4L6AA

Structure of human mitochondrial 5'(3')-deoxyribonucleotidase
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
201
structure length
201
Chain Sequence
SNAASGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase, mitochondrial
publication title Structures of human cytosolic and mitochondrial nucleotidases: implications for structure-based design of selective inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 68
structure length 201
sequence length 201
ec nomenclature ec 3.1.3.-:
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4l6aA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4l6aA01
1J97A 4BBJA 3L7YA 2G0AA 1IWOA 4UATA 1RDFA 1J8DA 2I54A 2AUTA 4QQFA 2FUCA 5ALIA 1Z4PX 2RAVA 1N9KA 5E0OA 3ZVLA 3WGUA 4AP9A 1QQ7A 3KD3A 4NABA 2B1RA 4I9FA 1EK2A 1SU4A 5ALWA 3QU9A 2D2VA 4UAVA 5AKYA 1RKUA 5AVWA 1X42A 3S6JA 2YJ5A 3OCYA 2ZG6A 3AR2A 4CF5A 4PNHA 5AI8A 2GO7A 3E58A 2P9JA 4FE3A 4KX5A 2CFTA 3L8FA 2ZBEA 3E8MA 3L5KA 1RC8A 5AVVA 3L8EA 2JARA 4KX3A 4HYTA 3SD7A 4C4TA 2YFYA 3AR7A 5AKJA 5AI5A 1CQZA 2G07A 3A1DA 5AVQA 2ZBGA 5AW9A 3AR6A 2G08A 4BX2A 5AVYA 1T5SA 5AHXA 3B8EA 2YBDA 1ZRNA 4HGRA 4QJBA 2QLTA 3DV9A 5AK4A 3E84A 2HX1A 3L8HA 2B8JA 1T5TA 3MC1A 4KYTA 1QYIA 2QYHA 3VAYA 3AR8A 1ZS9A 2HSZA 2VKQA 3GYGA 4L6AA 3I6BA 2GFHA 3MPOA 3ESQA 3QU5A 2X4DA 4UARA 4UM5A 4EELA 5ALQA 2JAWA 4Y2VA 2BY4A 5ALLA 3DNPA 3N28A 5AW1A 2HCFA 2R8YA 3ZWKA 3NAMA 1L6RA 3QU2A 4OHFA 2IOFA 2Q4TA 4UASA 5ALYA 3TLMA 2YY6A 3ZX5A 3QXGA 3EF1A 1U02A 2WHEA 2G09A 3OTQA 5AK3A 4DCCA 5AVZA 2YMLA 1TJ5A 1Y8AA 3ZX4A 1PW5A 4DFDA 1Q91A 2B30A 3K1ZA 2O9JA 2OM6A 4J2TA 5AW6A 2MU1A 1QQ6A 2FPRA 2WF8A 2NO4A 2HHLA 4Y2XA 1XPJA 4YCLA 2B1QA 3NANA 3PCTA 5ALSA 2FPWA 1WR8A 5AW0A 3WKCA 3NALA 3PGLA 3HYCA 1RQLA 3M1YA 4CE6A 2CFSA 1AQ6A 2W11A 1VJ5A 3OCWA 1NRWA 2O2XA 3SMVA 2P69A 5ALPA 2P27A 1RKQA 3U19A 4MUMA 3QUBA 4BNDA 3I1YA 3AR9A 2Q4RA 2G06A 3FZQA 4G9BA 2WM8A 5AIBA 2FUEA 4UMDA 5A3SA 2OYCA 2FPUA 3UMCA 1N8NA 2IOHA 3SF0A 1T9ZA 5AKKA 5ALUA 1WZCA 3B9RA 5AVSA 4GIBA 4F72A 1RLTA 1KYTA 2YMPA 4C4SA 4UU0A 3U7HB 3ZTYA 3RFUA 1Z4IA 1L8OA 4UW9A 5T41A 4L57A 4BEWA 4XE5A 4MWOA 5AKEA 2OA0A 1L7MA 3PDWA 2YMQA 5AVUA 4HGQA 2WF6A 3N07A 1L7OA 3NUQA 4G63A 4KN8A 1Z4MA 4XQ0A 3ONNA 2I6XA 3J7TA 4XOUA 1U2SA 1RQNA 3W5BA 3SHQA 1FEZA 3L8GA 2FEAA 2C9MA 1ZOLA 3R09A 4FYPA 3R4CA 5FP0A 5IS2A 1Z4KA 3ZW7A 4Y2SA 2R8ZA 5AI9A 5AKHA 5AW5A 1ZRMA 4NV0A 3A1CA 5AK6A 3WK8A 2EARA 5A3RA 3EWIA 4NAVA 4XPZA 5ALOA 1QQ5A 1K1EA 2JAOA 3FPBA 3U7GA 3IRUA 2YMMA 3QU4A 4UMEA 4E88A 3FPSA 5A3QA 3BA6A 5AW8A 2GMWA 3DDHA 2I7DA 3PGVA 4HAIA 3N1UA 1Z5UA 4O8CA 4BKMA 3QX7A 4NWIA 2I55A 4IFTA 1WVIA 3A1EA 2W43A 5AI6A 1YMQA 4JDPA 3OCZA 2ZXEA 1VJRA 2BDUA 2Q5EA 4AS2A 2DQSA 3QGMA 1Z4JA 2FDRA 3CZ4A 4YGYA 5AM0A 4HGPA 3E81A 4BNDB 1VFPA 1U7OA 2IYEA 3AR5A 3IJ5A 5AKIA 3N5KA 5IT0A 1U2TA 5ALHA 3A3YA 3UMBA 4EEKA 3OCUA 3U26A 5AVTA 1NNLA 1YJ5A 5ALRA 3WKDA 2GHQA 3B9BA 3ET4A 3WK6A 5ALNA 1RPZA 1YS9A 4DWOA 2R8XA 2RBKA 5AM4A 1Z4LA 3QUTA 3ET5A 3DAOA 4EENA 3WKEA 2HDOA 1RRCA 3I76A 2NO5A 4OFZA 1L7NA 1O08A 2EAUA 1Z5GA 2RB5A 3WKBA 4J03A 1ZD5A 1TA0A 3AR3A 4EX7A 4ZEVA 1ZD3A 3NRJA 1CR6A 3RF6A 3SKYA 1YNSA 4BEVA 4KNVA 4CNQA 3SKXA 5AK5A 5ALZA 3U7FB 5ALDA 2AH5A 1RMTA 3ZVMA 2I34A 4C4RA 3ESRA 4Y2YA 4RETA 4YCNA 2RARA 2YJ6A 2ZBFA 4Y2QA 2HO4A 1SWVA 5AI4A 3EPRA 1YDFA 3ED5A 4Y2JA 3KBBA 2B8EA 3OCVA 4OD0A 2C88A 3U13A 2IA5A 1S2OA 4JB3A 3IB6A 3I28A 1Q92A 1RLOA 3OPXA 4BX3A 5AI0A 1XP5A 4NFLA 3CNHA 4OCZA 1F5SA 2HI0A 4YIHA 2PKEA 2WF7A 1O03A 3NASA 3QYPA 3L1VA 4CF3A 1Z4OA 5ALJA 5ALKA 2C8KA 4UMFA 2HOQA 4EX6A 2C8LA 3N8GA 2B0CA 4IG4A 5AESA 4H1WA 1ZD4A 4BYGA 2B82A 1LVHA 5AKGA 2W4MA 2I33A 3MN1A 2IOFK 2YN4A 3QU7A 5AKXA 4YCMA 3P96A 1TJ4A 3QNMA 4ZEXA 1SWWA 5ALEA 3KDPA 1TJ3A 2GHTA 3L0CA 2R8EA 5ALMA 5AW3A 3WKAA 2G80A 5AM1A 2OBBA 3UMGA 5ALVA 2ZOSA 2P11A 5AVXA 3KC2A 4HGNA 3QLEA 4I9GA 1Z4NA 2HF7A 5AVRA 4UU1A 2MSNA 3ZUPA 5IT4A 1U7PA 3M9LA 4FFDA 1LTQA 5AICA 3OCXA 3BWVA 2BDEA 3FVVA 4Y2RA 3ZU6A 3KOOA 2AMYA 3ZVNA 4UM7A 5ALXA 2NYVA 3WK9A 5AM3A 1MH9A 1L7PA 3FM9A 5AW7A 2ODAA 1ZJJA 2YJ4A 3L0BA 1S8OA 5AM5A 3W5CA 2FPSA 3KZXA 3NIWA 3D6JA 3U7EB 3AR4A 1XVIA 4F71A 4KNWA 4Y2TA 2FPXA 1ZD2P 2YJ3A 4YH1A 2C4NA 5AW4A 4L6CA 3HLTA 1Z4QA 4Y2UA 1TE2A 3SLRA 4YIKA 3WGVA 2WF9A 1Z88A 3ZTWA 3W5DA 3EF0A 5AM2A 4UAUA 3L1UA 3L0YA 5AKLA 4AS3A 2WFAA 5JJBA 1RLMA 1RMQA 1NF2A 3F9RA 4ZEWA 2CN1A 3UM9A 2G1AA 1JUDA 1L8LA 3ZWDA 4B6JA 3QUQA 4DW8A 1RKVA 2PR7A 3MMZA 1WPGA 3FGOA 2CFRA 2HEGA 4GXTA 2JAUA 5ALFA 3WK4A 2PQ0A 2HF2A 2WF5A 1EK1A 5AIAA 3QUCA 5AW2A 3R9KA 5ALTA 2EATA 4BX0A 4UMVA 3WK7A 1QH9A 1RMYA 4CF4A 2ZBDA 3W5AA 4HGOA 4EZEA 4RESA 1YV9A 4Y2PA 2JGAA 4Y3UA 3WK5A 2FI1A 2AGVA 3ZI4A 5AKZA 5ALGA
chains in the Genus database with same CATH superfamily
