4L6AA

Structure of human mitochondrial 5'(3')-deoxyribonucleotidase
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
201
structure length
201
Chain Sequence
SNAASGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of human cytosolic and mitochondrial nucleotidases: implications for structure-based design of selective inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords 5'(3')-deoxyribonucleotidase, mitochondrial
total genus 68
structure length 201
sequence length 201
ec nomenclature ec 3.1.3.-:
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4l6aA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4l6aA01
2ZBEA 3QGMA 1ZD4A 1L6RA 3QUTA 3ET5A 4C4SA 1MH9A 2GHTA 3PCTA 3OCVA 5AI8A 2HI0A 4BYGA 4FFDA 2P11A 2C8KA 1NRWA 1YV9A 1TJ3A 2Q4TA 3MPOA 2P9JA 3QXGA 3ZTYA 1WVIA 2GHQA 5AVRA 2CN1A 4OD0A 3L1VA 5AW1A 5AIAA 2YBDA 5AI5A 2OM6A 5ALNA 4OHFA 4ZEWA 4UM5A 2PQ0A 2RB5A 4CF4A 1AQ6A 3N5KA 4C4RA 4RESA 4UMDA 3E58A 2I55A 2FPXA 1U2SA 1L7OA 5AK6A 3WK5A 1T5TA 1WZCA 3SMVA 3WK7A 3QU9A 1RQNA 1Z4OA 4PNHA 1RRCA 1L7NA 2YMLA 5A3QA 3E84A 2HSZA 2HEGA 1L7MA 1ZOLA 2R8YA 2WF5A 4QQFA 5A3SA 1L8OA 3QUBA 3AR7A 1ZD5A 3DNPA 4HGRA 2I54A 2FUCA 3WKDA 1VFPA 1ZRNA 4NWIA 3I28A 2GFHA 4HAIA 3U7HB 3FM9A 3QUCA 4Y2UA 1JUDA 3EPRA 2IOHA 1QQ6A 3OCWA 4KX5A 4XOUA 3MN1A 3AR2A 2WM8A 5AM0A 3HLTA 5AKZA 4H1WA 4YIHA 2W43A 3FVVA 4CNQA 2G0AA 5ALFA 3W5CA 1LVHA 3GYGA 1RMQA 5AIBA 3WKCA 2JAOA 2RAVA 5AW8A 3EF0A 5ALQA 4DCCA 4Y2SA 2NYVA 5AVZA 4NFLA 3KC2A 3W5AA 2FUEA 3ZWDA 3EF1A 3SKYA 3WK4A 4BNDA 4Y2RA 3QYPA 3L1UA 4G63A 5ALZA 1QYIA 2MSNA 3A3YA 4Y2YA 1YDFA 5ALYA 4KNWA 4FYPA 2R8ZA 4OCZA 2HHLA 4EX6A 1Z5UA 3P96A 4C4TA 4Y2PA 3U7FB 1Z4MA 1L8LA 3PGVA 2FEAA 1YMQA 2NO4A 2W11A 1EK1A 1KYTA 5ALPA 3QX7A 5ALDA 4L57A 1QH9A 3ZVLA 2ZBFA 5AKEA 1XVIA 4EENA 3W5BA 1ZJJA 5AVUA 2EAUA 1CR6A 3R09A 1S2OA 3E8MA 3NANA 1QQ5A 5ALWA 1RKUA 4XE5A 2Q4RA 2WF9A 1Q91A 2G06A 3QLEA 4MUMA 4I9GA 4KN8A 3L8HA 4EEKA 2C4NA 5ALEA 3W5DA 5AW2A 3ED5A 1QQ7A 3NRJA 4OFZA 4Y2QA 3ZWKA 2YY6A 2HO4A 4BEVA 4O8CA 5AKKA 3OTQA 1Z4JA 3B8EA 2WF8A 2HF2A 3M9LA 4YGYA 3R4CA 1U02A 1FEZA 2G07A 3S6JA 2I7DA 3NASA 5E0OA 1N8NA 4ZEXA 3PDWA 4KX3A 3ZX5A 3RFUA 1J8DA 3HYCA 2IOFK 1PW5A 3L8FA 4YH1A 2P27A 3M1YA 2G80A 3AR4A 2HOQA 3QUQA 5AKLA 5ALGA 3F9RA 5ALUA 4DW8A 3I1YA 2WHEA 5AKJA 2B1QA 3N8GA 2B30A 3A1EA 1J97A 2GO7A 2HCFA 2ZOSA 3AR6A 1U7OA 5ALTA 4QJBA 2JARA 1TA0A 5AVQA 3ESQA 1WR8A 3WKAA 3L7YA 5AM3A 1TJ4A 3FPBA 4F71A 2HF7A 5AW0A 2I34A 3N1UA 4UASA 1EK2A 3PGLA 3KOOA 2B8EA 2PKEA 4GXTA 2B0CA 2QLTA 3TLMA 1S8OA 2AH5A 2D2VA 4JB3A 4UU0A 3KD3A 3CNHA 4UAUA 1Z4IA 3BA6A 1RDFA 3IRUA 1RLOA 4KYTA 3UMCA 1ZRMA 2AGVA 3OCZA 5AVYA 1ZS9A 4L6AA 2ODAA 1RPZA 5A3RA 1YNSA 4DWOA 4J03A 4J2TA 1Z88A 1LTQA 3L0YA 4HGQA 2B1RA 3SF0A 1O08A 1Z4NA 3E81A 1U2TA 1RLTA 2B82A 2ZBGA 3FPSA 4Y3UA 1T9ZA 3SHQA 2HDOA 3B9BA 3AR3A 3WKEA 3ZVMA 2WFAA 2IOFA 3U7GA 3ZI4A 3A1CA 5AM4A 5AW6A 5ALLA 4EELA 3SD7A 3FGOA 1TE2A 2BY4A 5IT0A 2I33A 2G08A 5ALIA 4BX2A 5AVTA 1SWVA 1Y8AA 3B9RA 2Q5EA 1SU4A 2O2XA 2ZBDA 4ZEVA 1Z5GA 4UMFA 4AS3A 2CFTA 5AW9A 2EATA 2VKQA 5AVSA 2YFYA 2IYEA 5AKYA 2DQSA 2JGAA 2NO5A 5ALRA 4Y2XA 3FZQA 5AW3A 3U7EB 3OCYA 2FPWA 1NNLA 3L8GA 5T41A 5ALHA 5AVVA 4F72A 2CFSA 2CFRA 2FI1A 2IA5A 2C88A 2AMYA 3I76A 3QNMA 3U26A 3J7TA 3CZ4A 4NAVA 4CE6A 2YMPA 1Q92A 4EX7A 5AI6A 2WF6A 3NIWA 4JDPA 4KNVA 4IG4A 4BX0A 3KBBA 3WK6A 3ZUPA 2W4MA 4B6JA 4HYTA 2QYHA 3MC1A 2BDUA 5ALSA 4MWOA 3K1ZA 3QU7A 5AHXA 4CF5A 4YCLA 5FP0A 2JAUA 2FPUA 4NV0A 4G9BA 4Y2VA 3ZX4A 1O03A 5ALKA 3KZXA 4UM7A 2OBBA 5IT4A 5AW7A 1ZD2P 3ZTWA 4EZEA 3UM9A 4BEWA 5ALXA 1XPJA 3OCUA 1XP5A 4YIKA 5ALMA 1YS9A 3AR5A 4NABA 5AKXA 2P69A 3DV9A 3N07A 5AVXA 5AM2A 2EARA 2YN4A 3UMGA 2RBKA 5AESA 3ESRA 3EWIA 3L0CA 5AVWA 2JAWA 1RMYA 2WF7A 3OPXA 3RF6A 4IFTA 5AI9A 1Z4QA 2RARA 3ZW7A 3D6JA 4XPZA 3WKBA 1Z4KA 5AK4A 2C8LA 1T5SA 4E88A 4HGNA 2YJ5A 5IS2A 2I6XA 1K1EA 2O9JA 2YMQA 3UMBA 1NF2A 3A1DA 2R8XA 1RKQA 2YJ4A 1RQLA 2X4DA 3L8EA 5ALOA 1Z4LA 2YJ3A 2BDEA 5AI4A 3SLRA 3QU5A 4HGOA 1WPGA 3NUQA 4BKMA 4XQ0A 4AP9A 4L6CA 2B8JA 3QU4A 1RMTA 4UARA 4BX3A 5AK5A 4UMEA 3R9KA 3WK9A 5ALVA 4YCNA 4FE3A 3U13A 4Y2JA 1VJRA 2FPRA 2PR7A 1F5SA 3L5KA 4AS2A 3U19A 2OA0A 3IJ5A 4BBJA 3NALA 4YCMA 5AM5A 5AI0A 3AR8A 1X42A 1ZD3A 3ZU6A 4UW9A 3AR9A 5AICA 1RKVA 2G09A 5AKGA 1U7PA 1VJ5A 4HGPA 5AKIA 1IWOA 4DFDA 2MU1A 4UAVA 2YMMA 4I9FA 3VAYA 3WGVA 4UATA 3N28A 5AW5A 4RETA 1RC8A 3SKXA 5JJBA 3I6BA 3WK8A 4UMVA 3ZVNA 2ZXEA 3WGUA 2C9MA 2HX1A 1TJ5A 1L7PA 4GIBA 1N9KA 3DAOA 3NAMA 3IB6A 3KDPA 3ET4A 3DDHA 2GMWA 5AW4A 2YJ6A 2FDRA 5AK3A 1CQZA 1SWWA 3L0BA 3OCXA 1Z4PX 2R8EA 4BNDB 1RLMA 5AM1A 2ZG6A 2FPSA 3MMZA 2OYCA 3QU2A 4UU1A 5AKHA 1YJ5A 4Y2TA 3BWVA 2AUTA 3ONNA 5ALJA 2G1AA 4CF3A
chains in the Genus database with same CATH superfamily
