4L6AA

Structure of human mitochondrial 5'(3')-deoxyribonucleotidase
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
201
structure length
201
Chain Sequence
SNAASGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of human cytosolic and mitochondrial nucleotidases: implications for structure-based design of selective inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords 5'(3')-deoxyribonucleotidase, mitochondrial
total genus 68
structure length 201
sequence length 201
ec nomenclature ec 3.1.3.-:
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4l6aA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4l6aA01
4Y2TA 4DWOA 4CF5A 3VAYA 5FP0A 3QLEA 2I6XA 2IOFA 2P69A 4H1WA 5AIAA 5AKGA 3U19A 1FEZA 1K1EA 2HO4A 5ALIA 3U7GA 2C8LA 3OCVA 1VFPA 2B1QA 2OYCA 5AKEA 2ZXEA 2G07A 3SKYA 4XPZA 5AK6A 5AK5A 2HSZA 1Z4IA 1XP5A 1ZD4A 3ZI4A 4Y3UA 3ZVLA 2IOFK 2B82A 2W4MA 2CFSA 3GYGA 2ZBGA 3FZQA 4Y2XA 3MC1A 4FYPA 4L6CA 3L0YA 5T41A 3I28A 5AVZA 4MUMA 2I33A 3MPOA 3OCZA 1Z88A 3L5KA 4Y2QA 4BBJA 1SWWA 2VKQA 2GHTA 4UM5A 5AW1A 1ZRNA 1U7OA 4EEKA 4YIKA 4GXTA 3N8GA 3A3YA 4RESA 4UAVA 3NALA 3UMCA 4G63A 4HAIA 5ALHA 5AW7A 4JDPA 2G0AA 3M1YA 4AS3A 2I55A 1VJ5A 5IT4A 3AR3A 2WFAA 2O2XA 3KZXA 3AR2A 2NO4A 1CQZA 1Z4QA 3OCWA 4KYTA 2AH5A 1XPJA 5AI9A 3QUQA 2EAUA 1JUDA 1Z5GA 4HGQA 5AVRA 4YCLA 1QQ5A 5ALXA 1RQLA 2YY6A 1WR8A 1SWVA 5ALZA 4AS2A 5AM0A 3NIWA 3UMGA 3R9KA 3WK6A 5AVTA 3L8FA 3SF0A 3EF1A 4XOUA 3QUTA 2I54A 4Y2UA 1O08A 3QGMA 3NAMA 3QXGA 3ET4A 5ALEA 4UATA 3ESRA 1RC8A 3F9RA 1CR6A 2D2VA 4UMVA 5AVXA 3SKXA 4EZEA 4IG4A 2R8XA 3ZWKA 5ALJA 2I7DA 3E84A 5JJBA 2P11A 1L7MA 5ALRA 3W5BA 4EENA 5ALVA 5AKXA 3PDWA 2G09A 3WK4A 5AKYA 2Q4RA 2YMPA 3EPRA 3KC2A 5AVWA 3R4CA 3WK7A 3AR7A 3ET5A 1Z4LA 2Q4TA 3W5AA 5AW0A 4NFLA 1O03A 2P9JA 2IYEA 4C4TA 4F71A 2G1AA 2MSNA 5ALFA 2YJ5A 2HDOA 2GFHA 3AR4A 4YCMA 3B9RA 3WK8A 5AVSA 5ALKA 4C4RA 3S6JA 4BEVA 3E58A 5ALDA 5AI5A 2ZOSA 2FUEA 1J97A 3SD7A 4JB3A 4OFZA 5AM3A 3E81A 1RKUA 3RF6A 1RPZA 5IT0A 4GIBA 3NRJA 3WKAA 5E0OA 4L57A 4YCNA 1TJ3A 4UM7A 2AMYA 3KD3A 1T5SA 1F5SA 5AI0A 4IFTA 3WGUA 1L8LA 2OA0A 3NASA 5AKZA 5ALGA 2RBKA 2YBDA 3RFUA 1QQ7A 2B8JA 1MH9A 3FPBA 2HHLA 4FFDA 1TA0A 3M9LA 2AGVA 4NABA 3PCTA 2RAVA 4ZEWA 2GMWA 3ZU6A 1YNSA 1LTQA 3CNHA 3WK9A 2WF5A 2ZBEA 2HOQA 3W5DA 1U2TA 3AR9A 1LVHA 3NUQA 3AR6A 1WVIA 5AESA 1RDFA 3I6BA 4YH1A 3W5CA 2G80A 1XVIA 2BDUA 3B8EA 5AW8A 3L1UA 4I9FA 2WF6A 2WM8A 1J8DA 2JARA 2ZBDA 4NAVA 3WKEA 1N9KA 3AR8A 1RQNA 5AICA 4C4SA 3K1ZA 3ED5A 3KDPA 4UASA 2YN4A 4EX6A 4OCZA 2MU1A 4ZEVA 1X42A 3N07A 2RARA 4BKMA 1T9ZA 3FGOA 4UU0A 2W43A 3UM9A 4Y2RA 3FM9A 4J03A 1L6RA 2YMQA 1Z4PX 2WF8A 4QQFA 1PW5A 4O8CA 1Y8AA 1RKVA 5A3SA 1Z4NA 3QU5A 1L7OA 4HGOA 1RLOA 3NANA 3OCYA 5AM5A 1ZD5A 1ZJJA 3EWIA 3IRUA 4YIHA 3QU7A 2FPXA 3HLTA 5ALYA 1YMQA 1TE2A 4L6AA 3A1DA 2WF9A 3OPXA 3ZWDA 4UAUA 2HF2A 3WK5A 1S8OA 3ZVNA 5AW4A 3OTQA 2G08A 4MWOA 2HCFA 4PNHA 3SHQA 3OCXA 5IS2A 2YMMA 4BX3A 5AI8A 3BWVA 5AM4A 4Y2YA 4AP9A 2OM6A 1TJ4A 4KNVA 2CN1A 4NV0A 5ALQA 4HGPA 1NNLA 4G9BA 3MMZA 1SU4A 4Y2VA 2FI1A 3MN1A 3N5KA 3A1EA 2YFYA 1WPGA 5AW3A 2P27A 1YS9A 2C8KA 3ONNA 4DFDA 3R09A 2WF7A 4UU1A 5ALPA 3U7HB 2R8EA 1VJRA 2PR7A 2DQSA 2OBBA 1L7PA 3U13A 4BX2A 3ZTYA 1L8OA 3L8GA 2YJ4A 5AVYA 2RB5A 3WGVA 3L8HA 5ALOA 5AW6A 1ZOLA 1RMTA 1QQ6A 3L7YA 1NRWA 1Q92A 3U26A 4CE6A 2O9JA 3SMVA 1YV9A 4J2TA 4HYTA 4UW9A 2G06A 3ZVMA 5AVQA 2FEAA 4YGYA 4DW8A 3QU9A 5A3RA 5AW9A 3WKCA 3FPSA 3OCUA 3DDHA 4EX7A 1Z4OA 4KX3A 4OHFA 2HF7A 2NYVA 3ZX5A 3WKBA 2JAUA 2C9MA 1ZRMA 4RETA 1U2SA 5AVUA 5ALWA 4Y2PA 2R8ZA 4KNWA 4QJBA 5AM1A 1IWOA 3E8MA 2B0CA 1QYIA 1Z4MA 3HYCA 4UMFA 3ZTWA 2PKEA 5ALSA 1EK1A 2IA5A 4BX0A 1L7NA 2CFRA 4UARA 2HI0A 4XQ0A 2R8YA 4KN8A 1Q91A 3D6JA 2ODAA 4B6JA 1Z5UA 2FUCA 3KOOA 1U02A 1TJ5A 3A1CA 3U7FB 1RKQA 2HX1A 3QYPA 5AI6A 3ZX4A 4CNQA 5ALMA 3U7EB 1QH9A 2ZBFA 5AKHA 3QU2A 1Z4KA 1EK2A 5AI4A 3WKDA 3ZUPA 3QNMA 2FPUA 2BDEA 5AW2A 1RLMA 5AHXA 2YJ6A 4BNDA 4F72A 2B30A 3AR5A 2B8EA 4CF4A 1RMYA 2Q5EA 3KBBA 5AKIA 5AK3A 3ZW7A 4Y2SA 1Z4JA 2CFTA 4FE3A 4UMEA 5ALUA 1N8NA 3P96A 4E88A 3QUBA 2X4DA 2EARA 2BY4A 1S2OA 2ZG6A 4HGRA 2NO5A 4ZEXA 5AKLA 2FPWA 3IB6A 5AKKA 2FDRA 2PQ0A 3BA6A 5AKJA 1ZS9A 5AIBA 4Y2JA 2C88A 3ESQA 4NWIA 4DCCA 2WHEA 3L1VA 1ZD2P 2GO7A 3EF0A 2AUTA 3L0BA 2EATA 3IJ5A 1AQ6A 1WZCA 3L0CA 1RRCA 3N28A 3UMBA 2I34A 3QX7A 2C4NA 4XE5A 3N1UA 1RMQA 5ALLA 4BEWA 2QYHA 2FPSA 2W11A 2IOHA 1U7PA 3DAOA 1T5TA 5AVVA 3DNPA 3SLRA 3I76A 3L8EA 4I9GA 3DV9A 4BNDB 3PGVA 2HEGA 5ALNA 4EELA 3FVVA 2JAWA 2FPRA 3PGLA 2B1RA 5AW5A 3B9BA 2JGAA 2QLTA 2GHQA 3I1YA 3J7TA 4KX5A 1ZD3A 2YMLA 1YJ5A 2YJ3A 3QUCA 4OD0A 1KYTA 5ALTA 1RLTA 1NF2A 3CZ4A 3QU4A 5A3QA 1YDFA 4CF3A 2JAOA 4BYGA 5AK4A 4HGNA 4UMDA 5AM2A 3TLMA
chains in the Genus database with same CATH superfamily
