4L6AA

Structure of human mitochondrial 5'(3')-deoxyribonucleotidase
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
201
structure length
201
Chain Sequence
SNAASGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of human cytosolic and mitochondrial nucleotidases: implications for structure-based design of selective inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords 5'(3')-deoxyribonucleotidase, mitochondrial
total genus 68
structure length 201
sequence length 201
ec nomenclature ec 3.1.3.-:
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4l6aA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4l6aA01
4Y2QA 4Y2JA 5T41A 1L7OA 5ALOA 2Q4TA 4DCCA 1YMQA 1ZJJA 4BYGA 2GFHA 5ALNA 2GO7A 2R8YA 3ET4A 5JJBA 2RB5A 4ZEWA 2G09A 4Y2UA 5AM1A 3OCWA 3L1UA 3ESQA 4KX5A 2YMMA 3D6JA 2CFTA 2WM8A 5ALUA 1RLMA 3DAOA 3B9BA 2YJ3A 5IS2A 1Y8AA 3A1CA 3QU4A 2P9JA 1RQLA 2HX1A 1TJ4A 3ZUPA 5AKHA 3FZQA 3E58A 2OM6A 4H1WA 3DNPA 3B8EA 2FUEA 2WF6A 4KNVA 4OD0A 3QUQA 3FPSA 3L8HA 4KNWA 3EF0A 5AVQA 1RPZA 3R9KA 5ALGA 4NFLA 1Z4NA 3L0CA 2RAVA 1F5SA 5AICA 1XPJA 3QUBA 2ZOSA 1O03A 4YCLA 5AVZA 3QUTA 3VAYA 4B6JA 2C4NA 3NALA 4UU1A 5AVSA 2X4DA 2YJ4A 2HF2A 3ZW7A 1NNLA 5AI0A 5AIAA 4CNQA 1Z5UA 3WKEA 2IOFK 3IB6A 4G9BA 2I34A 5AW9A 3SHQA 3U26A 1QYIA 3EWIA 2OYCA 3DV9A 4UMVA 1RKUA 3FGOA 1ZD2P 4DWOA 3WKCA 5AVXA 3A1EA 5IT0A 2FPRA 2ODAA 3RF6A 2MSNA 2JGAA 3ET5A 5AW8A 3NUQA 4XQ0A 3AR6A 3OCYA 1S2OA 1Z4JA 2YJ6A 4C4RA 4UMDA 1Q92A 3MMZA 3CZ4A 4BNDB 5AM3A 1QQ7A 4E88A 4PNHA 5AKIA 2PKEA 3J7TA 3M1YA 4J2TA 1WR8A 4UATA 4IG4A 3WKBA 5AK4A 2NO4A 1Z88A 2QYHA 3PDWA 2OA0A 4NV0A 2BDUA 3W5AA 2G06A 4L57A 2OBBA 3QU2A 3NASA 3ZX4A 2FEAA 3EF1A 4EX7A 3W5DA 1ZD4A 4JDPA 4Y2YA 5ALRA 3L5KA 1K1EA 2O2XA 3UMGA 3L8FA 5AESA 1QQ6A 1U7OA 1Q91A 4NABA 1LVHA 3M9LA 4O8CA 2P11A 1U7PA 3GYGA 4MWOA 5AK5A 5ALIA 1XP5A 4C4TA 4DFDA 1T5TA 1T9ZA 3QU7A 1U2TA 2YFYA 4QQFA 2ZBDA 5ALHA 4XOUA 2RARA 3I1YA 3PGVA 4HGOA 4IFTA 2WF9A 4EELA 3I28A 2G1AA 1Z4PX 3FVVA 4OCZA 5ALJA 1ZRNA 2P27A 5AW2A 1L8LA 3AR7A 4HGRA 3L7YA 3DDHA 4GIBA 1RMTA 1ZRMA 1NF2A 5AW5A 5AVUA 3CNHA 4XE5A 4UAVA 1Z4IA 3AR3A 4EX6A 1U2SA 1YNSA 4YCNA 2FPUA 4AS2A 3N5KA 2AGVA 2HSZA 5AVTA 5ALFA 1TA0A 4L6AA 2YBDA 3ZTYA 2R8ZA 4YCMA 4UU0A 1PW5A 2YN4A 2HEGA 2HI0A 3FM9A 1YV9A 1RKQA 2G80A 2W4MA 5AKEA 5AI9A 3SMVA 4DW8A 3AR8A 3ESRA 4FE3A 3SD7A 5AVRA 1VFPA 2PR7A 2W11A 3NIWA 1RLTA 2ZG6A 4FYPA 2B82A 2C9MA 1RMYA 5ALYA 5AW4A 2JARA 3E81A 2WF8A 3MPOA 4UMEA 3U19A 5ALWA 4OFZA 4Y3UA 5AKYA 4F71A 4EENA 5AI5A 3N1UA 5AM0A 3UMBA 3BWVA 2PQ0A 3TLMA 2B8EA 3HYCA 1J97A 2Q5EA 3KZXA 4CF3A 2BY4A 1RKVA 4BBJA 2EARA 3E84A 5AW7A 2ZXEA 1RLOA 4Y2PA 5AI6A 3ED5A 4RETA 3F9RA 5AKLA 1CR6A 2Q4RA 5A3RA 4BEVA 1RDFA 2CFRA 3QYPA 5ALTA 1L7PA 4KN8A 2QLTA 3PGLA 4FFDA 5ALXA 3KD3A 3N28A 2WF7A 3OCXA 3U7HB 3OCVA 5ALPA 3FPBA 3WK7A 2HF7A 2HCFA 1LTQA 5ALVA 4HYTA 4J03A 2B30A 2B1RA 2ZBGA 4QJBA 4I9FA 5ALLA 4RESA 4UMFA 5ALSA 4UASA 3SKXA 2I33A 3ZWDA 3N07A 3S6JA 2NO5A 4HAIA 1N9KA 3QNMA 4Y2TA 3WK8A 3ONNA 1YS9A 3A1DA 5ALDA 1XVIA 2R8EA 4C4SA 3R09A 2WFAA 2I54A 3WK5A 2ZBFA 4I9GA 5AM5A 2YJ5A 4ZEXA 3L8EA 3AR4A 3WKAA 4YIKA 5AIBA 3ZX5A 2GHTA 3E8MA 4CE6A 2IYEA 1IWOA 4EZEA 2YMQA 2R8XA 3KOOA 2HO4A 4BX2A 2FI1A 3EPRA 1Z4QA 4NWIA 1RMQA 1J8DA 4GXTA 5AVVA 3WGUA 5A3SA 3I6BA 5AW6A 3L0BA 5AKKA 5AW1A 5AKXA 3OCUA 1X42A 2WHEA 5AW0A 1ZS9A 2FPXA 4UM5A 2I55A 2G08A 5AKJA 1CQZA 2C8KA 2CN1A 2B8JA 3ZI4A 1Z4LA 1TJ3A 3RFUA 3A3YA 3QGMA 1SWWA 2YMLA 2G07A 2AUTA 4G63A 3P96A 3ZTWA 5FP0A 1TJ5A 3QX7A 2IOFA 2EAUA 3AR5A 3W5CA 4AS3A 5AK3A 3ZWKA 4BKMA 1ZD3A 2IA5A 2G0AA 5AVWA 2B1QA 4JB3A 1Z4KA 1S8OA 5ALMA 3SKYA 3SF0A 1QH9A 2FPWA 3W5BA 2IOHA 5ALKA 3ZU6A 4YH1A 3KC2A 2O9JA 4BNDA 1KYTA 2WF5A 2JAUA 2DQSA 3QXGA 3R4CA 1YDFA 1WZCA 5AHXA 3L0YA 2ZBEA 4HGPA 4BX3A 3IRUA 3OCZA 1N8NA 4AP9A 4UARA 2HHLA 1L7NA 3UMCA 4Y2SA 3NANA 3SLRA 4EEKA 5AI4A 3NAMA 4Y2VA 2YMPA 1RC8A 4Y2XA 4BX0A 1L7MA 2HOQA 3KDPA 3ZVNA 2VKQA 3ZVLA 2P69A 3ZVMA 1Z4MA 1YJ5A 3AR2A 1SWVA 2C88A 5AK6A 5AVYA 2EATA 4YIHA 1EK2A 1FEZA 2D2VA 2JAOA 2YY6A 4CF4A 2I7DA 5E0OA 3HLTA 1EK1A 4L6CA 1ZOLA 4XPZA 3WGVA 5AKGA 2AMYA 3QU5A 5AI8A 1U02A 4KYTA 2I6XA 4BEWA 3L1VA 3U13A 4UM7A 2CFSA 5A3QA 3QLEA 1AQ6A 4HGNA 3L8GA 2NYVA 5IT4A 1O08A 3AR9A 1Z4OA 3U7EB 1QQ5A 2B0CA 1MH9A 3UM9A 2JAWA 2RBKA 5ALQA 4ZEVA 2GHQA 4NAVA 2HDOA 5AM2A 3IJ5A 3WKDA 4HGQA 1ZD5A 3WK9A 2C8LA 3BA6A 3QU9A 5ALEA 3U7FB 1Z5GA 3OPXA 3WK4A 5AKZA 1JUDA 2GMWA 2FPSA 4KX3A 1T5SA 1WVIA 5ALZA 3WK6A 4YGYA 3K1ZA 3I76A 2W43A 4CF5A 2FDRA 3MC1A 1RRCA 3KBBA 1L6RA 4OHFA 4F72A 4UW9A 3NRJA 1WPGA 1L8OA 3B9RA 1NRWA 5AM4A 1SU4A 1VJRA 2FUCA 3QUCA 3PCTA 1VJ5A 2MU1A 4MUMA 2AH5A 3OTQA 2BDEA 4UAUA 5AW3A 1TE2A 3U7GA 4Y2RA 3N8GA 3MN1A 1RQNA
chains in the Genus database with same CATH superfamily
