E A;  1ML8 A;  1FUO A;  3E7X A;  4JI1 C;  1NY8 A;  5A1I A;  4DCS A;  5AE1 A;  1FLO A;  3A25 A;  1XNQ C;  3R6Q A;  3KXW A;  4DR6 C;  1PU1 A;  4JYA C;  2CY1 A;  5BST A;  5DV9 A;  4KHP C;  3A9U A;  2EGT A;  3UZ0 A;  4U5Y D;  1TJU A;  2JMP A;  3I08 A;  4DV4 C;  4NSL A;  4ISB A;  5BUR A;  3TUF A;  1T5H X;  1O9T A;  3T1Y C;  4E88 A;  1IBK C;  4NXN C;  4G36 A;  2ZM6 C;  1YFE A;  3C8T A;  1XRA A;  2P2M A;  4DR4 C;  4LF6 C;  2PTS A;  2JAR A;  1T9H A;  2OPL A;  2YWB A;  1U0L A;  4B3S C;  2AYA A;  2XR1 A;  2MM9 A;  1O90 A;  1FUR A;  4FTF A;  4DCU A;  1ZB8 A;  3TDE A;  5A2Q D;  1IBL C;  1VEH A;  5LMN C;  3J80 D;  1C3U A;  4AQY C;  1HY1 A;  2NCL A;  3TV2 A;  1I94 C;  1UKK A;  5E7Q A;  4BC7 A;  5AE2 A;  4MX2 A;  1VLA A;  3UX2 A;  2E9F A;  2VZE A;  4DG8 A;  1DOF A;  3LGX A;  1DCN A;  2Y4N A;  1MH9 A;  2QL8 A;  1C3C A;  4RVN A;  3S82 A;  1PG4 A;  4LFC C;  4NDN A;  3LUS A;  2VQF C;  1XWO A;  5BSR A;  3PBK A;  3GTD A;  4JI4 C;  3F4R A;  4DCV A;  3UX3 A;  4JI8 C;  2E8F A;  4OX9 C;  5F91 A;  3TR3 A;  2D1R A;  1MXC A;  3NYR A;  4GS5 A;  1U16 A;  1HNX C;  1QM4 A;  1EGA A;  1P7L A;  4FUT A;  4DV0 C;  3OCF A;  1XS3 A;  2ONF A;  3R44 A;  5BSM A;  3NYQ A;  4FUQ A;  2UUA C;  2DYJ A;  2OBV A;  3RD8 A;  1HNW C;  3L8C A;  3K6R A;  2P20 A;  1I0A A;  1USP B;  1K0R A;  1WF3 A;  2WD9 A;  4JV5 C;  4L6A A;  5BSV A;  4RLQ A;  4GKK C;  2E8C A;  3OTO C;  4DV6 C;  5LCI A;  1RE5 A;  4LF9 C;  4LE5 A;  2YCB A;  2YX1 A;  5CZV A;  3IML A;  2PN2 A;  4RMN A;  3CQ1 A;  4MUM A;  5T8T A;  2FUS A;  4ADL A;  4APA A;  3J81 D;  4IQJ M;  2JAW A;  1V26 A;  1Q5N A;  1XNR C;  2BJO A;  2PRO A;  1ZB9 A;  4LF7 C;  3T1H C;  1MKY A;  1K62 A;  4PUI A;  4LF5 C;  2DHM A;  1FJG C;  2D27 A;  4R1L A;  2V7B A;  1M6X C;  1NYE A;  5BUS A;  1JSW A;  4R1M A;  4DR2 C;  4NLE A;  2X75 A;  2UXD C;  3DHV A;  4I9G A;  4LF4 C;  4DR7 C;  3E7W A;  4JI0 C;  4B3M C;  4RM3 A;  1Z4Q A;  4ZLP A;  4NXM C;  4DV2 C;  3N2Q A;  1PA4 A;  1XHJ A;  4DR1 C;  3TQI A;  3FCC A;  2HJG A;  1IBM C;  1VDK A;  4D56 A;  4GXQ A;  4LFB C;  3GR1 A;  4YHH C;  2CXC A;  3NO9 A;  2UU9 C;  4JM1 A;  1LCI A;  