3L4BC 2YV4A 4KGZA 4DWOA 4JR1A 4LWOA 1M2EA 3QE4A 5L6MB 4OOFA 1FF9A 2JCYA 1H94A 2NTYC 2A8YA 2C4KA 2FWRA 3JAKA 3N0VA 4CQJA 4D3DA 1ADCA 3C6QA 4MRVA 2VJKA 3OZIA 3UZUA 1KQPA 3EC2A 1KKUA 3C3YA 1YCGA 3EHDA 2PX4A 2RHWA 4I1YA 4S1VA 3KVVA 2XRMA 3INRA 4J07A 2RC5A 3BORA 4MWGA 2C8LA 2ZBPA 4YP6A 3ZQ4A 4X1KB 3HCOA 3B82A 1LGYA 2BISA 2OYCA 4HAVA 4URWR 1UJCA 1MAWA 2G07A 2JLXA 4Z4EA 1V0JA 3M1LA 1M1NB 1Q3HA 2A9KA 4EGJA 5J23A 3KL4A 3N8HA 2C9ZA 4ZT6A 3K9LA 3FCXA 3NHAA 3K20A 5FRDA 1FSGA 3T9AA 4EHNA 4FYPA 1EWKA 1N0WA 3G8CA 3TJRA 4YUYA 1OTYA 2FMXA 2YWXA 4PIMA 3HVKA 5T4EA 1SUEA 3KPVA 3MGGA 3UFXA 5H81A 2FZKA 1SVLA 1Q57A 2R1ZA 4PG6A 3HGQA 2ZP1A 4R7ZA 1THMA 4CMEC 2CFIA 2D06A 1NPDA 3MQFA 3S99A 2J0QA 1OB2A 1FMTA 2H4JA 4OIFA 3SXUA 4JB8A 4OQNA 2VJBA 3CRW1 3CR8A 2LRHA 3RRYA 5AT1A 4AJPA 4BLUA 5JALA 1FZTA 1XRSB 1MOZA 4EJSC 1JAXA 2VSOA 1PSWA 1JS1X 1V5GA 1YJAA 2XDWA 3FOBA 3GLUA 2V7BA 4M1KA 4AZVA 5KBYA 2BBTA 1FYDA 3TLXA 4D25A 1Q95A 1Y3IA 2E82A 4I55A 5TS2A 2XT6A 2H7VA 3BL8A 3VHLB 3AI1A 5B58C 4A82A 5HW0A 3IOCA 4E3WA 2QOEA 2PWAA 1FUPA 1IHXA 3N2EA 1BAPA 4PZLA 2JLVA 2OP1A 4MB0A 4OHWA 5DLQC 3V48A 5IT9A 1AY0A 4X90A 4XWOA 3DMTC 5CFRA 1OFGA 2F67A 3NHYA 5EJFA 4JENA 1NN5A 2HTFA 3AEZA 1ONSA 1ORTA 2EFDB 1HSOA 3Q72A 4LY3A 2JCSA 1R6XA 2C31A 4JX9A 4AY4A 4P80A 3EJ6A 4CM5A 1CNFA 1CS0B 2OGTA 3BGWA 5FAKA 3AFOA 3C48A 1EM8B 3EWAA 3NV7A 4O8ZA 1Z2OX 3ESZA 4J0FA 2IZ7A 1W36C 1D2HA 2Q2WA 1Z13A 4HAYA 1JUDA 4RA6B 3VRHA 5ARCA 5B5SA 1M2JA 4Z54A 2VBCA 4K3VA 4BZWA 3CZCA 4LYGA 2X8JA 1VIAA 1C3VA 2JFNA 3NOOA 1TF2A 2CWDA 2B5WA 1R16A 3QXJA 4ALKA 5MN5A 3FBWA 1P0QA 1A5ZA 1F3OA 1YI0A 2MSKA 3GT4A 3OAAD 3NIWA 4BFSA 3ZZNA 2SECE 2I62A 3GLRA 4MIKA 3HK2A 3IP9A 2BBWA 3QEOA 1FW6A 1NX6A 5IHXA 2EFYA 1O6ZA 1EBUA 1UZUA 3EBPA 4FGLA 4P93A 4ZHQA 3WC4A 3W8EA 1WVGA 1TO1E 3FSJX 2C4WA 4XJTA 4OI2A 2BJWA 4E1BA 4KTTE 1NC1A 4LSZA 2D2VA 3OQIA 1W94A 5IW8A 2XYPA 1G21A 3G8DA 1Z0KA 1GXSA 1I36A 3HWRA 3ZGOA 4B34A 1L4FA 3W5BA 1XN4A 1Q7RA 3WNQA 4GICA 4HAXA 4KPEC 3ETEA 4GL2A 2G76A 4TKZA 1XMVA 4LI0A 2FR8A 4DLUA 4PPYA 3KE9A 2NV6A 5CPBA 3RROA 2AKEA 4MVWA 2Q5IA 2H4YA 1VLMA 3NBXX 3O4JA 4BHTA 1ISFA 2VF2A 1O5IA 3SK0A 4DLRA 1M0WA 3QPBA 4IM7A 5J2UA 2W48A 2YICA 2BYTA 2FMTA 5TPZD 2ZI7A 2W8BA 3QI7A 3DTYA 3S2IA 3DKIA 5EHGA 1YR3A 4RZSA 4KQXA 3IDSA 2P9JA 3D4BA 2W0MA 2VTKA 3OLVA 2MSNA 1WUHS 1R5OA 3TW8B 5CCXA 1XNRB 1DUIA 3ICCA 2X1HA 1JVNA 4DJ5X 1EA5A 1Z2NX 2IXDA 5F7JA 1ZD9A 1G8GA 4IHQA 1EYZA 2ZJ0A 3B1ZA 1U2QA 1SH7A 4DG8A 3JVDA 3MCWA 3VZCA 2WFLA 3LCCA 3H75A 2XDAA 4QUKA 3LYAA 2W9XA 5K4AA 2WE8A 5JMPA 1IY9A 4OFZA 4QPNA 1B26A 2DHEA 2LIPA 4LVNA 1T6BY 4ZREA 1QHXA 1FP7A 4NZZA 4J43A 3ONEA 3SDZA 2H2WA 5CEJA 1G5TA 2X42A 3GLGE 4CHTA 5EE1A 1Z0FA 2R4TA 3WGUA 1VKRA 1CYDA 2CNOA 1R0WA 2PKQO 4FWIB 5EHQA 2X2EA 4V3CA 3T3IA 4DQUA 3AWIA 2QN1A 4HR7A 4R2XA 3QI2A 4WNIA 4GQBA 1E61A 5CP8A 1JJFA 3A4IA 3K73O 4WESB 2BM9A 4A0HA 5KPDA 3JV7A 1NV9A 3IB3A 4HUQA 4Y7DA 1VCMA 4Z0HO 4ZEWA 2ZTHA 3H7IA 3N3BC 1CBUA 2ECQA 2QT1A 4CV3A 3AKZA 4G0VA 4IFIA 1OE0A 4TL7A 1N8TA 4JOSA 4ALLA 5JR3A 5JHGB 1Y9ZA 1A04A 2WWHA 4FX5A 3WJAA 1V7ZA 1HYEA 1XQWA 4AX4A 5KPJA 2QD2A 1MTZA 1RXSA 1V8PA 4OQDA 1E32A 4EPTA 1XVIA 2FRXA 3M82A 4BQFA 2UYGA 2GEFA 1GP2A 3BZUA 3D59A 1J8DA 1JSZA 2BF7A 2SKCA 1DWPA 1FTGA 3EXHC 3K32A 1E9FA 1UMCA 3WKEA 5BWLA 3AUYA 2YH2A 3THOA 1GPAA 1L4BA 3DTVD 3PQ6A 1A9TA 1UWCA 4CMEA 4ENVA 1EE1A 1ZESA 1G20E 2FUG6 4KW7A 3KOUA 2B8WA 5TPWA 4C4AA 2BI8A 3ED5A 3IE2A 4L28A 1R18A 2WSYB 3CLRC 4XDYA 4JUDX 2ZZNA 2FG6C 2MU1A 3NWBA 1FYFA 1ID1A 3U31A 4CFZA 4HH0A 1X42A 4MS3B 2FE4A 1NKTA 3TLJA 2GD6A 1B8NA 4TZTA 2NGRA 4KGDA 3V8MA 9ABPA 3T0GA 2N1MA 3D9QX 5IK2A 4JCOA 2B37A 1PW5A 3D0QA 4LK3A 3SFTA 1IJBA 1RCUA 4FGUA 2BVNA 1ONNA 2JLCA 1LX7A 2XVMA 3EAGA 3RRNA 3TQIA 1NVGA 4IO1A 3GQBB 5I9MA 3D6VA 1YS7A 2UVPB 1KI1A 1WCWA 3HLTA 4G8CA 4KFUA 3R75A 1BJKA 1SCAA 5CXQA 2WF9A 4I9NA 2P6OA 5LZ5A 1G2IA 1I1HA 1YS2X 1G6KA 1SQSA 1C2TA 2YX1A 4K9SA 1D6JA 4LYHA 4UAUA 4BFTA 5LD2B 1S8OA 2R8OA 1ORRA 1P2DA 1TU4A 3JWEA 4H3SA 6CHYA 3SDSA 2O8BA 2BFBA 4UCXA 2HCFA 3MAJA 2UUAB 2JANA 1XRQA 2ZYRA 3W2HA 5FBVB 5KUTA 3RRXA 3BL5A 2WTMA 4HEA6 4N8DA 3W77A 3CEJA 1BE8A 3K8YA 4DUGD 3LP8A 2SHKA 3ZXXA 1W2WB 1TJ4A 3I9V1 3RQSA 3NEPX 5A6VA 5FQOA 2X2OA 1YQEA 1MUUA 5BMOA 2AEEA 3NVAA 3PC8A 2ZE7A 4RKEA 2AZXA 5EP4A 1Y82A 1W5TA 1T3GA 4DNQA 2XB4A 4S04A 2EHDA 2OD2A 4CKZA 3HR8A 3N7UA 4R5MA 4DUYB 3OZWA 4HVAA 3KQWA 1WPGA 1Q1ZA 3DAFA 3A70A 3HUEA 1AIPA 1FTQA 5JH7B 3L8YA 4OMCA 4B7UA 1BEEA 4JI5B 4GPAA 2E5LB 2EZ8A 3WGHA 4U9UA 2HM7A 2VAXA 1NW6A 2BR3A 1CP2A 4DJEC 2Q62A 2LCFA 5FWAA 1VLHA 2R5WA 4HWGA 2FMIA 2P9YA 2XE8A 4A0SA 2NW6A 5IDXA 1UJ4A 2E9FA 3F8TA 4K05A 4MRMA 4O2BB 1B3RA 1KQ3A 1QKIA 2CVPA 2JJ2D 2PR7A 4L3VA 5ES4B 3LX4A 1ZMRA 1E3EA 1MC1A 1DCKA 1OOEA 2XXBA 1CSEE 2NZYA 3AKCA 3G5TA 3NS7A 3BEDA 3C70A 3OM1A 3PPIA 4QOJA 4BP9A 3NOQA 4B09A 2PTGA 3VC1A 2BMJA 5HKOA 3V1UA 4XIYA 3W3AA 4U7GA 4LF4B 3RFFA 1S01A 2A0YA 2EGGA 2GVNA 4BNIA 4EYOA 5AW6A 2GESA 3OE7D 2I22A 3VC7A 1XMQB 4RGQA 3SC4A 2H5JA 5G53C 1WZNA 1X0VA 1XDSA 1SRQA 4AUNA 2F8SA 3RAJA 3KSAC 1SQ6A 5ELXA 5HDQA 2BFCB 2AEMA 1R8QA 1E98A 1UQRA 4YCDA 5I4KA 3P4UA 4MULA 2ZUWA 4NBWA 4YGYA 1J8QA 1SPBS 2UKDA 2X4GA 3TZBA 4AD8A 3P0HA 4KHPB 3DM5A 4PYNA 3SOPA 2F1KA 1N7GA 2QNBA 5CD9A 1E99A 5KJEA 2B1JA 1ORDA 3L0DA 4GBGA 1M6WA 1NT2A 1DRWA 2FW1A 4L50A 2RHOA 3E05A 1EESA 4Y9TA 2E4XA 2NYVA 1O95A 1FLVA 1ZZGA 1S1MA 5FV4A 4MQ4A 1E7QA 2AC7A 1Y9DA 3OJLA 4I50B 4QAJA 1XVLA 2OGZA 5FUBA 4AUMA 5L6LB 2W2TA 4JJ8A 5EKSA 