2PUEA 2P4HX 2BH2A 1QGZA 1QIDA 1XQ1A 1YZYA 3R6VA 2IPLA 2QOEA 1VG9B 4QQFA 3KZKA 3SXUA 4TXJA 1J9EA 3O7MA 5ALIA 4C0LA 1PF7E 1O94D 1U5CA 1U2EA 3OOSA 4MB6A 1SEPA 1KZ1A 3NDPA 3HDGA 3FOCA 1Q19A 3OCCA 3DNFA 4H60A 3TW6A 2JA1A 3NHUA 4EFLA 1EKXA 1G21A 3TB6A 1OAKA 1YHNA 2WZDA 3VAAA 4JLDA 2BFDB 2C2KA 2BLLA 2HFJA 1AXEA 1H8EA 3OCYA 5SV2A 2I4LA 2OZPA 3ECAA 3KT3A 3I6YA 2ZJ1A 4YJGB 4JZKA 3C4VA 3QTBA 1HQCA 1Z28A 3GU3A 2JCBA 2GK6A 4GZMA 4IXWA 5AD1A 1MJHA 3KKKA 1TU3A 2W0SA 1AKUA 1XO1A 2NGRA 3GLKA 2QUAA 4S1NA 1PGJA 1LK5A 5K03A 1OFVA 2H54A 3RB8A 1NUHA 3PD0A 1DG9A 4MV9A 5CG1A 2ZAOA 1GSIA 4GOXA 1YFKA 1NTRA 5LDGA 1UM8A 4C04A 1ZHHA 1FNMA 2XJ4A 3LU1A 3CLUC 4GWLA 1KORA 5FOQA 2NXWA 3CXUA 1K62A 4LHZA 1Z5OA 3NTQA 4BX2A 1MU0A 3DVSX 4WJZA 4TUYF 3AM5A 3NOXA 4XVUA 2ANCA 3OECA 4NG5A 3LWNA 3AF4A 2AOXA 4YK7A 3T9AA 3CZPA 3PTLA 1EVQA 1YWGO 1U1FA 3LBHA 4KGXA 2PUVA 3PPYA 4FEAA 5EHNA 3TVYA 3G8DA 3RS7A 1TCCA 3R8FA 1SIWA 3HR8A 1C1HA 3FOWA 3CYFA 3QG5A 5IM5A 3DFUA 4I50A 1AUPA 5E8JA 1N34B 2BE9A 3E3NA 5HJ7A 4FSHA 5D51S 1N8TA 4PLPA 3RTDA 3R3VA 3FXAA 3D6TB 1CX9B 3IQXA 4YRAA 3N0VA 5ALQA 5ITZB 3EODA 3CZ5A 4BMZA 1FRQA 4OHXA 3LPLA 1BSVA 1Z3IX 1WXDA 3OEHD 1MJNA 5HIIA 5K1ZA 3GNSA 4L9WA 3JD1A 4V1CA 3LWZA 5DNVA 1MHPA 4Q15A 1SCNE 1T0IA 5ADUS 2H5IA 2WDZA 4UJ5A 2OL4A 4WUTA 2OFFA 3ZX5A 3G8CA 1IJFA 3IPYA 3OZIA 4XTRA 3A3OA 3CB2A 3H3XA 4H3KB 3T5MA 3ZEAA 4NRDA 3P9ZA 3K72B 3DMRA 3AEUB 3V8MA 4DIOA 5EQDA 1J2UA 5A4DA 4ROSA 4DMMA 5TLSA 1IBCA 4XIIA 4RZHA 1YR9A 4W5QA 1IUNA 4K86A 5JNSA 4C4AA 3P2OA 2QN2A 1HO3A 2H1OA 1T15A 1EGMB 2ZPAA 1YJ8A 4C0SA 2BCGY 4GHWA 2AFIB 3K4QA 1K2WA 4K3VA 4BQFA 2JHGA 3WAKA 5DP1A 5EQJB 1ECPA 2FPRA 1NLZA 3UFBA 3H3FA 3PXXA 1W9HA 1YRLA 4AZ3B 2H57A 4RD4A 2G0NA 3AERA 2OXTA 1OA1A 1V4NA 5MFZA 4QM7A 1QB7A 1VL2A 4G89A 4B6OA 4M8SA 3BSWA 2Q4EA 3TQTA 5FUXA 1DTWB 3CRVA 3E9YA 3R5KA 5AVKA 4DSAA 4HC4A 4WJKB 2QTBA 4FUQA 1AQ6A 3WHPA 2VBFA 4XM1A 5CLGA 3OCWA 2AE2A 4WCFC 4BVAA 3MG9A 1EB8A 1RAGA 2ZEJA 3O1JC 3F7TA 3DKRA 4GBJA 1M1YE 1NAIA 1LPNA 1DX6A 4M7WA 4TQGA 1AJEA 1Q11A 3U19A 1P60A 4PU0A 1AVTA 1I2DA 3CN9A 1DJNA 3KHSA 3PFGA 5JS7A 1XNJA 5JS1A 1JA9A 1G3IA 1HTBA 3SEAA 2H7CA 1QK3A 3S2ZA 4UMDA 4P33A 2VA9A 4N3GA 2BFOA 2EZ9A 3IB3A 1NI4B 4RLQA 5EKUA 2ZT6A 1W4CA 2P6RA 1TAQA 4M83A 3HC7A 4G1CA 5EEHA 5TQJA 4B9EA 1OH8A 1TUBB 3HKCB 1J7KA 2XCRB 1QZ3A 2W2TA 4YAGA 1KJZA 1WUHS 2PH3A 4JLKA 2XUFA 2GKGA 1T3ZA 4B7XA 2J0QA 3B70A 4L57A 3DEAA 4Z9YA 5C8YF 4UEJA 3EZGA 4HX2A 4I66A 4MRSA 4Q4AB 4CZ2A 1MV8A 2FSIA 4HPJB 1J8YF 2SNIE 3CO5A 3LRPA 2VF4X 2FZGA 4U8HA 5GWXA 4PINA 5TMBA 4J1TC 1RAEA 4B87A 1TZKA 1AHHA 1J24A 2ZUDA 3FCOA 4BFZA 1SXGA 2YMQA 2Z3VA 1Z7WA 5CA1B 2OGSA 3CKLA 4XZ3A 5I5EA 5J47A 2QL9A 1E4EB 2EP5A 1XQVA 2WHQA 3EZLA 5JBIA 4DJ5X 3RIMA 1KOJA 2Q9UA 3HE3A 4IGIA 4IDNA 5DLEA 4F9FA 4HQ0A 3BJIC 1UDBA 4XOUA 4RIHA 1AUVA 1SRQA 3CR3C 3R5SA 4PZDA 3SHQA 1HEYA 3G1WA 3WLKX 4B80A 3I04A 5M04A 1LDMA 1NVGA 4TS9A 4PAMA 2Z5GA 1TPYA 1Y6GA 1YA4A 5BNIA 1BEZA 2HBYA 4NCHA 1UKCA 5TGTA 3TOCA 3QF7A 4UHKA 3EXAA 3OTOB 3IBYA 1FBNA 1XEXA 4DWWA 2BEVA 4KDFA 4OGFA 3G9XA 2ZB3A 4YJKA 4R1OA 1ZRMA 4MWCA 2GUWA 3RVBA 1QO0A 3KUCA 2CDRA 4OSOA 1ULUA 4QDJA 3EWNA 1ZR2A 1M1NA 1G8AA 5A3RA 1N1EA 5CD1A 3QFSA 2NSJA 2XB9A 3DVAB 2XUIA 3BZBA 3E05A 2VP2A 3DE2X 4LY9A 2YX1A 1AOXA 4IAOA 3W1WA 4BP1A 3ABZA 3ZCRA 3BMNA 1DEHA 4P58A 5FPKA 1F9EA 3TUIC 4ZCLA 1IOZA 2VHUA 2C99A 1Y1KE 2IY7A 1BX1A 3TTYA 5KPJA 4AY5A 2YOHA 1M33A 5I9SA 4UNPA 4WXPA 1YI1A 4XEUA 4B3HA 4CMCA 1J00A 5JAPA 4B43A 5EWMB 3ZZUA 4Z1MA 4MWZA 2V54A 1EFTA 1PW7A 4BKMA 4JYMA 1XQXA 3UAXA 4DDHA 1ECCA 2CVZA 1W2WB 2A0FA 1U15A 1Q84A 2IKSA 2Q1XA 4YCJA 5DNDA 4I1IA 2Q6KA 1XDSA 2FPPB 2PU5A 4ECEA 4P22A 5I51A 4TTVA 3H9QA 3Q4GA 4WW0A 3ZJVA 1G20E 2FPLA 3A6JA 3R1IA 2O1WA 4FWBA 5DE3A 1LK7A 1X1EA 3B5JA 3I52A 2NT4A 3P9CA 4IZIA 4LSGA 4WXEA 3B8HA 4DS3A 5A5VA 3D4LA 4BNDB 1JU3A 3EWSA 1N5OX 2QT1A 5A0FA 1O77A 2Z1DA 5HA5A 2JZOA 2WUGA 4M46A 1WX1A 4A6XA 4AF7A 3H4TA 2ZROA 3IHKA 3DBHB 5EA2A 3U56A 1GSHA 2XBLA 4G9EA 3K6JA 2D7JA 1C7RA 1A8IA 5ARDA 2QJTA 1VDKA 2XZTA 5KNCA 4I55B 1M2NA 3A70A 2WMYA 1ML4A 3GIWA 4ZAZA 4UBIA 4EKEA 2MINA 3DO8A 1X1SA 4CM9D 4RCYA 1G6HA 2QRNA 3C4JA 4R81A 5EIFA 3RK4A 2ZE7A 5DOZA 1E2KA 2EQAA 4DSOA 5DSXA 3F47A 4GOJA 2F64A 3CTMA 4C4ZA 3GLIE 4PW0A 3RADC 1B6TA 2IELA 3PB3A 2XZDA 1IY2A 3QFCA 5JXIA 3UATA 1ZUIA 3GJZA 3KPJA 2RE8A 4ZOLF 2P6OA 2QTWB 1RRMA 4CTMA 2B34A 2E4AA 3DUFA 3PF9A 4GKAA 3WKBA 4I4TA 3MQ2A 1R8YA 3K4PA 1PJ8A 4GMFA 4Q02A 1SUWA 2KE5A 4GLLA 5EQTA 5ETJA 4YDQA 3OH8A 3E5NA 1V3UA 2LRHA 3CEPB 3EJWA 4I9HA 1GWNA 3Q40A 2HSEA 4ML3A 3HHEA 4RVGA 4W1QA 4YBRA 2UUAB 4WWHA 1ENOA 5K3OA 1O6GA 5C80A 4BFLA 1M7GA 1NVAA 2OQ2A 4FWIB 4EW3A 1IXSB 3HABA 3HBAA 4D80A 2QU7A 4KRXA 3D7KA 1D9ZA 3NJ4A 3C5CA 2V0CA 5KTSA 4FZRA 2EZ4A 1US8B 3BFKA 3O2NA 3KJEA 4DDMA 2AZXA 4CDRA 3EDMA 3LT0A 4RTRA 2OGTA 2WFLB 1JFTA 1C0PA 2HTEA 1X1RA 2FMIA 2G04A 3OEYA 2ZBFA 2E1RA 1MABB 1ZUD1 5DHPA 3PXGA 3FDZB 2DBVO 2HSJA 3H4MA 2RC6A 1SCAA 1LTKA 1JVBA 1BVUA 2EDCA 4X60A 2OSVA 4ZU1X 4CLHA 4IV0A 4F93B 1KDVA 2FQ1A 1JXQA 3CO0S 1XP5A 4NHEA 3ILYA 1Z3CA 1AF7A 4ZCIA 821PA 2O8EA 2PS3A 4DCVA 4YIHA 1YCHA 1U80A 4OHBA 3IBSA 2P5UA 2WVJA 3T3IA 1E1NA 5A7HA 5C46F 1Z4OA 3FI9A 2XODA 1C7QA 2ZS8A 4LK2A 4RHEA 4FLEA 3S7TA 2RI6A 4JEMA 5EJ4A 2FFHA 1EU1A 3K3PA 4C6SA 3TM5A 3H65A 2BUCA 6NULA 5TMDA 3W2EA 4C2AA 1N78A 2Q1TA 4TYNA 5HRCA 3RIGA 1JR4A 3TPCA 1M1YA 4HHEA 2O2DA 5HMLA 3QU7A 4MYSA 5IXYA 1CDDA 1I1QB 1TJ4A 2G4CA 3KDPA 2GHTA 3E7XA 2G4LA 2XNKA 4QYTA 1T0HB 1TJVA 