3ZZ0A 5L7TA 1F0YA 1I1OA 2BBOA 5I5GA 3R7SA 1MOSA 3AETB 3NAGA 2JF0A 2ODWA 1GITA 3T7DA 5J4LA 5JVDA 4BYGA 4KFUA 5EKSA 4BB5A 4ZYWA 1IULA 5GZ6A 4K0RA 1IUOA 2KHZA 4RACA 1L5FA 3VYWA 4A16A 1RWXA 4TN1A 1YQQA 4EHAA 4NSLA 1ZICA 4KQIA 4MWTA 1UIMA 3GZNA 2RAFA 5CYPA 4YRRA 1MG5A 3ZKAA 1IQRA 3DXZA 4NQRA 1NVAA 2OXRA 3PNBA 3MFYA 3VYVA 4Z5XA 2C9DA 2HLPA 1CDOA 3CQ9A 5L8VA 1GAEO 3ADCA 2WUVA 2YC4C 2GO1A 2HMYB 2YZ7A 4NBWA 4B0PA 4OF4A 4XX0B 5LQCA 1Q0SA 2XA2A 3LVFO 4FLFA 4NK4A 4BJ3A 1A7KA 1Z56C 3IALA 3N2KA 1E2KA 4GXRA 3HUEA 1OB2A 4ZK2A 4HHEA 3ZUPA 1RJFA 1HDCA 3FUVA 3D4OA 2AYXA 3LWDA 7YASA 4FDMA 3D4LA 4Z0TA 3EGEA 1ZLYA 2YOFA 1Z5OA 4OYLA 2DR3A 3SGLA 1SUPA 1U81A 4YAKA 4JHXA 3F5DA 3L7BA 3WRYC 4DNQA 3E9DA 2IY7A 2R9VA 1E1KA 4Z6KA 1Z4NA 2B7LA 3JYOA 4MVJM 4LJSA 5DIFA 1PX2A 5SZIA 5FWYA 4O4LF 2J9FB 4KVFA 3L41A 1BW9A 5AICA 2FP4B 3SJBA 4DCUA 5F5LA 4W5RA 2QVYX 5BP7A 2ZOSA 3HFSA 4X20B 1VLJA 1VXOA 5KOHA 5ITWA 4A1OA 3G2MA 1XZNA 2XHZA 1UT8A 2Y1CA 2G7ZA 4A36A 5BW5A 2X0NA 3ZHSA 2WYWA 4OLHA 4K6GA 2GAJA 2HVGA 1CP3A 3ZQKA 2VJCA 2B3DA 4UDOA 3PQ4A 4O3FA 3VPSA 2O5CA 3RIMA 2W8BB 4G9BA 3K9FC 1J33A 4M8NE 1XVVA 1CG6A 3TNFA 4DBZA 1PK8A 4YJHB 2PS9A 1NOKA 2XE4A 4GM0A 1K7CA 3T5TA 1BDMA 1JWLA 1E69A 4FYHA 3E9EA 3GDOA 4XSGA 4RFSA 5FI5A 4TLBA 5HKAA 4KE6A 1KBZA 3A1EA 2VYND 3CZ5A 5ESXA 1ZH0A 2A33A 1IN8A 1THZA 4R0VA 3PQ6A 2BMWA 3CC8A 1EI9A 5MFPA 3DKIA 2F1KA 4CUKA 4YT4A 2AXEA 2GCEA 3KWMA 2NYAA 2ZRGA 1YL6A 2E4VA 1J3UA 1UPTA 4FGKA 2R6JA 1IOWA 1XUOA 4U6NA 4YWHA 3DONA 4DV5B 1P0PA 1PNOA 2RGWA 1I2ZA 2ONJA 4MS3A 1ZCAA 1VG0B 3BA1A 5JWRA 5HRCA 4LHEA 4V2UA 1BE0A 4HN4B 4ZGGA 5IJ0B 2QM0A 4X8OA 4EUKA 1DAOA 1EFVA 3NT4A 5DX1A 3ORQA 1MH1A 1I4WA 3QFCA 1A98A 4Q00A 5KKNB 5C31A 5IAOA 1BMFD 4NJMA 1MZPA 3MGCA 3FX2A 2YL2A 2EGUA 3VR2A 1KI6B 4JNKA 5JXIA 2X0EA 1QWSA 3FWHA 1D2MA 2KM1A 1PT6A 2W70A 5JZ9A 2C3UA 1L5ZA 1VBFA 2G04A 4JDPA 3LSTA 4YJ3B 2ZFUA 3CYFA 1QGYA 4UDNA 3U3MA 1FVHA 1WXIA 3OUZA 1ZC4A 2AF3C 3KLPX 1XALA 1V7CA 1YRQA 1FRQA 3DBRB 3FSRA 2COEA 1IHYA 2BCEA 3HCEA 2PIDA 4YPFA 2RH4A 3E5MA 4OA5A 1N3IA 3AUYA 1X74A 2H4YA 1KMIY 4LAFA 4E5UA 5B6JA 5BXQC 4BMXA 5BWNA 4HQNA 4QFBA 4B7ZA 3CPJB 4C4TA 1W87A 1RPTA 1XCGB 3PFKA 3IUYA 3RRYA 3GLHE 3AUXA 3TDKA 4B3XA 3T3OA 3HHEA 3LUHA 5FB3A 1UL1X 2GASA 2W83A 3B5IA 5JDCA 3RM3A 3BD9A 4YP6A 4ZYLA 1VCOA 3DVLA 3U9LA 2QMEA 3SR4A 1WMBA 2Z58A 3S0JA 3GFPA 5JFGA 1GKYA 1A27A 1OFVA 2CHQA 3VR4A 4OP2A 1U7UA 4KE8A 2F90A 2GKGA 3Q3GE 4PZUA 3GLGA 2OGWA 4KHPB 1RCFA 5AJXA 1DV1A 1SEVA 2KBFA 3TZQA 5KSZA 5J2TB 2IS2A 2LPMA 3KKOA 1D09A 4GL4A 4Q1AA 5EMKA 5LWQA 3DXYA 3OZFA 2CK3A 2IC5A 3AF1A 4JGGA 1IATA 5L3RA 3G5AA 1TOAA 2WG0A 3AG5A 1QGZA 5FO1A 2HHAA 2I3GA 4G5XA 3CLRC 4TTPA 5GZ3A 2H5IA 3K5PA 3ZDCA 2ZIEA 1GNLA 3AIMA 2JD0A 3R0VA 4MVJI 5C37A 3O3OB 4Q9NA 4YAEA 4CUZA 5HK9A 3PITA 4GRDA 4UUNA 3ZXIA 4HQOA 3HNRA 4B6OA 1JH8A 4JYCA 4P22A 4UDYX 3ZTYA 4LY3A 3RIEA 2PUGA 4NR0A 1VGRA 1H4VB 4I4NA 1LFAA 4H59A 4DA9A 5JYDA 1QTIA 1OLSA 3JRNA 5E1MA 5TPWA 2G83A 3H11B 4LV5B 2QRGA 3WNDA 1P2BA 2YXBA 3AFOA 2O59A 4X24A 3CWCA 1QXSA 1ZXLA 4NFYA 4OK5A 1S8FA 3EXFB 5DU2A 3SD7A 5HZHA 5JS7A 1FW6A 2PUEA 1G20B 2XYPA 3B9PA 2R8PA 3CSUA 3QE2A 4PZ9A 5FUXA 4EVRA 4RO0A 1N6KA 1UH5A 3LO5A 3ZWBA 5C53B 2F7SA 3G8CA 1TLTA 2O06A 3UJ3X 4NATA 3PC4A 4QA9A 1E9DA 5KWEA 4YREA 3CKYA 5LP1A 3AMVA 5CJ2A 2FPPA 1EK0A 4D9EA 3TW8A 4EH1A 4EW2A 3S2EA 4ZQIA 1NJ1A 1H5NA 5BSUA 5B7QA 1SO8A 1TO6A 1YJCA 3IMKA 5EMJA 3IO3A 2C4HA 2KMLA 1H1DA 5BSGA 3TLMA 4BFTA 3BCHA 2QVBA 3FSJX 3DL0A 3VDNB 4JUAA 4A0FA 3ZD9A 3A9UA 5IMSA 4X00A 5K3SA 1J2YA 1U28A 2D74A 1LQ2A 2TYSB 2ZRHA 2ZUSA 3F9RA 3MELA 1JKJB 4H7FA 2E6UX 2F1IA 2O0HA 4RY9A 3RD5A 4UFPA 5LZ5A 1Y4DE 1ST3A 3KETA 1DQRA 4RD1A 4C0KA 4WJLA 1B6SA 1KY4A 1HYHA 4CL8A 4E94A 1DKNA 1CY1A 3PYLA 1WDMA 1QHFA 4EHJA 1T8TA 4EF6A 2POCA 1E89A 2BM9A 2YJZA 1X8LA 4HLQB 4Z4FA 4C88A 3CLTC 4ECEA 3AUJB 4AG6A 5DE3A 3U3KA 1Y8CA 3MJFA 2QLTA 1ND5A 3OU7A 2EU8A 3PDHA 4ALIA 4G0MA 1D4AA 1AH2A 3OICA 3TAHA 4Y6PA 4KQ6A 1RRGA 4QX6A 2HWWA 1L5RA 1TW2A 3TMYA 2GBLA 2HJWA 2XR1A 3HRKA 2GN4A 1G4AE 5JT1A 1X1EA 1E4OA 3FPGA 3B1YA 3PWSA 1CE8A 5EZYA 1NR5A 4R83A 3U44A 1JSRA 3ED1A 5EESA 2OCBA 1P8JA 3DT6A 4OEHA 3OPYB 4G84A 2VBGA 3LY7A 5HILA 1YQ9A 3L79A 3OA2A 3VNRA 4B09A 2YVUA 5CEEA 4RTNA 4GVPA 3OSUA 2YJTD 2J45A 3WIBA 2I33A 1WHSB 3NP7A 2B92A 4A0QA 1B0ZA 3VISA 2VK2A 3HDHA 2CXSA 1XXLA 2FCAA 2O3RA 3EFOA 5A7GA 3ZD8A 1I4OA 1CUWA 1SXJB 4MQUA 2BAGA 2CHGA 4YACA 1R8JA 1OBHA 2R8EA 1Z73A 4WN9A 5K99A 2GJKA 4DA4A 1Q0QA 1ZP6A 1EBUA 4F8EA 5LM3A 4B3BA 2Y76A 3FNRA 4AB1A 2C1EA 1M2GA 3WYCA 3DG9A 4HGYA 3TSZA 2OAQ1 4JYAB 2ODTX 1A2KC 1T1SA 5B1EA 3VU9B 3TLJA 4HAYA 3P2KA 5IDXA 2XJ9A 2G72A 3EIEA 1IPEA 4DLUA 4X9XA 3U0BA 4C0AC 3ADBA 1I8TA 1GRRA 1I0LA 3CO5A 3QFSA 4FYMA 3HB5X 2V7TA 2VBCA 1V7PC 1VZ3A 2FI1A 3IT2A 3QWHA 4N5NA 5K0TA 2A0WA 2P68A 3ZN2A 3IUEA 3TOVA 4IIFA 3QVVA 3W5UA 3FCOA 1SNYA 1JVNA 1N1GA 1XN4A 3QI2A 2H2AA 3CJRA 3CCBA 3U0VA 1P1HA 3BXOA 3L6RA 5LU9A 3SDSA 5TEVA 1VA5A 3AVTA 3AUTA 1NAHA 4FU0A 3CIOA 1X1SA 1QKJA 1QWOA 1TUEA 2GZ1A 4MAAA 1KAOA 4GECA 4N41A 1C9KA 3GLRA 4UUQA 3CZRA 1QVWA 1TRHA 1FS6A 1ADYA 1N0VC 2JHAA 4QGGA 4EAQA 1QGED 1NW7A 2FR8C 1MAVA 3QTLA 1Z8HA 5ERGB 5T64A 3VM6A 3EZXA 4N49A 4PPYA 3RFUA 1J9GA 4LF5B 2PH3A 4TQ9A 1S4MA 1CRZA 2REXB 2Q9CA 3NV9A 4NYMQ 3UIEA 4ZJPA 3WXBA 1U99A 4L78A 1OFTA 3T6KA 4M38A 4F2HA 1GZUA 4JCOA 4OL0A 2M6LA 3TSAA 3X3HA 3ZTWA 4I36A 2RAPA 1GTRA 4UNIA 2FZCA 4BKQA 3KU4A 4CODB 1XELA 4UHBA 2XUGA 2G4CA 1VDZA 3E3MA 4LTDA 4Y6OA 5DMHA 3NOQA 