4FLEA 4RPKA 3HYCA 4J91A 3KLMX 3H2ZA 4O4JA 3NX4A 5BR8B 3N2KA 2EF0A 2QJWA 2I6FA 2BJHA 4LDPA 1XZBA 4XLLA 5FPKA 1H2WA 4ARZB 5FTWA 4RPIA 1KQGA 3LSTA 2R8YA 4KR0A 4HI0E 1Q91A 2W93A 2O5CA 1R9MA 3KTOA 4PLVA 2JJMA 2VXOA 3FWYA 4ZHQF 3MLAA 1BQ3A 1I3NA 1LW7A 1JVSA 3AONB 4PTZA 3QYPA 4UHJA 3T94A 3ZX4A 4CNQA 4YP9A 3WHKA 3ANYB 4YRNA 2RGGA 1Y1LA 3KHKA 2AF4C 3QF7A 3FFXA 3WHPA 3WAKA 1KMQA 4YNBA 2XMRA 3WKDA 3TD2A 1KJZA 2QTWB 1IVYA 1EP9A 3GFPA 4Z9FA 1FIUA 3ZJTA 3QLUC 3F2VA 2AT1A 1WXHA 3D7NA 2HHAA 2QUJA 1Q5PA 2B8EA 2R11A 3M4ZA 3SE0A 1PL7A 2EP5A 3KBBA 4M88A 3K0CC 3DM9B 3LT4A 4FZ5A 3ZW7A 4B3BA 3PHBE 4GFDA 1BO6A 3TR6A 1Z4JA 1EXVA 1T8SA 4OI0A 4CCAA 3D8UA 1M6NA 5E1MA 2OTCA 1M1XB 3OP1A 1R8XA 4D43A 4DR3B 2VOJA 3RUIA 3TRKA 5L53A 1DADA 3TNYA 5L3QB 1G2PA 2BKVA 3KT6A 3O31A 4XYBA 2EGHA 4QZVA 3U4HA 3GT7A 2FX3A 1SBNE 3EEFA 2J9RA 3D5EA 1DS6A 1CZOA 2WT4A 3DEIA 3OAAA 2VHWA 1YRQA 3LPMA 1L5OA 4MS1B 4MRSA 3S8MA 2O0JA 3AIOA 3WGGA 4E1VA 1I7NA 1ZIXA 4F2HA 1MB0A 2H4HA 4OHBA 4YMLA 3GUVA 4GE0A 3X1ZA 1JIVA 5F5LA 2XTZA 4BY9E 4R8SA 3RIGA 4QJIA 3R6VA 1W8DA 5FPQA 4M1ZA 3JQ8A 3SLKA 1VBKA 3WRXC 1Z15A 3EGDB 1YDWA 3ZZTA 1WZCA 3BYZA 2XYGA 4YMHA 4V1CA 3UG6A 4CM9A 3W5JA 5J2TB 3CMCO 4YUXA 3H5VA 4C4OA 4AZ0A 5HKKA 5DNUA 2DERA 5EQDA 2WB2A 1NVUQ 4QFDA 3HM9A 3TMAA 3V3KA 3ND8A 5KDOA 2V8OA 2JH9A 2EJUA 2P3QA 2YHIA 1T1IA 2OFFA 4GT1A 4KPYA 3PV0A 3X1MA 4CYMA 4W5TA 1X1TA 2B2NA 2R2GA 1AKUA 2PMDA 4OQMA 4JD5A 5EE5B 1DBQA 5TPZA 2WJPA 5L45A 2HIGA 1F4VA 3LBIA 3QBEA 4HXYA 1H6CA 4Z0TA 2NPFA 1J2UA 4LJ8A 5J4YA 2XRFA 1LLFA 5DX1A 3NVMB 3ZD9A 3PGLA 1KVQA 2QW1A 2R65A 4OHOA 3CLKA 4CMKA 3ECSA 5I9NA 2HSGA 2C9CA 3QIVA 4HB4A 3VHXB 4P4UA 1M9NA 2VXCA 1QE3A 3KV3O 4CEIB 4EVSA 3O0DA 4EB8A 3FI0A 3UYKA 1PGNA 1LV7A 2B2CA 1UKEA 3Q87B 4TLMB 4V2UA 1MX3A 3VA7A 2I87A 2UUOA 2DSNA 1HY1A 2NO7A 4HX9A 3B60A 2FMKA 3CZ4A 4WFQA 5AJTA 2JZOA 2ZE5A 5EESA 3V2GA 2HDWA 2XHZA 5JRZA 2RJOA 4J0KA 2BHRA 4KQ6A 4ND6A 4B9EA 4GZ6A 3PUYA 4ZO4A 3L7AA 5A06A 2H4WA 5CHEA 2E4AA 3S70A 2X8AA 1IY1A 1HRKA 1K8RA 3SYKA 3JQ7A 3VTZA 3ABZA 4JEMA 3NC0C 3PJRA 1E2MA 4BFWA 2ETVA 4L7QA 3WSTA 1HYGA 1NDQA 3LY7A 4ZMSA 4EPRA 1C7IA 1DDGA 1F8FA 1KP3A 4XLTA 4A9AA 1TK3A 1UMDA 2YW9A 3ORQA 2ONJA 3SG0A 3LP5A 3QH4A 3QBTA 4IEFB 4CFSA 1KYIA 1T0PA 2R1UA 4BO3A 3ZHSA 1RTTA 1U1EA 5AKGA 1YVUA 5JZMA 1E0JA 3HXPA 2XV1A 3VH2A 4MWEA 5BN3B 2WJGA 4P92A 4BS9A 2LPMA 4HYYA 2Z8ZA 4FMPA 1VP3A 2ZRAA 3PFKA 821PA 3IAS6 4D46A 3HXTA 3ZTTA 4R69A 1Z4IA 3C4JA 1W35A 5TRTA 3ZI4A 3IEKA 2BMDA 3ZVLA 1Q1BA 4U2DA 2R0QC 4ZDJA 1RTKA 4Q3KA 5CBPB 1T2EA 2CFSA 2W2VA 3L6DA 4B7CA 4MH0R 4WBXC 4V1CI 4AKGA 2QRLA 4EG3A 2ZYAA 1WQ3A 4GC5A 1UF9A 3RKUA 1A5TA 4HN2A 1U0BB 4GQAA 3PWSA 1OGYA 4KBYA 1GQ2A 1H22A 3MLBA 5EYPA 3UK7A 3PUJA 4BE9A 4RJ2A 4H7HA 4C4PA 3FYUA 3FFAA 4LYEA 3IBGA 1FNNA 2QTRA 1NJ1A 3HBLA 4IINA 4KQIA 4YN3A 2OENG 2R6CA 3HCAA 3MVEA 3A37A 4P3KA 4E09A 3R7SA 4V0SA 5FBQB 3INTA 3L7BA 4CKEB 5IU6A 1SXJB 4GKBA 2GARA 4E11A 4EHBA 2EJTA 2O1XA 4Z49A 1CQJA 4O2BF 3LL4A 3EPKA 1WE2A 1IG0A 5LM3A 1W47A 4KO2S 4LHEA 2J33A 3WFZA 1YBHA 4RX1A 1XZCA 2H5EA 1UANA 4UTZA 3HN7A 1RWMA 3Q41A 4YRBA 1PN3A 4C7MA 2JDID 3C7CB 2Y99A 3LQ2A 3U3XA 5KU7A 3UK6A 3RVJA 3EHEA 4TGLA 3T3HA 2CSUA 3FWPA 1M2OA 1PR0A 1GQRA 4TN1A 5A02A 2GGSA 3KSBC 3A6KA 1GCAA 1H0HA 2CW5A 2QG6A 1ZRHA 5A5VA 5HS4A 1FUUA 4OM7A 3AO0B 1ULAA 2LV8A 1N5JA 5EXXA 3UXYA 1JB1A 1KI3A 3Q6IA 5LKRA 3KM0A 1ZBQA 4DUZB 2YYAA 3RUDA 1CQZA 4Y9RA 2NTVA 2HK6A 3JQFA 4KDFA 4NCNA 4UHHA 3COZA 1G8AA 3ZHZA 2VL7A 5KIAA 1A2OA 5DP1A 1G8YA 1M54A 2CMHA 1RQGA 2R9VA 4ZVMA 3ZGYA 4BKQA 2RKOA 4DUGA 5KEIA 1ZGJA 3FHTA 1XD9A 3GFQA 4MA5A 4FNOA 4GOMD 3F6BX 3AHCA 3EZYA 4Q4CA 3R3YA 4C2TA 1WUTA 2C9OA 2DTXA 3L7IA 1PZEA 4PX3A 1T9DA 1UBCA 2ADFA 1NYLA 3TEJA 1J2JA 3LLVA 2FPGA 3EF1A 1BWSA 4DB2A 3W9UA 2YY5A 1TW2A 2IUEA 3IELA 4M46A 3WICA 3PXXA 4TQGA 1MX1A 1QGUA 4CKXA 4EY7A 2FVXA 1PDWA 1KO1A 2QRVB 4GR9A 3F6PA 2D2FA 5C8YA 1YCHA 2O1SA 3EXEA 4J16C 4YRRA 4CM4A 5ALJA 3WLPA 4OHUA 4MPRA 4QARA 1SC6A 3HCDA 4QYSA 1M2WA 1UKVY 1N6PA 2QJFA 3BTUA 5BNFA 1IPHA 2OAGA 3ZCTA 1EGAA 2C7QA 1G60A 1OXVA 1WSDA 3Q7QA 2CXOA 1RYNA 1U8TA 5CK5A 2WIGA 4CI0B 3DDNA 1W0KA 2ZYHA 1NTOA 3MERA 1FNMA 1L4EA 3K8OE 1SCDA 4LV5B 1E20A 3SGLA 2XB2A 3OF5A 4HGZA 1AJEA 2ECOA 1BX0A 4XEUA 1Y9EA 3MT7A 4FNMA 3REFA 3ZLBA 2VVTA 3DWEX 3RHTA 5HIKA 1JVBA 4DIKA 1REQB 2WFZA 3GBPA 4M7WA 3AGQA 1K2VN 4PX2A 4RVNA 4N4AA 4C6HA 1ZH8A 1G5HA 3SQWA 1JFLA 4TWJA 4HAUA 4G86A 4BC0A 1X2BA 3IOBA 2G3YA 3AJRA 1AB6A 1U7HA 3AR4A 2DC1A 3UHFA 3WLQA 2V6GA 3TQFA 3ME5A 3WK8A 1EG7A 1BH6A 4C1BA 4WCFB 1UQTA 1IN1A 5HRAA 1UBGA 4N9QA 2C2XA 2DWUA 1YA4A 2E4VA 2FUEA 4QRHA 3O4IA 3AUKA 5A3VA 3WB9A 5L3SA 3HJCA 3LXXA 3GUZA 3IUYA 1U7TA 4PYLA 3NIGB 3MMXA 3VVMA 1Z0SA 2H16A 1O94A 1CPYA 3D6UA 1CUEA 1U8FO 3DYVA 4KKVA 4C7OA 2HLNA 1PTJA 4YONB 1J0EA 2GJ4A 2BP7A 5KREA 3HCRA 2RBKA 2NZUG 4P31A 4QJ4A 1CTQA 2VK4A 4KQ2A 4YJKA 1TCBA 2CL7X 1OY1A 5ETJA 5JDCC 1LLCA 2PPLA 3OD1A 4YAWA 5A7GA 4EYQA 4YRTA 3GLFB 3N9IA 3KO8A 2OV6A 5B2FA 5E38A 4Q82A 2KBFA 1OYYA 2HSEA 2WSLA 3ZH2A 1A1VA 2RD2A 4DSZA 3OIWA 2WYUA 5B64A 2IYSA 2PRKA 1JZSA 5F3RA 2NU9B 3IILA 5CA1A 3AZPA 3SC3A 1QRRA 1T2AA 