1U3VA 2R8EA 3GJRA 1IG3A 2OOKA 3OE1A 5AJHA 5ALMA 1OGIA 2NZYA 2X8BA 3D5EA 4HNAA 4PG7A 5AM1A 1DAPA 3SDBA 4LDPA 3UMGA 5K4GA 1W36D 1OYWA 1TEZA 1O54A 2LNDA 5I9LA 5FUQA 3QF4A 4M22A 3ZBQA 3HB7A 1RLUA 3ZGXA 1C3OA 2HF7A 4BWFB 4KXXA 3W4KA 1E94E 4GECA 4OAOA 1NQOA 1R0RE 2H0RA 4ME6A 3R7SA 2VHEA 1K6EA 4H31A 5IT4A 4A27A 1PK7A 2ERCA 3ZIAD 1FVFA 2VRCD 3I9JA 1U1DA 2IU6A 3OCXA 4GI3A 4D8TA 2PT7A 2FWBA 4CIXA 5KC9A 1P75A 3NFYA 1I1OA 1XTTA 1YAHA 1YQXA 4H6XA 4XPIA 1S3SA 2GK4A 2IHKA 1YONA 1B4DA 2GAIA 5AOCA 4NSNA 1D2EA 4PLYA 5F1KA 1W30A 4ZO8A 4EHDA 9LDTA 2VUSA 4F9GA 3TSCA 2QJOA 4F3KA 4WY8A 1LPOA 2DBRA 3KP1A 5IAGA 1MH9A 4AJ1A 1YBVA 4WHMA 1W0JD 1M66A 2FRDA 2ZUBA 3C3KA 3GWGA 4ZT6A 4F91B 1OXUA 1OXBB 2GPYA 1TUEA 2H2DA 1G5HA 3B3AA 1DIBA 2PHZA 2VI5A 3AV3A 5EXPA 3RIXA 4JYAB 5LA6F 3EISA 3KELA 4RKEA 3WGZA 4YAUA 4D99A 4ZJYA 3U60B 3MWGA 3RVJA 2JIOA 3UJAA 3EH1A 3QFHA 4OBBA 2FEXA 4G0OA 4GLFA 3LUHA 5CFQA 3INGA 4HNUA 1U7TA 3R0VA 3MTBA 1A76A 2FMUA 3CRRA 3QW2A 1AUXA 3NJRA 2IW1A 3HLTA 5FA5A 4EB6A 5AJWA 1JLHA 1UBRS 1EFCA 2TSYB 1DS6A 1LJUA 2BGIA 2HJVA 3A4NA 2CK3A 2O3RA 2YS7A 3CW2A 3PT5A 5CH3A 5BYJA 2VQEB 2OXFA 1HA3A 3F3MA 3FNRA 5FXMA 2WSYB 1YVRA 1KO7A 1FP7A 1VHTA 2H3HA 3LWDA 4Q1EA 4QGBA 4D3SA 4HMOA 1YB7A 4IYRA 2AKEA 3I1JA 3ZKWB 3GW8A 2ONZA 3LH5A 3EVGA 3CVYA 3L1UA 3BIWA 5IHXA 2HA0A 4OJQA 1TQ8A 4A0RA 4NU8X 5HM8A 2PKQO 2XMBA 4CV0A 3N87A 2BW0A 4GX5A 1RD4A 4TLBA 3ZWDA 4MVJM 3HYRA 1KH2A 4IMIB 4WESB 5AXCA 4MYHA 1XC7A 4CF6A 4BQQA 3E22B 2R1TA 2B1JA 4FI3F 3V8QA 1LF5A 2JAUA 2A0UA 4ZI7B 3IIEA 1AMOA 1IONA 3BXGA 5H3LA 4HRXA 2AD1A 2WF5A 4OKNA 5LNK6 1X92A 5IFLA 3ZLJA 2I3AA 1ES9A 3ZS9A 5CT8A 1TQ4A 4HD8A 3TCNA 1X39A 4LNUB 3ZJTA 2UZ3A 5GJWC 2QVGA 3OZSA 3PUZA 2WWIA 1G20A 1S7GA 4RYDA 4UMVA 3OVMA 2CEKA 1E96A 4G1VA 1JBQA 3C6XA 3OT1A 4PQRA 4F1JA 3MJEA 3NT4A 3PDIA 2NZWA 4PSUA 3TFWA 4MS1B 2I4MA 3WJ1A 3KQYA 2H06A 3B12A 3H1PA 3HWRA 2FI1A 1VSVA 3TPZA 4Q9HA 2GCEA 3GR6A 3V8NA 1JHAA 2FSFA 3MJ4A 4ZEMA 1N1MA 1XTKA 2BSAA 2FK7A 3I01M 4KLCA 3JVVA 4OIFA 5JEEA 1DMSA 2KLHA 4FR5A 2V98A 2PO7A 2X2FA 4K26A 2QTLA 4J7UA 4U7GA 5C1OA 2ZRPA 4HDRB 1H2RS 4FFOA 5BXYA 4AMZA 3T3HA 2NTVA 3AFOA 4RVSA 4B46A 3HKEA 2QRHA 2K87A 1WNTA 3FRJA 4H2DA 4JP5A 4UD2A 2BM0A 1XAGA 4US1R 3ESXA 1VFNA 4ZOAA 3N7UA 3T94A 3BHIA 1RKBA 3UKDA 2Z30A 4NOLA 4QT0A 3GLIA 4ZHQF 2PUAA 4AP9A 2WQZA 3HUEA 3KD3A 1Q1AA 3N39C 4HLQB 3VX3A 3WRYA 6Q21A 3SK0A 1EIWA 1DJMA 2VBIA 3P9KA 3N86A 3QSGA 4M1WA 4ZQEA 1QGUB 5L3QB 1D9XA 5IX8A 4P7JA 2XDQB 3LBIA 4GVLA 1KI4A 1MB0A 2XNDA 4B3IA 1KS2A 1X8KA 5JTUA 2BT4A 4H1HA 4KQCA 4D82A 4I08A 2XA9A 5EZ6B 3VR3D 1EINA 1UOEA 3O2QB 4CF5A 4BKUA 3ZE1B 1FZQA 4ZAYA 4XVRA 1BXZA 1ZR4A 1RWPA 5JJKA 4BRSA 1U0RA 2VSFA 3CZRA 2IHJA 2JNWA 4LXQA 5KKNB 5A6VA 4GX2A 3MWLA 3VOAA 1WM1A 2WY2D 2ZIEA 1CRWG 1GVNB 2AN9A 1NSTA 4CI0B 1SCKA 2ZYWX 1RBZA 5DT2A 1XF9A 1RWNA 1C0IA 4MB2A 1XCBA 7YASA 2VG8A 4Q7KA 3A37A 4X8HA 1F06A 5FOUA 1UMCB 3I12A 3HKDB 3U09A 3F8WA 1YGYA 4BGUA 1W75A 4A5SA 3KOWA 5L3SB 3RAFC 3RPEA 4PYMA 3OQIA 2OEPA 3NHPA 1WB4A 5HJEA 2W37A 4U2BA 1Z0SA 3IHTA 4GR9A 5JEDA 1V0JA 5IVHA 2VDWB 1JILA 3L04A 4FHCA 1D0SA 1UEIA 2VYND 2CDCA 3NV9A 4B85A 3LP6A 3UJPA 4FT2A 5IWCA 3DGFC 5J23A 2O0LA 2V5VA 4RFVA 1JHQA 2OQIA 3CUSA 3GLHE 2GCNA 4H6WA 4ONEA 4B84A 4QJ3A 3K70B 1QNFA 3MJVA 2JAWA 1QVWA 2G67A 1HORA 1QKIA 3EGCA 1OC4A 4P3XA 4MOWA 5TXGA 1DXOA 3B1YA 2MR5A 3QU2A 4IDGA 5K2MA 4CIDA 4LA4A 2HU2A 4M9QA 3VSCA 1SGWA 4TVOA 1NDUA 1Z47A 3K8ZA 3P32A 5DLDA 3W7AA 1LB1B 4RPCA 2OTCA 3TWOA 1ULSA 1BJKA 3OTQA 2PCLA 5AMXA 3THXB 2O52A 2DHDA 2QRMA 2W2MA 4Y7CA 4MIEA 2WT8A 3BQMB 3BWYA 3NV7A 3JQCA 4L5CA 1Z0DA 4MW7A 3DLTA 2PZMA 1P39A 1SBQA 2FEOA 4MPPA 4DAEA 2V8BA 1FNCA 1TFUA 1ISHA 1PUJA 3IULA 2GVZC 2XLBA 2GBLC 4QNMA 3LX6A 1CE8B 3I32A 4FN5A 4Y2XA 1S3IA 1W5SA 3AILA 3PGA1 4N8SA 1R1DA 5KSPA 3OQ1A 1JJIA 3THOA 4HDOB 3MELA 5CJJA 4JXXA 4BLUA 2CJWB 3DLAA 1FXSA 4OHPA 1GDDA 1JMKC 1KXJA 4YWJA 1IB0A 2E1PA 3L41A 4E51A 3IEMA 4YY3B 4GMGA 5EEGA 3F46A 3O38A 3H5NA 4KFUA 4KWTA 4JLPA 5BW4A 1JHPA 5MN5A 1Q1GA 2FH5B 5CH5A 3OOJA 2IV3A 2ZANA 4LC0A 2OHGA 1T3TA 2VK1A 3WGMA 1T8TA 2L19A 2WLSA 2ACKA 1TYCA 1EGQA 1P5FA 3O3CA 4P80A 4EI8A 1S5PA 4BMYA 5GOZA 2QIOA 3GRPA 2D54A 1Y7HA 2WM8A 2PX4A 1GY8A 3DO5A 1YR3A 4HATA 2A5YB 4M9XA 4RWZA 4D0LB 5CA1A 2OYCA 3ZPXA 1SZCA 1OKKD 2Q1YA 3BAFA 3CNOA 3FVQA 1WHSA 1FYWA 4TXMA 4AZVA 2RMKA 4O6VA 4NH4A 4YT2A 2LIPA 5ALUA 1YQGA 3T1NA 1OZGA 1VIYA 1G41A 1YHZA 1ZFNA 2OO5A 4MYTA 1P9LA 5CDGA 2JBWA 2Q27A 1X7WB 1CUDA 5BR7A 2ZCJA 2PFKA 2VJLA 1GN8A 4MQ4A 1UEJA 4Q18A 1KFKB 2H2FA 4U6SA 2JGDB 1TT5A 3SEQA 3ROPA 3KYDA 4LY6A 3PPVA 2KS6A 1Z13A 3E2MA 1GZVA 1YS7A 4IDPA 1SUAA 2Y4OA 1KMIY 3OZRA 2PU7A 4C4YA 1U2DA 3A14A 2ZAGA 4ZRNA 5JCJA 1T91A 2D62A 2EJBA 2CT8A 6REQB 1PJAA 1II8B 1GTMA 2F9MA 2BGGA 2Q3FA 2Q50A 3W2HA 5JT1A 7REQB 2G1JA 1XQYA 1VHJA 1SUDA 1L4YA 2YFHA 1R4MB 2QTMA 3A9CA 4F3NA 3L8GA 2GD6A 1VP9A 1VMKA 3O8QA 2PXXA 2C82A 3WC4A 1LD3A 1PJ3A 1QJCA 1UOOA 2NU6A 4AKSA 1Z6XA 3KTAA 3R4CA 4Q00A 5HE9A 3CHYA 4DVJA 3HNOA 3LVQE 3WBKA 5JSHA 3B51X 5JWHA 4L28A 2IYLD 1IM2A 3I83A 2ZR0A 1X3SA 1CB0A 1F2UA 5AI9A 3KX2A 5SZJA 2V9ZA 3IR7A 3KSRA 3OZUA 3RODA 4U9HS 