2LD4A 4LCBA 1HGXA 3DOEA 1JYEA 4RZ3A 2HPHA 4MS1B 4RC9A 3PI6A 2GHRA 3SS7X 4BKPA 4GL2A 4KQ9A 4CQLB 1JTVA 2I8CA 3N8DA 3B53X 3JYPA 3B1KA 3K8QA 3LLUA 3Q10A 4IIDA 4RZHA 4WXRA 4EF5A 4HDSB 4X64B 4MHTA 3V7WA 1QH9A 1KZHA 4MP8A 3VZCA 1S01A 3I2GA 4MYUA 1GNRA 2VYVD 3Q3IA 4V0MA 4IINA 2PKQP 3TW6A 4DDHA 1FIUA 3KC2A 3MWGA 5E6UB 5FLYA 3T5MA 1GTSA 2VDRB 5BR4A 2XE8A 3R3XA 4MV9A 4UBLA 3AB7A 1L0BA 3NDIA 2NVBA 3BFPA 1IMOA 1WDLA 3DB2A 3LDUA 4C5BA 4UEWA 1DWQA 1YDFA 2W6PA 4GPTA 3TX2A 4NXNB 1KMNA 2HQOA 2WJHA 1CIJA 1MOQA 2R6AA 4BBZA 4PX3A 1YD7A 4JVMA 4TM8A 4E5MA 2PZ8A 1A96A 4FI3F 2FGKA 4MW9A 1PGQA 4X45A 3IHLA 3UPDA 1E5QA 2PUBA 4H4DA 2WFLA 4WE3A 1VHTA 3KXIA 4Y2XA 1E32A 3PTZA 4M4SA 1DAKA 1E1RA 1JHZA 1JXAA 2P79A 2YIMA 3FHJA 4UDXX 1Z34A 5IXJA 5C9ZA 3WSWA 3ZVLA 1GQ2A 1D4FA 3N8KA 2XRYA 2WR8A 3UMYA 2JFQA 3LBNA 3P0FA 5BN5B 4ABTA 4PC3A 1WMDA 4JH0A 3QVWA 3HVHA 5LQAA 4LE2A 2I7DA 5KAMA 2GCGA 3D8RA 3QELB 1SC9A 2ZJ0A 4QEDA 2ZREA 2DC1A 4LW8A 8LDHA 3LW7A 4Z7QB 4MYHA 2BFBB 1YGPA 4L8YA 4Z9XA 3STTA 5AI8A 4UPEA 4KYTA 2JFFA 4U2KA 4JITA 4EG4A 1K97A 3QXHA 2PUWA 1PQUA 4UE3S 1IBKB 3LCJA 1HK7A 3TLGB 3TPFA 3SNKA 4BX8A 5JNSA 2H1RA 4RVGA 4XSVA 1BX3A 2COUA 1FUQA 4TSFD 3IQGX 1O08A 4IEFB 4I9UA 3U4HA 3PHLA 6CHYA 3BRQA 3ICCA 1OH6A 4GE0A 2VBFA 1NPTO 4LXIA 3G8AA 3AW9A 3OJXA 4IIJB 4GDFA 4C0HA 4LF9B 2H18A 1ZCZA 2POQX 4W6ZA 2V98A 3OIUA 3WGGA 4P53A 2Q1WA 4D0GA 3ANNA 3BMXA 4R5HA 2QYSA 2DUMA 2QJOA 1PI3A 2OCAA 3RFFA 4CQJA 5EKUA 4ILEA 3MSCA 4KK4A 2C8LA 3ZCPA 3QU9A 1CULC 2HBQA 2YS6A 3H5IA 4GI1A 3PHCA 2Z8YA 5C4GB 4DC9A 3KZKA 1JUDA 1A71A 5DLQC 2XUAA 3RQSA 1OH7A 3SQLA 3OX2A 1ACLA 1YOBA 3FJYA 3JSAA 2GX6A 5EJ2A 4WNAB 5A7FA 1YBAA 4XGRA 3VPFA 5A6SA 5MN6A 1VP9A 2F67A 1CJSA 3PWKA 3Q5DA 1WPQA 1DKOA 3WQBA 3GWGA 4S1NA 3KFLA 2A88A 1U0FA 2XRMA 2NADA 2HJHA 1ISMA 4YP9A 5TQ2B 1AV6A 3VTAA 1B14A 4N3AA 5ELMA 4Z1OA 1PW7A 2ZVDA 1CY6A 2R47A 3FBGA 1VJRA 4DYDA 4BGDA 1ZD8A 1GQFA 1T36B 1JWAB 1ZHHA 3U80A 2OFOA 3QM1A 1DZIA 2D1TA 3E0XA 4X71A 2ZDGA 3C6ZA 4NCXA 2UUBB 4UJ5A 3PF9A 4WBNB 2C2OA 2QMYA 4B6GA 4OAQA 3NTXA 2BFFA 3AJRA 4DA6A 2W2OA 1PO7A 2WE8A 4TTTS 4A5OA 2XBMA 2EP5A 2W00A 4ZDWA 5JJ5A 3BQMB 2CVPA 4J3JA 4QZVA 5K01A 2WY2D 3V9AA 4EI8A 3LL7A 4RS3A 5C3UA 2Z6VA 1ZN8A 2R7MA 1F4VA 5HPYB 1L5QA 3IVGA 3OIFA 4PLZA 1L1EA 4JCCA 4QTTB 3ROEA 3ZBPA 3ZCVA 5CFOA 3M5PA 4G24A 3RSFA 3SLKA 3LO8A 1K06A 4Q4JA 5BN4A 3O2QB 3B7GA 1CIVA 5EXEA 2VWHA 1C5KA 1X0XA 3PF8A 4DQKA 3ZLJA 1OPRA 2C5HA 2JPDA 1YA8A 2OZPA 3PJEA 4L0QA 4TTIA 5EYPB 3SIRA 4RTMA 3UH1A 1BFUA 1BGXT 4O5OA 3FWPA 4ZOLF 2H3EA 2HWKA 5LDHA 2PE5A 1IZ0A 1MW9X 1PFWA 4D3ZA 3EX7C 2Z6UA 1RR6A 1E63A 4LC0A 3JTMA 5EWLA 3QU4A 3F1KA 3RI3A 4YP1A 4P3PA 4B9EA 4R1TA 3A3NA 5CVUA 3S2UA 1BA2A 2P4UA 4AAYA 1B8VA 4DMLA 1V25A 2DKOA 3IUNA 1MT0A 2PA3A 3RYFA 3O2JA 3I05A 1UC5B 2XSZD 4MWEA 3U4DA 2W2MA 4QOIA 2GK6A 2A5DA 5K20A 3H3XA 2UYYA 3DR5A 4P0TA 5FI1B 3W9UA 2HK6A 2XZDA 3T7RA 2EX0A 1QH8A 1J5PA 4HVAA 3WYAA 3DEAA 5EXXA 2VZLA 4C0XA 4LWPA 5DM60 2Z2JA 1RYMA 4AMZA 3SE0A 3U6BA 3B5JA 1SXJC 2OYRA 2Q6LA 1KPGA 1Z29A 3EZGA 3EOBI 2WKPA 4NYJR 3F1LA 4HNHA 4E2YA 2NNLD 2BZGA 3ZW7A 4N5MA 3HLKA 4MV5A 2WICA 4K1LA 1HDIA 2GT1A 4MQ5A 1U15A 1NNLA 2HT6A 3O1JC 4YR9A 4M53A 1D0VA 1VYVA 1CY2A 1MC1A 2BHRA 2KLHA 3E22B 2QLJA 3BGDA 3F71A 3LLVA 4KBFA 4N18A 4P84A 1E2FA 5FNVF 2I2AA 5BVGB 2R6ZA 4D0SA 5DNDA 5CX1A 1C1XB 4JI6B 3ST7A 5I5EA 1HKHA 1PWEA 3EG9A 1AKNA 2FSFA 4DJAA 1QIEA 1DKQA 1CY4A 3JQ8B 4FYWA 4ZQHA 4IIJA 1RWWA 5E7MA 3V7UA 1YNOA 2ODAA 5J2UA 2MSNA 1YKGA 1EFAA 1D8AA 3IAM1 3NUQA 5C34B 4G86A 2P2GA 3AR6A 4OL9A 3CRQA 4B44A 1PK7A 1XU4A 2YV2A 2QN6A 1XO1A 2FF5A 3BFKA 3KB2A 3OTHA 3KEFA 1O97D 4OYYA 1TKCA 3OPYI 4EMTA 3B7WA 5TMDA 2I6UA 1Z35A 4RANA 5CH3A 1YO6A 5ITVA 1THGA 2I29A 2QEQA 2TMDA 4P34A 5JD5A 1LTHR 1VMEA 4HN2A 4ZRMA 3UOGA 4IMIB 3ZBTA 1VM6A 2YDXA 1ZGJA 1Z7BA 1KDVA 4KKVA 1YF3A 3DLTA 4F3TA 3EGIA 1EK6A 4KXLA 1GDDA 1M33A 3CXRA 4NBLA 3HLYA 3ZKWB 5BN5A 3RJMA 3U1TA 2GEFA 4LE1A 2IPAB 4RVNA 4G9EA 3ESYA 1XEXB 1XVUA 3T7CA 1XZLA 3QLUA 5K8VA 5LNK6 1BKYA 5JCXA 2R6HA 1BDIA 1N34B 1BNCA 3HFGA 4EX7A 4RHEA 1MIHA 3HU3A 2B4RO 1JHRA 1OZFA 1XRJA 1XWWA 1ZIPA 3RLIA 3EMDA 5JPCA 4GZMA 1XSEA 3IELA 1OV4A 4UNRA 3H4TA 4NZZA 2MWMA 1NC3A 1X1TA 2ZJ8A 3L8FA 3IO5A 3FOFC 1PV4A 2H7XA 1Y8QB 2HB6A 2OENG 4DLZA 4DYHA 5KB3A 5FL3A 1XA0A 2YXPX 4QXRA 2AYZA 1E20A 4TT3D 1XG5A 5KX5B 3ORHA 1SQ0A 3ZHUA 1P19A 3PLAE 1YZNA 1QG0A 1Q1BA 2B4AA 1BCSB 2IITA 1COWA 1RXCA 2M6SA 1ICIA 4QU0A 1DJPA 4EG6A 1TVCA 1QHHA 2D0IA 5JSQA 2WYOA 1ZH2A 4J7UA 4GW3A 2ZIGA 5JSYA 3A1SA 3FPCA 1ZM4A 2XWPA 1II0A 3EXHB 2Q27A 2WF9A 3EIQA 3L77A 4HGOA 3TR6A 4W99A 2R86A 5TMBA 1AKTA 2OFWA 2PH7A 1RFGE 1VYTA 2V7PA 3TRIA 4I3FA 1PD0A 1N1MA 1XAIA 4JXZA 3JWIA 3W0LB 5H7XA 1AGXA 4U2DA 5CLGA 4WBSA 2ZJ1A 1X87A 3VVMA 4KUEA 1REQA 1SU6A 2P27A 2QPTA 3L40A 4XRRA 4APBA 4C3UA 5JZMA 1F48A 5DULA 2Q3LA 3VHXB 4A8HA 1XPRA 1RAEA 2P91A 2D62A 3OKFA 4IGEA 1U0LA 3IHKA 5SYNA 1Y48E 5JCJD 2WOOA 3QMMA 1DGQA 1GRCA 1MB4A 1J8QA 1Y6FA 2VLIA 1KEUA 1D1QA 2DH5A 1RXWA 3RTCA 1FSGA 1I1HA 2OV6A 3BF7A 3LHFA 2OECA 5TNXA 4JIGA 2Q5JA 5C35A 2AGVA 2PFSA 5P21A 3CNQS 1M8FA 2NIPA 3ML1A 1NWCA 2J5QA 2PO5A 