3WYCA 3E5MA 4ERXA 2EOAA 4IUBS 1IVSA 1X87A 2FRDA 3AR9A 1KY5A 2JH8A 1Z33A 3GLKA 2DF8A 3LZ6A 1Z0IA 3A6DA 3AZOA 1QDLB 4GYWA 3T3NA 2ZJZA 2IXBA 3MFYA 4KPFC 3VOBA 5T67A 3AUAA 3LW8A 3B8EA 3O2QB 2Z8YM 1ZSNA 4KR7A 4A6PA 4EJFA 1AN9A 1G66A 1LK7A 2OE2A 2RHCA 3QHAA 2XQIA 2AYXA 4GPEA 1P18A 5C31A 1XD8A 3Q5DA 1XOIA 4Y30A 4G0MA 4S24A 4D99A 5B2EA 3TW8A 3D54D 1YVPA 3C85A 1BS2A 1GQOA 2AFHA 5HK9A 3THXA 3MXOA 2FX2A 4R51A 5COQA 1NT4A 1Q1NA 1M5RA 1GSHA 1V95A 1SCJA 3FGPA 3PLAE 1JLRA 2YQ4A 1VLJA 4OJKA 3GJ3A 3X2EA 1XUOA 1VG8A 3HI6A 3I8XA 3W7AA 5I9LA 2BPOA 3G23A 1Q0TA 5F3WB 1Y9AA 4X1YB 2AWNA 3KUCA 5JG7A 2ECPA 3RS2A 5AYVA 4HS9A 4DLVA 3E1SA 4PLWA 4P22A 3N05A 5C3MA 4YMTA 1A71A 2Z2IA 4EW2A 4G4GA 4HDAA 4U7WA 1GKIA 1ZNWA 3ELDA 3SIWA 4K5QA 1R4NB 4LDAA 4F85A 4YIHA 4KVFA 1KAGA 3CRQA 2CJPA 3WA6A 2H0RA 1UT8A 4HDNA 2OV8A 3A1DA 3CJTA 3HV2A 4M8NE 4J76A 2P0YA 4FBGA 1ADJA 5DHRA 1YGPA 4MV6A 3HO1A 1PV4A 3R7FA 3ZBTA 3NHWA 1SVSA 3KHTA 4IIDA 2C83A 4U2GA 2AWOA 4PNHA 5HQJA 1ISJA 1X80A 4CM9D 1ULSA 4YMVA 2ZR7A 3LC7O 4UDNA 5IS2A 2DT5A 1FJGB 1UAYA 5LUBA 1T8RA 1TDJA 2I2AA 2VDUE 4URUR 1W34A 2JI9A 1I3CA 4M0EA 3R9XA 2DZDA 3D7SA 1YZYA 3RANA 4XJSA 3IDOA 5CX4A 2Q3HA 4Y2VA 3THWB 3MN1A 221PA 4LI3X 2HBQA 4QPCA 3TOZA 4JFAA 1L5QA 1ZUD1 1LRJA 5E6SA 5KC8A 3AM5A 3AHIA 1SEVA 4LISA 2GKOA 3BE5A 4YWJA 1PWHA 2Q3JA 3AHJA 1KPGA 3D3EA 3LKVA 4FMCB 3DE7X 2KLHA 3CRMA 4JWTA 1EX1A 1MH1A 4K9DA 1IZ7A 1H05A 3GAFA 4I4TF 3WS7A 2GM4A 4IZIA 4NK5A 1E2IA 3I37X 4L8VA 3HYTA 1CUWA 1NU8A 3E82A 4HWSA 1LI7A 1HDEA 2UZ1B 3LECA 4NF2A 4BNTA 3DLHA 2MWMA 4MPPA 3EFHA 3BAFA 4B0PA 2V7PA 2BD0A 4BVLA 3KLBA 1HE2A 3MS4A 2JJ1D 2X0IA 4P82A 3HUFA 4ZQGA 1JMYA 2EXXA 2JA1A 1Q11A 4K87A 2LDBA 2QM3A 3ILSA 5EJ8A 3WGVA 4CL2A 2D0OB 3WSVA 3V4VB 3DVLA 4GECA 3V1LA 1U7XA 1U1FA 4PHCA 1VL0A 4UCFA 3UHPA 3EZXA 2ID4A 4URHA 2W6JA 3NORA 5KNCH 4JI2B 3NG1A 2VCYA 4IIUA 2ZRKA 4IOJA 2X4IA 2NT3A 3AW8A 1S5PA 3FWHA 3II6X 1M8FA 4V0RA 4DE5A 1QR2A 1Z62A 2D0IA 1C1XB 1GADO 2A5DA 1DSSG 1YIAA 4CDNA 2H51A 3A2NA 3OF3A 4C2AA 4I0WB 1H42A 4CFYA 4A4DA 2ZIVB 1FP4A 1WCYA 5HMMA 4MV3A 3OTHA 4PFKA 3U3KA 2PNJA 1GIAA 2W6OA 3DTTA 2I3ZA 3MGKA 5EP1A 4AURA 4PG8A 2QAGB 1M6VB 2YHUA 2O07A 2H1LA 5DMHA 5DYYA 3VHRA 3DT8A 2NYRA 3F5QA 4KLAA 3RSZA 4C29A 1AQYA 1XZJA 4OHFA 4KGXA 1HL7A 4NVRA 4Z1MA 4C4YA 4E5KA 4UXJA 2BIFA 5BP7A 1JFFA 4Y1RB 3BWYA 3LT2A 1KYVA 1E0AA 1SK9A 2WJVA 3C39A 4FOSA 3TD6A 5K0CA 4YV1A 3DOIA 4K0KB 2YV5A 4IRUB 1JJBA 5AM1A 3ONVA 1SC4A 4WQMA 1ZH4A 3C1UA 1NOJA 1DBIA 1CIVA 3PFWO 4Y67A 1SA0A 4KFRA 4K40A 1U2EA 2A94A 2XPCA 3BB3A 4JBNA 3MGBA 4OBEA 4WJZA 4HPJB 5KYUA 2JFQA 3BMCA 4L9WA 3HWSA 5HF8A 1OFHA 1I1QB 2LVBA 3PUHA 1PNRA 1Z08A 1BE6A 3WBBA 2C7RA 1RAFA 2F3QA 4B4DA 2Z6QA 4XFDA 1V8DA 2F59A 1FFXB 3B5JA 4MR9A 1NFQA 4NBSA 1XK7A 4YR7A 1PLJA 4AZSA 1UK9A 5SY4A 2A3NA 1S02A 1NJ2A 1RLUA 3SHTA 3T7SA 1LY1A 2PAFA 2EGUA 1FP4B 4IIHA 1Z5UA 3ZDRA 4TXLA 3T41A 3FNIA 3AY3A 1O6CA 1TPZA 4RLFA 4G1UC 4IJWA 2PRIA 4LW8A 3RYHB 2GZAA 2VN8A 3P0IA 1T43A 2D5LA 3LO5A 2XDQA 3I23A 1JJIA 3PGKA 5T5QA 4O1IA 1OLSA 4ITVA 1I7DA 4K6GA 4EARA 2YV2A 4LVUA 3NOXA 2V7UA 2IGTA 2XB9A 4KJZA 3AY6A 4O2RA 1Y1PA 2H11A 4XM2A 5E4YA 3R6DA 4RF4A 3UUFA 4BYMA 3KQSA 2GXQA 1TADA 4PU0A 2I66A 2J5QA 4QT0A 5LCXA 2C3PA 2GDZA 3FUXA 4V0KA 4ZAWA 5LB4A 1EUZA 3A3NA 2HH9A 1H8HD 2C7BA 2OLEA 2E85A 4Q03A 4E46A 2UV8A 4QOIA 4MHOA 1NNI1 5JXJA 2Y1OA 2H57A 4GXNA 2EWWA 4I5GA 3OH8A 2Q99A 4C0QC 4NQZA 4IPTA 3SZOA 4ROSA 4ZOLF 5EINA 1A7KA 1DC5A 2IYXA 3KWFA 1T9BA 4P58A 2NSDA 3ANSA 4WA8A 5BSFA 2RGEA 5FBKA 3D7RA 5JJCA 5CJPA 3V32A 1JDBC 2YZNA 2ZUCA 4QXMA 3QKIA 5EJ7A 4MROA 3KKOA 2IHBA 3T4PA 4OGLA 4Y2JA 1JWLA 1V7CA 3L84A 2FZVA 4JH0A 1TEHA 3CW8X 4NWIA 5J43A 1CKEA 3UVEA 5LQKA 3ZDCA 1VDKA 2WHEA 2ATIA 4L72A 3SP1A 5FPYA 5IBCA 4H31A 5IBQA 2OORC 3UGJA 4G8BA 1QK3A 1JLLA 2D1FA 3GELA 3IAM6 5KDDA 2XGJA 2QM0A 2WU3A 5JIBA 3BJEA 1TECE 1CNMA 1Z0UA 2FGJA 3UMBA 2FHPA 4EGCB 5KTPA 1YZGA 4CR7A 2WM3A 2WHQA 3L04A 3JALB 4N5MA 4XQCA 1CDEA 2OVFA 3ROQA 1WETA 2Z8XA 3VH3A 5IWCA 2NWQA 4LNUA 5DBHX 2RGUA 2G4VA 3F5DA 4AJEA 3CPSA 1V3QE 1XEWY 2PTHA 3E61A 1RXCA 4HN9A 4XGNA 3UGKA 1QWOA 3IDFA 4NZPA 1VPLA 4DYVA 1FNBA 1FNSA 1FTWA 5EAIA 4QOHA 5BQPA 2B1RA 2C98A 1BEZA 3T5DA 2JGAA 5CXUA 1CD5A 1ULTA 3ANNA 5ICEA 5DTMA 4F11A 3KQNA 3FWKA 3ZGNA 2A5GA 1Y1KE 4P2BA 5DN9A 1GTMA 4CTJA 4YCCA 2EKBA 5LPNA 3JATB 1XE3A 1JFVA 1RQ7A 4FGZA 4M83A 2Z5VA 2GCPA 4ZJYA 2ZEJA 4U2KA 3TF5A 2JHAA 5CNJA 2C0QA 2Q2QA 2YIMA 5JCJA 3DLCA 3TCXB 3PITA 4BQEA 3AB3A 4RTQA 2WWYA 4Q18A 1U9IC 3CWZA 4RKRA 1JDNA 2VHTA 1JH8A 5I7VA 3TL6A 5JFOA 2C7VA 1NBEA 4C3OB 2ZM6B 3A9VA 3HCEA 1S2IA 4IOMA 4OGFA 4RNDB 1KP9A 2PNFA 5EWLA 5JWRA 4I2NA 5CB4B 5KWIA 3PNPA 4MQEB 3R8FA 2BRUA 4RHEA 5JS2A 1LXCA 2J6CA 2JS7A 3QKWA 1GGHA 2LWIA 5A4KA 5KWVA 4FFPA 4FFVA 4O2AA 5DPMA 4DYHA 4DQKA 5KKCA 2PWZA 5IM4A 1Y3BE 3DKRA 4HLUC 3NTOA 4W7SA 3U3RA 4KAXA 10MHA 1Q20A 5TX7A 4Q4JB 1XRMA 3A06A 3ND6A 4H1WA 5ITWA 4L1KA 4YPVA 3KWLA 1YOBA 5CA0F 4KJXA 1R3DA 3JYLA 1DJPA 4KOEC 1UC9A 1YXMA 2BTQB 2DKNA 3AV0B 3CNQS 4L4UA 2NVWA 3KXLA 1B8OA 2ZQ5A 4RQUA 1Z34A 1C29B 1Q0QA 3AYXB 4UD2A 2X13A 4NLLA 1RWOA 1N9GA 4Y3UA 4X1IB 2OCAA 4ZP1A 1PG2A 