1G3RA 3V97A 1G55A 1NZJA 1G5QA 2VFAA 4FCWA 1HY3A 3QI7A 4HBGA 2A7XA 1KDYA 3STTA 3UHFA 4NAVA 1GM5A 1VHQA 1PFWA 2M6RA 4DLYA 3ZJUA 3RR2A 5FL7A 5A4FS 1DBRA 1KFBB 1BMFD 1ZPDA 3O9ZA 1F2TB 1RJDA 4BFUA 3A2KA 3CA8A 3IE2A 3QM1A 3TX2A 3KJQA 3UJBA 2D1SA 2XVAA 4LYGA 3FAZA 1E5QA 1BE0A 2VP6A 2CNNA 2GD0A 4R0VA 5B1HA 3PC8C 1R4NB 3GG2A 4E70A 4H3HB 1O89A 2QHXA 3ACCA 2A5DA 4PY2A 3OZTA 1ORVA 1QHHA 1QHXA 1Q0SA 5BYAA 3M2PA 2JLUA 2O8NA 2VDQB 2ON6A 5FBWB 4LHVA 3C8HA 3SP1A 3I3SR 5JVDB 5CDYA 1HYGA 1EFVB 3H8VA 1I33A 2J0UB 3EZ9A 3A1EA 3H1BA 2YFQA 4MS3B 1WETA 1PYGA 1CY0A 3R24A 4QNNA 3WP1B 4C5BA 2QTFA 5C7YA 1CEYA 2ZBQA 3DL0A 2HCJB 1NVDA 2VDNB 3CPJB 3Q11A 4BHTA 5E4FA 2UXBB 3COSA 1Z0UA 2H1WA 5CM9C 5B1YA 3NTVA 2BDUA 2VNAA 2FY8A 4JA0A 1EBUA 1GNRA 2XPCA 3Q9LA 4M0PA 3U48A 3P97A 4Z1OA 3EZFA 4RULA 1NJSA 1P2TA 3FDFA 2OKGA 4U3JB 1L5HA 3ER9A 4ND6A 3AU8A 3KYCA 1T2DA 4FM9A 4F97A 3A32A 4LHWA 3SS7X 4PZCA 1QVAA 3NIDB 1P1BA 2E6UX 5IVPA 1E5TA 2WJAA 3ICOA 1NG1A 2VAPA 5H1YA 4C05A 4KZPA 4D5GA 2DZDA 1L4HA 1EJ0A 3GLUA 4QYXA 1QGAA 3RROA 3ZWWA 1KP9A 3GLGB 4PLFA 2QVXX 3OCUA 5F1PA 3ONWA 1WKBA 1E6CA 2IS6A 3E3MA 2AYXA 4Q1BA 1V3QE 1CZNA 3HUDA 1E6UA 3LGSA 3O4JA 1E64A 1QF6A 4L16A 4P93A 2DFVA 4QBIA 4ZAWA 4ZU6X 3ZGVA 1OJLA 4PPQA 4R05A 1WSDA 3OJCA 1KYQA 1R2QA 1VLLA 2C20A 4HZUA 3IUMA 5EJ2A 4ZTZB 1KEVA 2J87A 4WASA 3RG2A 2HDOA 2GFQA 2YC4C 3QPWA 3CMMA 1FTNA 2VYCA 4G8JA 1QBGA 5LOVB 2IH2A 1Z73A 2PX6A 1JWBB 4QAQA 2H8GA 5LQUA 5JNVA 4RM2A 1ND5A 1M74A 4CLDA 4TSKA 1FQKA 3U9TA 5CDSA 3E35A 1M67A 1L4GA 3SKYA 1YNSA 3CWQA 3G13A 4OMUA 3A28A 2XTAA 3GLHA 1KI6A 1SVLA 1LGYA 2BR4A 3K1AB 4XX1A 4ZVVA 3U7QB 3PRJA 3WWZA 5CEEA 3FUXA 3M6WA 5EUQB 4EHBA 2O2YA 2MMCA 3HPRA 3ACDA 3KB1A 5ALDA 1NI5A 3FIJA 2C4TA 4G4SO 3RSGA 1E3JA 5HGXA 2ZJYA 3FYUA 2KPOA 3R3XA 1OC2A 1WP4A 4ZCQA 2J0SA 2EL9A 3PK0A 4Y2YA 1HV8A 3H9UA 2O4UX 1Z45A 1U94A 4CGYA 3RFFA 1ESNA 4MYCA 4L7QA 5BQXA 1DC4A 3EFBA 3S7ZA 3HXQA 1GPMA 1Q1EA 4ILEA 3EA4A 1K8RA 4IJKA 2O1SA 4K87A 1SXJB 1DPGA 1JVSA 2XCQA 3IJPA 4B7AA 2HO4A 2CSUA 1WRBA 1H65A 2VPXA 3CTPA 4QFBA 3URMA 2GS9A 4Y2JA 5HCUA 3NM5A 2ZGVA 5BRJA 1TCUA 3BHNA 5HRAA 1HFEL 2P9QA 4R8KA 4TT3A 3SS8A 5IVIA 4XFKA 2Z6UA 2IEYA 1N0HA 1JIKA 3M5DA 2AWOA 3R2JA 5HQ3B 1LDEA 1R0SA 2MSEB 2WD9A 1P72A 1MZVA 4OGLA 1T1JA 4ZT3A 4BP9A 4P5DA 3OX3A 2XVXA 1V1RA 1NIPA 3U37A 5C0OE 2RG1A 4IICA 4DNOA 4F4FA 1TIPA 4YT8A 5H82A 1TW2A 5AHWA 3I05A 4L9AA 3I9OA 1Y42X 3WGNA 4O4HA 4BTLA 1R5JA 2GZDA 2UKDA 2KYRA 5B4VA 1R27A 3DXFA 3NW9A 5DJ5A 2I65A 5JYEA 1MW9X 3KKMA 3T1YB 3VR4A 2J5BA 2KJQA 3KKOA 1A0OA 4PLZA 1FDIA 3ENNA 2BFBA 3NC1C 3HBJA 4FR2A 4YR7A 3NWEA 3VM6A 3KAKA 1N5DA 2W4MA 4FDVA 4JCCA 3ZG6A 4DMGA 2BUBA 2X5XA 4OG2A 3UAYA 4FFWA 4MP3A 1UDRA 1C1XB 3K6SB 1GAXA 2H31A 5JD4A 4AYWA 1FYFA 3GDWA 2H9YA 3L1KA 2JLZA 1TJ3A 3TI7A 1LF0A 1H23A 3JQRA 4RD1A 4ZI2A 1HZZA 4O29A 5TPWB 1E3SA 2G80A 2E9FA 3PE4A 5D1NA 3SQMA 5IKOA 1T9HA 4DR7B 4YB8A 1KYVA 4PQFA 5JAMA 2P11A 4UULA 1XSEA 5TMPA 1LX7A 4MQLA 2WT9A 1GAQA 2PZGA 3AWIA 4N18A 5TJHA 5IDQA 2KBFA 3SBOA 4UUQA 1IEVA 4A91A 3U1BA 2AHOA 3ZCPA 2MSNA 1QG6A 2J7KA 5K0EA 4KR3A 3NXKA 1UWKA 1L5ZA 4ENUA 1QS0A 1Z5NA 3GH3A 1KDTA 2VAWA 1UJ5A 4JGGA 4FFDA 3NO9A 1EMDA 2F1JA 3HO6A 4BNKA 2G63A 1UOPA 4Z0NA 4J16A 4F8JA 5BOVA 3NTLA 1W88B 2I1QA 4QUBA 2YOFA 4IVNA 5BMOA 1OAOC 2AYYA 4KO8A 1YQUA 4DUGD 1RM5A 3N0WA 2QD3A 2ZB8A 3G23A 4NESA 2AXQA 3SF8A 1CJBA 3PHGA 3UMSA 3CFYA 2QY9A 1E5LA 2W4QA 2QQEA 4HJRA 5FOSA 5JJIA 4AKGA 1D4OA 3DTVB 1PD0A 4DC1A 4C7OA 3K09C 4FYWA 1UKVY 1WXWA 2FEKA 3EPPA 2J9RA 2IODA 1NMSA 1QMGA 2V58A 4JB0A 2MCFA 3WSVA 4D02A 4NCXA 3E23A 1Q7RA 4XWGA 3NBZC 1Q0HA 3A0UA 3IV9A 4INOA 2HLHA 1UQUA 2AW3A 1BWRA 4FEYA 4U00A 2FWRA 3DC2A 5IWAB 3KK0A 4BKPA 3I09A 1ZIDA 2XR1A 4ALNA 3K20A 4JV5B 3KM0A 4BZPA 4LYYA 3UXMA 4HQOA 5K0JA 3BIOA 2Z2ZA 2BZ0A 1XKLA 1R8XA 5K0BA 4Y2UA 4X85A 5EG5A 1G6KA 2OG2A 3LXXA 3SYNA 4YV2A 4G1UC 1BVRA 3GRZA 3H8WA 3H2ZA 4MAMA 3OZBA 3UFXB 1BS9A 3MGBA 4ZIRA 3EIUA 1C80A 2HA3A 3L4BC 3KSDO 3V33A 3JYPA 2XMZA 1P3DA 2VPIA 4RQAA 2JZNA 4AKHA 3KBOA 4BUZA 3KPYA 3H42B 1HTWA 2JFOA 1IZ7A 3IPAA 3UV6A 3G8AA 3U0VA 3B3QA 3QELB 5GM2A 3U7IA 3CVVA 3MMZA 2B2XA 3GO4A 4QQ8A 3FGOA 5TARA 1EQAA 2PUHA 2GTIA 1A9PA 3H18A 4RDIA 1Z8NA 3H86A 4LK3A 3STYA 1YMUA 3CM0A 4IX1A 1D2AA 1OMOA 3ETEA 2DBQA 2PTQA 1PYOA 4S2EA 2OD2A 3E3LA 3BA1A 4B3CA 3JALB 3K5IA 3LDUA 4UE6A 3A4IA 2ZJ3A 4EW1A 4BX8A 2I4RA 2PRYA 1USGA 5BW6B 2SECE 2XSZD 2UV8A 3F49S 2L69A 3NS7A 3PXDA 3QYAA 4GBGA 2C54A 2WHPA 3MHPA 4UM9D 1I14A 1PLLA 1QH1A 2Q5OA 4HGOA 4ZT2A 1DKNA 3UJ6A 5L40A 4BLSA 1M8KA 1NW7A 5G1OA 4R71A 3C6BA 2WHRA 1M1ZA 3DEIA 2DKOA 4BNLA 2C8JA 4OUDA 4CHTA 1JQBA 2VAXA 3OX2A 4QIHA 2W6IA 3RV4A 4BN4A 2EIXA 4O4LA 4GQAA 2LKDA 5HCIA 2Q2WA 1P91A 1NOKA 1TA9A 4TTRA 4XR9A 2ONYA 1PNQA 3L7YA 1MJGA 5CT9A 3UCEA 4QFMA 2D1QA 6PFKA 1OH6A 1A9OA 1Z0KA 1U98A 2BR5A 4PGGA 5FLEX 3PX7A 4N8DA 1RYYA 3ON5A 4OAPA 4QDKA 4F4UA 4X20A 1NRXA 5GZ1A 5CCEA 3ER6A 2RHRA 4R1MA 1X19A 3N2ZB 4KVGA 2Z8YM 1X7YB 3WGUA 1XZAA 1CLEA 4WX2B 4OQXA 1B0PA 3HO1A 3AIKA 1YZUA 3F7MA 3ZHZA 4UCXA 2WQ7A 1U9IA 3B6JA 3B82A 1SU4A 3BMOB 2OK8A 3KLBA 1ESMA 2V0NA 4NAHA 3RF7A 4UAVA 1IOWA 1UPUA 