5D1NA 3LWNA 4NDAA 1M2OA 5KYWB 4FSDA 5LYJB 4FE4A 1ABBA 3BT7A 4HCJA 1CRPA 5EJMA 1FU7A 1H8EA 3L7DA 3TFWA 5KVAA 6ABPA 4DPKA 3KR2A 3RS2A 1FBTA 4CG1A 3IIEA 4GX0A 1MV5A 3NYIA 1L4BA 2ZULA 5A5FA 2J3DA 4FZ5A 4BIIA 1Y3FE 5K3EA 4CQMA 4TX1A 1ZOPA 1BXRB 1FK8A 1QORA 3U9SA 4Z4GA 2H7YA 1JAHA 3CUVA 3N7TA 1IN7A 1JG6A 1JAZA 3I04M 3FSGA 3KZVA 1ACJA 1GVHA 2Y67A 4GF5A 5ALSA 2XRFA 3NXKA 1Q57A 1KEEB 5BNZA 4X6LA 5ALWA 5GOZA 1A4RA 4WY2A 4BB6A 1P80A 3BJIC 2Q62A 4LIPD 1BMQA 3D8BA 1DBWA 4WZ6A 3GCDA 4CXMA 1W2WB 3U39A 4EENA 4WT7A 1T5LA 5CXSA 3D43A 4CKYA 1H0KA 4IEIA 3OMLA 3IVXA 3N9IA 1JQ3A 2BM0A 3QVKA 4J0IA 3AL0C 4NZ9A 3VKFA 3EGXA 3HBLA 4OV6B 2B61A 4FB5A 3LU1A 3Q15C 4IXNA 4X93A 1YIDA 3PI7A 1EX7A 5JG7A 1K3FA 4LQLA 2FZ5A 3PUIA 3LBHA 3QF4A 3TCNA 3AY6A 3WMEA 4TRJA 4CT4B 4NIMA 3R7WA 5IVPA 2IXEA 4KQ2A 1AN9A 1TM5E 4DV1B 5L4NA 1T5DX 2HFJA 4D9CA 2BLNA 1JNXX 3V8RA 3KYIB 3PVCA 1HT3A 3NCHA 3BFVA 4Z51A 4HLCA 4Q4AB 3TPCA 3RW9A 3KHKA 3UUEA 4JR2A 5DLEA 4MUHA 5ADHA 3HZRA 1PGPA 3OMWA 4FDTA 1T9CA 4MWGA 1OJLA 5ALXA 3D6VA 1YZYA 4RDIA 2EZ4A 1E1QD 3KWJA 2EFHB 3AIOA 3A04A 1DINA 1XNJA 1OI3A 1E2MA 2HF7A 3DE0X 1UKZA 1YZUA 2PGAA 2Q8NA 1DQSA 1CR2A 2R7NA 3HJNA 3LX4A 3TSYA 2HA2A 5LN1A 4KREA 2E87A 2EJWA 2HFKA 1IOZA 4CM7A 1B1CA 5IC6A 1U9IC 3AV0B 1N5KA 5LR6A 3NTLA 2DCMA 3QOXA 4HAUA 3NATA 4WXHA 1IRXA 3TUIC 5EJAA 4DKJA 5EXSA 4H7HA 2WDZA 4KXXA 2JI4A 1CLUA 3ORYA 3X2FA 2OCPA 4Y2TA 2HPAA 3BTUA 1VC2A 3WK8A 3LHIA 3QW4B 1CU1A 1ZGHA 2V5VA 3PNVA 3Q85A 3Q88A 3ZBQA 5EJ6A 4BO4A 4XVUA 3A6FA 3EZNA 1BSVA 2R2GA 2OUKA 5J58A 1WLYA 4BHTA 5IM4F 1YFMA 1AUPA 2DRIA 2QMZA 3ICWA 3Q1KA 1CRWG 1NMEA 3L84A 1GADO 3PXGA 4LNAA 2MSWA 1AQYA 5H1YA 1ECJA 2I62A 5D3KA 3ZDYB 2VP2A 3C3EA 4FS8A 2JCGA 1YMUA 5EKXA 3RBAA 5JNTA 3GW8A 5K3FB 1JHPA 5KYKA 1T1RA 3LL4A 3KOZA 5A4FS 1JEYA 2G6BA 2XT0A 3G5MA 3PT9A 5I9TA 5IVHA 2ZSBA 3L6BA 3RHTA 2C8JA 3JQDA 1O6ZA 5CM9C 1G20A 2AOVA 1KS2A 5TJ9A 3M1AA 5KYVA 5I8WA 1YS7A 3I9OA 3V42A 5E38A 2WIGA 4PIMA 1O95A 2FQQA 3V4VB 5AXDA 3G82C 2BEUB 3I6BA 3ZLVA 3KOMA 2DUUA 4N3NA 2RI0A 3S7TA 3D2BA 4HRVA 5J5VA 3AC0A 2YHIB 2HHCA 2Q3BA 4R5MA 2IYZA 3DVAB 2NM0A 5T5QA 3RTBA 5CBPA 4M76B 3M6MD 2UZ0A 3FJ1A 2G1KA 4ZO8A 5LFAA 1TKAA 3L8MA 4C4OA 4HS4A 2IYOA 2B8JA 3A7DA 1YQGA 2W2KB 1SBIA 3FOBA 1AKEA 1ORHA 2R4TA 3HUDA 2VIIA 3AF0A 4H18A 1E9VA 4TTQA 4J0JA 5LZ8A 4ABYA 4F4UA 5J23A 5F9HA 1BDJA 2GLUA 1QHYA 4D92A 1OI7A 4Z1MA 2FOIA 2OB2A 4D9FA 1IJEA 1FNMA 5CB8A 2BR3A 4H7PA 2H2HA 4E14A 3QBTA 2PMKA 4IGAA 2QTZA 4FFSA 4ZICA 1Y1LA 4MVCA 4ONEA 4YQFA 4L0DA 5D1HA 1DI0A 5DHFA 2ZXFA 3I5XA 1Y8RB 1OCEA 2CXHA 2C9OA 4F84A 3AG6A 4NV3A 5JJIA 2VK8A 4E07A 2VPQA 2W6CX 4E5KA 3HB1A 1KO7A 3QY0A 4C9BA 5KJFA 1X1RA 1GL6A 1W9HA 4LPSA 3RTAA 4E22A 3MFQA 3PGMA 4OK6A 3EVCA 3HADA 3CLUD 2BFEB 4BP1A 5AVOA 2IKQA 1KOJA 4QPNA 3G9ZA 1I9GA 4RZ2A 2ZUEA 1JALA 2YDYA 2EHJA 4UKDA 3W5BA 3TECE 1A50B 1KETA 1WKCA 1M6VA 1X7WB 4PRYA 3TQRA 2L18A 5HX7A 2Q5FA 3OQOA 2FXVA 3QKSB 5TC4A 2XA1A 4LYHA 3ZWXA 5HQTA 4LBVA 4CGYA 3T34A 3V4FA 1CJKC 3KLOA 3CKKA 2IGTA 5GONA 1VRVA 4G41A 4JYMA 1T91A 3IL2A 1GSHA 4BFUA 3GVIA 5BSFA 3HJBA 4DIUA 5A9TA 4FFMA 4HD8A 4AP9A 1L7NA 1IM2A 3PP8A 4FNGA 4BY9E 2QAJA 1WTCA 1FSZA 3PXCX 2IDZA 3A8TA 4PS1A 1U0BB 4YJFA 4YQEA 1AUWA 4BO6A 2YZKA 4F3KA 4YT2A 2FU5C 5HDBB 4G8DA 2UVQA 1JSZA 1HLDA 3PR2B 2AEJA 4HR7A 1R9JA 3JZAA 1UBNA 4OLFA 3B3JA 2PT6A 3MNFA 2ODBA 4PLPA 4JX8A 1GTL1 2VQSA 2WU0A 2FMKA 3B1WA 4OM7A 2OXIA 1C1DB 1MC8A 1PEKE 5GIPE 3BM5A 1BQEA 1C14A 1EK1A 3KEOA 1G9TA 2JFOA 3FPLA 5CNIA 4LZJA 4CQNA 4CIWA 2GBGA 1G6HA 2LGJA 2XLCA 1QF7A 1O0CA 3D6MA 4F60A 4ZYTA 4M0LA 1CX9B 1SVMA 2B35A 3ESZA 3TB4A 3DD5A 1PYDA 4H3VA 3FGZA 3IB3A 4QSHA 4GKKB 4ETIA 3RVSA 4QU8A 1IBCA 3O8NA 3IP8A 3PDCA 1MPXA 2G88A 2QTLA 3MLBA 3QLEA 4O2BB 4IIYA 4B43A 3GGCA 2Q1XA 3V6LA 5GQSA 4MVWA 4L07A 2OM2A 1GU0A 2OUIA 2R7KA 2XKAA 4ALJA 1MH9A 3GHHA 5ES4B 3UATA 1JVSA 4U9UA 1P4GA 1ZXBA 2G36A 3IVMA 1LB1B 1ZESA 1QPGA 2OBFA 2RGGA 4II2A 3GJQA 3HJAA 4S1PA 2P9YA 3SOPA 2J9ZB 1DOFA 2I7XA 1NXQA 2WKRA 4MRMA 1BJRE 1MAAA 1KOGA 2XE7A 1VPVA 3CEHA 1KARA 4NZPA 4CKEB 1URPA 3O94A 5EYPA 3VYRB 1PBNA 4GX2A 1V45E 2ZK7A 4X1OA 4D56A 3JARB 1K8RA 1T2CA 2X6TA 3ZHYA 4FYVA 1HZJA 1LZLA 3PHBE 4HNAB 3L7CA 4EFCA 7GPBA 1G21E 4WINA 3ONDA 2JLAA 1WMFA 4K9PA 1MFZA 2VDPB 4PTYA 2ZYRA 2QUIA 2B0JA 3IE2A 3KBBA 3QKRB 4OHFA 3C39A 3UAYA 3G0DA 4JKIA 2OP1A 3IOYA 1QAQA 5C1IA 2PD3A 3O5AA 4TYMA 5AXAA 2ZCUA 4DQ0A 1I10A 4Q3NA 5CAEB 1NRWA 4Z0PA 5A1TA 1IEXA 4MR7A 1EQUA 1VMIA 2CXNA 4OQMA 3W5HA 5CB0A 2W2PA 4MDYA 5DBFA 3TTVA 2PUHA 4H0CA 4YDHB 4O4JF 3A2NA 1PWYE 4HX9A 3D3KA 1NF8A 3C87A 3T9DA 1MW8X 5BQ5A 5IN5A 4P35A 2I7CA 3G7NA 3UWDA 3U7GA 1VPDA 1X39A 3QKUA 3B38A 3VXKA 4JI8B 1EIWA 1OE0A 2O2GA 2FR8A 3NHBA 4DQXA 3BE4A 3IKMB 3TLYA 5LMUB 2JS7A 5KSPA 4B48A 5AJYA 5CHYA 4QUKA 3ZDEA 4X6UA 1GGNA 1HOXA 3H9GA 1GL9B 1YMQA 2IEYA 3OZSA 3L9WA 3U4IA 3ZV5A 1XMPA 1XTBA 3QA3E 3BSSA 3B3AA 1N1DA 4WTOA 2OAGA 4XB2A 3O21A 1E0JA 1RI2A 2C5SA 1GZ7A 5BR1A 3WAJA 5KX5F 2FTKE 1GPMA 3HO6A 4R0MA 2G8LA 3SBOA 4WADA 4DIEA 1ZKMA 1JAIA 3IAAA 4B80A 3H8SA 2Y0EA 3ROGA 3ZQ6A 4IH9A 4ZQCB 1ZSYA 3AM5A 4K3VA 1WCV1 4XYMA 2E49A 5DHQA 2Q9UA 4A2PA 3RVKA 