4BNJA 3KT0A 5UKDA 1GKLA 2WTUA 4C2UA 4MQUA 1YOVB 3MNFA 2BONA 4X00A 1EHIA 3MTQA 1OSNA 5GTDA 1BNCA 3F5FA 3I28A 1RAGA 5JECA 3U49A 1WOYA 1VSUA 2QTLA 4NRDA 5M3BA 4WK6A 2JVIA 1BS1A 2R87A 3G0GA 2J4CA 4MR8A 4OB8A 4MJXA 1DBSA 4PVCA 2P41A 1K0FA 1W1WA 1MC4A 2D74A 2C82A 2WWXA 2OO3A 4Y2HA 3PJEA 3P97A 3K9WA 4XCQA 4HAWA 2I3GA 3GO4A 3FNFA 3O5AA 1YMVA 4B74A 4GOKA 5KOIA 1C1DB 1D9XA 3W5HA 1KK3A 1R12A 4IGKA 2ZT5A 3WAGA 3ETNA 4FINA 5LXTF 1G6HA 4DABA 5J59A 1ZVJA 4AECA 1MDFA 4QNMA 4ON9A 4XWWA 3STUA 4EYSA 2ZJYA 2BSQA 5NULA 5HZGA 3D3WA 5E8JA 5K3FA 3K9NA 1G4UR 2XQKA 2WB4A 1GV0A 1LZLA 3VTAA 4F4JA 4H9GA 1Z4QA 1U94A 3A27A 1WJGA 5HBRA 2YN2A 3GFSA 4MOWA 4I08A 2B7BA 5T4HA 2AI2A 2BEJA 2QKYA 4N49A 5IVDA 5JSFA 2PO7A 3PWTA 5KVAA 2GTHA 1J8FA 4RH0A 2PTQA 5BRAA 1R4MA 3QMVA 4F1KA 4F93B 1NI4A 1CQIA 2HPAA 5B6JA 1R9GA 2JRLA 2OD9A 4JZKA 1B74A 1UEXC 2GEKA 2YVLA 1J24A 1R27A 1GZ4A 2OL4A 3GFRA 4YDRA 3R9KA 2AR7A 3WIBA 4EY6A 3KXPA 5DIZA 1TMYA 4GWKA 3TSWA 4LDJA 3IUNA 4X20B 1E6EA 4FX2A 1ZLXA 3NAMA 4U02A 3BSSA 3SZUA 3WLKX 4KDCA 4E5VA 5HGXA 2OECA 3F9RA 1CR6A 3AHDA 2PT9A 2ATCA 4P4LA 1Z12A 2EG9A 4G1FA 3ZE6A 1MC8A 3M5PA 3BRSA 3F4LA 4MKIA 1KJIA 5JAIA 1OWLA 2AJTA 3I04A 1VL6A 2XVAA 2B3DA 2BFOA 4IIYA 2DPHA 2QU8A 1BZYA 1KHHA 3PNVA 4FR2A 5DHAA 5C7YA 4X62B 2XCIA 1N3BA 2V7QA 2IELA 2HMVA 1T2UA 1GPWB 1A9SA 1QFSA 4RMNA 3TZHA 2QRPA 2JJ1A 3M5DA 3IR6A 1QGYA 4KDRA 1H2EA 2HRRA 5CGZA 3WOVA 2NLOA 2P9ZA 3CVOA 2XTNA 4PSKA 1NXOA 2YMPA 1KFEB 4JJFA 2HA3A 2ZRBA 3MJHA 4PQYA 4ZVLA 2C5LA 3HXKA 4N40A 2CHGA 2WNHA 3HVHA 1W36D 4LXQA 5FHQA 3W5AA 3KQOA 2H07A 2FZEA 3PICA 4M4SA 2B25A 1GNQA 2VQDA 3F3SA 1HDOA 2G1AA 2W6NA 2ZRQA 2XXAA 2B69A 2FW6A 3I9OA 1UBNA 1GAJA 4JBIA 4H4EA 3DZHA 4RF5A 5TV2A 2VH5R 1IZ9A 1EFKA 4F5YA 1TT7A 4CKEA 4BVGA 5G02A 4JQCA 1E6LA 1I6KA 2LDXA 1RRKA 4C03A 1CQJB 4UCQA 2PLRA 2IWRA 1XAJA 4JVNA 3AGPA 4LCJA 4ZCTA 2G9QA 3Q2KA 1ESCA 3QE2A 5AM3A 5E6RA 1A9XB 4G2TA 4KC0A 5BN1A 2L17A 4I3FA 4U7JA 3HL0A 4PEVA 3QKSB 4D98A 1XCMA 3WKAA 4FEGA 4AJOA 1N2IA 2Q1TA 4EFCA 3U09A 2JI7A 4OJTA 5TMBA 1JHVA 3I8OA 3JY6A 2V7TA 4F3YA 3AVXA 1IM8A 1N9GB 3QPDA 2FMHA 2ZE6A 3UK1A 1OWPA 1BXGA 2YWEA 3IE1A 1AUPA 3PGA1 4TYYA 1QK4A 3IERA 1ORHA 2XE4A 2C0CA 2PZMA 4EFNA 4P81A 5BN5A 4XVQA 1I5RA 2DYKA 1P45A 1AUXA 3UA3A 4OGGA 4QC2A 2VJLA 1AO0A 3I05A 3TECE 1JG2A 3S28A 1JAYA 4GEGA 3NFYA 3U7RA 2ZVDA 5BQ5A 2FMUA 1NYRA 5ER9A 4DIEA 3LLSA 1QVZA 2O0LA 3M4XA 3VKVA 1EWTA 1GTL1 1OAOA 2H7XA 2RIRA 3JQBC 4G0XA 1WDMA 5G2OA 1VKOA 1KOGA 1M8JA 1TQ4A 4G2NA 3DPUA 1Y9JA 3DWFA 4H35A 5EPOA 3WIDA 1EE2A 1LNSA 1C3CA 1L9KA 1MABA 3D8BA 3Q2OA 3MZ0A 1QG0A 4O59O 4E70A 4GU5A 5BRJA 2AG5A 4C01A 4MS1A 2ORYA 1GUAA 2JARA 2ZZKA 2ZBDA 3NH9A 4WK0B 3TRIA 5A0FA 3T3MB 1WQ1R 1PWEA 5GONF 1VI6A 1FLNA 3I83A 4FCCA 4RDHA 3I2KA 4D4JA 1BXGB 1Z68A 4MLDA 2J3IA 4XFJA 1SBCA 2AZMA 4Q7QA 3NCTA 1CS4C 3WZLA 3MRSA 4APAA 5TS3A 4IJMA 2V3WA 2VDQB 5IDQA 5LZ9A 4J16A 1JBKA 4FDVA 1YKFA 4B43A 4BNWA 1FJ2A 4QGSA 2YV1A 1YZHA 2I6QA 2IYZA 3A8TA 3HRIA 4GX5A 5CW1A 4YASA 3U6KA 1Y3HA 2HDNB 1WU7A 2IU0A 5DFAA 5K3BA 3G17A 2XCOA 3TOCA 1RKVA 4TMYA 1LSUA 3DYIA 3EYAA 4TMXA 5A3SA 1BIFA 4F45A 1F1BA 1KY3A 1M73E 2GPSA 1QM5A 3PVSA 4HKTA 5IX8A 2I0FA 1QYCA 4CMJA 3FETA 1KOJA 4M9SA 5FFMA 5HR5A 2ZXFA 2NNLD 4MUGA 1P1BA 2RI0A 4CI9A 4CMGA 2BJVA 3C3EA 2EC5A 3H4VA 3QV1A 5EVCA 4U5XA 2NZWA 4ZAZA 1EVQA 4EB6A 5HTKA 1YA6A 4X20A 3L46A 4RYLA 4PG7A 2MJLA 3QY0A 3ODPA 1GUZA 1K97A 1KPHA 3A6GA 3GK3A 3DB2A 4G0NA 4YMWA 3WNVA 7ADHA 4ZJUA 4IDEA 3QY9A 1CY8A 3ZIAA 2GUGA 1D4FA 1D1PA 3LDFA 3BGSA 1B0UA 1QUEA 1U6IA 4FMBB 2A2ZA 3OCXA 5EL0A 4B8ZA 2PUWA 3H6KA 2Z6AA 1ORWA 2XUAA 2ZWAA 2I4RA 1ECCA 3BCRA 3LYHA 3L2OB 2JJYA 4KK4A 2WDPA 1T6NA 5DNDA 3MRVA 1XNHA 2XLBA 4P53A 3GFFA 2O2ZA 3DO6A 2K87A 3L01A 3Q12A 3B51X 3RS5A 1QPBA 2JNWA 3PS9A 4BP1A 4E5NA 1FJXA 5B6IA 3CZQA 1GYQA 1M0SA 1KJNA 2XMDA 4A7PA 5ADHA 1D2RA 1GG5A 1S3SA 1E60A 1UOPA 2FW9A 1BMTA 1NSFA 2IYLD 3PKIA 4V24A 5G3YA 1YASA 3VTKA 2JB9A 2FCRA 4EKDA 5AW3A 4DV6B 2Z9DA 1BYUA 3RSQA 4D9JA 1DC4A 4KLCA 1OLUB 3WRYC 4WXHA 3W2GA 4X60A 4WUTA 2O8VA 1O94C 1HT0A 3BH7A 2AEFA 2PVSA 5ALPA 1ENOA 1HDYA 1I2DA 1PTJC 2ATXA 2ERCA 4ND4A 4YUAA 5A9SB 1M33A 4L6IA 4D97A 5JNRA 3CZ5A 3CLSC 3EIEA 1R5NA 4S35A 4WN9B 2GEVA 4DLSA 4P0QB 4CTMA 4DAEA 4R0NA 2C95A 4M38A 5D86A 4BLSA 4LX8A 1X19A 2FV8A 3HMKA 3HNOA 3AP1A 4L4ZA 4UE6A 5E7JA 5HG0A 4HXGA 5JQGB 1XJCA 3F5MA 2Y77A 2JH3A 3FG9A 3L1JA 3IQFA 3IQEA 2P4UA 3BRWD 3K70C 2Z2ZA 1O1YA 2NO1A 2IIBA 4IYRA 4M22A 5JNVA 4WLUA 5E3IA 3VOTA 3E15A 1XMJA 1C1HA 1YQUA 4ZVUA 4HDKB 1V5EA 4PZCA 1OT3A 3OQPA 1NIPA 1YBMA 1G38A 4NESA 4J2TA 4KGVA 4BZZA 2XECA 4W5WA 2GB4A 4NFSA 2XKJE 2OCXA 2Q0QA 3HFRA 4CUZA 3DUFA 3LAWA 1YONA 1K5PA 2E49A 3EA5A 3UWSA 1JPJA 4K7JA 4H6PA 3FPSA 3DDHA 5EOVA 3BKWA 3ZBPA 3KOZA 4KX3A 5EZ5A 4EEZA 1OZAA 5ARDA 4MVJH 3VU9B 5TQVA 3AF3A 3I6YA 4G81A 2ZSFA 4BUJA 2VAVA 4ZZ1A 3PUXA 2R7KA 1BKDR 3UJHA 2VXBA 4LXGA 1FLDA 1W59A 1E58A 3RYIA 1GXSB 5ANRB 2AFVA 1CF4A 5AO9A 1DQNA 1ZK0A 1U16A 2ZAYA 3NPAA 1OX4A 5SY6A 5C9ZA 5K8TA 3QZUA 3ZLTA 1KZ7B 2A7QA 1ISRA 2N42A 4MYHA 1EA7A 2IOQA 1VCIA 3GG9A 1QOQB 5EUMA 3RKSA 3VFDA 5F4ZA 1UKAA 3H9BA 3O8OB 3DUFB 