1XMO C;  2UUB C;  2P02 A;  3GKU A;  4ZJZ A;  4BBY A;  2JNV A;  2YV5 A;  4APB A;  3CW9 A;  4L4Q A;  5BSW A;  1RY2 A;  1HY0 A;  3PES A;  3DAY A;  3BWV A;  2QW0 X;  4X64 C;  2OO4 A;  4K0B A;  4L7I A;  3G7S A;  4YY3 C;  5KYT A;  5D6B A;  1TJ7 A;  1UWD A;  1Q91 A;  2PTQ A;  3GZH A;  1ULT A;  3R9W A;  4ADM A;  4DCT A;  4PZP A;  4GKJ C;  4MWO A;  3ETO A;  3PRO C;  1V60 A;  3GPC A;  2PT7 G;  1Z4L A;  1YFM A;  1XMQ C;  4JI6 C;  2E0G A;  2I7D A;  4OYC A;  5F92 A;  1YJ7 A;  1FUG A;  4G1I A;  2CU6 A;  4HGV A;  4YIH A;  5IFI A;  1PG3 A;  2BH1 X;  2D1Q A;  2VSQ A;  4MH4 A;  4TPS B;  4D4I A;  3UEB A;  4NOZ A; 
#chains in the Genus database with same CATH homology
 1XRB A;  4DV5 C;  2D28 C;  2YWC A;  1HR0 C;  3VNQ A;  3RG2 A;  3IEV A;  2P2J A;  1AMU A;  4JI3 C;  4MTN A;  4JI7 C;  5A19 A;  3GR0 A;  1USP A;  2E5L C;  4DUY C;  2VQE C;  4B3R C;  1RG9 A;  3VNS A;  2UUC C;  3I07 A;  3VNR A;  4G37 A;  5KYV A;  3IEU A;  4DR5 C;  2Y4O A;  1MXB A;  1N33 C;  3N54 B;  2E8E A;  5IT9 D;  5JRH A;  1HH2 P;  1BA3 A;  2E7G A;  2QVX X;  4K0K C;  4LFA C;  3B7W A;  3H2T A;  5AE3 A;  1L2F A;  1HNZ C;  1IW7 D;  3RV2 A;  4GXR A;  2ASB A;  5K8F A;  1MDF A;  4DV7 C;  4B3T C;  5A1G A;  4BSZ A;  4BC9 A;  2Y27 A;  4LF8 C;  1O92 A;  1MXA A;  4HPV A;  5LMU C;  4JI2 C;  1MD9 A;  3R9X A;  3LNV A;  1LQL A;  2QVZ X;  4KTV A;  1J5E C;  3CJE A;  2DPL A;  5CZX A;  1N32 C;  2WP0 C;  2UXB C;  5IWA C;  3NPD A;  1QWI A;  2D1T A;  4DV3 C;  1O93 A;  3EER A;  2P2Q A;  2D1S A;  1T5D X;  2F4V C;  5T8S A;  4X66 C;  4EAT A;  1N34 C;  3ETC A;  1JOS A;  1WH9 A;  1MDB A;  4JI5 C;  2D7V A;  4RM2 A;  3F4S A;  3A4I A;  4DR3 C;  5ADZ A;  4I9F A;  3AF6 A;  3L95 X;  4PRO C;  4IR7 A;  3F4T A;  2ATW A;  5FLX D;  2P2F A;  5BUQ A;  1XRC A;  4L2Z A;  4WV3 A;  3DLP X;  1V25 A;  2UXC C;  1N2F A;  4IZ6 A;  4ODJ A;  3LAX A;  3NI2 A;  5KEI A;  1KKG A;  4D4G A;  2HHH C;  4XX2 A;  4X65 C;  2QVY X;  4BCA A;  1N36 C;  4D57 A;  4RLF A;  4DUZ C;  2P2B A;  3CW8 X;  2KZF A;  3AF5 A;  4RVO A;  3FCE A;  5BR8 C;  4DV1 C;  1GPM A;  4X62 C;  3IPL A;  4R0M A;  4DG9 A;  3EQ6 A;  5K85 A;  3A9V