3DAOA 4XJSA 3RASA 4TMKA 1P2GA 5IDQA 4JENA 5LZ4A 5THQA 1FB5A 3A10A 4F2GA 4F12A 1RQLA 1VKOA 4V0KA 4ZYXA 3PTAA 2Q45A 2XMZA 3V9PA 1C8LA 2QTVB 4JZKA 3VNVA 1P3Y1 2IH2A 5AKHA 3CX3A 3TR0A 3WISA 4FCWA 2PUDA 4IJVA 3SX4A 1W29A 3SSNA 2HY7A 1T9KA 3B8EA 2FUEA 5JY6A 5KU7A 1L4EA 2RAUA 4I1VA 4R7GA 3UKDA 1GGFA 4OB6A 3ZHOA 2LRHA 4PWZA 3ROFA 2AR9A 3P1JA 3G02A 5CB4B 1KDTA 1KRXA 1YQEA 2QE7A 1OYYA 1Z3IX 1C0EA 2OZLB 2FH5B 3PSAA 3S8YA 5A0TA 2O07A 1XFDA 3LCVB 1F5SA 4RKEA 1ECBA 2RHOA 5HS6A 4KQ1A 3NDJA 2PWYA 1J06A 4U7HA 5DYTA 1P0IA 3HP1A 4FMDF 3GA7A 4FHDA 3V4LA 5B6IA 4AK9A 3KT3A 1DCNA 4R8RA 2HN9A 5T3YA 4YRKA 2FF7A 3A6HA 4YROA 4Z7NB 1FP7A 3VPCA 1P2TA 2ZJ3A 1I30A 2G63A 2PMCA 2VRCD 3JARA 5AT1A 3A6PC 2VOJA 4JWKA 1EINA 3CVUA 4KWTA 2QRVB 3QEMA 3TQTA 1F8UA 2Z9DA 4XWYA 4CV3A 3LG2A 5FH9A 5DK4A 3AB3A 4CDGA 4CNQA 1Z5UA 3R0IA 1GNQA 4U7TB 2EJVA 4JA2A 1ZL2A 3PLNA 3ENVA 3TRHA 1SBCA 1VHLA 2QTNA 3WNZA 1DBQA 1MABA 3NO4A 3PE3A 4QGFA 2LUOA 4DUGD 1RM4A 5BYAA 3VNQA 4WLFA 1ZD2P 1IY9A 2ZIAA 2OGZA 2VHXA 4IICA 4KITB 5IT0A 2XXBA 3G2OA 5DM4A 4ZYVA 3RF6A 5LXTA 1T4CB 4KEAA 1NXWA 2P9CA 1D1SA 2BISA 2JGLA 2IDKA 3WGIA 1SCUB 4F6CA 5FQNA 1S2OA 5TX7A 1NUTA 1EDZA 2IJGX 3HEAA 2D1FA 1XMSA 1T4CA 4BO3A 5ICSA 1RYBA 1W9MA 3BD7A 3ZWAA 4Q9HA 3CPHA 1G9XA 3PC8C 4JQSA 4YDQA 5TT1A 1WBJB 3DKKA 1IWBB 5AOVA 1NUSA 1EGVB 2IHJA 1LBHA 2ZIFA 3FYSA 3IMEA 5CB6A 1IN4A 5DNVA 3EHDA 2EWWA 1Y82A 4YXFA 4EYGA 4YV0A 2XB8A 4JL8A 1JEEA 2C0CA 2RH9B 3M6XA 2KX7A 3MXTA 4GM1A 4PCLA 3JYLA 1OWLA 4FYJA 4U4AA 3PNSA 5GGXA 3RPEA 4CEJA 2QGFA 2XZLA 1Y6QA 1TKRA 1TFUA 3ONWA 4EMSA 3NT5A 3SC2B 3E03A 1QRSA 1G17A 3CV3A 1N2JA 3FIUA 3LQYA 4QKQA 1V8FA 4YMUA 2WU8A 2MSLA 1NP3A 1NMXA 2FE1A 2VPYA 1YA6A 1MEOA 3UENA 3NTRA 2TECE 2YC2C 3ZWYA 1MIOB 3DV2A 4S1OA 4GWLA 2Q5LA 5BO5A 5LBUA 4KTTE 2QMOA 2IF0A 3PUWA 4PN3A 2JIZD 3VO9A 1HYBA 1SHJA 2H4WA 1DX9A 2C4UA 4K9DA 5KJ6A 4CKWA 2CXTA 5FTMA 3IPCA 2GBIA 2NGRA 3QVSA 4MR9A 3EPHA 3GYGA 1M1XB 4MWOA 3T52A 3ZE1B 3U5TA 1RXIA 4DFDA 4K6FA 1T9ZA 4AO7A 4HB4A 1CQXA 1OC4A 1V5WA 3WGOA 2EKDA 1CRQA 1DC5A 2ZBDA 5CDUA 1T6XA 3ELUA 5IM4A 3INRA 1W0CA 3PPWA 4EELA 1UCFA 3P7MA 2LTAA 3F90A 3OQHA 4U9HS 3HGMA 5FL7D 1PLJA 2G9VA 1Z0DA 1S1MA 3BPSA 3KHSA 2FFJA 2IPNA 1ZRNA 4INZA 4TS3A 2PGNA 4Q02A 4Y18A 2VK4A 1ENYA 2PMEA 4BCBA 2JKZA 3VR0A 2EDAA 4DC0A 5ISMA 5CURA 5DXAA 2FEWB 3UICA 4GE3A 1KVUA 3V2HA 4PC7A 5KINB 5D5PA 1RXSA 3ZE0B 4AMVA 3A4TA 3WL7A 2XNHA 3RTEA 4TMXA 1Y34E 4GYWA 3RS0A 1DXYA 5F64A 4EG5A 3A2KA 2RK3A 3F6PA 4C2TA 4N5DA 4YT5A 2OGTA 3QA9A 4QGSA 4DR5B 1QIGA 3L8YA 1YE8A 3J81k 2DWCA 4YCNA 2FPUA 1RQGA 1UK8A 3ER6A 2W2KA 3LUFA 2PA0A 3N5KA 1W4BA 4PAMA 4WN9B 4O2LA 1ML3A 3EOZA 3FYTA 3UXYA 1NI3A 4E7OA 5KTPA 2XOXA 1UR5A 1NMSA 2QF7A 3LRXA 1JFVA 1UWVA 3C98A 4AMBA 5KUTA 3SYTA 5EJ7A 1L7DA 5A5EA 3CEAA 2ILVA 4IILA 1CKEA 2YHIA 1ZUNB 2MYTA 1WHSA 1JU4A 4KQWA 2HBYA 2WAOA 4LF6B 1S2IA 2XOKD 2J0QA 3U7IA 1I3LA 1Y1SA 2EBFX 2YHBA 6REQA 3VZRA 2WIJA 1KIAA 2ID8A 1RAIA 4KO1S 2HCJB 2V58A 2H4JA 3G17A 2FZGA 4B6SA 2JLWA 3GT3A 3TZCA 5ILQA 5HZKA 1ATIA 4HH4A 4F4HA 4P7BA 2B82A 4ME6A 4U2GA 2DKFA 5LNK1 2WIKA 5DISB 4ID9A 3DH0A 3I5MA 2ZYVX 4QUIA 1ECCA 4HNAA 3DLPX 8GPBA 1MG0A 4Q12A 5AW4A 3FZEA 3TTYA 1Q2UA 1TEZA 4QTZA 3A1UA 4WXYB 4DLYA 1J6UA 1TQHA 4UMEA 2BTEA 3DHWC 5DGCA 1Y7IA 1TUBB 2CSUA 4H6WA 2ZRNA 4TTJA 5BY2A 3FWZA 2CD7A 2IELA 4LMBA 2AFHA 3GT7A 4RTKA 1XZDA 4P81A 3VR6A 5AI5A 1JIUA 1GAJA 1WW8A 3QXJA 2B8EA 1HPLA 2VJBA 3STVA 3DP7A 5C5DA 1NBMA 4HNVA 3KZXA 5BV8A 2O2HA 1CNMA 2XD4A 3S3TA 2BGJA 3HVKA 4UHDA 4V0RA 4APAA 2R5WA 2EBHX 1JQAA 4KIGA 2D7DA 3GGOA 1AMOA 3GCWA 2GF0A 1OYWA 1N5MA 2AFHE 1JKJA 2QMHA 5DXFA 5FOVA 4RETA 3OQVA 4C0SA 2CUTA 2PXXA 3QG5A 4I3GA 2UYOA 4Q7JB 4XUEA 1BJTA 3UA4A 4HSGA 4BNJA 2JJYA 4G4JA 4KQEA 3CA8A 2EF0A 3KJZA 3CO0S 5FQOA 4G0UA 1KWGA 3GJ5A 3QWBA 4K88A 2Q6IA 4W9RA 3CF2A 3G2KA 1NN5A 3SHOA 1COZA 3VR5A 3QYPA 2EQAA 4M1WA 2ISQA 4EGFA 1AG9A 1L7PA 5BSKA 5I9BA 2IBTA 4FOLA 1KZ9A 2W4IA 3WLEA 1B23P 4XOIA 4ZCQA 3LZCA 1R00A 4HUJA 2I6QA 1CDEA 4KAFA 5IK2A 2NV2B 5C7IO 3HCRA 3OCVA 4JNCA 3UGTA 4OXKA 3RK4A 1BHO1 1HE8B 4ENRA 3E2MA 5IBPA 1NFFA 3RWMB 1CUIA 5DNUA 3C1OA 5JYCA 4ZOLA 1MZVA 3L7JA 1ZNYA 2BJWA 1S3GA 3BIWA 1D2HA 5KNLA 3BGSA 4E2ZA 3UQYS 4DA8A 3VTFA 4KWHA 2OCYC 3EN0A 1HC7A 4HFMA 1NOJA 4UMFA 2ZSIA 3OSZA 3H11A 1B6TA 1K6XA 1YDGA 4KXUA 4UASA 2PG3A 4YJGA 5FAXA 5L4SA 5LUAA 4WGGA 1H66A 3R6DA 1GOTA 2KQUA 2FXIA 2ZTMA 1F3LA 2AN5A 2KSQA 1WV1A 1XVIA 4P9NA 4QC2A 2ILTA 1BS1A 2JCYA 3K53A 4F91B 2R65A 3N76A 4C03A 1T2UA 3EPLA 1FFAA 4L28A 3GPIA 1O96B 5DWDA 4EB3A 5LQNA 1M6VB 4IAOA 1Y9EA 1U3GA 2ZBFA 3MQFA 3BH6A 3JVEA 3NTQA 3S2YA 5JXJA 2ODQA 4OLAA 4G0WA 2DJ5A 3V8QA 5AM5A 4RW0A 4F9GA 1E5LA 5BUCA 3HB0A 3D8HA 2X4GA 1JXQA 3OPNA 5AIBA 5L95A 5MN5A 4BQNA 3QSYA 2HA5A 2I1LA 5JPIA 1JI3A 3GH1A 4OOEA 3VU0A 4CE6A 3ZXYA 1Y3IA 4RPLA 4TL6A 3D5QA 1CLEA 2YWXA 4PFKA 1YASA 3LUGA 2VHWA 3MMNA 3VPGA 2UUCB 1BXRA 4TWBA 1E1LA 4C7JA 3RD8A 1BRTA 4TXMA 2HO5A 2QJWA 1IXZA 4H7EA 1Y5MA 4BRSA 4EDHA 1E1YA 1NUPA 2QUBA 1POWA 1E62A 4LYFA 4TROA 3ZDAA 3D7NA 1RCTE 4FN5A 3ZWVA 4X84A 2DERA 1X8XA 5D2CA 3D4PA 4QBGB 5L3ZA 1UBLS 2GN0A 3RRBA 3ADOA 4IDAA 4IY1A 