4QHTA 3TNFA 2QVGA 2X0NA 2QJRA 2FUCA 1J39A 2OC9A 1WXWA 4WGFA 2CMFA 1QONA 5K0TA 4LNAA 1WKVA 3GRYA 1QH9A 3N2KB 5A0TA 4ENWA 4YAIA 4A27A 1W4AA 5TQ2A 4HEJA 4YRDA 4YT2A 1YR8A 3AY0A 2LXNA 2WU1A 5DN6D 5HOQA 1G3RA 2PS0A 4INPA 1X2EA 5LNK6 5E2AA 4DDHA 2N9UA 3WLTA 4D8TA 121PA 4OYHA 4PSAA 1WA5A 4OQLA 1VG0B 1BA3A 2I8CA 2PCLA 2CFTA 3EIFA 1GCOA 2W7TA 3MS2A 4UMEA 3TZEA 2FPPA 5ISMA 1N8NA 3STVA 4IDHA 1AMOA 5H83A 5B1SA 3RIXA 1R64A 3TNLA 2D4HA 1SC9A 1KI6B 2EKDA 2HFKA 5JVDB 4Z86A 4IKPA 5JLJA 4NDAA 5LKAA 2BY4A 4ZU6X 1QB8A 2CEKA 1H6DA 3B1KA 1XTBA 2NO5A 3ZNNA 1GITA 5AKLA 4KR9A 2ZRJA 2TMGA 1XWIA 2YHSA 4XUEA 4EI8A 1VGVA 2YN0A 2O57A 1KK2A 5GAJA 3VZPA 3CF2A 1TJPB 2Z1MA 2VYVD 3FZGA 3GFGA 3T5GA 2C07A 3ORYA 3QVJA 4OL9A 4HNGA 2Q27A 3TVYA 4CLEA 1MHPA 1OHHA 3PQEA 4GF5A 2ZWMA 2V7XA 4FYMA 4O0LA 2CLMB 4LY6A 3WGTA 1P7ZA 3LQQA 2B4TO 3CISA 3KKEA 2O3TA 4NJMA 4QGHA 1GGFA 5ARBA 3V2HA 3NGLA 4K3UA 3H9CA 1E2DA 4DLNA 2VSQA 3QELB 4K6CA 1QIHA 4KMOA 5CH3A 2GPNA 1P8JA 3QX7A 3CSSA 2Z3ZA 4FYVA 4ICIA 4IIBA 2HUPA 4D8VA 4EHKA 1EXDA 1QCDA 4F5WA 1I51A 5KJ1A 2B6HA 4E31A 4QDUA 1DTWB 1E0SA 4E4RA 4BBAA 4M0PA 3HXQA 3F98A 1P91A 2Q6TA 1KY4A 1QRTA 1WXQA 1H0KA 1RQ2A 1PBNA 4PHGA 3VHQA 5AVVA 1HX7A 1X9IA 2YZ2A 1IPEA 4G0PA 3EXIB 4EDFA 2O2HA 1QNLA 1F6DA 1U0SY 4GLLA 5DSTA 2ENWA 3BMCB 3KT3A 2KS6A 1KTVA 3EZFA 5ENVA 3UAXA 4CM6A 3VJRA 1SVKA 4YJGB 1GVNB 5C8DA 1NMZA 4A92A 2VQ6A 1WP4A 1W6RA 4BCBA 2WE7A 2W2LD 4MVCA 4B73A 1QRAA 3WDKA 2QVZX 2D7JA 3GJYA 1F20A 1KYTA 1TA9A 1U8CB 1YR7A 1DC8A 1PQYA 3TB6A 1E5LA 1IBRA 3BSYA 4QWWA 4G26A 2PBFA 4HK4A 5JS8A 1WVMA 1K7CA 4JHXA 2J7PD 1I0ZA 5B3JA 3BIWA 1YDFA 4YK7A 5FTMA 5DWVA 5KYXA 2Q3MA 4MKGA 3CVJA 4QFMA 2BCJQ 1UPBA 2BEVA 3K2EA 2IYWA 2PCJA 2XTAA 2RI6A 3I09A 2GYUA 5CT9A 4EI7A 4S05A 3GJSA 3IKLA 3G5AA 721PA 1ELOA 3RV3A 2P68A 3OQVA 4ZCIA 4RS3A 4AM8A 2BR5A 3GAZA 4ZVKA 3IIEA 3C8DA 5ESWA 1MV8A 4N48A 2O54A 1BA2A 4B8YA 2ZRNA 5JSZA 2CJYA 2GTPA 3GP3A 5D85A 3PXDA 2P1ZA 3UQZA 3WNBA 2WPNA 5K6RA 1POXA 5LDHA 2YWGA 2VNSA 2Q07A 1CS0A 4ROTA 1SUDA 1L5LA 1TVMA 3NXSA 2HAEA 1XQYA 4PQGA 4TVOA 4CMHA 3OFNA 2PBRA 4OVKA 1Y6QA 2PANA 1R1DA 2DAPA 1M2HA 2OQIA 3CRNA 3RT7A 2IEDA 4I7EA 4OHXA 5AKEA 2OXEA 1IOZA 1KHTA 1TZBA 1TKRA 2J0VA 2Q5CA 2IIQA 3H11A 4GM0A 4JNCA 4LZWA 1AS0A 1ACMA 4XPZA 4EK9A 3W1EA 2JJ8A 2H1OA 4Q5IA 4ZQHA 3WBKA 3WL5A 4PBRA 3TMKA 3W7BA 2XJ9A 3AYZB 2WFMA 1AXGA 3GRCA 2NPIA 1QTNA 1UZMA 4O2AF 4RMJA 5A5FA 1JQ3A 2J3LA 2X40A 4YQFA 3O93A 3D4OA 1E96A 3LVBA 2HO5A 2II6A 4GX0A 5EZYA 4K88A 4BBJA 5BSKA 2FR8C 3UENA 4M86A 4ARAA 1CUIA 5ERGB 4DQLA 1UC5B 3LQYA 2GZHA 1RACA 2EYQA 4YIKA 2C0PA 1D07A 2QVLA 3LUCA 4MQ5A 3G2NA 7MDHA 2IHZA 2BGMA 2Y8EA 3IP7A 3RU9A 2OESA 4MGIR 4QUBA 1P62B 5ICGA 1HQDA 1NA5A 3IKJA 4H08A 5LLSA 1O97C 5LL6P 3M49A 4CT0A 1ZW1A 1N1DA 4GX1A 3S7TA 3H8JA 3L1KA 4ZALA 4CV0A 3SVLA 1ZCZA 5JO0A 1DKPA 1F9EA 2RK3A 3N76A 3WLEA 1KDRA 4IUCS 2WFAA 1EHCA 3CUEF 3JATA 1JEEA 2GN4A 4BFCA 3FGNA 1USIA 2O4CA 3LOPA 4L4RA 1YDMA 5DWQA 3ZDDA 4LHXA 3AUJB 2O2IA 4Z4HA 4ZTZB 2MINB 4Y0VA 3ZR4B 2VJMB 4H6WA 4J1TA 1UBJS 4JBYA 1ILWA 1L4YA 3L8DA 1JTVA 3FAZA 3TWOA 1V16B 1QQ5A 5G4LA 1ZSVA 4BWYA 5HNKA 3OQMA 4GGMX 5DKFA 1Z5WA 1WMAA 5ELMA 3BQ9A 1TXGA 2WHYA 1NULA 1PDVA 2GRAA 3AG5A 3SJAA 4D9HA 1UR5A 4LQCA 4PCAA 3SSNA 1Y1TA 4PPQA 2B36A 4LJYA 2Q49A 3QOXA 3O94A 1B8UA 3OEHD 3A1SA 3ROPA 2DETA 2VLBA 4GUAA 4Y2UA 2QTBA 3B9PA 5GMOA 3QGMA 2ZJ3A 3TQTA 1K6XA 4EFMA 1ZUNA 4F4FA 4EUFA 5CMLA 5TQJA 3ZWKA 3E84A 1C3JA 1C9KA 2QY9A 4CVNA 4MVJP 1XMXA 3U48A 3UJNA 3K70D 4XRRA 2ECKA 3PGMA 5LBTA 1MQSA 1GFWA 2FSGA 3A0RB 5EJGA 5JSYA 4GLJA 3HVUA 3UCFA 4DT1A 1W9HA 3QFCA 3RYFB 1CUCA 3F6CA 2NUPA 2C2BA 2A1UA 2QAJA 3KS9A 4IICA 4CWAA 1QH1B 1ECPA 3BIXA 1YVDA 4HTFA 4DBLC 4J49A 2ZJBA 1TKBA 4DNXA 1JR3E 1SUPA 2BUBA 3SZLA 4MB6A 4INZA 3LY8A 4S1WA 2C2OA 3QWBA 3THYA 1YOVA 3WK7A 3REQB 2CBGA 3CG0A 3OSUA 2ZCUA 4L51A 4W8GA 2CNKA 4JHLA 1O03A 4CU2A 1ONPA 1BFUA 5CT4A 1HA3A 4N0PA 2V54A 5SZKB 3TSAA 4L9RA 4MITA 5BOSB 1LVUA 3NTVA 2PH3A 4OMFG 4G5GA 2WIBA 1AKWA 1V5IA 5C5CA 2P3SA 3EFOA 4P4NA 3GRKA 5BN3A 5JATA 5J2TA 1SIOA 4TL8A 5DYTA 5ALDA 1T3TA 1C3OB 3G2IA 1RLIA 2GN9A 1X7WB 2AI1A 2XQGA 4NZ9A 4B87A 3L06A 3MT9A 3IQIX 1IZZA 5DE3A 5K8UA 5ENZA 5JJLA 1G9XA 4NSNA 2R6R1 2QI9F 4D0RA 3DSRA 4RPCA 1XPRA 2YW2A 2XZDA 3ZCPA 2R5NA 3TIFA 1GZHB 1G8KA 3IT0A 2BCEA 1TJ7A 4XGQA 2NMVA 2HPVA 3L0PA 5JSKA 4L57A 2A1TR 1TJ3A 4LWQA 3AJAA 2Y1EA 1ZI6A 2XDQB 4Q9JA 3WO0A 3ZJYA 3MQ2A 3GRFA 3ZGLA 3W1WA 4EMUA 4OSOA 3A9WA 4NP6A 1SUSA 5CFMA 4UBJA 1BQ4A 3G89A 5LIPA 3A4NA 4FFBB 4GWGA 5HBGA 1JQ5A 1C7JA 1KKLA 2B8JA 2C5HA 4EF5A 3S1LA 1WKBA 2EFJA 2XUGA 1E8MA 1TZ2A 1J2RA 3OETA 2RHTA 4HNRA 1SQ0A 2G9RA 1G3IA 1N7JA 1WD5A 2IEZA 2WQ6A 5GGYA 3RFVA 3TQOA 1F8YA 2NSJA 4CQLB 4L75A 1UK6A 2QAGC 1A69A 4DZRA 4NE7A 1J56A 2LIVA 3KKPA 1NFRA 3PC8C 4HF7A 3UJ7A 3UK0A 4CKBA 2D5IA 2WM9B 3C7AA 2FF7A 3RS9A 2O3QA 5K6AC 1S2DA 2J5XA 2ZRHA 4DA8A 1ICEA 5IZCA 4RSRA 3ZNOA 1E1KA 2WV9A 1BU8A 1T0IA 2BDUA 1JG7A 4FB4A 3SJBA 3VTFA 2QN2A 4D6XA 1LJLA 1W19A 4TSFD 4Z3DA 2YASA 3E9QA 4DLBA 3TG8A 2AZDA 4MTLA 4JJ6A 3ZCRA 1KIMA 2RBEA 1NUAA 1JWBB 4MCAA 1PQ4A 2GCGA 3B2NA 3W7VA 4KWEA 3HXLA 2AOWA 1GHTA 