4TS1A 4XGRA 3BB3A 1E7RA 7GPBA 1NN0A 4NS4A 4QRDA 2VDOB 3RS5A 1L4KA 4OA8A 2VUTA 4TL6A 2QR5A 1J2YA 2IU3A 3KL4A 4G8BA 2GO7A 3BMCA 3OIGA 4AJ2A 3TOXA 2ZYIA 2WWTA 2PBRA 1VBFA 3ONFA 5FUVA 3LO8A 3G2NA 3EDQA 1E3EA 2ZJ4A 3OMWA 1GNTA 1HL3A 1KQPA 1U0HC 1WNFA 2IYAA 4PR0A 2J0VA 2YFYA 5B1IA 2WTXA 4DR2B 4BGIA 1V2HE 5BVHB 1CXZA 1L7QA 1YZVA 2APJA 3HZZA 3K0KA 1SPXA 4M3NA 4MUJA 1KO8A 2UYHA 4R9VA 4MV1A 3MBOA 4LBVA 1GYRA 4HGRA 4E5MA 5ADWA 4OYYA 5IAAA 5HRUA 2YHIB 3TMYA 3ZZNA 3BIXA 1VHLA 1ONPA 3JQQA 4KYTA 3MC1A 2CLEB 3TJRA 3WWCA 3SI7A 3NP7A 2VSOA 1ZCAA 4J0IA 1RLIA 3EIHA 5LR6A 4ARUA 1U0TA 3M4XA 3BXOA 5DLPA 4UTZA 3RAPR 3JQGB 3D8NA 2YV3A 2VYFA 1RPNA 4FEEA 4UARA 4QPZA 3VPDA 3LYUA 5K0LA 1COZA 2PVCA 4B3RB 5LU8A 2WB2A 1O97C 2NTYC 2Q3CA 1YU6A 5EJ8A 1RZRD 1S1CA 4KXYA 4Y2VA 2F4VB 1CEXA 1I36A 3QXHA 1PX0A 2XUZA 1LPBB 2R8YA 2W6JD 3ZN2A 2YZ2A 1OXSC 3NAMA 2BEWB 1A96A 3UVEA 3L4SO 5HUHA 2JAHA 2G0TA 4QELA 3UMMA 2F4NA 2GN1A 3TLMA 2AOTA 1XXLA 3LW8A 5A9TA 2CLSA 1J56A 1R4AA 4IIXA 4MEBA 5B58T 4ZYWA 1NUPA 5LQSA 2NVWA 3QEKA 2H1VA 1PSDA 3TQCA 1I6MA 1P2SA 3PU6A 3Q72A 2B8NA 4Z7OB 1Z75A 2RBEA 1OX6A 1FVHA 1NNUA 3FF4A 4J2TA 5DH9A 4CGZA 4BU0A 4Y2PA 1PZGA 2W2PA 4AY4A 4JCOA 3FBGA 3P0FA 3ZHOA 3QKUA 3E5MA 2BP7A 2J9YB 3KJIA 4MUIA 4OA5A 1PNRA 3AHIA 1OBHA 2O2SA 4RYLA 5FX2A 3T0IA 1KZ9A 2D0DA 3IBCA 3PFNA 4LISA 1C9EA 4NBNA 5JO0A 3TSAA 2HWKA 1XZFA 1NXTA 3AP3A 5EERA 4AC9A 2ZRDA 3CF4A 3ILSA 3IKVA 4FMCB 4MK4A 5LIRA 5JC1A 4Z53A 4Z4FA 4JIMA 1RCTE 1RWWA 4NZNA 1OX4B 2EBFX 1KYZA 3OFKA 1WCXA 3PVZA 4MVXA 5KREA 1E4YA 3ZWMA 1ZGJA 3UUWA 4YQYA 2D1FA 2IJGX 2J3QA 5ISMA 3I1YA 4II3A 4M1MA 3TSOA 5SZHB 2EKPA 4HFNA 1U9YA 2AOUA 1UINA 5TF0A 1J42A 1A71A 4EI9A 1NZDA 2XQFA 4WCDA 1GPYA 3C3MA 4TZKA 4B3MB 3Q7QA 4N39A 3RSZA 1CQJB 4ZI7F 3ETJA 5BSFA 1QG4A 2H52A 2RGBA 3MGKA 4QX6A 1E0JA 2W6ZA 1PQ4A 2IOHA 1W52X 5D5QA 2CXUA 3KG2A 3FE2A 1CIPA 2IOYA 3HYLA 2PL1A 4JSYA 4Q21A 5PNTA 1EFPB 2IZ5A 5KOHB 1OVMA 4Q24A 3RM3A 2GSDA 4EHNA 4F72A 3K0SA 3BAZA 1P29A 1ZSYA 2VRCA 4A92A 3CEJA 4YREA 4JBIA 4W9NC 2NG1A 5HCNA 5IYZB 5KWJA 1JQJC 3MMNA 4C7VA 3OCJA 4UVDA 3P0EA 4OXKA 4XW2A 1A2BA 3FRHA 3AFNA 4FJ2A 4E1VA 1Q1NA 4S05A 3B1VA 1WDLA 1UBUS 3ZR4B 2ID9A 2K4MA 1I5OA 1UXGA 2XKAA 1DBVO 1KI9A 4RA6B 1M6HA 1FYVA 2QK4A 1H3FA 4X1KB 3RJ9A 2NU9A 3SPXA 4DCTA 4XIFA 3G9TA 4OHUA 1DEOA 1RI2A 1TQDA 3LBYA 2JIZA 4KN8A 4K81B 3QXCA 1JJ7A 2XA2A 5D86A 1FK8A 4AG3A 4HSGA 4FGLA 4Z8YA 1F1BA 4GM4A 5H9VA 1XB2A 4BNNA 3BZWA 2D3WA 4GGPA 4IVPA 1GCUA 1LQUA 2ZJ2A 1V48A 4D26A 3K8YA 1LJLA 4K6CA 5HP4A 4DQDA 2NVBA 1DO2A 2QMYA 5FDFA 3PXCX 3OZDA 3ICCA 2CXPA 1C0EA 1V16B 3GV0A 4R98A 4I3FA 5H4HA 3QA9A 3E03A 2R8ZA 1M5RA 5KSYA 5AOAA 1XTIA 3ZLUA 1YQEA 4YRLA 4F6CA 4Q3CA 1ZZEA 2EF0A 1AD2A 5G0VA 5KMGA 5G2OA 2ACEA 3V8PA 4CWAA 5GTDA 2UZ4A 1NV9A 1TK2A 4J1TA 1TJWA 4QPCA 5EJFA 5ALOA 4BZXA 2HNKA 3HS3A 4LJ8A 5D6NA 3TFQA 3UJ3X 4DZTA 4A36A 1NHGA 5HF6A 3PITA 3U7GA 5KJEA 3RS0A 3HU5A 3HZRA 3SYKA 3MCTA 2ZXUA 2YMMA 4N0QA 5A05A 1TI7A 3I58A 3NGXA 4R0NA 3FMPB 4YUXA 1VZ3A 3A04A 1FYXA 1DWOA 3BA6A 4II7A 4O33A 4UNQA 4W7SA 4IDHA 3DQQA 1E9AA 3O3OB 4FCVA 5D6OA 3OLCX 1OT3A 4PRKA 1CD5A 1DAFA 1XZNA 4V03A 4ZYLA 1UMBA 3VDNB 3UENA 4LFBB 2EEZA 1AV6A 1BU8A 1KOFA 4EJFA 1DEKA 4LI0A 3VDMA 2CDAA 2PGDA 3VZBA 3TOZA 4CEIA 1H6CA 1K6MA 4R40A 5CJ2A 4TYWA 3VBEA 2X22A 3HYSA 3NEYA 1PEYA 4NZ9A 2XITA 4W7IA 4JJKA 1V8ZA 4YACA 2FOIA 4RENA 4YGXB 4CKEB 2HJSA 3HRHA 4QKQA 1IHDA 1AGXA 1IUPA 1I24A 2GN8A 3DMHA 1EB9A 1WB5A 1ZNYA 1GPUA 2C9DA 1YOVB 2FK8A 2J3DA 4N7MA 4P92A 4EI7A 4WBNA 1CR1A 4B7CA 4ZCMA 3PIRA 3K70C 3LL4A 3FPCA 4X94A 1Y8ZA 2GOYA 2BGWA 1C7FA 3FAKA 1H4QA 2XB8A 3MJTA 3CX6A 2GPBA 3Q88A 4PO3X 4YQEA 1PDVA 2ZIUB 3NCHA 1KI2A 3MGAA 3QI2A 5T67A 1UFVA 3V1LA 4XDHA 1JR2A 1YKSA 3O9MA 4P4SA 1OJ7A 5FLKA 5TQ0B 4C0XA 4ZYZA 5BORA 4GLJA 1W59A 5FB3A 2I87A 2YIDA 3ICEA 3VGJA 4H08A 4M98A 1XLVA 3TW4A 5CCBA 2Y1EA 2XHEA 1FURA 3PNVA 3L7CA 1I7NA 1O6CA 3J7AC 4Z4EA 1QOPB 2YZKA 1JEYB 1DU4A 1EWVA 1Y9JA 2R8XA 2Y77A 5J43A 3HH8A 3IUNA 1GXSB 3G0OA 4RKYA 5KSOA 4WN9B 3ET5A 1W4AA 2CLHB 1SMKA 4JUFA 2XZOA 1OILA 1UJCA 2Q6LA 3OJWA 2H4JA 4ZVPA 4F38A 1JP7A 2VWPA 4RLHA 1O08A 4PXSA 5IARA 1RYDA 5F21A 3SR3A 4TTIA 1D03A 4DMFA 3MILA 1UPFA 1ZK1A 2ZRKA 1E3LA 5E1BA 8LDHA 2QZSA 1R16A 3ZGLA 1QRUA 1P2VA 1IUOA 1K75A 3DOFA 3KFLA 5HIAA 4XJVA 4ZGGA 2ADMA 2UVDA 3OETA 3B52X 3KQHA 1RVDA 4Y98A 2C2WA 4RIGA 1QH8A 1Y8RA 1JR6A 3NNNA 1E79D 2QVLA 4QQKA 2XCOA 1WLSA 2IU0A 1CNFA 5AK5A 2IV2X 5YASA 4LYAA 1H94A 1RQXA 1TJYA 3HSYA 3KOUA 4UM8B 4X93A 2JHCA 5GV8A 3TW8A 1J22A 3THYB 2PD3A 3Q0EA 4IVQA 5M2QA 3QEOA 1N3LA 5F4ZA 4B4OA 1X80B 3W4IA 3IIKA 4Z99A 3P4UA 2ZAYA 3FUCA 3T7CA 1C7EA 1I30A 5GIOE 2D0IA 2P2ZA 2JFVA 2QXTA 3BE4A 5L7TA 2OZEA 4PS0A 1HZJA 4HB2A 1L9XA 4JJ8A 4BWYA 1E2EA 4QDXA 5DCWA 1I01A 2HLNA 3WLAA 5FBVB 3DBLA 2J30A 3I5AA 3U81A 1HX7A 4OD0A 4ASUA 1SVKA 1RW4A 1HNXB 4FX2A 1E9CA 5EE0A 3DZBA 1LZKA 3GCXA 1G9XA 4FW8A 4CQMB 4ZO7A 4NFLA 3RVNA 3TG8A 1T0PA 1F5SA 3C8MA 1MPXA 3RUPA 2RK4A 1E0KA 3BDVA 1NF9A 4CKWA 3DP7A 3DAYA 4FKBA 4G09A 4DV7B 5JTTA 4ESVA 1B6GA 3O94A 3GPLA 5H8WA 1AV7A 2VRBA 2Y4NA 3FMIA 1AGNA 4L4SA 5IZCA 1M8JA 1M6NA 4YAJA 4F5WA 