2H16A 1DV2A 2ORVA 2O23A 3DFMA 3K0HA 4ZARA 3FW1A 5T4FA 3TLKA 5KYYB 2YWJA 1W4LA 1DOZA 2ORED 5HKOA 2DSTA 2EKPA 4NAUA 3GVXA 5LJLA 1ZR2A 3K0AA 4Y6SA 1L5MA 3CZQA 3KLNA 3DMGA 1AK1A 2QTMA 1AKUA 2DUNA 2XMGA 4J6EA 5AQEA 3EODA 3VYSB 1XF1A 3DBRA 1R27A 4QODA 1I32A 2IW1A 3PX7A 1RACA 4WOCA 5KO2A 3H9UA 1Y3AA 3A1TA 4P54A 3VYUB 1WJGA 2DWPA 2WZDA 5B12A 2AUTA 4AIRA 3EZ7A 4RY8A 1A9RA 1FMTA 3FR7A 4RGQA 1YR7A 2CFOA 4L08A 3LKVA 4WA8A 4E1VA 3E27A 1K7FB 3H5AA 3N86A 4I08A 5FUWA 4CG0A 4GOXA 2ABWA 3MWYW 1DVRA 1TTPB 1W88B 1SC1A 1X7ZA 5E1DA 4IXDA 5EZQA 1HORA 2G0AA 4GI7A 1DKRA 4JU8A 3UTCA 2XCQA 4LKRA 4C7MA 4CTNA 4EOGA 5BVHA 2CVQA 2G7MC 3DXXA 1TEVA 1XZGA 5JNWA 2CZQA 3UJAA 3IV9A 1ADGA 1T2DA 2HZ7A 4RF4A 1E6WA 1GV0A 2JBAA 5I7EA 2ZKIA 3O91A 3X1YA 1MGOA 1YE5A 2IV3A 1KYTA 4ZN6A 2RB4A 2IU3A 1FMFA 1YBFA 3QXGA 2CMDA 3KUKA 5KX5A 4HLDA 1DXOA 1AC5A 1PRYA 1T1IA 1Z45A 3GDGA 3QVTA 1RFLA 4RV4A 1EUQA 1WSBA 4HYEA 3NWOA 5JMWA 3N53A 2YKGA 4BWVA 3HFRA 3S40A 3OZAA 2WWYA 2WJIA 2REQB 2IHBA 4ZVQA 4HN9A 4Q7MB 2OOSA 2BFOA 2R48A 2VDUE 5COAA 1L5OA 3ZWNA 1L7MA 1JNYA 3ICEA 4ZRDA 2O0LA 1SZPA 1VHJA 1B15A 1FUEA 3KQTA 1ZCFA 2PBLA 4NNPA 4TT8A 3NHYA 1NN1A 4DOMA 2ZJ6A 2C7BA 1K6JA 2C88A 1OLOA 4QBHA 4ANFA 1RJDA 1TUBA 2XUIA 4EK9A 5HKKD 3NH6A 4GLFA 4YBRA 3W2IA 4PHTA 2PUAA 3TI7A 1NXXA 2EFEB 2QZSA 3GG9A 2JB9A 3K20A 2GJ9A 5G1OA 5JISA 4CFYA 3W8NA 1C2TA 1LD3A 3M5DA 3PJGA 3WGVA 5AKGA 3K9NA 1YFKA 4C29A 2AKAB 2ARKA 1K9SA 3GD7A 3PRJA 4L5YA 2FSIA 1W5AA 4UZEA 4V0ME 4S2UA 2MMCA 1EP3B 2NN3C 2AN3A 1X3LA 2JGKA 3MUEA 1ODCA 1ZUHA 2WAXA 3IBYA 3F96A 3PA8A 4IG9A 4F97A 5A3QA 6REQB 3ELWA 1V3VA 3EQ2A 3QF4B 5IT4A 4NNJA 1H6BA 1TZJA 4KSCA 4URUR 2YQZA 3TYXA 3IKVA 4GVXA 1ID1A 4ZKDA 1DAIA 3JYHA 3A3KA 3L7AA 2Z6QA 4AZ0A 3EG9B 3DOUA 3I01A 2V5AA 4OYHA 4WPGA 4BVAA 2HDOA 1SCJA 3QJGA 1V1RB 4FFBB 4N5IX 3DBLB 4PCUA 4ZA2A 5FORA 5G41A 4BASA 3IJ5A 2F48A 5K8JB 2ORIA 4EPXA 3L92A 4G0XA 4TMZA 2I9PA 3BE6A 1YBMA 4G9GA 4KO3S 2QD5A 3E22A 3IT1A 3L0SA 4LYJA 3A7EA 4MA0A 3W90A 3GFGA 3BGOS 4ZZ2A 2IYWA 4FQ7A 3SBDA 3SZOA 3SVLA 1T5SA 5CFZA 5ALZA 1ADFA 2A0FA 1GGHA 1HQCA 1AKVA 1XK7A 3GRVA 3P9XA 4UHEA 1LLUA 1OU0A 2FR0A 2DETA 3KAJA 1CIPA 1F8FA 1ZMRA 2F9MA 1MQ9A 1QIHA 3EBOA 3H0EA 2D5IA 3MC1A 2YWBA 5DEOA 1WNTA 1ZITA 2C1ZA 3V7FA 4ZI2A 1H9AA 5B4TA 5JTUA 1RRCA 2D1YA 1QRUA 2B4YA 1C3UA 2ACVA 3GVPA 4IHJA 2F3PA 1AOXA 1A5ZA 2VH5R 3NBUA 1IZZA 4Q47A 4HZGA 2HU8A 2O3UA 4KXVA 2PNJA 5F2EA 4EGCB 2GK3A 5E4FA 3W5IA 3I64A 5EAIA 3U1BA 2D00A 3JAWB 4XJTA 1FTSA 4PZAA 2ZB4A 4P2GA 5EUMA 3T06B 4P31A 2RK6A 2WV7A 3WQQA 1Y7HA 2XCUA 1QIJA 3KHUA 3WIEA 3SYRA 4EVSA 3IEVA 3O1LA 1Q0HA 2R66A 1UZAA 4C4YA 1FZTA 3A0UA 3AESB 3B70A 4QBFA 4J94A 1G2PA 4M88A 4BO9A 5EJEA 4M7PA 4V1CA 4EQ6B 1F06A 3QKIA 4EKGA 2GN8A 4P5PA 3COYA 5K6AC 1M3SA 3LT5A 2BJHA 3I2IA 4AJJA 2RDMA 2REOA 2R97A 4TTVA 5ALOA 2VQ3A 3JAKB 3A28A 3SMQA 3WBFA 2MOKA 2GFHA 4R9VA 4HBZA 2BEWA 3IQEA 4U7FA 4N82A 2ZS9A 1E7RA 2IWHA 5HZMA 1K6EA 1P5RA 2OMEA 3U48A 3VOSA 1BCRA 3DP9A 4BJHB 2P77A 2RHJA 4Q4JB 3U37A 1A5TA 1C0PA 1L7XA 2JAQA 4A23A 1XXHE 3Q6IA 1JR3D 2J5KA 2ZSUA 4Y0AA 2WT4A 5HF5A 3VHXA 3L1UA 5ECGC 4RPCA 2AT1A 1QONA 3WMXA 3UC5A 1YZGA 1B0PA 2GBFA 1P72A 3P8ZA 1RLMA 4YJ3F 4Q5IA 1FFYA 3RC1A 2E6KA 2Y66A 3LBFA 4B2PA 3EF3A 3RVOA 3E8SA 5DTQA 5A6VA 5J63A 1QRTA 2FA9A 3INTA 1T26A 2C57A 2DR2A 5JZOA 4YAJA 3EWSA 3T54A 4Q82A 1SVWA 3QQPA 4JL6A 4QNRA 1K66A 2AKYA 5TVGA 5C1DA 1B1AA 1DIAA 2ZQ5A 3NVKI 1EFCA 2ZT5A 3TD2A 2PGOA 4DQVA 4MW4A 1IJFA 2DT5A 1ORIA 3PPYA 2H2FA 3L8HA 4Y6LA 4AJNA 1BG6A 1NT4A 2W6JD 2D4AA 3JD2A 2NV6A 2NU6A 4I50A 1Y6ZA 3ZH2A 4GYJA 3O7WA 5TQ0A 5BR8B 3FFBA 1BQ3A 3QK7A 5LQRA 1RWMA 4CL3A 2F17A 2QU8A 1QHGA 1GN9A 1XTPA 2A30A 4OBEA 1Z6XA 1N2IA 3MBOA 4YCLA 1W47A 1LC0A 4FUTA 4B6JA 3EAFA 2CLKB 2ORYA 1TVMA 4WMLA 1GQQA 3D7SA 4ZQFA 4B47A 4LS3A 5BW8A 1Z17A 2PFKA 3CS3A 4IF4A 5BSMA 2C5AA 2C59A 5IZ4A 1OX6A 4MTCA 1E4EB 4BMCA 3AOEA 2J48A 5FWXA 1ESDA 1U8AA 4AZTA 2IVFA 3V1LA 2VXYA 3JATB 4KQMA 3FYDA 3VR6H 5C51B 3IBGA 3FOWA 1STOA 1QS0A 3DBIA 5FA6A 2IT1A 2TSYB 1QYVA 1WXGA 5FTNA 3K2BA 3UUGA 3TPZA 1IUKA 4IP0A 5CLQA 1G3UA 4WZAA 3O8QA 2AG6A 1J0DA 1JQ5A 3RVDA 4D5GA 2QUKA 2Z8YM 3G5LA 4OQXA 4CIDA 1DC3A 5IJXA 4H3SA 2XUZA 3A31A 4QQRA 1EEHA 3Q5EA 1VPTA 3L02A 2E0IA 5IK2D 2VFAA 5FXMA 4CM3A 4PX2A 1QV9A 5DBGA 1EWKA 3MMZA 3OJFA 4C5CA 2C54A 4CKXA 4D57A 1KIMA 5G53C 4RELA 3GN2A 4PM4A 1ISSA 1PGJA 2AG5A 2HUNA 3ZDXB 1PE0A 4IDGA 4EHIA 1MJGA 3FE2A 2BUAA 2YXNA 5AK4A 3OPQA 4FYXA 4M1EA 4W63A 4J1NA 5DN9A 1P4JA 1TQ2A 2YRWA 3P4UA 3WB9A 1NG9A 1W1IA 2QQGA 5JADA 1K98A 1M6NA 2V7WA 1YTLA 1ECFA 2BRUC 2ZYUX 3D81A 3I92A 1VIVA 4KLCA 4MIYA 4NCNA 4TT3A 4ETMA 1FPQA 3CT4A 5IEJA 4CCWA 1YK0A 2ATEA 4E5SA 1XIVA 2XB4A 3TG8A 3RC3A 5E4JA 2XMQA 4FXPA 3L1HA 5HVNA 2C5BA 4AXBA 2WD8A 3DEIA 3LXRA 3FMGA 4PZDA 4B4OA 2A58A 4J0DA 3TV2A 3SFVA 1DJMA 4ZCSA 5AOCA 3QV2A 5JPDA 2H5EA 4MW2A 1G66A 3CN7A 1AHIA 1AZTA 2A14A 2NSYA 2WU1A 4ZDJA 3PXXA 4RPHA 1IB0A 3FPFA 1LVHA 3HVJA 3GJRA 3PEYA 2BMEA 1C9MA 4AYWA 1THMA 3R41A 3BULA 3NEPX 3M6AA 5KSYA 1UBHS 4MUIA 3QW2A 2XVYA 4BL5A 4RIFA 4BX9A 1SIOA 1PT9A 4ON9A 1YFZA 2Y3IA 4EI7A 3FLEA 1QP4A 1N6LA 1RYYA 1XWFA 4L8LA 3EASA 