4KIJA 1R6UA 5FTNA 4IDPA 1OXSC 2DERA 4I1RA 5HM8A 4DIMA 3EOAI 4GZ5A 1XKTA 1IRXA 1L6RA 2J9XB 2LKCA 3LDAA 1KEUA 4Q7JB 4IH4A 4WLUA 4E94A 4LWQA 2O8DA 2ES4A 3WA6A 2Z3VA 3KUKA 2IT1A 3OC0A 2VDPB 3NYWA 2ZSDA 5LZ7A 3IGFA 1AC5A 2GLUA 2V3VA 1VB3A 1JMKC 1LDEA 1Y9JA 2L19A 1PQYA 1B41A 4WE3A 3STUA 4A5OA 3BZUA 3QXXA 3LZCA 2DY0A 2ZSBA 3IUBA 3LFTA 4AYWA 3ULKA 4RGQA 4JI5B 1Z07A 1GU7A 2Q1YA 4D4IA 3TVDA 4BV3A 1GNSA 4BKQA 2QV0A 3DVAB 1WV1A 1PTJC 3PHIA 3WXMA 3C3AA 4RULA 4IQ8A 1L5KA 3O4JA 4NX2A 4MUNA 4APAA 2WWGA 1M2VB 1X70A 4NKRA 3GN2A 4RGBA 3RUHA 4KRGA 4DADA 1L7OA 1MVOA 1N5LA 3EQ9A 4MR7B 1P72A 3D0KA 3EMDA 5JMOA 1EWQA 4MUHA 1ENZA 4X71A 4ZT4A 1L7NA 1U1GA 1D1SA 2HSZA 3DBVO 2XBUA 1RE1A 1D5WA 2OG2A 5AT1A 3VAAA 3FTCA 3P2OA 3I9FA 4MYHA 2HGSA 3EVCA 3AR7A 3WLLA 1M1NB 4ZCLA 4UTRA 4AXBA 1VYVA 2I54A 3RTCA 4BMNA 2CZGA 2O6LA 2Q0QA 2A5JA 3ZKAA 5F78A 3OQOA 4YC7A 4HV4A 4MRAA 2IV7A 3W5IA 4DQUA 2P6RA 1K6EA 2JAXA 3UG6A 2P40A 2JS7A 4IP0A 4DCJA 4F6RA 2XVZA 4S24A 3IBFA 2O4CA 2PMEA 1JJ7A 1BEZA 1YCGA 2ZATA 2FEKA 4JLMA 4AS1A 3K71B 4MVJM 3L8MA 4LHZA 1VGQA 1ZYUA 3ESAA 4LBWA 3O03A 4PNEA 3T1YB 2XCOA 3LU1A 2QLLA 4NBVA 5FLKA 1YRWA 3SXJA 1GSAA 4GP6A 5CH3A 5TQ2A 5AFSA 3U6BA 1RU3A 4FOPA 2PS1A 4ZAZA 3FZEA 4LSGA 3KCQA 3L8YA 1HRDA 2ODNA 4D8UA 2AZXA 1WBBA 2ATEA 5AIBA 2VAMA 3GLFB 3OKFA 3IEVA 4EJ6A 3KOUA 3G68A 1GZ6A 3B12A 3D6UA 3DBOB 3N0WA 4NCIA 2RIPA 4KAJA 5G4KB 1E9DA 1T4MA 5JAUA 1RXUA 1ZITA 2NZXA 3BMCA 1WZEA 1ZK0A 3DLAA 4FFLA 4ZCQA 3RHSA 2XA1A 4OQNA 2W2QA 4I66A 3ZLJA 2XV1A 1MO6A 2BHNA 3BCSA 1U7UA 4KMRA 5BN3A 3J7AC 3B20A 1O95A 4G63A 3M4XA 4MQ6A 4R9VA 1WP9A 3TQCA 5BRNA 1BW9B 4QULA 2ZCJA 1AZLA 1CX9B 2DQKA 2XECA 3GWZA 1T5LA 1R9JA 4YXFA 2QUKA 4UUNA 3I0NA 4LDQA 1I51A 4MWZA 3THYB 3ANXA 1HQDA 2ZB2A 2CE7A 1SQ0A 3V7UA 1Q0UA 3HP4A 1SBTA 5D00A 5DOZA 3LC1O 1EVQA 5HXAA 3EIOA 3X1YA 1HFKA 3NOOA 2PV7A 1MIOB 3PICA 2E87A 3BGVA 3QJYA 1SKYE 1GQSA 3E8SA 4RDHA 3PF8A 2ONCA 4RF3A 1JEAA 1Q84A 3VPBA 4ZQCB 1Z29A 3W3ZB 3WA7A 2BFDB 4GEKA 1KQPA 4JI7B 2Q3JA 4BIIA 2QN6A 4JJEA 5ALDA 3EVBA 4L75A 2QIOA 4P7KA 3TR6A 2WA2A 2IYXA 3LGAA 1NLZA 3BIWA 3R5JA 3N0TA 2ZIVB 2WJVA 4JL6A 5ECGC 3V33A 3V4FA 4DMUB 4LTDA 3ZCRA 5CA0F 4QEKA 1JLRA 3IPXA 4JHXA 3Q6MA 5K0EA 3B2QA 3HGQA 1FMLA 2KE5A 1MABA 4RTPA 2WF9A 4GQBA 1M1YE 4M7OA 5LL6P 5TNXA 1XDUA 3RSLA 3W5DA 1O9HA 5AXDA 2W8ZA 3QJ5A 4EVQA 1IN1A 2OCKA 3K0AB 4DLWA 1NLMA 4UBLA 3RHFA 1TYCA 3JZMA 3KETA 4XR9A 4YT4A 1QIGA 1LGYA 3DDSA 4KAFA 1KBZA 5IVDA 1HNZB 3F5QA 4OHBA 1VE7A 2WV9A 3LHKA 4WN9A 5KAPA 3RKRA 3BS4A 1C81A 1E8NA 5DRTA 4E22A 2EOAA 1XKLA 4UBOA 1W0JA 1YQGA 1ADJA 2HF2A 2J4FA 1JDBB 4G26A 4AKIA 1DAHA 1FQJA 3DVSX 4CLEA 2GDZA 5CRIA 3RVLA 1C7IA 4HB3A 4E5DA 4D0NA 3TDNA 2BP7B 3D7SA 3H9CA 2V58A 4IY1A 3MTDA 4BQNA 4B6RA 2YZ2A 1O6CA 3ZV5A 4KUHA 1J8DA 3ZE0B 3OESA 4CLOB 2Z1MA 4DY6A 2FSVA 2H2DA 3BEDA 4MWTA 4FTWA 1IJEA 4WIAA 4K9PA 1L5YA 1N6IA 3DFFA 1LK0A 3GG2A 2RE8A 3ER8A 1QFSA 1QGOA 3ILYA 1T1EA 2XE6A 4EMSA 4QRDA 5AKJA 4J2OA 1RYZA 4F21A 1AS3A 1G5QA 2ZB7A 3CUVA 3H6KA 3KEGA 4DAOA 3I1JA 3ICVA 4N0DA 4K9MA 5AJTA 5E4TA 1X0VA 1JYFA 4NOKA 4CIBA 3USCS 1IUNA 5AW0A 4LBVA 4NMWA 1TM4E 4D74A 4MINA 4YGXB 3SQNA 5C3MA 3UB2A 4C7XA 5CNIA 1R27A 1DC7A 1YZGA 2ZDHA 4RJKA 2XRYA 3W8DA 4GNKA 5E0KB 1G3RA 4JB3A 5FB3A 1VCMA 3ROMA 1AX9A 1K6IA 1JQKA 2ZU0C 3PGKA 4UBIA 4RIEA 5GJVC 4R1OA 4XM1A 4EYKA 4YCCA 4GFDA 3FYCA 4KYUA 4CKWB 1RQ2A 5FI1B 3WWDA 1IZ0A 1TQ6A 2OC9A 1NONA 3QEMB 3CEMA 4PZUA 4Q93A 1X92A 3WIBA 5BSHA 3GO4A 3R1IA 5J59A 4L6AA 4S2EA 2QX4A 1OU0A 2R44A 3PB3A 4TLBA 1DWOA 2OY0A 4U7JA 4WLVA 2TMGA 2HCTA 1I5OA 4RJIA 4DWOA 1P5RA 3P9QA 4ZQGA 4ZRDA 3A4LA 1EFHA 1H1LA 5CJPA 4BMZA 1Z2NX 5L3SB 4ZVMA 1LY1A 4AZ3B 1X7WA 1YUNA 2JI9A 3LE8A 2GXSA 2V0CA 1SJ9A 4YFYA 1DRVA 3EXEA 6AT1A 2F8MA 1GNPA 4RK7A 1U2TA 4WNCA 5IWCA 4ZDJA 2PHZA 2QLBA 4KE9A 3OHPA 4GKVA 5DT9A 4UE6A 2IYVA 3UA3A 1WCIB 3WRWA 3TOZA 4TXJA 3C85A 4UPVA 2PA0A 1UJCA 3G89A 4YI3A 2A33A 2YJNA 3ZGLA 2JAQA 3AG5A 4DT1A 4XUGB 4RQAA 4YXWD 3C16C 1ISSA 1KQ7A 1BSVA 1XL1A 2PAFA 2XMSA 3ZI4A 1S2MA 4BKUA 2UUAB 3DM5A 3ZJTA 3N9IA 3VH4A 4PZYA 3FGOA 1NV9A 4OQFA 2PTGA 5C3UA 4EI2A 3QFSA 1IC6A 3BL5A 4IJWA 4IZIA 2FA9A 2BY4A 4O0MA 2EKBA 2O8CA 4KQHA 1DGQA 5BSRA 4FHDA 4GLBA 2RH5A 2YHBA 4KUEA 4F4CA 3DE6X 5F73A 1IM2A 4Q4HA 1C3JA 4YUXA 2KSQA 1MGPA 5FORA 3Q3HA 5IX8A 1BYIA 1KWKA 2CJYA 3U44B 3CLTC 3I64A 4UMFA 3WJ7A 4G0MA 1OXTA 2GN9A 2P9HA 3SEQA 2BEUA 1FNCA 2CFTA 1Y3DE 2HLHA 2NV6A 2WKQA 2WVAA 4KQGA 1XLWA 1DOHA 4NE7A 5IN5A 3AHFA 3EGIA 2N0SA 2ZUWA 1RD4A 1GZ3A 4QOHA 1YB7A 1F0YA 2ZANA 1NKTA 2R85A 3FDXA 3F8SA 4NJOA 1YFEA 3KLMX 4TKMA 1I7NA 1TZCA 3PEFA 2IZ0A 2J9FA 4EB0A 4GVLA 2B4AA 2N42A 4BNKA 1N6PA 2PUHA 3ZCXA 1RYNA 1QCDA 3EUAA 4Y6GB 2FZLA 3OTIA 4FEGA 2XYRA 1OH8A 2VL7A 1YS7A 1RIFA 2QT0A 1PYGA 5F5XA 4AF8A 1GGHA 4P58A 4BV9A 1NL3A 3STYA 3WNCA 2C9YA 1GRCA 1PJTA 3EGDA 4PSDA 5B55A 1E0DA 1XWIA 4XW2A 3MTQA 1FZTA 4P4SA 1SD1A 3TZ6A 4R2MA 3PHJA 4BMYA 3RYFA 2DHCA 2ERYA 2IUEA 3VPXA 2NT4A 3EBOA 3Q2IA 1JMYA 1NUQA 1NP3A 3QVUA 4F86A 2A94A 2PS3A 4IMPA 1NSYA 1XK7A 2FHPA 4K05A 3G13A 4MUGA 1XRRA 3LO8A 4YAFA 1SHKA 1YKSA 3E35A 4H7IA 1PGPA 1F20A 2HA2A 2HJSA 2I2DA 1MN6A 4X45A 4ZYZA 1GQOA 1OYOA 1DINA 1SVIA 2A88A 3I8XA 2V5AA 3NJRA 2JIRA 3QU7A 2PTHA 4RORA 4K1XA 3SZMA 4RXUA 3FTFA 1EVJA 5CX1B 4IDNA 3BILA 4UVIA 5IDYA 4DC1A 1OAAA 3DD5A 2QVBA 3G85A 