A;  5GTD A;  4KTT A;  3SO4 A;  3UOW A;  2OPL B;  4PHT A;  4WS9 A;  5H9U A;  3JAM D;  4OXI A;  5BSU A;  3C5E A;  1ML8 A;  3E7X A;  4JI1 C;  5A1I A;  4DCS A;  5AE1 A;  1XNQ C;  3KXW A;  4DR6 C;  4JYA C;  2CY1 A;  5BST A;  5DV9 A;  4KHP C;  3A9U A;  2EGT A;  3UZ0 A;  4U5Y D;  2JMP A;  3I08 A;  4DV4 C;  4ISB A;  5BUR A;  3TUF A;  1T5H X;  1O9T A;  3T1Y C;  1IBK C;  4NXN C;  4G36 A;  2ZM6 C;  1XRA A;  2P2M A;  4DR4 C;  4LF6 C;  2OPL A;  2YWB A;  4B3S C;  2AYA A;  2XR1 A;  1O90 A;  4FTF A;  4DCU A;  1ZB8 A;  3TDE A;  5A2Q D;  1IBL C;  5LMN C;  3J80 D;  4AQY C;  1I94 C;  1UKK A;  5E7Q A;  4BC7 A;  5AE2 A;  1VLA A;  2VZE A;  4DG8 A;  3LGX A;  2Y4N A;  2QL8 A;  4RVN A;  3S82 A;  1PG4 A;  4LFC C;  4NDN A;  3LUS A;  2VQF C;  5BSR A;  3PBK A;  4JI4 C;  3F4R A;  4DCV A;  4JI8 C;  4OX9 C;  2E8F A;  2D1R A;  1MXC A;  3NYR A;  4GS5 A;  1HNX C;  1QM4 A;  1EGA A;  1P7L A;  4FUT A;  4DV0 C;  2ONF A;  3R44 A;  5BSM A;  3NYQ A;  4FUQ A;  2UUA C;  2OBV A;  2DYJ A;  1HNW C;  3L8C A;  2P20 A;  1USP B;  1K0R A;  1WF3 A;  2WD9 A;  4JV5 C;  5BSV A;  4RLQ A;  4GKK C;  2E8C A;  3OTO C;  4DV6 C;  4LF9 C;  4LE5 A;  2YCB A;  5CZV A;  3IML A;  2PN2 A;  4RMN A;  5T8T A;  3J81 D;  4IQJ M;  1V26 A;  1XNR C;  2BJO A;  2PRO A;  1ZB9 A;  4LF7 C;  3T1H C;  1MKY A;  4LF5 C;  1FJG C;  2D27 A;  4R1L A;  2V7B A;  1NYE A;  5BUS A;  4DR2 C;  4R1M A;  2UXD C;  3DHV A;  4I9G A;  4LF4 C;  4DR7 C;  3E7W A;  4JI0 C;  4B3M C;  4RM3 A;  4ZLP A;  4NXM C;  4DV2 C;  3N2Q A;  1PA4 A;  4DR1 C;  3TQI A;  3FCC A;  2HJG A;  1IBM C;  4D56 A;  4GXQ A;  4LFB C;  3GR1 A;  4YHH C;  2CXC A;  2UU9 C;  4JM1 A;  1LCI A;  1XMO C;  2UUB C;  2P02 A;  3GKU A;  4ZJZ A;  4BBY A;  4L4Q A;  3CW9 A;  5BSW A;  1RY2 A;  3PES A;  3DAY A;  2QW0 X;  4X64 C;  2OO4 A;  4K0B A;  4L7I A;  3G7S A;  4YY3 C;  5KYT A;  1ULT A;  3R9W A;  4DCT A;  4PZP A;  4GKJ C;  3ETO A;  3PRO C;  3GPC A;  2PT7 G;  1XMQ C;  4JI6 C;  2E0G A;  4OYC A;  1YJ7 A;  1FUG A;  4G1I A;  5IFI A;  1PG3 A;  2BH1 X;  2D1Q A;  2VSQ A;  4MH4 A;  4TPS B;  4D4I A;  4NOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...