3OPNA 1GPAA 4PLWA 3RVDA 4ZT4A 2VJQA 3VSBA 4H1WA 4ZCRA 2OXRA 2EBUA 2NO6A 4PYOA 2QE6A 3H9JA 5FWYA 1Q95A 1P1FA 2PMKA 2PRZA 1GU1A 4MV7A 4WA8A 4YRDA 2OPBA 3SJCA 1GQRA 4RZUA 1N6LA 1V7QA 3VSDA 2BHNA 2NMVA 1I2ZA 3DONA 1PDOA 3TQFA 4DCGA 4RFSB 3RC7A 3WL7A 1DV2A 3L0CA 3SQOA 1GQOA 1GTZA 5KNCH 1ZOPA 3WYFA 1EESA 1NVEA 1SUFA 4JFRA 1GQFA 1QPGA 1V5FA 3WQSB 4DR4B 2H7YA 4ZQGA 5AVXA 1FUEA 5D3MB 3KQMA 3MXOA 3U3RA 2HF8A 4ID9A 4XCXA 2TS1A 4HNHA 2R9VA 4TKLA 2GQ0A 3SE0A 2GA8A 3RHTA 3JQEA 5LSAA 4BO5A 5K3FA 1KBZA 1CP3A 1K5PA 3BYZA 1Y5LA 2LIVA 4ZDKA 1P1HA 5CDTA 3EXHB 4PGFA 1RFLA 3RVKA 2R11A 3C6QA 1ISMA 4HAUA 2QAGB 3HV0A 4YP5A 3SQWA 4F21A 3HJCA 3O2SB 2C95A 3QVUA 3OOWA 4JC0A 5DISB 4EYGA 5F77A 2YNMA 2AOWA 1WXEA 1AE1A 3IUJA 1R0ZA 5LQCA 1R0WA 1CJMA 4D44A 1Z5PA 4EFDA 2I6FA 3KU1A 2YXPX 2AHRA 3TSWA 4DYHA 3ZWQA 4KXMA 4XR4A 3HXMA 1SHZA 5B36A 3H13A 3VDXA 2OK7A 1KETA 4RCZA 4JNCA 1U7XA 3CX8A 4Z8XA 5JD5A 4O63O 4WV3A 4TTAA 2PH1A 2QLFA 3WSWA 4B3TB 4BNJA 5JFTA 3I53A 5JVDF 4Y6PA 5CITA 4X71A 2O59A 2W2NA 4DHWA 4URHA 4MCJA 2IP4A 3O21A 2OCLA 3MLEA 3U7EB 2PG3A 2UYGA 5BWNA 2RIRA 1HQDA 2AVNA 2FPXA 2O2IA 4U1RA 4NVRA 4NQZA 5FOWA 1OB2A 4KLNA 4OP1A 1PZXA 5G3ZA 4ENSA 3BMXA 1V7PC 3ZDEA 2A57A 4NH0A 1M1XB 2BFWA 1J25A 2KW5A 2RKWA 4CLRB 2YV2A 3NGLA 4KACA 3EG9B 4ZXPA 3SLRA 3OF2A 3TTUA 5DCYA 4FLFA 2X0JA 4J8PA 3WIEA 1TAUA 3NORA 4BO8A 3LY9A 1BOFA 2CVQA 4HAZA 3ZTWA 1ECLA 1U2PA 4Z3DA 3QEMA 2JLWA 1LX6A 1DAGA 4BO4A 3TIIA 1VBNA 4XX0A 2IZZA 1GPBA 1XNHA 2QUIA 3M2TA 4AWAA 1YE3A 1PLKA 4A0QA 3TXYA 2DEUA 4K9PA 1E9DA 1K0FA 2JCXA 1RKVA 2W5UA 1JKMA 1P6UA 3T38A 5NULA 3TGLA 4C22A 4KFRA 4FT4A 3RK0A 5JH7F 1B6SA 5JHGB 1V26A 1OI3A 1C9DB 1TYEB 4NK4A 4CT5A 2E18A 2XI4A 4H77A 4JT2A 1FRVA 5D01A 5KQGA 3AEQB 4A0HA 4G5GA 5LOVF 2VT2A 4N65A 3R9KA 1OZFA 1HTTA 5IKXA 3LTNC 1GT91 3QLUC 1DC6A 3NTXA 5T8KC 4BNVA 1DBQA 4EUKA 3WK7A 1Y9DA 1WCWA 1BMFA 3AI3A 3THSA 3TRKA 3PQ7A 2JLRA 1AHIA 3LPAA 3TRIA 3OKPA 3OKAA 4O4JA 4W8HA 3PCRB 4YP0A 3OG9A 5REQB 3G0IA 2V74B 1T6BY 1HT1E 1L4FA 4PS1A 4F2DA 3GRKA 1HYEA 2PYZA 3M6UA 4YJ2B 3VMMA 4DWOA 1FXWA 5IPFA 1K9SA 1R9GA 3ZD7A 2EJVA 3EUFA 4K9DA 4UATA 1KGDA 1E0AA 2QTGA 4JR1A 5J2TA 3EDRA 1CJKC 2I9PA 3A8TA 4MS4A 4BNUA 1AURA 2YN0A 3U39A 2FW9A 3GN1A 3D8BA 1SVMA 2BGLA 1JEOA 5GONB 2VJBA 3V9AA 2C2BA 1SXJC 2BE7A 2C7VA 1H1LB 5I7SA 2HQBA 4XLZA 1JRLA 4XFDA 5BUCA 2PJRA 1CV2A 5C5IA 4JXZA 3PFBA 2L2QA 4KVFA 2R5WA 2C8VA 3QYFA 5LP6A 5E0OA 1S9DA 4FFVA 5EIXA 3KZNA 2Z8XA 3E4CA 1G4UR 1VRCA 1QPBA 1T2AA 4YDRA 1JDNA 1CRLA 1Y9AA 3QBEA 2NTNA 1TKCA 5FUYA 3PPXA 4ND1A 1WBJB 3C70A 1X0XA 3NLLA 3WGYA 2BD0A 1D04A 1Z2NX 5B64A 1KC3A 4OLAA 1USWA 4W63A 4YNBA 4YBZA 2BFCB 3OIUA 4MO9A 4DA4A 1ZAYA 3G68A 5CPFA 2F00A 1T9DA 2Q2VA 3KVYA 4X7MA 5TT0A 2DQ4A 1ZP6A 2LKCA 2P9JA 3P4YA 3QPDA 4KDEA 1NM5A 5IJAA 3TV2A 4ADSG 1TL7C 1R0YA 1WTCA 2VXOA 3K9QO 4LW8A 5DO9A 5IU6A 3P0RA 4I1VA 2PKXA 4BS9A 3K6KA 3EC1A 2XRYA 3MB8A 3FNEA 3S99A 5JE8A 1J2EA 1I3CA 2O2ZA 2XBUA 4LZLA 2FR1A 2HBZA 3IYLW 1K7XB 1ACLA 1Z6PA 1JLMA 2VPQA 2WWXA 3C2QA 3KFXA 2ZAMA 3FJ1A 1CRQA 1CETA 1NY6A 3LRTA 4FD2A 3T6KA 1GNVA 3G2IA 3U40A 3VX4A 4GOLD 4OMCA 1RI1A 1WA5A 3ZWAA 3AUUA 4QGSA 1ICIA 2H9IA 2NSYA 4QVKA 4QLOA 3V2UA 2GEUA 5H3HA 3VAYA 5B3JC 1HWYA 2YQ4A 2OMKA 4TV8A 4X3OA 5FFFA 1CNEA 1EDBA 5TQ2B 5BVGB 5JCOC 4TMKA 5EZYA 4KQGA 1Y9ZA 4IV5A 2CV0A 4ZCPA 2VPPA 2GHRA 2ZJZA 1DXYA 5CLQA 1BCRB 3QU5A 4CLOA 3MS4A 4FYKA 5CA0B 4UNIA 5IDVA 4DKXA 3AF0A 4L72A 1IK4A 4R1NA 4EO9A 1UT8A 3B7WA 5KNBA 4G0UA 1W25A 4WD3A 5KINB 4DRXB 1MNAA 4DV4B 1V1JA 4G5HA 4RJLA 5IT5A 3ANXA 3N28A 2B7BA 3RUIA 4E5SA 2C4HA 3DKKA 2CJYA 2Q2NA 2XUHA 3HXPA 4KXFB 4TKUB 4YRQA 3AM1A 1S4QA 3ZGZA 3L4EA 1KEEA 4F85A 4UTPA 4YRGA 1B16A 5K20A 3ZVKA 1VXRA 4CLXA 2ATXA 2WHEA 4HLCA 4O4IA 2JLBA 2CYAA 2GLXA 2IDJA 1Y3AA 1H2FA 3TSZA 2I3ZA 1SNYA 4ZJZA 5AVZA 2R6DA 1TZ2A 3JQ8B 3ZX4A 2OILA 2ZSKA 4AG5A 1SFRA 3LUPA 1HURA 4NYJR 5LZ2A 2M98A 2VXCA 3N6XA 4A8JC 4PNZA 2W6QA 1DADA 3JWGA 2A8YA 4GOND 3IV7A 4B81A 2R62A 3F8SA 4NTZA 1O8CA 1Q0PA 2A35A 1JSZA 1NXOA 1N7HA 3SBDA 1N5KA 4WBXC 2IHTA 2B1QA 1Z68A 2BVNA 3GPIA 3AHFA 3E9RA 1ZITA 4IVRA 4UC0A 2QE7D 4XUCA 4LVUA 2RHDA 4XIGS 1C9NA 2W2QA 1AY0A 3AU9A 1GZ3A 2F17A 1RWXA 1V4BA 3GFRA 3L92A 2PGJA 3OHMA 4LJ7A 5DBOA 9ABPA 2ZKIA 1M6VB 1KK3A 4ARVA 4ZICA 4DSNA 2W11A 3HCEA 3S28A 4Z4HA 3N59A 3LO5A 3OOEA 4AJLA 4CI9A 2ORED 3RSCA 1XCJA 2J09A 2OV1A 1TADA 2P69A 3GXBA 3OA2A 3S3TA 1FOEB 2LGJA 5D85A 4QEZA 3GA5A 3OIVA 1A98A 1G2IA 1IPHA 1SBZA 2B25A 2XDWA 4PZPA 5EL0A 2FMKA 2GK3A 4NV3A 1P44A 2DSTA 1E6LA 1T0UA 2WM2A 3IBFA 3IEPA 4Q5IA 4QU8A 2VHTA 1L5SA 3HJGA 1WU8A 3GDHA 3USZA 1XPOA 4KPUB 4OQYA 1Y3IA 3WNBA 5BQ3A 2ECKA 2D7DA 3E48A 3UUGA 1Y8QB 3D3NA 2XCUA 5LLTA 4TS4A 5F5LA 4RABA 2DPGA 1A97A 2RONA 3NHAA 1TMKA 4YRSA 3JD0A 2FWJA 4KRYA 1DOFA 4DLKA 1MP0A 1UKZA 2OXIA 1UR5A 1E62A 2QRVA 1VP3A 2O0KA 3TTWA 2QDXA 3H9EO 1DKMA 3AL3A 1E18A 5AKEA 3PUHA 4TLAA 1XZKA 1RHMA 3MQ4A 4WT7A 4JBXA 1JG7A 1AB5A 2EERA 2Q5FA 2WF6A 3GLTA 4L51A 2ZYVX 5BQOA 2X5JO 3SSAA 4GSYA 5H02A 1VKZA 3ZNQA 4AP6A 2QUKA 1XRRA 2H4FA 3IOMA 2DHRA 4D9KA 3RC3A 1C9YA 1GGHA 1KIMA 1RXCA 5JYCA 5JCPA 4N82A 1UKEA 2C0CA 4DXHA 2HIMA 