1DCKA 5F91A 1NQOA 1KI6B 3FOCA 1XE3A 1XD8A 4PSCA 3ZTWA 5I51A 5ALXA 1LV8A 1H2WA 4B35A 3O94A 3OCUA 3RNLA 1I0IA 2DECA 3GZ4A 1NE7A 3SJ7A 2VQ6A 1OAOA 1QH8B 2J5BA 5EG5A 5ELLA 5ER9A 3RU2A 1CUIA 1NY5A 2REOA 4TLEA 2DEUA 2CEAA 3RADC 1OLXB 2IDJA 4IHJA 1PD1A 4S04A 3VVBA 5FBHA 2WWIA 5TMEA 2WSLA 4NBWA 4YAOA 3UNXA 4HNHA 1U5CA 4N5DA 1GGJA 3CIOA 4REQB 2ZIGA 1NNSA 3HKCA 2Z3ZA 4KXNA 1W1WA 4RAQA 3ETJA 5J2TF 5ARBA 4L4SA 1UFRA 3IB3A 4DGSA 1SU6A 2IK8A 4JX9A 3PFIA 2NO0A 3HUFA 1RHUA 3PHHA 3H8SA 4HZIA 1MC4A 3TZLA 5LIRA 3QBPA 3FFXA 1O6GA 5COBA 2G63A 1PRYA 2P79A 2CLMB 4LYYA 2OVFA 2IXTA 1ODLA 3W6UA 4G9EA 2O9JA 1E3WA 4B32A 1RKQA 2X4DA 3G5TA 4E5MA 3KUDA 5THXA 2H8KA 1RC1A 1U1IA 3FOFC 4O02B 4HGOA 1M0TA 1HLDA 1JS1X 1HO3A 4FYHA 4HX9A 2WTEA 3GLGB 2J6IA 4XQ0A 5FTJA 2M6KA 1J3UA 2WYIA 3HXQA 1IXRC 5JCZA 1PK7A 4CV2A 5LFAA 1VJTA 3F67A 5FUVA 1A82A 1DFIA 1PSWA 1WSDA 4FCVA 2EFDB 5G41A 5TB5A 5CDUA 5L51A 5J2UA 4NU6A 1N0WA 3D02A 4IVRA 1IW7D 1A9SA 4KGZA 2W0SA 3PC6A 3MOSA 4XFKA 4C30A 3DKRA 1YFJA 1ZUHA 3DTVB 4M1EA 4C05A 3H5WA 3WY9A 3PYLA 1KYWA 4LXGA 4QL3A 1AOXA 3K9HA 2BMDA 1DSSG 5E7IA 1I24A 2F8SA 3IMGA 4BCCA 5BR4A 2WWXA 4EYSA 1JFFB 1G5HA 1KZ7B 2AXEA 2YCBA 3MT9A 2V7BA 5DYTA 3ZHUA 4UNQA 1TJWA 1SG0A 1X42A 3GGOA 3K70D 1WLYA 2QHXA 5KOYA 2PX5A 3AR9A 1L4NA 3KT8A 4IQ0A 3K31A 3FGNA 1T8UA 4HO1X 4X7MA 4HGPA 2AQKA 5CR9A 2EBWA 2GH1A 1W75A 5F3DA 4TYYA 2BKLA 2F4VB 1U8YA 4Q4AA 3L4BC 1DG9A 5F4ZA 1HKHA 4YP0A 1PTKA 4U2KA 5GJBA 3A58B 1PSDA 1UF9A 1W4LA 4CKEB 1KMHB 5BV0A 4X7BA 2D0OB 1QX3A 2HU2A 4U9HS 4ZARA 1PV1A 2PWYA 2VQ3A 2WAYA 5F9MA 4C4PA 2M6RA 4WXEA 2FZKA 3TUZC 5K8CA 4I9NA 1T2FA 5C7YA 1Q6YA 3JZAA 1ZNZA 2AI3A 2EW2A 3KKMA 2IZ7A 4FX2A 1ZMRA 1RPTA 1HT3A 2NZYA 4PSUA 4LVOA 3Q2KA 3QFFA 1DO8A 3TIVA 1FB5A 3LGSA 3BMCB 2Q5IA 3CRVA 4V1CA 4D0SA 3GLGE 5DGHA 2Q50A 4KJXA 1P33A 2NM0A 3GUVA 2IXBA 1BW9A 2VPPA 5BR1A 1CUGA 5AM1A 1IOZA 3IPYA 2HSJA 1CR1A 2AHOA 1YR3A 2H0RA 3QEOA 2FPSA 5DM60 1BKSB 4TT3D 5FOUA 4EEZA 5C32A 1DJQA 3IQZA 3KVRA 3QPBA 4OQYA 3TFQA 2IYSA 3PLNA 2ISCA 3LQQA 1VMEA 1KJ8A 4N4AA 4NXMB 1MDFA 2VP3A 5B53A 3KVOA 2QRUA 1YR8A 2Y0DA 3SDZA 3QBJA 1ADGA 3PL5A 1UJMA 1UKAA 3A1NA 3DMNA 1PQUA 4JZYA 1QLWA 1Z2AA 3GMDA 4C7OA 4BNYA 1NXXA 3WTBA 4M0DA 4WTOA 4JLDA 1YHYA 1KS2A 3A4TA 1Q22A 3CISA 1NVVQ 1X0XA 5I9LA 4ZCMA 4FFDA 5JECA 1PVDA 4C4ZA 1WRBA 2HIAA 3JPWA 4WLEA 2BRUC 2A0YA 5JPIA 2OAQ1 1GGEA 4FGKA 4A2WA 3BHIA 4QC2A 3W5UA 1U2PA 1R8QA 1TNDA 3SZ3A 3ICEA 4UCWA 5LDHA 5E3JA 1XI2A 3OP1A 3DXZA 1NLFA 1SBZA 4L5CA 4OHVA 2AXQA 1MQSA 1TMYA 3KU1A 4FN4A 2JCVA 3TKAA 2BFEA 1GWNA 1LRKA 5FRDA 2IX9A 2I2BA 3FIJA 3UW3A 4O5OA 2QM8A 2RCNA 4ZEWA 3ANMA 4UVEA 2B6NA 3ZNQA 1W36C 2BHTA 3WLHA 5KZMB 3D81A 2RKWA 3FPKA 4NZMA 1P19A 2IXAA 4OV6B 4BJ3A 3QLTA 1C1DA 2JDID 1GCGA 5A03A 1VBKA 2I1LA 4HG2A 3BGWA 2Z6QA 1I6LA 3BK1A 2DTDA 3QMWA 4QUAA 2CL7X 1FTWA 3CI0K 2C1ZA 3GLIB 4RKYA 1B8NA 4AZ3A 2XKKA 3HA3A 1Q74A 3WK5A 1ZEJA 3LIIA 4JODA 2AEFA 3ZE2B 3VBEA 2H8GA 2Y0BA 3RS7A 5A3QA 4Z53A 3B6JA 4CR7A 4TMVA 3MS4A 4EFDA 1LD3A 5DRYA 2WU1A 3L7OA 1PFUA 3VXKA 4QQFA 4O5AA 2XE8A 3KS9A 5IH3A 1P75A 1D0SA 1D6MA 1H1DA 2GNOA 3O4FA 3QVWA 4GLLA 3TEMA 1C8BA 2AN1A 4B80A 5A5DA 5GVSA 3ILXA 3GX1A 3VR4H 1C4OA 4NRDA 2I4MA 4K9SA 4QAQA 1PJBA 3G2LA 5AJUA 1KZ6A 1Q1AA 2FN3A 4UE2A 3WKDA 4X64B 1S8NA 2I4TA 1JLSA 1OWLA 2QMUA 3OPYI 1KI8A 3P94A 1P0IA 3PKZA 4IM7A 4NESA 3P52A 3JW8A 2QYTA 4MXDA 5L4LA 3C5EA 1R3DA 3OURA 3ACBA 3NWPA 4FK8A 5J1SB 1KY5A 1FP1D 5KNBH 4S1VA 2XQKA 4BQSA 3WLOA 1JECA 3HBNA 3D4LA 1JEDA 2D5AA 1LC3A 2EZTA 5F2KA 2H59A 1JG1A 1OLUB 1KDPA 3KZNA 2FGJA 5ALFA 4F3TA 4FHZA 1E2PA 4TV8F 4PR3A 1JTFA 1IPEA 4F3RA 4JXZA 3WL8A 3RDPA 2IEDA 1TKAA 3CF6R 2BDTA 2ZSIA 3G2OA 1XNRB 4QO7A 2QVLA 4BZXA 1DQRA 3CFYA 1QAQA 4DIDA 4FYIA 1AHNA 1N1DA 1SUDA 1JHRA 1ZNWA 4NFLA 3AOGA 2AI1A 1ZVJA 2KW5A 3P45A 3UWKA 3ZIAA 3KJZA 3OO1A 2HYIC 4MR9B 4YJDA 2C54A 2WABA 3X2EA 2GEVA 2V6JA 4FGZA 1R66A 5CDFA 2CNNA 3RJ9A 5EWJB 1IEVA 3HY3A 2JLBA 4DA4A 2WJJA 4IXWA 1G1AA 3CY6A 1YVPA 1Y48E 1JYSA 4BNLA 2OFFA 3LHSA 1AQNA 4C89A 4D6PA 4PRZA 4M37A 4DV3B 3K70B 1U3WA 4LQ4A 4QOFA 3CLKA 4IJVA 2Q8NA 2XADA 3MTJA 3P96A 4QPDA 4RWEA 2WKSA 5GY7A 3ZHTA 1U2RA 1OXKB 3GCXA 4D4KA 6REQA 4HLQB 4I4LA 3CPEA 5EPOA 1L8LA 2WNIA 1RE5A 1NGSA 1Z26A 4XTRA 3O8NA 5HCIA 1O0SA 2W11A 4A4DA 4HX5A 1ZJYA 2QL6A 3RODA 5ICCA 4Z3OA 1B93A 3FCOA 4D25A 5FEMA 1BVHA 5IAOA 1FDIA 3W7VA 5CVTA 4Z5XA 1X3SA 5EKTA 5H82A 3ZEIA 2PDAA 1MORA 1TJNA 2PX0A 4JLSA 1JZQA 3OFNA 4CFYA 2PJRA 2KS6A 3NJ8A 3CMCO 2CBGA 4ZHQF 1S2OA 1SHJA 1C4WA 1T0JB 3OU6A 3EZXA 3OZRA 3LJKA 1RJDA 3UB4A 4IDBA 4GXQA 1Q91A 5AVSA 3T1TA 5FV4A 2J3HA 4MZXA 1FNSA 3ZWBA 3AXTA 2X9NA 2EJCA 1KVQA 2PYIA 3GAZA 1Y5NA 2H5EA 2FCRA 3U4QB 2QLMA 4ZO8A 2A78A 3DHYA 3AQIA 3COYA 5HZKA 1AA6A 4Z2AA 2O5CA 1U8TA 3OTQA 3DF7A 1CDEA 2OYSA 3DQZA 4NQRA 4EGSA 2P2NA 4J94A 1LB1B 2ZYIA 3DS8A 1ORIA 3GL9A 4Q00A 2EQAA 3NASA 3LWDA 4HDKB 1CDZA 2Q1SA 2CWWA 4RABA 1TIKA 2WG0A 4GOMD 4GS5A 3VOSA 3MBIA 3TB4A 3C39A 3PC3A 1SVOA 3G8CA 3GNSA 2ZAGA 3DFUA 3I42A 1DAFA 1Z2CA 2ZU6A 4WASA 3REFA 4YH1A 4DIKA 4R0MA 3I5UA 