1KU6A 2OKGA 1A9YA 3KQPA 4LVUA 1WVGA 2RBEA 1DPFA 1M2JA 1Z06A 3W7BA 3TCXB 3PWZA 5DGHA 4EEXA 1JH9A 4G1VA 3EPJA 3VR1A 3I5AA 1SHTX 4FKMA 4M36A 4LYEA 3JR7A 1C7EA 1JFFA 1V3TA 2FQXA 3TDNA 1W76A 5A06A 4KCGA 3HNOA 3DE1X 3DLIA 2QA5A 3I2FA 4GIBA 3R8XA 1EIZA 4PLGA 2QW0X 3Q8MA 1UBSB 1MVLA 2Z9BA 4FONA 2Q7DA 4QGBA 3R75A 1LY1A 1NP6A 5CXXA 5BQFA 5JD3A 4UBKA 3IOEA 1G3RA 2VAPA 1WDKA 3HVIA 5C0OE 2AD1A 3JAKA 3FUCA 3WLRA 1XQ1A 1EB9A 4QYMA 5H4HA 4ZT7A 1WABA 4UNQA 5KNDD 2WYVA 4DJTA 1WB6A 1THTA 2HSZA 2J3KA 2ENWA 2J6BA 1U5BB 3FI0A 4Q05A 2BFDB 4QUDA 4R6XA 5EQDA 1NZJA 5F1YA 3INGA 1BYIA 1RXYA 5CNMA 1BWRA 3FI9A 1V8PA 2VP3A 4KQKA 4GEGA 2H9AA 4I0WB 1XVAA 4BMDA 2Z09A 3DZDA 4EHDA 1EFHA 3FM9A 1FTQA 4I1YA 4HPJB 3V3KA 5GVSA 3KYCA 3ESRA 1ADCA 1UJCA 3AHJA 1DELA 3ETNA 2W22A 2FGJA 5AVJA 1EA5A 1R9NA 5AVRA 3VC1A 5F1PA 2DBYA 4O6VA 3UK2A 1VBKA 2PXHA 1PDVA 2WHQA 2EIHA 1FX1A 3UHFA 2WNIA 3AF3A 3BL6A 1T3LA 4ZCPA 2A1UA 2VOEA 2ZP1A 2PBFA 1R0SA 3IULA 2PD4A 4OSOA 1NJGA 2H8GA 2QZJA 4ZI7A 4L9AA 4KGDA 4C1BA 2X8WA 2ZJBA 4WVLA 4BGVA 3R7BA 3RB8A 3LHDA 4JLWA 1ZLXA 3BSWA 4QBIA 2R4UA 5AHRA 2QRNA 4MI9A 4JP3A 3F7NA 1CQWA 4TKZA 4EUSA 1OW3B 5D5HA 4G97A 5AKYA 3DDNA 4B4WA 3VBEA 2VHVA 3G2IA 2HR1A 3TZ6A 4WH0A 1Z6ZA 1J97A 2YIVX 3MTGA 2Z2XA 3C74A 2IYPA 3F5FA 1F9EA 1VLQA 2Y9MB 4HH0A 1XTSA 2Y1LA 3RV4A 1WU8A 1ZAYA 1TK2A 3OKCA 4JUIA 1U3FA 4IBOA 1C8BA 1TGVA 4J1TC 4QUAA 3RIYA 2DVMA 4Y2PA 5AKLA 2D5LA 4AWXA 3UUFA 1TCCA 2QTRA 1U9YA 1I0ZA 1E4YA 1LPMA 1V39A 2JGRA 3C5WP 3OM9A 2OK7A 3QBJA 5CFPA 2IW3A 1KOLA 2OV2A 1GA6A 3HK2A 1NUUA 4EUHA 3QKSA 5ILGA 3KQUA 3O8LA 1SRRA 5T4BA 3V00A 1PTJA 2HSEA 4RAQA 1TQ6A 4LWZA 4NDNE 1E6CA 3HHPA 1PKEA 3QVJA 4BC1A 2P0EA 2ZE7A 4GD3Q 2IH5A 4DR1B 5KYXA 2QGNA 2F8LA 1QVZA 1NY5A 4HQKA 1UBJS 1R6XA 3BD8A 5BRNA 4S04A 1A5SB 3AHFA 4FNOA 3R7DA 5TGZA 3RG8A 3OECA 3BD6A 3JZMA 3PNQA 4R2XA 1A7UA 5ER6A 1CK4A 1A82A 1WSDA 2IXFA 4LDPA 4RKWA 3R3HA 1FJGB 5ALLA 4KO4S 2VZ0A 2WFLB 5CVJA 1C9YA 5F1KA 4WX2B 4JI3B 4EG1A 1IRIA 1N8TA 4UUPA 4RK5A 1GAXA 3OCJA 3C5CA 3SXUB 2ZI3A 3W6ZA 5FWDA 1U2DA 1MOPA 1EAYA 4C6SA 1U4NA 1W4CA 2OHOA 4BVJA 2V4UA 4EFLA 1XCMA 3ZHZA 1BX1A 2JGMA 2QP4A 4OAPA 2VNIA 3MGAA 1R2QA 1GG8A 4J4TA 1K5GA 4FFPA 2X2OA 4MYSA 1NR7A 1O94A 2XUHA 4BV9A 1O4WA 4RL6A 4MULA 3PL5A 2UVPB 3I5UA 4HUQB 5CDSA 2FLWA 2G6TA 3H2YA 4NULA 1CUXA 4O4HF 5IAAA 1C30B 3HPRA 3HUTA 4JXJA 4ZAGA 4F3YA 3GLHB 4BN5A 3D7RA 1KEZA 5K3FA 2YMQA 1HDEA 3KOOA 4MKIA 3TVTA 5LOVB 2HO4A 5M34A 1PUIA 1W73A 1Z4QA 1JT9A 3ZE7A 1LNSA 1RMQA 2AZTA 2QM8A 3M9XA 1G19A 3DGEC 4Y9DA 1KMHA 3RVPA 4L4XA 5AJVB 3D5TA 3FHCB 3HABA 3OJLA 4A6EA 3CVJA 3P0IA 3LKDA 3BIFA 1IHXA 1MDFA 2P2NA 5FBQB 4CIAA 3PDJA 4RVSA 4NPHA 2WHEA 2ZSEA 4EO7A 1PV2A 4OXIA 3FYUC 2HMWA 2ZJZA 3OJ0A 3ONVA 3PEEA 4CN9A 1Q44A 1KTVA 2ZJOA 3SWWA 1QRRA 1WPXA 5DOVA 3MEQA 4YCSA 4KPEC 1W96A 1XA3A 2IPLA 3ND9A 3GBSA 1Z4LA 4M0MA 1Z0IA 4F4DA 4MWZA 3RVBA 5C46F 2N75A 1VFNA 5IC4A 3CT6A 2DQ4A 3VR5D 3WYDA 2BF4A 2XY4A 5KNCA 1F0KA 1GJRA 2YWEA 3KVRA 4B81A 1TYAE 1WMAA 1Z2NX 2R751 2ZANA 3AL2A 3PWTA 3BHGA 1BC5A 4E5DA 4MHSA 3WJ7A 4N7MA 4NCBA 1XJWA 4XYGA 4BFYA 1K6MA 2B78A 3QTBA 4L3WA 3T3GA 4LYYA 2IOFA 5FHQA 1EX1A 3S29A 1Z15A 5KYGA 2V8BA 3G7SA 1CTQA 5J59A 1FPMA 3KSDO 2HNBA 4GMDA 3GVCA 4V38A 3AIKA 4DN6A 2ST1A 2B4QA 3E23A 4MLDA 4X1IA 4NCAA 3FNIA 1PGOA 1JYFA 3UT5B 2VAVA 3K4HA 2QI9C 3AM3A 5K03A 3BCSA 4JN6B 2RHGB 1JDBB 2WTUA 1AMUA 3JASA 2BUCA 3URMA 2NQ2C 2UZ1A 4CLEA 3P26A 1AGPA 2HSDA 1UDXA 2DULA 1U98A 2DQSA 2Q3JA 1OBOA 3C3XA 3C5EA 4KN9S 5C18A 1XAJA 4O4JA 1DOAA 1VI6A 2MIIA 3CNOA 3KQMA 4HC4A 3TI9A 3N70A 2ZRPA 1GEGA 4D8VA 2HHLA 4WZAB 2ZITA 2ZTUA 4Y2SA 4DE5A 4RVDA 3E9CA 3SLRA 3BL5A 2NUAA 3IDZA 2XUQA 5EI5A 4OUKX 4C7KA 1C8VB 3ZDDA 1CYEA 4LPKA 2Q46A 1S2GA 1YT5A 2VZ8A 3ITDA 4WZBE 5JUWA 4DWJA 1H0RA 1FUPA 1V3QE 4ICIA 2VKQA 5F51A 1KI6A 2HLHA 3IJPA 1IQPA 3LCRA 1SUIA 2W98A 5J4KA 1WVMA 4QREA 4KQCA 1VI5A 2E37A 2ZE8A 4O29A 4PAOA 3NC0C 1TTHA 3W6NA 2OXTA 1KEEA 1FFSA 2FZKA 1N6IA 1IY0A 2ZGVA 4IDBA 1YC5A 1OXBB 2W2TA 4FFLA 2GQ0A 2PX8A 4N8EA 5LP6C 2UUOA 1F2DA 4UE6A 1L4HA 2IUUA 1M2FA 4B3IA 1BOFA 2YVLA 2OPHA 2X3UA 1QB7A 5CCBA 2D5AA 1MJ5A 2XTZA 4Q93A 2VHTA 1Z5VA 4OSPA 1EDDA 1I4LD 1OZHA 4GEKA 1EK5A 1G5IA 1R0BA 3CVOA 4TVBA 2K4MA 1SVUA 4HMPA 1KFBB 1PKXA 2YIDA 1ZW6A 2O48X 5DYYA 4EAAA 1KH2A 2OHFA 5ITSA 2VHQA 3EGOA 4IVRA 5K0CA 4AQYB 1QOPB 2HKIA 2VPWA 5IVDA 1B8OA 3PGXA 5IARA 1BS9A 2B37A 5TJHA 3M4YA 2BLLA 2XCLA 2HK9A 2P9EA 1CS0B 2HREA 1SHKA 2SECE 3HCWA 2HMUA 5JRZA 3ICPA 3SQWA 1USGA 2VHEA 4JUCA 2ZYGA 3ZPXA 3OE7A 4IQ0A 1MTOA 4JJ4A 3NQ41 4RH0A 1ZM3A 2ID4A 3LX5A 4E4YA 4DSTA 4NBKA 3OFJA 1CR1A 3ESCA 2P4HX 4HXYA 5AKZA 2V7BA 2FZVA 5J2UF 4OMUA 2XXJA 2OFXA 3LVRE 4Z9AA 4CR7A 4ED9A 2JLSA 1PN3A 1DKUA 4CF5A 1C3OB 1G0OA 1KP2A 2MMGA 2QM3A 3NEYA 4WJZA 5F5NA 4AY4A 5KOHB 4U0JA 5E6RA 4A03A 4CEHB 4RCVA 2C7VA 1A9XB 1VHQA 2ZROA 2A86A 5AJHA 5DTEA 4GMXA 1KMCA 3WHLA 4B3GA 2DLCX 3ZNPA 2GILA 5FWYB 4OGGA 1FXWF 2P9TA 3VH4A 3FTFA 4R2IA 2CCGA 2PWPA 3PFCA 2ZM5A 3K9LA 1SKYE 3HY4A 3THOA 5K09A 1MB0A 1QTRA 3F49S 1H69A 3VKVA 1ZJ4A 4BQQA 4CMIA 2NPOA 2R7AA 4LC9A 5C7OO 1UFVA 1ZYUA 1Z37A 3R6GA 4ZHQF 5F3WB 3MN1A 4TXLA 