3COPA 4A6DA 4NOMA 4EOGA 2JLQA 1QH8A 4A3SA 1U15A 1NHGA 3GEMA 4YRMA 2DR2A 1QO9A 3Q5GA 4GR5A 5ILOA 3LPAA 3P9XA 4OMDA 4B9AA 2EP8A 2GSDA 2PL3A 1C9NA 2W43A 1WZUA 2CCJA 1BMDA 2WICA 2ZAGA 2Q0HA 2XNJA 5TVKA 4DL9A 1QCZA 2L2QA 1CJKC 2P1RA 2FWIA 4RKWA 4QQFA 2F1OA 1NUQA 3DLIA 3KQPA 3IVRA 4RZ3A 4BUZA 5BR7A 2PH5A 2FDCA 4M1YA 4M98A 1MO3A 1PFKA 1NVTA 3BK2A 3T1QA 3FRIA 5T4BA 2RH5A 3KEQA 4DMLA 2F1RA 4Y6RA 2WPDD 3NANA 4R2LA 5AOVA 1OZ0A 2ZWOA 3CE6A 3OCYA 4H4DA 5FEMA 2OLKA 5H16A 5CLIA 1PQPA 3LQ4A 4TMZA 1F2VA 3T52A 4ZOEA 1IEXA 1QLHA 3FN4A 1V3UA 3TINA 1TE2A 2IPMA 3T3PB 1XPOA 4GBJA 3KT8A 1YTUA 3CT6A 3DWGA 3VV3A 2Z2XA 2OR3A 4JROA 3FSEA 4XPIA 1NVVQ 1TAGA 2DM6A 2CEAA 3GJ7A 3Q8XB 3LC0A 3GGPA 4BJ6A 5AW4A 1YZNA 5AJVB 2B9EA 4WY2A 2PX6A 3T5PA 4UM9D 4QXOA 4N6GA 1ODTC 2E2WA 1ISSA 2HJVA 3V4SA 2LP4Y 3HKEB 2CKDA 1IEWA 1Q3KA 3OJWA 4X7PA 4OSEA 3OCEA 1UBHS 4DMGA 2XYRA 3TCNA 3VDMA 3C15C 3KFVA 4FGSA 4NV0A 3WXMA 3OT4A 1J3UA 3OT1A 1IOLA 2ZBVA 5KTNA 2F9FA 5FPTA 3BJRA 4HB2A 1N7HA 1T3HA 4RSHA 2VHEA 4Z6KA 1QHHB 1CF9A 3CB2A 3G5MA 1KERA 2FEPA 1C9JA 1QQAA 2EKZA 4QUDA 4RVGA 5K3EA 4DB4A 2W2LA 4X6UA 4AF6A 3T7KA 5IPFA 3WE7A 3T1OA 1OVMA 4HPXB 5EIEA 1GPUA 1J7JA 3U7HB 1KWKA 3DFFA 3RM3A 2OBBA 1EJ0A 1XQXA 1MAAA 2V98A 1ISMA 3U13A 4FSDA 2C7OA 3QLJA 4X45A 4OLJA 2CD7A 2E55A 4JODA 3U7JA 1JU3A 1D8TA 1S8NA 1WAMA 3P9CA 1XELA 2DKFA 1W88B 4PQEA 1JV2B 2FGKA 4S1OA 4J1QA 2HJGA 1V8FA 4Q00A 3NC4A 1U3CA 2WMOB 1ZK1A 2TYSB 3EXFB 3MGAA 3NKVA 3KD2A 3ND9A 3U26A 13PKA 3RO7A 2B94A 2WWTA 4FMDB 1Y6JA 4H16A 1E1NA 4IH9A 1I80A 4I55F 3GLVA 4LRQA 1CB0A 4N47A 2XTJA 2IYAA 1DIGA 1IXRC 4WJLA 2UZ1A 4RW0A 2DLCX 1PJSA 4D4IA 2QMQA 3E0QA 5K6AA 4Z4GA 3HTXA 3SDBA 1AKQA 2H5LA 3QWFA 4L2IB 3TSOA 2I2CA 2ZREA 1YS1X 1C9DB 3JARA 3WGOA 2L42A 3KCNA 4YXWD 4FHFA 1D7OA 4RQAA 5TMPA 2IHYA 3MTAA 4D3ZA 5LP6B 1SMKA 4Q21A 2IEAA 1XVUA 4MMZB 4P83A 3NIDB 1C0KA 1YHNA 1X0XA 5GZ3A 4LA4A 3GR6A 1O95D 1E3SA 2J31A 1KMHB 1VDZA 1EFCA 1TK2A 1OZGA 1OFUX 1H2ZA 3QVGA 4EX7A 1MQ9A 1RWWA 2ZIWB 2ZRDA 3DW3X 3R0ZA 4QD3A 2CFOA 5K51A 2JAUA 4MEJA 1C3UA 1PEAA 3OOJA 4POOA 1J20A 3JQAD 5F64A 1OTXA 4YJHA 4EZIA 2W2MA 1VYTA 1JU9A 2ACVA 3CI0K 2PRSA 4N7RA 5WRFA 1SNYA 2JFYA 4JEHA 3LT0A 1UJBA 2DWQA 3D3JA 5KQGA 4MYTA 1SU7A 3VJLA 3JWJA 3E8MA 5DXFA 1YCDA 1TJVA 4Q02A 3HWWA 4EKYA 4P98A 5K45A 4UMFA 2FZGA 1PZGA 5JCZA 3ZWCA 1YA8A 4TZ0A 1RI1A 4KR3A 2FHSA 3TGPA 1S3IA 1M1UA 5FUVA 5IBPA 2G36A 2IA5A 3GAAA 4IQ0A 2Z9BA 4WZZA 4EJ0A 5A4IS 3PJFA 3PF9A 3PDHA 1NUUA 4Y6PA 3ST7A 4F7DA 4KN8A 2GBLA 2C8VA 5JCXA 3WIEA 3R9WA 1K5DA 3CTPA 6NULA 5LP6A 3CSDA 3D31A 1GILA 4S2EA 4X54A 5D8DA 4AZTA 2IODA 1Q14A 2R25B 4DJDC 4R6WA 2AR9A 4JXXA 3FRJA 1RHQA 4N7MA 4UUPA 2CLHB 2VAWA 4ZODA 3T8YA 1NL3A 5M34A 5BT8A 1JN0A 1SR8A 3O2NA 4JUBA 1FP1D 5J63A 2O20A 4FIZA 4ZGBA 5TNXA 1S1CA 4GDFA 1I4TD 4I46A 3QLVA 1E9DA 5F1PA 1GNPA 2X8WA 3EARA 3NATA 4HLNA 3FIUA 2B30A 4LDQA 1AQUA 5DO9A 3D1LA 4LS3A 4TUYB 4A6EA 4BMVA 1J0BA 4AN1A 4PAWA 1HYQA 2WIDA 5KHOC 4DQDA 3HU3A 4RVOA 1SM4A 4JVMA 2PZFA 5SYAA 5LMUB 5I4IA 1AKNA 2OGSA 3LSYA 3UW1A 5T64A 2GBPA 3L3BA 3BMNB 5I5GA 4RHCA 4JITA 3UV3A 1UEJA 4HCJA 5KHAA 5GGXA 2GCEA 1UK8A 1SAYA 4L15A 3AIIA 4M1TA 1XVTA 4H4CA 4L5YA 3AEKB 4MQLA 5DRYA 3SX4A 2DFVA 2UUBB 1LTKA 5FJJA 2ADMA 3G0CA 1Q0UA 5LOVA 3DAHA 3LC2O 1MGPA 4RVDA 4YDHB 2C88A 3DLBA 1J0DA 4IGIA 4U7TB 3RK0A 2XVXA 1L7VC 3RYIB 2V3VA 2A5FA 3A3PA 4MRPA 1OU4A 4OXYA 1RHMA 1YQQA 4QM6A 2NXNA 3Q88A 4Q3BA 1F2TB 5CDTA 1ENPA 1PI3A 4QLBA 4CLDA 5HKKD 5FFNA 1Y5IA 5DX8A 2PGLA 3NT2A 2AX3A 2TRSB 3L0CA 3W79A 5EJ6A 5K4GA 2I6GA 3H0EA 3P8ZA 1ZN9A 1U5AA 1KJQA 1J70A 4L95C 3MYYA 2VPXA 1AV6A 4M7PA 1CB7A 3LPLA 4PBTA 4RANA 3ZEAA 1N2HA 2PKWA 2XRYA 3VVCA 1YFKA 1NKVA 1MZPA 1IJFA 2AMLA 3NP9A 5B1EA 5B6PA 3DNPA 3DBLA 1A1SA 1SKAA 4PC3A 4I9GA 3HJRA 1AMNA 5B55A 4GLFA 4RIGA 5IJ9A 1XRLA 1OX4B 3DV9A 1U0OC 4LGMA 5AHKA 1NBIA 1NOKA 3ZS8A 1A0OA 1X7HA 3FVVA 1IIBA 1SC3A 3GH3A 4MUXA 5AW5A 5HKAA 2ZRGA 4Z8XA 2DFPA 2Y1XA 3R3XA 1V4VA 2INGX 1KYYA 5EFOA 4KQMA 1MIOA 2BEUA 2ZJ8A 1L5NA 3QUAA 5CFZA 2IF0A 4EFDA 1DWUA 3AEQB 3WMWA 5KWJA 1IBLB 3HDYA 4QUAA 3IBSA 1HLDA 1P0IA 2Z56A 1PZNA 2W6PA 2OCBA 2G6TA 4OD0A 3R7WB 1ZR2A 1ZIOA 3U2QA 4YAEA 3L5OA 2B8NA 4LDNA 5FD8A 2PHZA 2ETXA 5IAAA 2Q1WA 2I9PA 4RC9A 5FBWB 4OREX 1IAQA 5AM2A 5TEVA 1JQJC 5J3JA 1ZYUA 1BSVA 1K66A 3HO8A 3QBJA 4IF4A 4KSCA 4Z2YA 4BNGA 3AL0C 1OILA 4K6KA 1A9RA 1QIDA 4C88A 3K31A 5A03A 1B3BA 1TM2A 7YASA 1L1EA 2EBFX 3N2NA 1JQEA 2N75A 4HDKA 4ZKEA 1TYAE 2VCHA 3IPXA 4RMGA 3NEJA 4YS6A 2JGIA 2OG1A 4DXDA 1R15A 2H31A 3GN2A 2D00A 3DBHA 1KOLA 3LX6A 4ZYUA 3KB6A 4P3NA 4GP6A 2ZIEA 3OPMA 4JOCA 1TZCA 3HACA 5FL3A 2Y92A 2WHPB 4FC6A 3A1TA 4DLYA 3L7LA 1VFPA 3PDJA 3DFIA 1EQ2A 4UD6A 3LIIA 4Z2AA 1HEYA 1Z7EA 5EMHA 1YK0A 3HUUA 2IP2A 4BQSA 1PO7A 2NADA 1P81A 5AK6A 5PGMA 2XOXA 4KWTA 1P80A 1B8VA 3F7MA 4M9ZA 1WO8A 4PNPA 2BH9A 3IUQA 2Y93A 1A8SA 3VXKA 3KV1A 1EDOA 1DC6A 1ZD1A 1JLHA 4RV5A 2BGNA 2ZB7A 4RF3A 4AZ3B 3ZHXA 5I48A 2GF2A 3HKDB 4TMVA 2OV3A 3DMNA 4F6RA 1YZUA 3B3QA 3IUJA 3BFVA 3IV7A 2QJTA 1JIIA 2PSFA 2VJYA 3VYWA 3FNRA 3JQ9C 3GBSA 2CD9A 1L5SA 2WA1A 2JCXA 1F4LA 5I9TA 2Y68A 4B3CA 1B1AA 2D7CA 4GXTA 4LZNA 