3W79A 1JRLA 1YBHA 4L78A 5K6AA 2E9FA 4MROA 4ZANA 1DEHA 1XN4A 4IV0A 4GRAA 1BKDR 5ALUA 4CMJA 5KQMA 1KZ9A 5B3JC 2V65A 3CF4G 5DBFA 1UMDA 3BTUA 1J97A 1PAUA 1UKBA 1IM5A 2OUIA 2YC2C 4IMIB 4QUKA 4AICA 1JXOA 1FIUA 2I0FA 1I1QB 1CERA 1UANA 3GNQA 1Z08A 2HQRA 2PL1A 3WKAA 4S1WA 4YAEA 5EMLA 2FMXA 3NX4A 5FO1A 3WWCA 4DS3A 3BB3A 3TTTA 3ONWA 4G97A 8LDHA 3N1UA 4B2PA 2RHBA 1N1EA 2VYND 3L8ZA 4Q16A 4XFJA 1XTRA 4H3KB 1E7QA 1K6XA 1QFJA 3SSMA 5CEJA 2HPHA 4N0QA 1S2IA 2YIMA 2OSBA 3Q3VA 3STVA 3U81A 3EAGA 2WZDA 4QOJA 4U9UA 4X85A 3EEYA 4JGGA 3NHYA 3WYEA 2W2OA 1L5GB 2ORYA 3LHFA 3LRPA 1KQGA 2NU9B 2J07A 4TROA 3IDZA 1EFRA 2P2LA 5FPSA 2PSDA 4IHKA 3UQZA 3VSEA 4QO8A 1N8TA 2G9UA 3OEYA 3BBLA 3C3MA 2UDPA 3BFXA 1FUQA 3PRHA 3U4IA 1ORWA 3ZY5A 4E4RA 3Q11A 3MINB 4P4GA 1FL9A 2DPMA 2AOXA 2QD5A 1N5JA 3M4JA 2PKCA 4H7JA 4MK4A 4TRNA 2DR3A 1CFZA 3O1JC 3ZZTA 3D7KA 4HAYA 2YNMC 2BD0A 3ANNA 4J2TA 4ZVUA 3A2NA 4IJ5A 1GGFA 2V5UA 4A03A 2P9TA 1JIXA 5F9HA 4ESVA 2A84A 2WTUA 3HZOA 3WLPA 4HUJA 5HPYB 4X94A 5I7EA 1WW2A 3Q72A 1FP4A 1K97A 5KTOA 5E7QA 2H16A 2FDXA 1Z6AA 3A9SA 1UAAA 4BASA 3V1KA 1RVV1 1H9AA 1DX9A 1Y89A 1ZQ9A 2WMOB 4EKGA 4HKTA 1XEXB 1KH3A 2O52A 1JVSA 1U16A 2Q45A 4BNVA 4MLPA 2A4KA 4J0EA 5TF4A 4EFKA 3SIWA 3L7AA 4ER5A 2GCNA 1QTIA 1AKTA 1N2HA 4ZI5A 4CT4B 1CF9A 3EISA 4XM2A 3CLSC 4EPXA 1K7CA 1IHOA 1SVKA 2OXIA 4PZAA 1XCLA 1PJ2A 4PHCA 2HCJB 2H2FA 4QVKA 4QDJA 3VYRB 4BB6A 5C2JB 1VPEA 1VHWA 4I4TB 3LLSA 1CEYA 3GQVA 4ER6A 3I4FA 1H5NA 1YULA 2DC1A 1YVDA 2MDTA 4MVJI 5IT0A 3JQGB 2XKJE 4HFJA 1MB2A 4W5HA 2ZPUA 1IG3A 1QIJA 5LUBA 3AL3A 3GVCA 4XLZA 3MERA 4Y1FA 1PNRA 1PNVA 5DZSA 1BC5A 3V8BA 3TL2A 3RKUA 2PSJA 2PZMA 4D82A 5A5EA 1CSEE 1JX6A 1LQUA 2I78A 3S2YA 1M33A 1GTL1 2IYEA 2C57A 3U39A 2DQSA 4ZVVA 2JLUA 3PQFA 4U2GA 1C4XA 4CLXA 2WJHA 3K92A 1ONOA 2H9AA 4O33A 5FPPA 3T9CA 1ENYA 1MB0A 1JZSA 3EDCA 5CAEA 2OLJA 3MJFA 5AHKA 1MJGM 2W0MA 1E96A 4UXJA 2OCGA 4DV1B 3FGPA 4JQOA 4O1IA 1W94A 2G9VA 4MQBA 3SSNA 3I32A 3AVOA 3A1UA 1L5WA 2HK7A 3H2HA 4PBRA 4AAYA 2C88A 5AHRA 4YJFA 1IZ7A 3P1JA 3AUJB 1CY1A 4JI6B 2H4YA 4CE6A 4M8KA 1MRZA 2C20A 1MRSA 3PIDA 1OXMA 4DM7A 4DEVA 3ZOKA 1URPA 3EF3A 1H9BA 3A06A 3OUUA 2WF6A 3VR6A 1UKVY 4OQPA 5FL7A 3RGWS 1MQ8B 2NVBA 4GECA 1NYQA 4D42A 3JQRA 3X0DA 7GPBA 1JDSA 3B7WA 1G8KA 2HREA 2ZR0A 4XJTA 4PLPA 1EFVB 1B7GO 1E2KA 3MLEA 2XYQA 3JXEA 2UVDA 1MH1A 3DLPX 3USZA 1N1GA 3BH0A 3I2FA 4D8YA 2GK3A 5M04A 1HYQA 1C7JA 3NNNA 3R7FA 3HDJA 2XY4A 2R7MA 4IPTA 2VSFA 4QPZA 1E2QA 3FFBA 1U9CA 2ZM5A 4ZJZA 4MIEA 5HZGA 2GPTA 2V4MA 2FPOA 3O38A 3RTBA 4HDSB 5GONF 4ZCPA 1QHXA 2YDXA 3AINA 1L7QA 2NADA 3TFOA 4LF5B 4H7HA 3OCCA 3OIVA 3NM5A 4TN5A 4QAJA 5ES3A 3UAOA 3VI4B 4JLNA 1SVMA 2OP0A 2GBGA 5IBPA 1CRPA 4NABA 3SZUA 1JQ5A 1Z6ZA 5AKXA 3TCXB 4WBXC 4LXTA 1W9HA 3IHLA 2VTBB 3UHAA 3KPVA 3AKYA 1E4OA 1WUIS 4OSOA 3QMMA 2IUYA 3FCEA 1SKMA 3N0XA 2FFJA 1LTKA 1BOOA 1RKBA 3NDRA 5AESA 3P9ZA 5G1NA 3R7NA 2BFPA 1AKRA 1TB4A 3L0CA 5EKSA 1GNQA 3WGLA 1WCXA 2DM6A 2WT8A 1XPUA 1SCBA 1F6BA 2OGSA 1A9RA 2JJ2A 2R1VA 2WYWA 2AD5A 1EK0A 3B6KA 1VPTA 3DZBA 1W5TA 1CR0A 4M6WB 3WB9A 4J1NA 1E9VA 4CI9A 1U3UA 1E2DA 1X77A 3TLZA 1GZSA 2FKNA 3EG9A 3Q5DA 3RTDA 3WKBA 1FXUA 4YV7A 5JY6A 2XCTB 1IBKB 4RYDA 3M4NA 2V7UA 1AUQA 3DMYA 1VOTA 4Z4HA 5CDHA 1H93A 3ADKA 1KQFA 1KEEA 4BFCA 4G8DA 1W36D 4G0NA 2ODPA 4BLOA 1NF2A 3QTLA 3K9CA 3NHAA 3C70A 5KOJA 5LZ4A 3ZE9A 1PYOA 3K9GA 4IMJB 4NYMR 3B1FA 3BJEA 3WNVA 3V4OA 2FUSA 1QTNA 1OKKA 5LQJA 3A4NA 2QQFA 3LQ4A 5FL7D 3G2HA 1YDMA 1EVYA 4E4YA 2VRWA 3B9PA 1IVSA 3UV7A 3B38A 2G5PA 3QVKA 3MQ2A 4QFDA 1T3GA 2D1QA 1WXWA 3ZIUA 1KK0A 1XVUA 3MIZA 1KAQA 1ESEA 1GRNA 2C7GA 4FGWA 2VUIB 1K9VF 1TUEA 2GEJA 2IX3A 2EFYA 2R48A 4I14A 1GPAA 1L7RA 3OEED 4GUDA 1N92A 2BOVA 2MIIA 1ZCFA 2ZJYA 5FD8A 2D4AA 2EC5A 5ULLA 4BNNA 3BH7A 3N87A 3KHTA 4Q3CA 3AW8A 3MLAA 5TQVA 1F5SA 4AS2A 1GZ4A 1ST3A 2IWRA 2QVGA 1N2CE 3BE8A 3MTGA 1ZL2A 4FW8A 5EOVA 4DJDC 4EQZA 1KSHA 4HNUA 4DY4A 2O8EA 5HRUA 1SELA 3K1AB 4PR0A 3DQQA 4YJ3B 5TGDA 1GRQA 4FFVA 1HFWA 1G6Q1 1WU8A 2ZIAA 3C5CA 2EJBA 2YFKA 3GDFA 3KQSA 3R7BA 4LISA 3FNEA 3V46A 3E7FA 2Q4OA 4IO1A 4HSEA 5AKGA 3V97A 4FW9A 4ZQHA 2HD4A 1KDVA 5B1HA 1Y0BA 1Z6TA 3L6CA 3KR9A 1QK5A 1I4LD 1OX4B 1JBEA 5CIQA 1TF5A 1J20A 2CLSA 4N01A 4YN3A 3R74A 2PKRA 2IHKA 3F74A 2UUBB 4NU8X 4DMCA 2BMVA 2LXNA 4OTZA 4DL9A 1H0HA 5I01A 4Q9HA 2D1FA 2X5NA 1LSJA 2ZIXB 4OYRA 4X66B 3FCAA 3RVOA 2QAGB 1R6VA 2D7JA 4MQLA 3GRPA 1C2YA 4BLVA 2C9MA 3IRVA 3DMPA 3AUSA 3TZQA 2I7TA 1KEZA 2QRVA 3C7DB 2B7CA 3VR5H 3WC4A 2R11A 2R3SA 4C88A 4NJMB 1Q0ZA 1N2JA 3FX2A 3NAMA 5HKBA 2XT9A 3WO1A 4E5PA 4EUEA 3NH9A 1RXIA 3RWBA 1JIKA 1GR0A 5E3HA 2CL0X 1TVKA 1YR6A 3MHTA 4C2UA 5K8IA 1ZIOA 4N0PA 2FDRA 1Q5PA 5AK3A 2BLNA 1W52X 3L1HA 3G8YA 3AL0C 4WCFB 1Z33A 2PLFA 4N6GA 4WA7A 1RLMA 5G4LA 3RUFA 1E7SA 4GI7A 3KWFA 5JCPA 2DHQA 2XA9A 1KO8A 4K40A 2DLCX 2PPVA 3MMZA 2KJQA 4YVFA 3GY0A 1E62A 3IEUA 5CA0A 3RAEC 5BSGA 3SQOA 4CLHA 4URFA 1ZSVA 3ZQJA 1VPWA 3INGA 4YAGA 1NIJA 1RACA 3M6XA 2YASA 3MOIA 4ZAVA 3DTTA 2VNIA 2WJWA 4PPFA 1DUSA 1EA5A 4CIYA 1G21E 1M8GA 3CF4A 3ROXA 3HJFA 3LKVA 1N5MA 