1PBNA 2QI9C 3UAVA 1SQGA 4I50B 1L9KA 1JLLA 2JB9A 5DNUA 5DHSA 5IXSA 3DDUA 5E95A 5AQ1A 2SKDA 2VZEA 4L1KA 1YDMA 1JLKA 1HLFA 1T1GA 2NPIA 4AUMA 1B3RA 1E6KA 1XTQA 1ODFA 1P7ZA 1WUJS 4PZ0A 2DLCX 4CIBA 2OV2A 3W77A 4H4CA 3NM4A 1M2JA 2O3QA 2WTMA 5I7UA 3NYIA 2HRQA 3QY0A 1ST3A 2AJCA 2JGNA 3BK7A 3QE3A 2H17A 4FFMA 2D8MA 4FKMA 2EARA 1DB3A 1DG1G 2PLRA 4DLUA 3AVTA 3BXEA 3OU2A 1N4DA 1WPXA 3IHLA 5EXDA 3FUTA 4BNWA 5T5QA 3SJ7A 2N0SA 4S24A 2WU4A 2QN6A 1O9GA 3M6MD 1GQYA 4GM0A 2Y93A 4N12A 1E1RD 3RWOA 5FA6A 2BFNA 3NVKI 2XT9A 4MITA 3M4YA 2ZWAA 5FR2A 3DDHA 2O23A 1D4AA 4A1FA 1X7ZA 3FMOB 2I7DA 3GEBA 1K5HA 3GPCA 1PZNA 1THGA 5A0VA 1J20A 2JCVA 1SCQA 2NNLD 3WMEA 3HB4X 3L0SA 5D7BA 4IFTA 2QLMA 1GV1A 1WCIA 1NUSA 2VT3A 3KKPA 4WNAB 4G0YA 2DHCA 4YASA 3AM4A 4CKXA 3DE3X 3VPHA 4OJNA 5A5DA 4UHBA 3M6LA 3JR3A 3IMFA 2QXYA 2XNCA 3GT4A 1IM8A 4NMMA 4OXRA 1B1CA 4OM8A 1CUWA 4ZVTA 3W90A 5ERXA 3RSOA 1KBOA 1B0UA 1SC1A 1X1TA 2VLBA 3M6AA 5DLYA 3C74A 4A9AA 3N2GA 2A5GA 2CNWA 4LN1A 1GAEO 1L5VA 3DEZA 2GAFA 3G2KA 5A4AA 4DL9A 3AR5A 3TF5A 3PC8A 1K5GA 2UZ0A 2WKPA 3VR6D 4MZXA 5ALHA 3FFTA 3R75A 1PZEA 1ZIPA 3OJ0A 1ODJA 3RVRA 4CFSA 1RXEA 1DRWA 1PKXA 3KE9A 2ZTVA 5DM0A 3T3GA 5KHOC 3KR9A 3K0BA 1YJ5A 3LKDA 4S1TA 4EG5A 2XGGA 4HH1A 4EMSA 3KV3O 2WHYA 3O8OA 1W5AA 3LIIA 3G3EA 3M6IA 1YL6A 4HT3B 4CUJA 1NL3A 2AI3A 2A58A 3PFCA 4DBLE 5KQPA 3QIVA 5ICMA 4L4RA 1DCTA 1KZ6A 2GYWA 5E7IA 1GPJA 4D74A 1NIJA 1TD9A 1SKYB 4OFBA 4RVDA 4YAIA 4Q47A 1AXRA 2DU8A 5H9WA 1W7AA 1Y6ZA 1T9CA 4DMRA 4PPFA 2ZULA 2H4ZA 2QUBA 1PR3A 3AYZB 3NH6A 4EX7A 3UXEA 3I04M 1COWD 1ZZGA 5A4IS 4KV7A 3GEDA 1UPBA 3RHSA 2JATA 4IIJB 1ZNWA 1F1JA 2QUJA 4RZ3A 4QOIA 4UUAA 1VKJA 2X41A 3AX6A 3BXZA 4LNHA 3SKXA 4MGIR 1BD3A 3IPRA 1XBTA 2V5UA 4DLVA 4EKIA 4CQLA 1GNSA 3U5ZB 3P94A 4UBMA 1RMTA 4LMBA 2ODWA 1JQLB 3FPKA 4OVKA 2AOVA 4O59O 4MV4A 3W7BA 4LRTB 3QWAA 4F04A 3BB4A 2ONJA 1T8PA 4QREA 5BT9A 3OY7A 4PXYA 3MSXA 4U7PB 2CD7A 2D3TA 4G5QA 4Y9DA 2H00A 1XEXB 2YFKA 2BEVB 3VO2A 4EGSA 1SZJG 3IAEA 5EKTA 2FPOA 5E7MA 5F2NA 4PPYA 2AZ4A 1NPTO 1M1NB 3QVGB 3ST7A 5HX7A 3I28A 1REQB 1Y6QA 1F4VA 1MAUA 3ANNA 3CF4G 2VDMB 2ZWMA 1B8OA 2W7TA 3TZCA 5I8PA 1VPVA 1ZK4A 2HI0A 3QJGA 1SB9A 4Y6QA 4U8GA 1M0WA 2Z1NA 3DWEX 5IYZF 3F6SA 3OQ6A 1Y7IA 4Q19A 2GVDC 3BMNB 4J1SA 3PWTA 2G76A 3G1TA 1CTQA 4C87A 4DJEC 4G6ZA 3W9YA 5ALJA 5EXEA 2HDWA 2ZJ0A 2X42A 4L0QA 3ZHBA 4US0R 2YWFA 4HAWA 1XFDA 3QXSA 3AJRA 2NU7B 3Q0TA 5G3YA 5B6IA 3M3DA 3KCNA 4BBPA 2JKVA 3L8DA 4V0KA 2NYRA 1BA2A 1ZD4A 3OIWA 1AZSC 4UVIA 3OUTA 3Q1LA 1GNQA 1YR6A 5J5AA 4EGCB 1I3LA 1QIMA 3AKZA 5DN9A 1AC5A 1YS2X 1DDGA 2H9AA 4Q48A 2PMCA 2EW1A 2HEIA 4ND8A 1F3LA 1G64A 4A6EA 4YRZA 3BH0A 2B3DA 4PAQA 2P6UA 2AJTA 5LZ4A 4IL5A 4ICIA 1BNCA 4B48A 4CUKA 4ZA2A 1YL7A 1BN6A 3GVIA 5ALVA 2RGAA 5KJFA 1FUYB 3R7BA 1OXXK 2HVGA 3MUNA 5H0IA 1LBEA 2PSDA 5K99A 3A3KA 1UANA 2XMPA 5CM2Z 3KQUA 1MHTA 1Y1LA 3M3PA 1GG9A 3WIBA 4IDBA 3X1ZA 1Z35A 3BE8A 3NKLA 1U8CB 4NBRA 1ITZA 3QKTA 5CRIA 2BHRA 4H1UA 5DVZA 1BX3A 1IY9A 3S4YA 1KYXA 1OHHD 3V2IA 4BO3A 1C5KA 2BGNA 5AICA 4YXFA 1A50B 1YT5A 3MT9A 2QD1A 3K05A 5ED4A 1WMAA 2IXAA 1Y8CA 1M8GA 2MINB 3KWLA 4XIJA 4Q3KA 3DDWA 4XLTA 1G8SA 3QWBA 2AMYA 5BRAA 2IYSA 2G25A 2ZT8A 3H97A 3LUBA 3PIDA 5E4TA 1W1IA 4BB6A 3ZWVA 5TPZD 1YBHA 2PWPA 4UEWA 1UBOS 4GKJB 3NBYC 3DE5X 4FIDA 3WA6A 2OAGA 1T0JB 1V8OA 1YDHA 4H7DA 3FTEA 3U3DA 1T5DX 4TYQA 1FDVA 4BNZA 5E6UA 2BEJA 1XXHE 3DTNA 5BNTA 3SVLA 1QZZA 3DUFB 3DW1X 2CVHA 1FVXA 3H19A 3IX7A 1PL0A 3PFFA 4BQEA 2JLXA 2HJ9A 621PA 2VEOA 3VO8A 2ZUEA 3KOZA 3AHJA 3QMWA 1SEVA 3WLRA 3LUFA 4Y2TA 1DINA 4JIGA 5HZHA 1EHYA 5AWFC 2DUUA 2ZU6A 5T3YA 5A4MS 4PSCA 4L6CA 4B4DA 1N2GA 3WLEA 4MZDA 4UDNA 1TRHA 2IS2A 1Z22A 1BS1A 4EKYA 2ZLBA 2QIPA 4QWMA 3CEAA 4MTCA 3Q7TA 2OWDA 4LNAA 5LU9A 3W5DA 4RVUA 1ZH8A 3MRVA 2WYVA 4L8LA 3PR1A 4UE2A 1GL6A 1N7JA 1U9ZA 2A1TR 2MMGA 2QTRA 1XWOA 2QPOA 5HFAA 4EW6A 3AQ4A 1RLMA 1MX9A 2DR0A 2Q7XA 3D4PA 2P41A 4LKOA 1NF2A 5FAKA 2CN1A 4Y1RB 5JAIA 1MTZA 1JUDA 5ESRA 4DLXA 1LZLA 1EP2B 1NUQA 2GKOA 2ZTHA 2QSZA 4AK9A 3SWWA 4P34A 2PIDA 4LF8B 2O4CA 3T4EA 2CXRA 1T6ZA 4AN0A 2BM1A 2CFRA 2PRSA 3B36A 3VZCA 4XAQA 5E4JA 4EUNA 4EY6A 2H16A 3V4OA 1HE5A 1N9GA 2DAPA 4NSLA 3EXG2 1FW8A 1KQ3A 2NQTA 1KKLA 3TZBA 3OCFA 1NJ8A 2PT5A 4YPVA 2ZR7A 3W1VA 4CM4A 1BFDA 5BSEA 4RGQA 1BA3A 1G1AA 4OXYA 1T25A 2DKFA 3LG2A 4WAUA 5JMWA 1QC5A 1M5TA 3PNQA 3N2EA 1QE0A 4G8DA 1M1YB 4JYPA 4MQEA 1XCMA 2J4FA 2W2KA 2II6A 4ZV7A 1HETA 2A9VA 5JLAA 3OD1A 3V7WA 3WNDA 4RIIA 2IYXA 1VCOA 4OK5A 2JGAA 3WO0A 4CRWB 3EOZA 4BO2A 2K5UA 1SQ5A 3HJNA 3LDGA 3UJ7A 4D25A 4NICA 4IEFB 2HLDA 3ZI4A 1UWCA 3V8BA 1D2MA 1XA3A 4I8XA 4AMVA 3MRSA 1AUWA 3QVKA 1O9HA 1WXIA 2PKRA 3EWAA 4HQKA 3T99A 3AYXB 3HCCA 1PJQA 5IZ4A 3QF4B 5JMOA 3G2HA 4RPJA 1C3OB 1HFWA 6AT1A 1OLUB 1AIPA 3IVGA 2NT3A 2W42A 4I3GA 3AIOA 4OMFG 3A2LA 4WKOA 4ZZIA 1ABFA 4INZA 1OAAA 4IYJA 2JIMA 1N9KA 1OZAA 1RI3A 1WVGA 2WTEA 1H93A 2ZVQX 4J9VA 3BXFA 3X1KA 1FSFA 3MUFA 2NN3C 5L45A 1H9CA 4HKTA 1Y3CE 2W6NA 3URKA 2G77B 4C4OA 4JBHA 4JFAA 5BSVA 2JJYA 3EXG1 3R0XA 5C37A 4LF5B 3DPSA 3PJFA 1QLJA 4XPIB 4BAGA 4F56A 4OX9B 4ECAA 1BWPA 4KGZA 2CW5A 2Q6TA 5F12A 1QDLB 4JBGA 3I0ZA 3EA5A 3RU7A 3HZHA 