1AKRA 3FDIA 2I8LA 4F4CA 1N6NA 4HNQA 1QFXA 3FB1A 2NACA 3KL2A 5G2OA 2RGUA 3DSRA 1C4KA 3CXUA 4TTRA 4D97A 1KQPA 2R96A 2C84A 4UEKA 1DS6A 2FRDA 4TVOA 3RUEA 3ZJ4A 4M0PA 5HE8A 1POXA 1HE1C 1ZOSA 1P1IA 2VSOA 3ET4A 3I23A 1M7HA 1SU8A 2ZQZA 3U7JA 4YCCA 2P0AA 3LF1A 3EWAA 3CF4G 2BONA 2QTHA 1UOEA 1UOOA 9ABPA 4URZR 4G5SA 4MV4A 3UJPA 3O7MA 4HMQA 2VRWA 3B52X 1EAMA 2QJFA 4KQFA 4ZAZA 2R6DA 3O0DA 3T3DA 4TV9A 1IL0A 2C20A 3JVDA 5DW3A 3OEEA 1GIAA 3TM4A 4KYUA 4B9AA 2I1VB 5ALUA 2A9VA 1KAMA 4D4HA 1PK9A 3WBJA 3HV0A 4X65B 1GPH1 1PR5A 5KC9A 3UWSA 1JGTA 1EXVA 4IS3A 1V95A 2VXBA 3OCFA 4I7EA 1OWPA 4L4RA 4ARAA 3OWOA 4F4JA 3E58A 3EDRA 3F2IA 3L49A 3LAWA 4R54A 4DLPA 3IV6A 4BQIA 3CLUC 3R2JA 1NDUA 4F3CA 3A27A 3IHTA 3EJWA 4LBZA 4U2CA 5LB4A 1RI3A 2AZMA 4N12A 2L69A 3C8MA 5I7RA 1Q7BA 3PUVA 1G8YA 4HYYA 4Z8XA 1OC2A 1TMKA 3G1TA 4GPD1 4QPJC 3VU8A 2YRFA 3DULA 3HGQA 3O9MA 4KG7A 4XKJA 1IIRA 2WWRA 4KL8S 2FNAA 1D2RA 3L0CA 2XNDA 4K6MA 3ZYCA 4G09A 1EM8B 4M1SA 3L2OB 2XW6A 3DW3X 3QUBA 4QUEA 3IQWA 4KPUB 1IIBA 3NWEA 2NZUG 3JALB 2O2CA 1KVSA 2HPZA 3QXCA 2BPOA 3ZGOA 1Z36A 1FUUA 1I3KA 2HF2A 3MGBA 1UZMA 2ECFA 4X62B 3ETDA 1R4AA 5FPHA 1CUVA 3R9XA 3GOHA 4BO8A 3T5GA 4ZZIA 2ZSKA 3C6QA 4Z7OB 4QUGA 2Q50A 1AE1A 5J5AA 1HEUA 1ZHFA 3DA8A 3U6KA 1ZQ9A 3GLSA 1S6YA 3RAPR 2R25B 1UBUS 1AF7A 4WCFB 3ANYB 4LVOA 4CWAA 1RKUA 1X0VA 2FWNA 3BK7A 4J1TA 2WTNA 2DWQA 1XMIA 3TW0A 4IQJM 3HN6A 1QH8B 4XIGS 2UXCB 1G9SA 5BPHA 2DM6A 3T1QA 1DHRA 3ON5A 2QUZA 4HRAA 3GLIA 5EVCA 4LXQA 2G25A 4YAOA 1ZVMA 3TTXA 2DSNA 5TSDA 2OQ2A 4LWQA 2J5XA 2H1OA 4V2IA 4JAVC 4US2R 2HK7A 2XWSA 4INOA 1MABB 1W5FA 1WR8A 4IG4A 2XVAA 4YV1A 5KOIA 2GEKA 2VTVA 1GR0A 3M6IA 3QFTA 3C4VA 2JEYA 2WAAA 4LYDA 3TZKA 3F5MA 4NECA 2QG4A 3IVCA 3PDWA 2VF7A 1C80A 3L9XA 1LQTA 3IDOA 3WWCA 5KWVA 3GL9A 4GBGA 2GZ2A 1DUIA 1PJSA 3QF7A 2FEOA 4HDKB 5BN3B 2C0QA 5KTNA 3CN9A 2BZ0A 2OE2A 4JJZA 5I4KA 1ADJA 4GWKA 2I0FA 4X20A 1ZD4A 2EG9A 3UJHA 1SKUA 3BFXA 2RSLA 1R8XA 1T4GA 2KS6A 1K1EA 2IS1A 3AVQA 4LI3X 5B53A 3KTOA 5LQDA 4IGKA 3HKEB 1ZN9A 2H31A 3FOEC 2P3OA 2P8SA 3M9LA 4EG7A 1EVZA 1SURA 5G0VA 1YRYE 2L0XA 1I2DA 4U39A 5KYYA 1INLA 1M1YA 2Q9BA 2WDPA 1KNXA 3DHYA 5EE9A 3LA6A 4IKPA 4BMZA 1OIWA 2IRWA 5EPEA 4CKCA 3H5TA 4XOUA 1YDHA 1GYPA 1QHXA 1T43A 3W1EA 2QTVA 4PVDA 3NBAA 1T34A 2ZI6A 3N2KB 4GBED 4BNNA 2FWIA 1YR8A 1XRPA 1U2RA 1H65A 4LJ4A 2YHUA 2K87A 4JI5B 4CFZA 1MHTA 4XX0A 2I71A 3RBZA 3U60B 2WWTA 3UY4A 1TAUA 1AF4A 1EVYA 4A9AA 2FEPA 1J0EA 2I6TA 4JJ8A 1K75A 4NFSA 3P4YA 4AJOA 4S1TA 2Q1UA 2QDXA 1PZHA 3BWMA 4CEIA 1XTTA 2VQ6A 3R1IA 4UVHA 2QKYA 3IE0A 3UJCA 4GMGA 3FYUA 3HJHA 2CXQA 1PLLA 2OB1A 2AR0A 2NVUA 1UDRA 1CEYA 3MXOA 2QQ0A 5DYGA 1M1ZA 4GFDA 5IBCA 4ZAWA 3I61A 4OX9Y 1KR5A 3AHGA 2JVKA 3E82A 1WF6A 5ELXA 2D0DA 4A2WA 1YNSA 2IU6A 3A1WA 3QITA 3OD1A 4AS2A 3R4VA 5AVTA 4ZODA 3B9QA 1GTZA 4O4IA 3LZ6A 4CEIB 3I42A 4AKSA 1GPNA 1TZCA 3D2CA 3OT5A 4JOBA 1QH0A 3UPUA 4ZALA 5DLPA 1XTVA 1ZBDA 3AHIA 3ZV6A 3IP5A 1GZ4A 3OZCA 1QUEA 2W2VA 4IDOA 3R9IA 1GGJA 1LBSA 5HCNA 2QZ9A 4GNRA 5JAIA 4JBXA 4V3CA 1R8QA 5GV7A 2E5FA 3ETCA 4ZOCA 1JEDA 1J00A 1SN7A 1X92A 1Z0UA 2LP4Y 2WPDD 3PQ7A 4C20A 5K9ZA 3T4PA 1GARA 3AONB 1ZR4A 3B5EA 1KY5A 2FW8A 3G2HA 4PAQA 1CUBA 3MPOA 4IVNA 4XQGA 1X80B 1XLVA 1YQUA 4HUQA 4Q48A 1WWKA 2Z6AA 3RSOA 2H1IA 1NLFA 3H42B 4AJ9A 3NRBA 2R5NA 4WGFA 1FMLA 2VCEA 2O8NA 4BV2A 2DPHA 5AM0A 4EO9A 1VSVA 2GK4A 1DRWA 1NW4A 2ZT8A 3D1VA 3EUFA 4XI9A 3V4ZA 4DLKA 3NVAA 2I80A 1E2IA 5DCWA 4B76A 4F5EA 4BBJA 3TOCA 1UJ4A 2FFRA 1P5JA 4XM0A 5GM1A 1IOVA 1CT9A 1KI8A 1PGNA 1R4MA 3KKNA 5JMPA 2P9BA 4ADMA 5J40A 4GOJA 1V2GA 3EVNA 4FGLA 4HVCA 5A3JA 1QP7A 1IPFA 2P62A 1AUOA 3C3PA 1GCOA 3V1UA 3DVQX 4M89A 1R0CA 1U0TA 3DEZA 3W8DA 1NLMA 4L4ZA 1UXKA 2ZQYA 4XD7A 1YFEA 1Z68A 2YASA 5IG2A 1X7GA 4AWAA 1EE9A 3VKWA 4EUNA 3ZEAA 2OV3A 3TQCA 3E9NA 4LTMA 1J5XA 2Y71A 5F5XA 4CLRB 4LMPA 4F7DA 2P67A 2WTBA 4DM4A 3I12A 4NP6A 1JKXA 4K8OA 4PY2A 5KYXB 2W42A 2JD1A 3U4CA 3N0TA 3THRA 1KMMA 3VTZA 4CCSA 5HKBA 2V0NA 4IOJA 4W4TA 1YKFA 5LQSA 2XUFA 4V3BA 4QYSA 1S3FA 5E95A 2CL5A 3ZOKA 5L6MB 3ZQ4A 4IV8A 5KNBD 4G0PA 2I4OA 2C9BA 3O1HB 5HYVA 1J20A 1JQJC 4TLAA 1KRWA 1D0SA 3EVFA 4IHQA 2OYSA 3DM9B 3TBHA 4KE9A 3NAZA 3VHRA 4UM9B 4DR2B 2P41A 3ROKA 1TYZA 5B64A 2ZE5A 4QBTA 4JZYA 3W7AA 4HDNA 4HY3A 1PS9A 5E2IA 4M0EA 3M4JA 5JSZB 2AFIA 3BQNB 3R3VA 5GJWC 2FKAA 2IYVA 3NP9A 2HLNA 2Q3EA 1ZO8A 4TS9A 3OEYA 2VYNA 1A7JA 5LZ9A 1O9HA 2V3VA 2EIXA 2RCYA 1UMBB 2HJSA 3MJVA 3SZGA 4GRAA 2XQIA 1PR6A 1B42A 1CZHA 2NVUB 2NU7B 3E8MA 4ZVSA 5JQGA 2X4LA 3RRZA 4OHWA 3EVAA 5K0GA 2A1TR 3TS1A 3LQ1A 4EMUA 1N3BA 4N65A 1YFLA 1G3MA 1B73A 1JQBA 1YR6A 1E9AA 2A1UB 3B1JA 3IUQA 3HR8A 2E2WA 3KQOA 2V6IA 3LDAA 5HE9A 1H9BA 1E79D 1ODTC 3JXEA 1O0SA 4GH5A 4RXUA 3X0DA 5KSWB 1G7SA 3H2JA 2FJPA 3KYCB 1I2AA 1VLVA 3I9NA 4G56A 5A3SA 2YQ5A 4F0JA 2YWGA 4WASA 3H5NA 2Y1DA 1ZA1A 3LC7O 2YVAA 3LYUA 1G8KA 3LOUA 3KSMA 4PNEA 1E0DA 2ZSAA 2I6GA 4R81A 1Q50A 3ILHA 3BDAA 3OF2A 5CJJA 1EDEA 1VB3A 1NJSA 2WVAA 1OLUB 1H0SA 3A9VA 3D6UA 3DFZA 3R5FA 4H16A 4CKWB 1OHHD 2ZM6B 1HDYA 3HCFA 5K6TA 1PWZA 3GUUA 4LMRA 1XK6A 2BEUA 1NRXA 1BX0A 2W9XA 1XMXA 1I5OA 1U7WA 2P2LA 2ZBVA 1PJZA 1BDBA 2OZVA 5D01A 5HBRA