4KIWA 5AMXA 1HYHA 1PU2A 1UXKA 4UHEA 5KOHA 1CUZA 2HYDA 1Y6JA 3E5RA 2V7XA 2CC2A 4H9GA 4LOKA 1U7XA 4B3DA 2GCIA 4YRNA 1C0EA 4WWHA 1NNEA 3A3PA 1U2GA 5EESA 4C2BA 3O2JA 4A0SA 4XI9A 4J7UA 4DLAA 1BGXT 3WDLA 3MPOA 2P9JA 1XTSA 3F6YA 1NZFA 2VVTA 2O2YA 2ZJZA 2GHQA 3FTQA 4PLVA 4L50A 2DFTA 1NVGA 3GPCA 3AHIA 4HHEA 1BS1A 4J1SA 3T7DA 1GEGA 1Y4UA 3IE1A 2ZJOA 1HE4A 3NHFA 1JIQA 5FA6A 5FBVB 3VKHA 1VJGA 3VJLA 1W44A 2I4RA 4FINA 4IIJA 1NBOA 1I4OA 1JVNA 5K8JB 1JDVA 1IXKA 5B6JA 3WIOA 1J9ZA 3FG9A 3M6UA 3CWZA 5AK6A 4OLAA 1T2AA 2KM1A 3ICOA 3CUUA 2VC2B 4CM8A 2FX5A 4N9WA 3OPYA 2CXNA 2R6HA 1Q2XA 4C1BA 2CHGA 3R3XA 1BE8A 1GA1A 1XA0A 2EKPA 2HLDD 3OJCA 4J0IA 2ZUVA 4JELA 4X1YA 5D6OA 4FDLA 2JFFA 5EIBC 5T7BA 4HH4A 4OQDA 5T57A 4B2IA 2XBLA 3GLHE 4TRJA 4C5BA 1RRKA 2Q1UA 1UH5A 3B60A 3SIXA 4ZZIA 2CLHB 3JWGA 3HP7A 4KLRA 4YALA 3WSVA 4B40A 4KREA 4IG9A 2H2AA 3WRYA 4ZTBA 1EVIA 4QQNA 1QYVA 3EPRA 5SZJA 4PIVA 3U4HA 3JQ6A 3ZNPA 4CI0B 3THWB 2X9GA 2QRZA 2VJQA 2Y2UA 2V3WA 4CMEA 3LCVB 2N75A 4S35A 4DEYA 4BNFA 1Q12A 4YONB 5JD4A 3RO7A 3E9QA 4MW7A 2VUSA 5AKZA 1HG0A 4QWMA 3KUXA 3DNMA 3LQYA 4EA8A 1I9CA 2NN3C 1V3UA 2BF4A 1ZSNA 3D8HA 3LC0A 5HMLA 2ROQA 1G8AA 1DIRA 2G76A 3BJIC 1RMQA 2ONZA 4LGYA 1BGVA 2AB0A 4XPIB 1ACMA 1I1NA 4ZV9A 1EXNA 1RI2A 3D4IA 2BW0A 4M88A 2VDLB 4ZOCA 5A4IS 4K8RB 4XKJA 1MZVA 4RW0A 3T5MA 3TSCA 2FPIB 1AGXA 1RYBA 2RI0A 3EQ8A 4QJ4A 4TMFA 1KIAA 4E7PA 3SF8B 1YFLA 1T3LA 3PPXA 2XYGA 1ZGJA 3DBLA 3QE3A 4KPUA 4BO1A 1EJ6A 1U94A 3ZWDA 3ND9A 2CJFA 3HA7A 1CRWG 1UWKA 2J9GA 3S2SA 5GZ1A 3VSDA 5ALZA 3HO8A 3MFQA 2P4QA 2O2JA 3E3MA 3QVGA 1XZAA 2VJNA 3FA2A 2Z4SA 3N2IA 3CT4A 1A50B 1M2EA 1HETA 2K87A 4MHOA 3KKLA 2ZUEA 4F45A 4EX6A 1NSTA 1E1CB 1J56A 2P1ZA 4ZOLF 4EABA 4NCJA 4M9UA 1T1JA 3VYVA 4C4TA 4EO4A 4AJHA 4IV5A 4NBUA 1VGVA 4GKJB 2O50A 4QYIB 1MB9A 2QD4A 2VZ8A 3USES 4ND8A 3K4PA 4RPIA 2ZT6A 1VSQA 1U28A 1ZZGA 1ATIA 3DWFA 4WT7A 5K1ZA 2VEOA 5A7GA 3HV2A 2Q4DA 1V16B 3HEMA 4KBYA 1SVWA 4K9KA 4BTLA 1E64A 1NAIA 3IX7A 2YV3A 3RC1A 4HTAA 2WZCA 3PTAA 3H9QA 5ILOA 2XH8A 2XDYA 2GZSA 4D46A 5M34A 4YFVA 4P35A 3ZOZA 4GOJA 3A10A 3LSTA 1CY2A 2BE7A 2FK7A 2JBWA 3RUIA 4PXAA 4Q4DA 3SE7A 3SQDA 1WDLA 2ONYA 3F98A 1CU1A 5BSVA 1CDDA 3H0KA 3ED5A 3OO0A 4GM0A 3SSOA 1ZGAA 1U4SA 1XTVA 2C5LA 1LSOA 4HQFA 4OK5A 2R1UA 1B8VA 2F3SA 1P5JA 3BE4A 2HO4A 4YK7A 4IW3B 2GBLC 3MZ0A 5GGXA 4GICA 5H5JA 4J7CA 1Z16A 1PR6A 2GKOA 2GWHA 4LBZA 4DB2A 3C24A 3L2OB 4F93B 4Y67A 1VL1A 3NHBA 4P4SB 3OI7A 4QNRA 3IODA 1DEXA 5KPJA 4L9SA 4PGFA 4DRYA 4EHAA 1JIIA 3LW8A 3ENWA 3MJRA 3PNSA 5H80A 1XZJA 1NW9B 1R0WA 4HR7A 1T4GA 4IEEA 3ZXXA 1SBIA 1BA3A 1DAMA 3KB8A 4FR5A 3RCBA 4YLGA 1KI9A 3SEZA 4BEJA 1VL6A 4E2ZA 2QQGA 2HJVA 2AE2A 1H2YA 3AR4A 3QUQA 4FILA 4QFBA 4KH0A 3DE1X 1UC9A 3MGGA 5D3ZA 1DT3A 3HJCA 2YYZA 3PCRB 2WUEA 4UHBA 4RVFA 3ZQ4A 5B3KA 2XQGA 3KBOA 5M5BA 4FUQA 4QDXA 3ZWYA 3UOAB 4AY3A 3BX1A 3C3EA 4COKA 4OX9B 4OJNA 4DRXB 3ILSA 3O9VA 2QJRA 4QSMA 2GJKA 1CY4A 1PGOA 4P4TA 2I34A 1E3TA 3E3NA 1OC2A 2FN4A 3MCVA 3BMXA 4KFSA 1R4NA 1N5KA 4B83A 3GOHA 1FFSA 1U3VA 2PLNA 2VDQB 3K6KA 3KOOA 5K03A 3HFGA 1M0SA 3KT3A 2FMFA 3GDGA 3P2YA 4F6RB 1S8OA 5FBWB 1U8ZA 2IYNA 5M29A 2Q3MA 2EP8A 3DAHA 3IS3A 1MG0A 2GHIA 2QGZA 4BXOA 3BA6A 4AL4A 1IDOA 2DULA 3KVYA 1EJBA 1GVHA 2QDXA 3ZI7A 1SA0B 4RD3A 3EFHA 4P0TA 2AR0A 4W4TA 2RK3A 4BNHA 3I2IA 1MO2A 2GPBA 5EFOA 5JWOA 1LRJA 4MRRA 4QE3A 2G36A 3HS3A 3A6GA 3TH5A 2J0UB 1S4QA 3WFIA 2F17A 1KMHA 3JV7A 3LCRA 5A5FA 1E2UA 4K6KA 1JHAA 1N3IA 3FMVA 4HXGA 4BBZA 4F4UA 1YS4A 3C1AA 1BTOA 1DRUA 3QOFA 3VM6A 2C0CA 2DETA 5DNUA 4NSNA 1A9QA 1Y8RA 4PSKA 3NIGB 3OQIB 4POOA 1I0ZA 1JW9B 4BN0A 1L1EA 4HP8A 1X7DA 4DG8A 2UZIR 4OREX 1AKQA 1U6JA 3WL6A 1EHYA 3ZDZB 3OZGA 3PEWA 3HC7A 3RRJA 4DA0A 5FH9A 1YRHA 3B9BA 4FCWA 2QN8A 4US0R 4LE2A 2ZR9A 4LJ5A 1ORRA 4HNAA 4AO6A 4YPOA 3T3MB 4L76A 4XWOA 4MI6A 1Q57A 1NW4A 2GBLA 2JW5A 1Y42X 4QBKA 2ORWA 5EE3A 4G8JA 4PCAA 3IOMA 5AW6A 2RSLA 1UEJA 5GADl 3Q10A 3KL4A 1W4CA 3I61A 5IDQA 3I72A 4KDFA 1MX9A 1V11B 1ZUNB 1JYEA 4BMPB 3QEBZ 2E85A 2W4IA 3HU1A 3H5RA 2G08A 2XUFA 2B7BA 4KK4A 2RJ3A 5JYEA 3AV0B 1IAQA 1FJHA 4QWWA 1AN9A 2FHSA 5FNVA 5EE1A 4GBGA 1PVOA 3GW8A 1P4SA 4IYJA 2ZJAA 4OHRA 5HJ7A 1FJGB 5SY4A 1P9LA 2CFOA 5CA0B 2F3UA 3H2BA 1KEEB 5CFOA 1J21A 1QZUA 2ACWA 1RABA 1H5UA 3LC2O 5SY6A 4CKZA 3V8VA 1BD3A 1QCZA 2R1TB 2NO5A 4EB6B 3HXLA 3OUTA 4H16A 1F4VA 4AUEA 2WILA 3OJXA 5GJCA 3QEAZ 3OZBA 2GAIA 3BE6A 4C0XA 1NQ5A 2JK1A 3UJ8A 3ZLTA 2A86A 3C97A 1S9HA 1YDWA 4RY0A 2IOYA 4O4HA 3VQTA 3LQRA 3P97A 4MKFA 3AETB 2GEUA 2UXCB 1CJTC 3GFQA 1SXIA 2OCYC 4FUTA 4ZRNA 2RGDA 4RH0A 2VS1A 4LF9B 2AMYA 3MWEB 2CDNA 3U5TA 1ARZA 4V0NA 1D6SA 1MC5A 3U09A 3UAZA 2VTBA 1T43A 1PLKA 1RTTA 4PYLA 1O8CA 3WFZA 3TQTA 1W7AA 3T95A 1EFAA 3N0VA 5CT8A 3D2BA 2EJVA 4LF8B 3PP8A 1HE1C 1ZINA 3CLSD 1GG2A 1WUKS 1J5EB 2QJTA 1HUQA 3X1JA 5I7UA 3DVRX 4BO9A 1UPCA 2ZVQX 3GD5A 2J31A 1CJMA 3OFKA 2P9ZA 4KSYA 4MQ5A 4HYTA 2JD0A 5EHIA 3SY8A 2RHHA 2Q9CA 1F0KA 3UJ3X 1EP9A 2NG1A 4ZZ2A 2VJAA 1DO2A 1KS9A 1DQSA 2ZTLA 1WXXA 3IPAA 3VO9A 3HDGA 3N2YA 4Q1CA 1YMUA 4H60A 1G21B 1ZOIA 4YCLA 1FDSA 