1CUBA 3WFIA 4AJKA 1TK9A 4HDNA 4AG6A 5BR4A 1FMLA 1GRQA 5AI8A 2J5QA 2Q29A 3LCJA 2Q5JA 3B7GA 3LX8A 5DIFA 3T06B 5CDUA 1N6HA 2AXNA 3O95A 4YQFA 3KWFA 2XUGA 3TI9A 2ZT5A 3V5NA 2V4UA 4URFA 4PANA 5DGHA 3T9FA 2O7QA 2YUIA 2GAOA 1Z56C 2IKQA 2FR8A 2JARA 3MAJA 3NNSA 4KX3A 4EG3A 1ZH6A 3CLRD 4HDKA 4RMNA 2QT9A 3KV1A 2Y92A 3VVLA 1U1EA 2ZYHA 3A1DA 2ZBGA 3BRWD 3HCWA 3LQKA 1XAHA 1FS5A 2G5CA 4M86A 3UH0A 3AR6A 4CR6A 5JU6A 5KYXB 3OO0A 1HOXA 1XDDA 3HB0A 1M10A 3V46A 4RF3A 2GD1O 3DB2A 4YAOA 4ZQIA 2EF1A 2GUGA 4MUYA 4ENRA 3GOHA 3PI7A 1BX0A 5A2GA 5B55A 1XRSB 2AG0A 4GNKA 3GJTA 4L3VA 4MWEA 4O08A 4NZYA 4A10A 4YMVA 3JQDA 3QBVA 4F9EA 3BN3A 2YVAA 4JJGA 1B76A 3BGDA 1IC6A 1MN6A 4L6AA 2UYOA 2X0IA 3ILVA 3L82B 4EF6A 3B2QA 3KCQA 3BDAA 3VFDA 3KO8A 1KYYA 3QBJA 1PWHA 1P2BA 2JVJA 2UVQA 5EE1A 1U31A 5CFZA 4HLNA 2BIFA 1GSOA 1EGAA 1PEKE 2QLNA 5DYYA 4ZWNA 5IF3A 2W48A 3L1HA 3DNPA 1Z7YA 4OQPA 5DPMA 3T3EA 1EXWA 2G9RA 5HF8A 2R1TB 2AQKA 5LC1A 3WZMA 4A0GA 2PNFA 1E3MA 4LSWA 4HWOA 1MT0A 4HS4A 4Q3LA 1Q7BA 4RJIA 4UASA 1YFZA 1QM5A 4LZWA 5ERYA 5I9TA 4D0NA 2XY4A 3QXGA 1SD5A 2HWYA 3KTDA 2WR8A 4G4GA 2JFGA 4MUAA 3WQHA 2NP7A 2G72A 4EF4A 5AHOA 4ZI5A 2P0YA 1G20B 1TUIA 4INPA 3ASZA 3FJYA 2FA9A 1P7CA 3D4NA 1JIUA 4O25A 3ZK9A 4UTRA 1HE3A 1K9VF 1BD4A 4OYRA 4DDTA 5JFGA 3ZW9A 2W58A 1AQYA 3GRFA 1ZM3A 3UT5B 2FZ4A 3CR8A 3LCMA 2FWMX 1CY4A 1NW6A 3PDIB 1NVUQ 2FG5A 4H7IA 4RVCA 2FW1A 4IINA 4WZAA 2FMXA 1U1IA 4HWRA 2QF7A 2R7MA 5DBGA 2R66A 5GM1A 1M0SA 1RTTA 3JAKA 3G8BA 5T6BA 5LLDA 4HMQA 3U44A 1X74A 2FR0A 2OCXA 3ENVA 1ECFA 3F0TA 5C81A 4X7RA 1PWEA 2Q9CA 4PZEA 3A9WA 4KCGA 4LWOA 4CKBA 1ZVKA 5MDHA 1ESCA 3HKEB 3KYBA 4LOLA 2N47A 2CKDA 2AJ8A 1T6NA 2PWBA 2B9VA 3ORRA 4LGYA 3DR5A 1NYTA 1VBMA 2IK8A 3SMVA 3WMRA 3FCYA 3LDHA 4JX9A 4C7XA 1PR4A 2O2EA 4CL2A 1J2JA 2E89A 3FCCA 1PAUA 4TMWA 3L6DA 3AB3A 5A9SA 4LJSA 1QCDA 3FZQA 5E9JA 4YJFA 1KMHA 2JA2A 1XXHA 4KQEA 1NSYA 1YQTA 5CNIA 3ZWNA 2JH9A 4BLQA 4RS4A 3JR7A 1IBKB 1QUEA 4BB5A 2GN9A 4CW7A 3H1EA 4MUKA 4F12A 2V3WA 2ZE8A 1KAOA 3HYNA 3PSAA 1TAGA 3PGJA 2OFWA 5EKXA 1F48A 3FOEC 4GIBA 4PQYA 5G4LA 1MXHA 2F9LA 1Y0BA 2FKNA 2CHEA 3TNYA 3WHIA 4M0FA 1DOAA 2C98A 4L76A 1UXOA 4MUGA 4UW9A 1XDWA 1WIWA 3R9IA 3F74A 2ADFA 4IG9A 1BXGB 4FE7A 1P9OA 4W9MC 2A0WA 1JPUA 2ZS9A 4IRXA 3R3WA 3CNBA 3GRVA 5JS6A 5IJ0A 3QA3E 4YA6A 4YJ2F 1EWRA 1YKGA 2HU7A 4BOYA 3AONB 3RIYA 3T7JA 3JQ7A 4IDAA 1ZMXA 4L8VA 4QOSA 3FA2A 5IG2A 5FI5A 1OZHA 3OQIB 1Q12A 3IODA 4G07A 4CM1A 4QULA 4WFQA 2XT0A 1LKZA 4WQMA 1MD9A 4D3XA 4DPLA 4ZOQI 3LT1A 4D46A 2YXBA 1M9NA 1PHPA 1R8JA 3TO5A 5JQWA 3GPBA 3LCVB 3THWA 1Y1PA 3IUEA 1QQAA 1IEXA 5GGYA 2WD8A 2CLIB 4JMPA 1ZI8A 1JV2B 2W2VA 5D84A 3VZRA 1FDTA 3GFVA 3MJHA 3O83A 1KPHA 3PFWO 2ZE5A 4LRQA 4X7PA 3OTGA 4Y2SA 1BVHA 1CUIA 3FCUB 5AKHA 3ETNA 5TEWA 1R0KA 4ALKA 2YN2A 3ELDA 4AJJA 5DSZA 3ORSA 1K7SN 4ZRMA 4ZU3A 1G4HA 3ZHSA 3AIMA 4C0BA 3HEAA 4I19A 4MSUA 5ED0A 4ISBA 1PQPA 4X00A 4L5YA 1GADO 1C1DB 2D5CA 2C4KA 3D3WA 1HE2A 4REQA 5B3AA 2IUUA 3ZV7A 2Q8NA 2QNBA 3L6OO 4BLRA 3DD1A 3L7KA 4LE1A 5FTJA 1XDUA 2P9FA 2AMVA 4WZBB 4DXDA 4NJMA 2G7ZA 2ZYAA 3QBPA 1E3WB 2YWEA 3I01A 3OLYA 2I3DA 3T34A 3UWPA 4R8RA 2GBGA 2SCUB 2D1YA 3L0OA 3BX1A 3AEKA 3JQAD 4ZYTA 2H8KA 3TD9A 5JOQA 4IOJA 3V7FA 3BC1A 3HCPA 2XF8A 3M89A 4ABYA 2PYIA 2BJHA 2HRRA 5COQA 5IKMA 1KRXA 3PD7A 3PA8A 3E5HA 2A67A 2GZAA 2UVPA 4WH0A 3TBFA 4BRZA 1GG8A 3TMAA 4HUJA 3KD2A 3ED1A 4IJWA 1F9AA 5FI0B 3UAZA 2I4TA 3K0FA 1XKXA 5EXXA 3EZXA 1CQWA 1SBNE 1XTBA 1EPUA 3AT1A 2P8SA 4YJ3B 3KXLA 4RPHA 2P1ZA 1Z0JA 2GZ2A 5CA0F 5BSWA 3S2FA 2OCYC 2Z6AA 2GWRA 4I99A 3U3KA 3TVTA 2GCOB 4A4DA 2BTQA 1G8FA 1X2BA 2IHUA 1EFKA 1GIAA 4P83A 1XZ8A 4QT4A 4AKIA 4LQDA 1E1CA 1KJYA 3TNJA 4ZZ2A 4OM7A 1DKRA 3PE6A 1U2TA 2OCBA 4KO1S 1D6MA 3DAHA 5AKIA 5IK2A 3WYNA 2BHLA 4A0SA 3ADBA 1OUMA 4TXNA 1IYZA 3DTYA 2AKAB 3Q5GA 4MV0A 1NR5A 2FE1A 4GYKA 3STWA 3WFZA 1T36A 4MHTA 4JKOA 3CG4A 3EEFA 1CVRA 1YGPA 3FFXA 3KZVA 1C7ZA 3U7RA 4M8IA 4MR7A 2OZVA 4R2WA 5EUBA 3IA7A 4BVKA 4UOEA 4AX4A 2PT6A 3K4HA 4HH4A 2G83A 1YS9A 2HLPA 4B75A 4CTOA 3ANYB 1BKYA 1QHFA 2P4UA 3DWGA 1U11A 3QUTA 1VI2A 1Y6FA 3UCFA 5CLHA 1TT5B 2EXXA 3KYDB 1MBZA 3QFRA 4YUAA 3NVMB 4G0QA 2O0MA 4Q39A 5F5XA 5JYDA 2AN1A 3MD0A 2I62A 4P4LA 2BFMA 1JAHA 1NX6A 1Q20A 2GPJA 1QZXA 3CUEF 2C7PA 4OXIA 1FUQA 1VLQA 1ZD5A 2BH9A 2QJRA 3NTOA 4MHSA 4QAJA 2H5JA 2BJVA 3AUXA 3ETLA 3ISVA 3JAWA 4J1NA 3EXFA 4RXMA 2QEQA 4ZALA 1B3BA 2Q4OA 4EB8A 2DM6A 1NLYA 1P3Y1 3EPLA 3OZWA 1IJKA 3PXUA 3TLJA 5LCXA 1QONA 1VI6A 1G8JA 2ZAIA 3AKEA 2VRWA 4D8XA 4BWVA 1SVWA 4K3UA 2HN9A 1APBA 3GAMA 2PANA 1U7ZA 1WUKS 3ABQB 2FPGA 2NU6B 4KQ9A 4DEXA 3TQIA 2ZT7A 3KTAB 2FHSA 3VQTA 1J4AA 2I0FA 2PTHA 2QX6A 3KJGA 2ZDHA 2GF2A 4XWKA 1NVFA 4KXUA 5FWAA 1UBHS 1CUEA 1F2UB 4JNKA 1P5RA 2C9ZA 4YROA 2QUHA 1L3IA 2E4ZA 2J4DA 4HVAA 4KE7A 4AXBA 3EUEA 5J63A 4RA9A 5KHAA 5F7ZA 1JHMA 2REXB 1DJPA 3PQ8A 3IBGA 4NCNA 1GZ5A 1R6DA 1RJEA 2G6BA 4OCZA 5E6SA 2VJMA 1UT5A 4BRWA 2C3UA 2BF4A 5BUSA 2YYSA 5ESDA 3GEGA 4LCEA 4OQZA 3QJ5A 1JHVA 2XOXA 1SCUA 5EIOA 1D6SA 3BBLA 4PV7A 4G5XA 3EMDA 4F45A 3LT4A 1URPA 1K68A 3KAQA 3PZRA 1K3FA 3CONA 4RZXA 2GI4A 4RTPA 1QHHB 1S8AA 3WAJA 3HL0A 3SCZA 4URZR 2PGOA