4Q93A 4EEKA 2IHJA 4MJ3A 2FZ5A 3B3AA 3TAXA 2IVZA 3PI6A 3OZRA 3DBRB 3PD1A 1NV8A 4UE2A 1CP3A 2GSWA 2P77A 2WPDA 3K9HA 3C43A 4DA9A 1Z3CA 2BEWA 4HZGA 2QF7A 2X7JA 5LLTA 2W2KA 4R2IA 4JDPA 3JYQA 3O90A 4RZHA 3ZPXA 2E4ZA 4AWBA 1OJ7A 5HJEA 3V8BA 3HL4A 3QTBA 1VJ5A 3G7SA 5F7OA 4RZXA 1XLUA 3M7IA 4MARA 4HV4A 1E1MA 4EA7A 1RI4A 1GDTA 4L7VA 4TTPA 5I5EA 3GLHE 1U3UA 1LDBA 2KLBA 3O21A 4JI4B 4UHEA 5EWJB 3ER8A 1HT3A 2IZ1A 1I2CA 1E8DA 2Y1FA 4ABYA 2FP3A 1C0LA 1KO4A 2DQZA 3QOWA 2IBSA 2O2GA 1RP7A 2PQMA 5IKXA 9LDTA 3RSLA 1ISGA 2CLIB 4JBHA 4ZCQA 1AQLA 1YSCA 1ZOPA 2YRFA 3ORHA 3TTWA 2AK2A 1E3WA 1H2YA 4UUBA 4EBFA 2WUEA 4S1NA 1K4KA 2WD7B 5AM0A 2Y2UA 4L8LA 1IJKA 1UFOA 4BXOA 1IOVA 1FDVA 1NDHA 2I8LA 3DP9A 4TTRA 1UC8A 4XOUA 1UXJA 3VPDA 1QG6A 2X14A 1GGNA 1J09A 4G5QA 2BSAA 3ETDA 4FW8A 5E2BA 1JB9A 2NUTB 4UREA 3WLOA 5C4IA 2GWRA 2RH9B 1DRJA 3DZFA 1FBNA 2JBHA 2OHVA 5K05A 1FUKA 4HFMA 3OIUA 4IG4A 4JYMA 5H5JA 2M1XA 2RKWA 4OUDB 4BB6A 3F1LA 3V1KA 3D43A 4L9SA 5JJBA 4FDTA 4MYRA 1NGSA 3FHJA 1FRVA 1XNGA 1X7XA 1ZOIA 5ALRA 4XYLA 4I3HA 1B0ZA 3ZWWA 1J2YA 4FEYA 5LQCA 4WKCA 5BURA 1FYVA 3BF8A 1DP4A 3L1IA 3DL2A 5F21A 4EUEA 3E53A 3JXEA 5HM8A 1NC3A 1VYVA 1CVIA 5TT1A 3L77A 4H59A 2ZUTA 5KTSA 1NVBA 4NPCA 4H7IA 4DKJA 4EY5A 7REQB 1GCGA 1E3TA 1NVWQ 1XYVA 2WILA 3OPYA 3FGZA 3I9JA 3O83A 4CKYA 4UNSA 2R68A 2WT9A 3OF2A 4MI6A 3AR7A 1KYXA 2CCKA 4A2WA 1IY0A 3NWPA 4MMXB 4RK7A 4NC9A 4FHDA 3LFHA 3KZNA 4CTNA 4PR0A 3V9PA 1PDOA 4B3RB 3C5VA 2QTMA 4NLEA 3AQ4A 1DLIA 3AZQA 3O26A 4HHEA 1T4MA 3NIFB 1WB5A 1E9CA 4YCMA 1ZL2A 4ZMRA 2Q3LA 2R60A 3QOFA 1JALA 3JQFC 5KTOA 2HYIC 1GYRA 3OTOB 4PGFA 4Q3LA 4TPKA 2HFJA 1UPFA 1JSWA 5IC5A 4F86A 1AKEA 5AVKA 3KB2A 1GT6A 2VJMA 5DBOA 3DE4X 5TJHA 3OTWA 4XD2A 3HDJA 3OZAA 1YB4A 1CYEA 1Z6XA 4NCBA 1GGKA 1DQYA 3TIIA 5ITZA 5LQMA 4RTSA 3H7AA 5JSHA 2P35A 3NHMA 1LK0A 3RJMA 4GIBA 1P5HA 1P9WA 5EZSA 2H4ZA 3HEBA 1JEQB 3JQAA 5B7QA 4NTZA 2PGDA 3RHSA 3HXOA 1SXIA 3DF9A 4HFRA 1NWHA 1ZMXA 4MVJG 4RNCA 2QR5A 1Z2CA 5AKZA 5EE3A 3TLGA 3VR6A 1ZUWA 3UK2A 3ZK8A 2UYHA 3I5UA 4QBGB 2B4KA 2HHLA 2GBLC 1FUIA 2VYQA 1CWUA 4FFDA 1CJMA 1TA0A 4PRYA 1ZMOA 2AGVA 1B2LA 1DFHA 2QD5A 3PEFA 4JB0A 4N0QA 4PCUA 2GMWA 1WMDA 2GBIA 3EGXA 3C7TA 5K8JB 2IYTA 3UAZA 2Z8YA 3ADOA 3AFNA 5IG2A 1CUSA 3O4FA 3ABRB 3EFBA 3D1JA 5FV7A 1O96B 5SZIA 1E7MA 4KIWA 1EQAA 4QM7A 2K7ZA 3OZCA 4YH1A 1O9HA 3PU6A 3N87A 4CHGA 2VNHA 4WOBA 2YTZA 1AXRA 3L7MA 3P2KA 3DE5X 2GS9A 3B20A 4HLUA 3L1UA 2NYAA 3LLMA 2WF6A 1W25A 3GRRA 5CGQB 1H6BA 5K3FB 1MRZA 1OGJA 1TMKA 2D1RA 3L0ZA 4R7GA 3GVXA 5IARA 2YNMD 1YZ3A 3GZHA 1GA6A 1O54A 2OAEA 2QORA 2JLZA 2GYVA 1MVLA 4N7JA 1ML3A 1O9GA 2COEA 1G5PA 3IQZA 2B9VA 2DGDA 4GKKB 4CUJA 1XTUA 2QPTA 4RD2A 4KLZA 4JMPA 3WB1A 1J22A 5DB4A 1NW7A 3FR7A 1NI5A 3H6GA 1AC5A 2DR0A 4HSEA 1OIWA 1M0TA 1DPGA 4RAQA 1MABB 4KU4A 4Q7LA 4Y2RA 2VHZA 1JJVA 1OV4A 4LHSA 2X9QA 4YBZA 4C07A 1L6RA 2VDMB 1Z4PX 2WF8A 4D0SA 3WDMA 3O8QB 3V7UA 3ER9A 1GM5A 5KAPA 2PSJA 3G9ZA 2AOUA 4ILEA 4V0LA 5CU7A 3L6CA 1DJMA 2GNAA 4JVSB 4G1EB 2PBLA 1L7OA 4LBYA 1X1BA 4UNRA 2BFNA 2YOGA 1R0CA 3IUBA 1L5ZA 2QUKA 4HRVA 3TTXA 4QU9A 3UPDA 5JYCA 5CX1A 4BVKA 1C9MA 1M34B 4OHRA 3A6LA 5LB2A 2O8EA 3BXGA 4XPIB 5F1YA 1HYHA 1JYSA 1XFDA 3GDOA 4WFIA 4ENRA 1VIVA 4JVLA 1EFPB 1I4LD 3UHOA 4DY4A 3L6EA 2HF2A 5EJMA 1HETA 3TDKA 2ZBQA 2JPDA 2VUUA 3SHQA 4G9GA 4AMZA 1NLMA 2ANCA 2EVWX 1YE3A 4BX3A 3FDFA 1TI7A 4ZKDA 3AF4A 2QUIA 4IOLA 4TV8B 3TZLA 3R3ZA 4RF2A 2QTAA 2CZGA 1CE8A 1V16A 2Q8PA 2RHBA 3H2GA 2GF9A 3PX2A 4FFWA 4PVDA 2E48A 3H8VA 1Q6YA 3MUEA 3IT2A 3OT5A 2VAMA 1JHQA 5FUWA 1LBIA 4NEQA 1DQRA 3D6MA 3S0JA 3W2IA 2MYTA 3GLSA 5K20A 3KZVA 4G67A 1PJ2A 1UMDB 2AKYA 1NNLA 3ECAA 1N6HA 5C1PA 2PGIA 4JXJA 4ITRC 3HDVA 5BWCA 3SAJA 3U60B 1XSEA 3H9EO 1MGOA 3I4LA 4XJVA 1NUPA 1PKEA 3H05A 4LHYA 3D8NA 4YLGA 5CVDA 1GZVA 3JYPA 1G4AE 3NBKA 4GM4A 2PWBA 1XNJA 3LUPA 621PA 3NDBB 3A9UA 3WZ2A 4RTOA 2IZZA 4MI9A 4G8DA 4ZD6A 4C4ZA 2YWCA 1EFPA 1VKZA 1G2OA 3ANTA 2DPYA 4UVGA 1PK8A 3E7FA 1T9KA 3UTCA 1HGXA 1FFXA 4B8WA 4C0LA 1KDTA 4G65A 2JIPA 3BXXA 1DIAA 1L1RA 3B5EA 1EUDB 4KVGA 4BFYA 1L7PA 1R4MB 5JZVA 2GETA 3ANXA 1ZM9A 5CTAA 4KH0A 1DG1G 2A1UB 2PUGA 3CH7A 2MT9A 2FRVA 2RB5A 1XKQA 3EXFA 3FFBA 1FW8A 4FOOA 1O89A 1QHIA 2I4NA 4XWTA 3K4HA 5ILQA 3L7DA 5ITZB 2J1LA 6LDHA 2OO7A 2XCRB 1QB7A 2HLDA 1KZ6A 1M67A 2DXIA 1K92A 3O4HA 3QJGA 4FW9A 4OMUA 5D2CA 5HHTA 1SCKA 5EXDA 3P52A 2AG8A 1FVXA 4D0LB 2PUCA 3MTJA 4BMSA 4C0AC 1T26A 1VMKA 5LQRA 3JAMA 1ZONA 3OJ0A 4MUAA 2FQ1A 1EUYA 1KAQA 3DEZA 2GD1O 4JLDA 2P3LA 2GZMA 5FLKA 4X1OA 5HGJA 3V9AA 1DUVG 1E7RA 4B6SA 5IUNC 1SVOA 4R1QA 2VYFA 3CIOA 2QTVB 3K1JA 3KKKA 3JYNA 4U3JA 4R41A 1O0CA 1ZISA 4M1EA 4B3SB 1DJLA 2DQKA 4YXFA 1Q1QA 1X15A 1W2GA 2ZW9A 2GBGA 2HHHB 1MFZA 1OR8A 4HBZA 4ZAFA 4CM7A 3C8HA 4UFPA 3K2QA 4PBSA 3H8WA 2L82A 1EVYA 3MRTA 1V25A 2AC4A 3JZMA 1JYFA 4W9RA 1N2ZA 1SGWA 2PLFA 3TE7A 4AJ1A 4N41A 3AVQA 2VWHA 1DVRA 2ZS9A 3KPJA 5D5PA 3WKBA 2ONYA 2C9MA 4GGOA 4X63A 2HA5A 5DHSA 4TX1A 3CNLA 1TC2A 1YR6A 3EDQA 1E1CB 4S3MA 1G41A 1AHNA 1A50B 3GZJA 4ZAYA 3ERCA 2Z08A 4INJA 1R0YA 1QFZA 3HN6A 4WFKA 3O6VA 1WW2A 1XZMA 2EQ5A 2QRKA 1XKTA 4GZ3A 4NENB 1U99A 2RGYA 2R1VA 2RC6A 4MV1A 5ALSA