5FFNA 1LI5A 5FP0A 5LWHA 5DNVA 5CVUA 4CYMA 3VR6H 1S2NA 1AQUA 3QNWA 3RT7A 4LZZA 2IUTA 5FOQA 1Q1EA 4R0NA 4EZEA 2GB4A 3SDSA 4U39A 1YD7A 3IMEA 4MZDA 1MV5A 3PQ4A 2UU9B 4MJ7A 4HDRA 3MMXA 4PZ0A 4EMTA 2P4UA 4ECAA 5ALMA 3VYUB 4KFRA 3BF7A 1WXDA 1APBA 2C7QA 4XUCA 2ZJ2A 2AD1A 1AGYA 1NRXA 2FQ1A 3KHKA 4K6HA 1NXOA 3DV9A 2IU6A 4XDHA 2GXAA 5DNEA 1AD2A 3FTNA 9GPBA 4XWYA 1N32B 2NUTB 2WHPA 4OJTA 5DGCA 3B85A 4WZAB 1JQ3A 3TQIA 4GO1A 2ODTX 4QUGA 5AXAA 3U56A 2EX4A 2UKDA 3BORA 2CCKA 2H7CA 1QHEA 2PVSA 4AYXA 3PGXA 4BN4A 2VBGA 2VHZA 2ZREA 3CSSA 4ZPXA 5TQ0B 1O8BA 5SYNA 1M6HA 4KHZA 4NFSA 3ZE6A 1UKZA 4FI3F 1U0SY 2I76A 5EGSA 2XBMA 4E33A 1JQJC 1UFKA 2VK8A 3LXUX 4FFNA 4G23A 1R18A 1N3BA 1X1AA 2ASVA 4JLVA 4LGMA 3RPEA 4R1LA 1HE5A 3M6WA 1PG0A 5CNMA 4O4JB 1WUYA 2IP2A 2M9MA 3NTQA 4TV8A 1P18A 1YIOA 4M7RA 2H52A 1JEJA 1DI0A 3LD9A 4FSHA 2YJ4A 3N58A 3RK0A 4RZ3A 1G0OA 1Z8DA 2ZK7A 3ONEA 4HH0A 1Z4LA 4YJ2B 4WZ6A 5C5IA 3FOWA 5AI4A 4JYAB 4MWSA 1LF0A 1V39A 2I7CA 5LXTB 4XB1A 1PFWA 3ROQA 3OIUA 1Z8FA 1A2BA 1UBFA 1WCWA 1AM4D 1QPGA 2GZ2A 2PH3A 3C8DA 1DCNA 3D5QA 1EP3B 1WB5A 1HX7A 4E5NA 3P26A 2WP0A 1CJUC 1DC5A 4RY9A 2BMJA 3G2NA 1Y6ZA 1ZH0A 2V9PA 1KAMA 2RGWA 3PWSA 2IZ1A 4CCYB 1GV1A 1FE8A 4OXIA 3R44A 3D8SA 2RH8A 4CEJA 4YBZA 3OT1B 4TVBA 3ESBA 1CZNA 4CMKA 3M5CA 3UWPA 4HT3B 4MKGA 1XZEA 5IXSA 1U9YA 2ZBVA 4WZBA 3DT8A 1SG9A 3RS3A 2DFKB 2XDWA 5IVIA 5IBQA 5KU7A 5J23A 3VUEA 3D6HA 3FPAA 4OXKA 3K70C 3E1KA 1GUYA 1Y3FE 2WPNA 1XUOA 3AEQB 4U2CA 3F96A 4BFXA 4AF6A 1NXVA 1FUUA 3W1WA 1O5IA 1OT5A 2AUMA 2VJOA 1PSZA 3X1XA 1FMJA 3ISVA 4ZAXA 4DCVA 2ZUBA 2Q27A 4EY3A 2GA8A 3TK1A 3ENNA 2YYYA 1LQTA 4P7BA 3GYBA 3TNDA 3NHSA 3UW1A 1IN5A 4MV8A 2BR5A 4GPIB 1UBJS 1N0IA 3IUEA 1E1LA 4IIGA 4TTSA 4EPTA 2H08A 5CD9A 3OZ7A 1P5HA 2RGUA 4LJLA 5K09A 3OPQA 4CKBA 1NY6A 4I1SA 2ZXEA 4OMDA 2CHVA 2G88A 3CZMA 1ISIA 3PEUA 1DG3A 1BRTA 1U98A 1Y80A 2HXGA 3WGTA 1A27A 1R6XA 3BOSA 2WIBA 2ZRBA 3CNNA 1H2BA 4J6FA 2QRNA 4WEQA 4BJ1A 2ZJ4A 1ID1A 2VDOB 3IOCA 2I1WA 4KR2A 1GADO 4B46A 4XGKA 3DDHA 1K68A 3JRXA 2GMWA 5KC8A 3GGPA 1K2WA 3UHPA 2ECOA 3CG0A 4XCVA 3K4QA 4XDGA 2LZ0A 4KO1S 1E0JA 2RKBA 2I6UA 4ZFNA 3T3DA 2GNPA 3TECE 2PRIA 4BVLA 2EJUA 2NP6A 4UHKA 3O5AA 1T6ZA 2NPOA 3FZNA 3HYSA 5LDGA 5F5NA 3GJSA 5ENDA 2GNAA 1YKGA 1OQAA 2R00A 3P0EA 4GM4A 3BSFA 1I1HA 2PGDA 1SUWA 4J0GA 5IJ0B 4J2HA 1MQAA 4C14A 2GD0A 3EIWA 5DH9A 4CF3A 1NUHA 2G4VA 3AP1A 2GX6A 2OCDA 3FFAA 1NP7A 4TSFA 1CUDA 4NMLA 4N3NA 3OZEA 2QMZA 3CH4B 4C4SA 1NRIA 3KXKA 2A2ZA 3NBFA 1ESCA 1IHYA 1Q11A 1XXHE 5J9FA 5H16A 4EHHA 5AI8A 4WBNA 4Z7NB 3T4XA 3K09C 3EZGA 2MYTA 5CYPA 5JDCC 2C8KA 2Y4NA 1FDVA 2PK3A 3LIPA 5CW1A 2WKPA 3GT7A 4HN2A 1CXZA 1W73A 2G4LA 4WZAE 1EAMA 1EDZA 2GTIA 3RS4A 1T5IA 3DDNA 4BB5A 4NEHB 1PJRA 4MI9A 1L5LA 2GUGA 4FZ3A 1JI3A 4UU7A 5MFPA 3WGKA 3TTYA 4B34A 2FP4B 621PA 4LHSA 1K6MA 3NBAA 2OR3A 1L5QA 1PZEA 2YBDA 2ZAYA 5JBNA 4UAJA 5B2EA 4INJA 5GOTA 5DVZA 5JUWA 3A9VA 3HN2A 2VBCA 2YX1A 3GRCA 1DDIA 1XZLA 1N2SA 3IHTA 5ESXA 4P92A 1E6KA 1W46A 1T1RA 1WB4A 2KBEA 3GRYA 1I10A 4R2IA 3V1MA 1JHMA 4J3FA 3LK7A 1GLGA 1Z0IA 4L5AA 5A05A 4BX8A 3EXG1 4YDRA 1JEOA 3VR1A 1WDTA 4LJSA 2AFRA 3PHCA 4JBYA 3IPLA 2HEGA 2Z2XA 3RT9A 1IN6A 1SKQA 4CIXA 4YQFA 4MUEA 4OVKA 5JC8A 1Y8QB 1QQTA 4TXLA 1IE3A 1M2WA 1NI3A 2GRUA 4QTUB 5HK9A 2OD7A 2GI4A 4PTYA 2ASEA 3GCGA 4Q4JB 4G8CA 2RHMA 1SOWA 2FUCA 3JQ9A 1R37A 3PYMA 5LA6B 2HMAA 2C5GA 4KYVA 4DBZA 6ABPA 1XDWA 4IO0A 2FJUA 3DEYX 4IFEA 5KKCA 4KR3A 3JQEA 1AIPA 1O97D 2EKZA 2EERA 2GD6A 5KJ6A 1MAWA 1ZUIA 3HFSA 1JJFA 5CAEB 4H1WA 3V2IA 4OYYA 4KZPA 4PSVA 1P2UA 1D2MA 1S6YA 1YT5A 3DCNA 1UC8A 3UMYA 4ISCA 2WTXA 5EVCA 3AG6A 4CNQA 3T5PA 5JJIA 1B14A 4IVPA 1TYAE 4J0QA 4V0OA 3AVTA 4X90A 1T1SA 1AXGA 4GGPA 2VR1A 5A06A 4LQCA 4PNZA 4W5OA 3DLTA 3KAQA 2R87A 3IR6A 2RAVA 1AH2A 4TWZA 1T1IA 1V25A 3RJ5A 4NU0A 1QB8A 1ZMTA 2HJRA 4B3FX 2VHQA 3RABA 2IYRA 2FR8C 4IL5A 2JFVA 3ESZA 2EL9A 1ITZA 5J2TA 3AESA 4FQ8A 3COVA 1E79A 1J1UA 4MYTA 3GFRA 3SKYA 3K0FA 1XEXA 1LUAA 1M1NA 3CR7A 4BWYA 3U6KA 3QYPA 2NP7A 1CBUA 1H69A 2QG9A 1M0WA 5PNTA 1VJCA 1J0EA 4HB0A 2YOGA 2AVDA 5EXDA 3KEQA 3VVCA 1G9XA 1BCSB 1SM4A 2QQ5A 5ALYA 1Y8RB 1RM3A 3L7CA 1T4CA 3I9NA 4FYPA 2V59A 1VKNA 3QG1A 4F97A 5KQGA 3W04A 3ODGA 2FN8A 2ZBUA 3KQHA 1X8JA 2Y0CA 4JROA 3SCZA 2A5LA 2OM2A 4LI3X 3ZH9B 4AI6A 4LIPD 4DLXA 3TDMA 1N7IA 1O58A 2VHUA 1SOVA 1I6MA 3WE7A 5J4VA 1U0NA 2G40A 1TEXA 3I92A 1JFLA 4MITA 3AM4A 4F5ZA 2OCXA 1IAVA 1WKBA 1E3QA 1K5HA 2O23A 3LTEA 2EF0A 1W85A 3LUPA 3VH2A 4YR9A 3OQIA 4X6XA 4DV5B 1N5IA 3GRFA 3GMTA 4EENA 4Z99A 4N3BA 4MV7A 2FCAA 3FCYA 2JIBA 5K3AA 3HVKA 3F46A 1KTIA 1B6SA 3NHRA 3PV0A 5H70A 3W1VA 3UUWA 4GLFA 1JAIA 3NDPA 4ML3A 3OIYA 4FNMA 4RD4A 2G06A 4A82A 4MUMA 4R54A 1HEUA 4OAQA 3HFRA 3TXAA 1ZH8A 1K7XB 3ADOA 2EP7A 3W5SA 3H5OA 3L07A 3U40A 4ZGBA 1B42A 2E37A 3GB9A 4EYGA 4EI9A 1V1JA 4G5RA 4UNSA 3H1TA 2H7YA 3FWZA 3LBIA 2HA5A 5FTWA 1FDUA 2YHSA 4A3SA 4AIRA 5A4MS 5BSWA 4NEQA 4H0FA 1LBIA 2BN4A 2XLBA 3I9V1 3VSAA 3A4IA 3AFMA 3WV5A 1EJ0A 1SA0A 1BKYA 1K0UA 3D8BA 1Z0JA 2OENG 3EQ7A 5TDHA 4UXHA 3UOGA 3UMMA 2L18A 1NVUQ 3KPYA 4BAUA 2VUUA 3AF2A 4QDUA 5JJ5A 3K73O 1U99A 1E9BA 4XD7A 4U0JA 2OO5A 2P27A 2XRMA 3A6FA 2TYSB 1T9AA 3ZLUA 3MXOA 2QMEA 5ICEA 1J2RA 3SK0A 1CY7A 5EZ6B 1G20A 4L16A 4HFMA 4B3BA 5I3CA 2PZFA 3DNFA 3D1VA 4AN0A 4UTVA 5EQJB 4TZ0A 2RBGA 4N0EA 5JYBA 2HCFA 1YH3A 3C7KA 4HCJA 2PEYA 3WZMA 4FYYA 3AVWA 1G2QA 2YJZA 1J0AA 3MG9A 2BFMA 4MX8A 2BFCB 3DKPA 3L7YA 4G24A 4EF5A 4F71A 1DBVO 3QVMA 1LDBA 3IOBA 3RGGA 2BFFB 1G8GA 1V1RB 1EWKA 3OHMA 1NQVA 1W6RA 5K3CA 3WGYA 3WLIA 5LXTA 2EEZA 2WB4A 1CZRA 2Y6VA 2H5LA 3GFVA 3D4BA 3M5WA 4GOKA 4KO3S 2B8EA 2D5LA 4GXTA 1T9HA 3JALA 3DEAA 1NA5A 2X3FA 2VK2A 1E32A 1Z22A 2D2VA 1REQA 2JGJA 2WUWE 3IKVA 1U5AA 3SYMA 5JDIA 3S2EA 2BFOA 1EINA 2FR1A 3Q5EA 4G0VA 3MPUA 3CGGA 2D28C 3HJUA 3MRXA 3GD7A 4R01A 4C7BA 4GL2A 3DKKA 2EIHA 3KZ1E 4CN9A 2C9DA 1WOMA 1O9BA 4MGIR 5K0CA 5ELXA 2M32A 3TUIC 5LP1A 3HXKA 2D0IA 1CJCA 1Y3AA 3PA8A 3VNSA 4G1UC 4RA6A 4DDMA 5LD2B 3BRCA 2F8TA 1VMKA 2GM9A 3KE8A 4RK6A 4LWOA 4X7PA 1AMNA 1CUFA 1LI7A 1IY9A 1F4LA 1U4OA 2GAAA 5A3RA 3FZYA 2HRBA 2VYNA 2E4WA 4YMIA 2BBWA 1X1BA 2WLSA 2CHUA 4B6QA 5KYXB 1P6UA 1DV1A 3ZWWA 2RHDA 5K0TA 4BJ5A 5I5EA 2I8AA 2D2EA 1YE3A 4N9QA 3W4IA 1DJMA 4ZYYA 2OV6A 3VKGA 3TQFA 1IUOA 2WFMA 4C76A 1EFUA 1KXZA 3LUBA 4QU8A 4XX1A 2O6HA 1IIBA 3JZFA 4L27A 1ABBA 4K1LA 4IZOA 1R9MA 5K0ZA 3GLSA 4OM8A 4JGBA 3HFJA 3PU6A 5BT9A 3WJ1A 1DNPA 3I3SR 5KTSA 1U04A 4XARA 3MJHA 4OUDA 4MEAA 3MSCA 1UJBA 3C98A 1T0HB 1E59A 2GILA 2FW0A 1C14A 4D0GA 1FU8A 5JMWA 4MUXA 5GWXA 3JSXA 4WGGA 3LA8A 3VNBA 1KGSA 3RC2A 1LPMA 1BX3A 4F06A 3ENQA 1Y9EA 3O4HA 3PQ3A 1ZM9A 5ALIA 2X40A 5HFJA 4CHTA 1TQ2A 2P9BA 1XPRA 1U81A 2BMEA 1WTAA 4W8OA 3PCXA 3WGIA 3EYAA 4AS3A 3WGMA 1JPUA 4QXQA 3GRZA 4ZU6X 4DC0A 4BNJA 4G4JA 2HK9A 1T29A 3OVMA 2JFWA 3LUDA 4N49A 1KY4A 4RF5A 3W2FA 3GAFA 4Y2XA 3WZLA 2QAJA 1JHZA 2FXIA 4ESEA 3OHSX 1V3TA 2IODA 2V6BA 3FHCB 5EIEA 3R6QA 2BEJA 2GN4A 3BCHA 3ZV3A 3OPMA 1RKXA 4Q3LA 1XEWY 4Q9IA 3PDJA 3GA5A 3VC1A 2CFSA 4EWLA 1HGXA 4DQ0A 3EJ6A 4W1RA 3INTA 4CIDA 3EK2A 3LW7A 3ME5A 4MVJA 5DIFA 5G02A 3DB1A 2P4EA 2Y67A 4YMVA 2OZKA 4GH5A 1KTVA 1VJ0A 3H2SA 4CM8B 3EARA 2PIAA 2EWMA 3IAEA 5HTKA 5C5EA 4HDKA 1R5OA 3G9UA 3BXXA 4X9XA 5I7AA 4ALJA 4ENWA 5JU6A 3SJBA 4I8XA 2YV2A 5EYPB 3UPUA 3G0HA 2AXPA 5I7WA 1V2HE 5CB4F 2CNLA 4I46A 4ZEMA 4PV7A 4LOLA 1U9IA 4MRMB 2X75A 5C37A 2WAMA 2FLKA 1HDXA 4DM3A 2EFJA 2QBYA 4E5UA 2HQOA 1IJFA 4BO8A 2NUPB 4Y1RB 1X7WB 2BM9A 3GJ0A 4DQLA 2DQYA 2W2KB 4P80A 4NK4A 3G6KA 4ZMBA 5JH7F 1YMVA 1PJ4A 3H0EA 4Y2VA 1P1HA 1PL8A 4K86A 5ALKA 1L5FA 3KLPX 3C6KA 1K7WA 3L6DA 3ZK8A 4A8JB 5KTMA 1Y1LA 1S2GA 3UA4A 3ESXA 4ARVA 3S29A 1XP5A 4MW5A 4ETWA 3GCDA 3QYJA 1JKFA 2RH4A 2R25B 4BMSA 1GKKA 4V0RA 3HBAA 1A98A 4F9EA 2Z8YA 2VDJA 3ORQA 3OU2A 5LKAA 3C3PA 2QROA 3N07A 5KTYA 2R9VA 4PFJA 5BW5A 2XEDA 4INOA 4Y2GA 3UJPA 4JEIA 1M5RA 3FLAA 4B48A 4Q01A 4QXRA 4RX1A 1QUEA 3FI9A 4MLDA 4Q05A 2YNMD 1VCNA 1V8BA 4PZ9A 1VTKA 1ZH4A 5AYVA 4IDCA 4G0ZA 1TW3A 1RMYA 1YRLA 3WIDA 3RF6A 5CYGA 1ADYA 1R6DA 3H1PA 3EIHA 3IUYA 3MW8A 4U2FA 5HFNA 3ZBTA 4DA7A 6NULA 4LFBB 2FZVA 3BGDA 3RFVA 2NW6A 3JARB 5LYJF 3IP8A 1CD5A 2JI8A 4ZVKA 1H4QA 3TFWA 2OCPA 3LDUA 4MW9A 3LXRA 3VR6D 2GM3A 1K8YB 3HCEA 1ISRA 4GKAA 4PZLA 3UBTA 3L46A 1ZVVA 3G2MA 4GU5A 4IVQA 1LV7A 2I6XA 3IQFA 3UT5A 4UVHA 4IILA 4RZIA 1EGHA 2DWPA 5KCMA 1H0KA 3GDHA 3TBFA 3AFGA 4NL4H 1NW6A 7ADHA 2BFBA 2P75A 2EZ8A 1MOZA 4M54A 4YJGA 3FNFA 1QH8A 2XAAA 4K6MA 4E2YA 1J9EA 2PSFA 3ER6A 4Q1VA 5B2ZA 2ERCA 3JD2A 5HW2A 4A10A 4D8WA 4PEVA 5CG2A 3QTTA 1WS6A 3EAFA 1QAMA 5F1PA 1N36B 1YJ8A 1NTRA 1L4FA 1QZTA 3JYOA 4I4TA 5JRZA 4CEIB 4K26A 4DLVA 5KX5B 3TR5A 3JVVA 1NLUA 4HUTA 1E7RA 1XX6A 4XWWA 2V6FA 4YUZA 2D7CA 1UBEA 1DPFA 4BTEA 4D56A 2PRYA 5BSFA 4I5DA 4D92A 4FEEA 2DRIA 2B61A 1FTSA 2ZJFA 2WIAA 3DTYA 5JNTA 3LOQA 1SUEA 3FYHA 3CUKA 1P3Y1 1OTYA 4IJKA 4ARBA 2EEPA 3DEKA 1QHNA 5AM5A 3H13A 2GSDA 4TZ6A 3WLRA 3RS9A 3I8SA 1ZRHA 4O0LA 1TPYA 2ZFUA 3K2EA 4CL3A 3NO9A 2J7PA 3AOEC 4IIEA 4EBFA 4WBNF 4DFDA 3FMFA 2DPLA 2CUTA 3AIIA 5ESWA 1XSEA 1YRBA 4I4NA 4NC9A 5EIOA 1A9XB 2C98A 5T8KC 5B3LA 3DTVA 2ZPTX 3L6OO 1R00A 2WWYA 5H81A 4KPGA 4LRSB 1NXSA 5J47A 1P73A 3SKXA 4XIJA 1W49A 4QZVA 2H48A 3NR2A 5DYYA 2OZEA 2HTEA 4GHWA 1ETHA 5C5DA 2MMCA 5I4KA 1ND5A 4KQIA 5EXPA 1E92A 4FN5A 2QUIA 3COWA 4MDHA 3TAHA 4BQFA 3LDHA 2SCUB 2GOYA 5FFFA 5LB2A 2LV8A 1T9GS 2ZUTA 2VNSA 2HUNA 1V5IA 1P1IA 4BE9A 1A8UA 2A57A 2XF8A 3IB6A 1ZK2A 3QKTA 4I1IA 2W2LA 1G42A 3O8OA 4G2TA 1W5FA 2BGRA 3P9IA 4HDNB 1GCOA 4KWHA 2WJYA 2HT6A 3EZNA 3OMWA 1PR4A 5DIZA 2RCYA 2XNJA 3A3KA 1WQ3A 3L4BA 5TS3A 2FSUA 2W48A 2RI6A 1Z4PX 4ZEOA 5JW6A 5F21A 1R4NB 3CVVA 3QWAA 2B5WA 3NHUA 3D4NA 4WINA 1U0TA 2ZJ3A 1SU8A 5FV7A 1SK9A 4ENPA 4GX0A 4KXQA 4MV1A 4UAGA 2CXPA 1K7YA 4QG7A 2DTEA 1OCEA 3NU1A 2NQTA 1DBIA 4HEQA 1BCRB 1RADA 4Y0NA 3W6OA 3S81A 1XRNA 3LT5A 3EC1A 2QZSA 1SC9A 4RVCA 5ES4B 1XFAA 5T64A 1YOBA 1WSAA 3QKUA 4DBLE 1VFNA 3HKCB 1TKBA 5D8DA 3LNTA 1J22A 3FVQA 3FRHA 5H0IA 3FRIA 5DNCA 1UEIA 4WQMA 2WB2A 1Y1PA 3FROA 3OCVA 2FPGA 2B94A 3PNQA 1Y82A 3AKCA 1BFDA 1YDGA 2XODA 2Q2NA 3MMPA 4R1TA 5E6SA 4HNVA 4WD3A 4DQDA 3QBEA 1IUKA 3QXGA 2DMRA 3CCFA 1T15A 3OQ6A 4X41A 1OB5A 2ACEA 1JN0A 2ZAMA 3LPCA 3MOGA 3ZZMA 2FAXA 1RE0A 3I45A 3R3ZA 4N8DA 2GETA 3H19A 3P0HA 1MOQA 1Q0LA 1W96A 2QX6A 3GNTA 2JH9A 1SKAA 3O31A 3PFNA 2OV2A 1T2EA 2QQ0A 1EUCB 4QX6A 3SI7A 1GPYA 5B57C 2GF9A 2QUAA 4AM8A 3F3YA 1JFFA 1G6OA 1B8UA 2D0PB 2PL9A 4RESA 5IAGA 5EWLA 4EKIA 5K0GA 1U2SA 4MAAA 4MJ3A 4CM4B 4RTQA 1BXKA 1C30A 5KYTA 3ZCUA 1XMJA 3KOYA 3ER9A 4JC0A 5E9QA 1T5TA 3O2QB 3E9RA 2Z3WA 3RBXA 3QVXA 3SHFA 3RK1A 4GLOA 1L7MA 2PL5A 3JY6A 5EIBD 2ZWPA 1PX0A 3D4PA 1WB6A 2A7QA 5A3SA 4UBJA 3HDYA 1CUYA 1E99A 3RVKA 3PFFA 1UDWA 3UWDA 4BOYA 1XYVA 3D2LA 3FVTA 3UJCA 2HAEA 2PV0A 1YUMA 3UC5A 1UPBA 1DJLA 1DKOA 1LWNA 1ZRNA 4B44A 1XWFA 1V4BA 2XT0A 3U7HB 4L5BA 5DP2A 1QBKC 3BD7A 1W1UA 3NS7A 4LGCA 1U6KA 2EFEB 4HWRA 3OCWA 4LYGA 1OAOC 4H1TA 4QGFA 3IDOA 3TAXA 5JDCA 4XOUA 1XCJA 1XF1A 4AG6A 4JC4A 3D8TA 4OMUA 4CM9D 4E5YA 5K05A 1H3EA 1NJ8A 1MOSA 2MSEB 2P6PA 4N47A 1NDHA 1FLAA 4K6CA 3CEJA 4WUTA 4E6EA 2FXVA 3BZWA 4FDAA 2LCIA 2G0AA 1UIRA 2JA1A 3MBOA 1X1TA 1ZCBA 2AFIB 4LXYA 5TQ2B 5KU1A 3U4MA 1VPDA 3GUZA 1RSZA 4QA9A 3ETCA 3BM5A 1SHTX 1ZHFA 3LS2A 3L79A 4ZOLA 4J3JA 2FMIA 5JEDA 2XWJI 3IT2A 3WKCA 2QRQA 1J09A 3CR8A 1Y1TA 1P80A 1JPJA 3C48A 2XXAB 2OG1A 3IAXA 3GLFA 3CBQA 3TIFA 1PCXA 3CLTD 4Y7DA 2VPIA 1FU7A 4Y2SA 3V4PB 1Q44A 1R9GA 1S5PA 2OV4A 3JAKB 3R7LA 2Q7XA 3KC2A 4Q9NA 3T7AA 5BXQC 3EVNA 2C42A 3FWKA 2WJ3A 1X9IA 3FYTA 1G17A 5HIMA 3SFVA 3WK4A 4AJKA 1P4HA 4M0LA 1IZ8A 4H4CA 4JLUA 5AHWA 5BURA 3J81A 4LYFA 1OLUA 221PA 3IFSA 4XYGA 1J90A 1UPTA 1CHDA 1Z0SA 5EVJA 4ME6A 4OJQA 4FVTA 3ZNOA 4RZUA 2P3SA 4A6PA 1KFKB 3DP7A 1EWVA 2HHLA 3C3JA 5J40A 1A9ZA 1VXOA 1Z5UA 1OY1A 4J9VA 4RFSB 3U7FB 4P7FA 2MYPA 2ISSD 1BG6A 4LECA 1NDUA 1T34A 1G1MA 1J5XA 3EOZA 5ALPA 2HA4A 1M2OA 4TSRA 1XZFA 3VUFA 3W2TA 1XR3A 2HY7A 2UZ3A 2DH6A 3HYLA 4LY6A 2AMLA 1SUFA 1UPAA 2JCGA 1RJ9B 3VC2A 1T0BA 1NYLA 3EFOB 3CZ9A 2X5OA 4EY8A 3DE0X 4ETNA 3NONA 2Z09A 4F84A 2VBFA 3ITNA 1E1YA 2WHXA 3VYWA 1OYWA 2W6QA 4JJGA 4O4HF 2AW5A 4APBA 2I4LA 2VH5R 1NBMD 2BJVA 3V1YA 5AW2A 2R0QC 3I58A 2OXCA 3GU3A 4X54A 5JS7A 1L7BA 2J9YB 4LYJA 3VHXB 5KTNA 4EO7A 1U1CA 3MA0A 1OFUA 4RS4A 1LPPA 4XQEA 4Z4FA 3AB8A 4QGHA 1G66A 1H23A 2GN0A 2BAGA 3TNFA 3TJZA 4A23A 1ZOSA 4BFYA 3AJ9A 3GP3A 2D5BA 2Y1LA 2ZRCA 3D8RA 1WEKA 4TV8B 5JVDB 7REQB 3DA8A 2O2IA 3GFFA 3O7WA 3CH5A 3O2NA 3BQMB 3JWJA 3QQ5A 4H6PA 4YP5A 4AKTA 4DIEA 4E11A 3CIFA 2Q6OA 3IDQA 4R7ZA 4NP6A 4EHJA 3D2AA 2F6RA 2WV7A 4U9IS 4JUFA 3SR0A 4JS0A 3UMJA 1L5HA 3TLJA 1QYXA 2R00C 1TECE 2B3TA 2HQBA 3BK2A 3RD8A 3GH3A 3L7LA 1Z8NA 1PZNA 2O1SA 1IEXA 1EA7A 2QTTA 4II2A 2ONJA 4ANFA 2PQ2A 4DW8A 1U2GC 1PFQA 1TQ4A 3FFWA 2PT5A 4X92A 2JEZA 1TD1A 1YQ9A 4JVLA 2M6LA 2AL7A 2NU8A 1O94D 1YRYE 4AMGA 3S7TA 1EXDA 4MYDA 4L4RA 2XQVA 3DOUA 2RGRA 1HYBA 1RLIA 5AM3A 4N8EA 3AWIA 4HLUA 4DXDA 1ESZA 2QSZA 4N5IX 2B8TA 2ID9A 4WK6A 3HCRA 1LLCA 4D9EA 4UOEA 4CEHB 1EK2A 5KTTA 1XTPA 4O1HA 5JZBA 2JIZA 3NC0C 4HPWA 2K2QB 3FLEA 1JKIA 4HDRB 4DBLC 3CUTA 5EJ2A 3AFNA 4DAEA 1DAEA 3DUFB 3JQCA 4IDFA 4RPHA 4D4MA 4CMCA 5LYYA 2OQVA 4D8TA 2G8LA 4TM7A 1VLLA 3W4JA 1DDOA 2YWBA 3LPMA 5CCEA 1JEYA 3Q9LA 1TGYA 2CNWD 1JHOA 3A6HA 1AGRA 4HQ0A 3PQ8A 1I3OA 1OIWA 1XZGA 3A6LA 3AGQA 1QBGA 4I50F 5AVYA 1MIHA 2SECE 3R7AA 2C9OA 3RAPR 1SEPA 1XCOA 2W6MA 5DM1A 3R6TA 5T4BA 4DZZA 4EG5A 4RLHA 3IYLW 3UUFA 3KWMA 3PUWA 4YNBA 5JD3A 5LBTA 3B3AA 5LM3A 1YNSA 1XNJA 3LRTA 5HKAA 4CODB 2XDAA 4O4IA 1PZHA 1UUFA 4LHVA 2RHRA 1KBQA 5DCWA 3SU8A 1GSHA 1C9EA 5H4GA 3WWPA 2WSMA 5LJIA 4Q15A 5EZYF 1U9IC 4KKXB 2J0SA 4Y6QA 3HCBA 3KR2A 4O2BA 5TPZD 4PG5A 4KGDA 5ANRB 3BDIA 4AN4A 4O3MA 5F7XA 2FMTA 4U5XA 4DYHA 4PHTA 4H0CA 3MCUA 4Q7QA 1Z17A 1L1RA 2BUCA 5JATA 5T4HA 2G72A 4PX3A 1NXWA 5E9WA 2F1RA 4EVIA 5MF6A 4EY4A 2NO1A 1KVUA 4NCHA 4JEUA 4HATA 2IOFA 4ZYLA 5LQNA 4WDQA 1PHPA 3JQ9C 4PPQA 4QTZA 5L7TA 3UT5B 5LP6B 2DPGA 4EGAA 5FAKA 4GBJA 2P9FA 4AZTA 3SD7A 3CUYA 3VR5D 4YT2A 1KVSA 4GKBA 3PF9A 1MLDA 3RK4A 1G8PA 3U4GA 2XIJA 3FPEA 3V00A 4TWBA 4UTNA 1BHSA 2EYUA 2JLAA 1I7QB 4QBHA 4MWBA 2OPHA 1VI5A 3U1TA 4NU5A 2HM7A 4F6CA 3IV9A 3R3UA 1SWVA 1WHTB 1P74A 2ZYVX 3JU3A 4JKOA 1YQXA 5ESRA 3TQOA 4IXTA 5IF3A 4C4XA 2X1LA 2ZQ5A 4ZHQB 1MW8X 1E1QA 5KNCD 2C8VA 2IYFA 2ZJ6A 2BV3A 2CZCA 3EY4A 1GXSB 3HXTA 3TZHA 1Q1GA 4JJAA 4IDOA 2QUJA 3IQDB 5AKYA 4IDGA 4URYR 2R7LA 1QM5A 4L0DA 4JBLA 3GGCA 3N3BC 5C46F 3ABSB 1NVWQ 3L8GA 3PTLA 2NGRA 3BMNB 2B37A 2C82A 1V43A 4MQFA 5AXCA 1V9CA 2H1IA 1NYTA 1ETUA 2I6SA 2IIPA 1GDHA 1AGPA 2RC6A 1KMCA 4BNZA 2FI1A 3PKIA 4ZCTA 4UHDA 2I4IA 3CKYA 4LZOA 4EY6A 2HIGA 5K0LA 2H0QA 2YHIB 3ORHA 1BH6A 1XB2A 1S0UA 2PL3A 4AULA 3ZWPA 4EB8A 2OP1A 2PEZA 5CDTA 1SFRA 1KAGA 4V38A 5BVGB 2JGMA 3V8MA 4F60A 4BVJA 4TVSA 3QYAA 1QRAA 3MYRA 4MVJP 5L95A 1CUEA 4G4SP 3WK6A 2P9GA 1YB6A 3K7EA 4MI3A 3WLTA 1GA6A 2ORED 4Z3DA 3MWDB 4MDYA 4U2DA 3K9WA 5CFNA 1LBQA 1XA4A 2XGOA 4BRUA 3KLBA 3WWOA 1CZUA 1KP3A 4WXMA 3TI9A 3KKEA 1L4MA 2VYQA 2YBEA 4PQGA 3HY4A 3LBNA 5AHXA 5IYZB 2WPDD 1DOAA 1ONPA 3MWYW 4EKNB 1D2EA 3AY6A 4KRXA 5HF5A 2A9PA 1P39A 3OBIA 2P5TB 3KEMA 4GBED 4N7MA 1F8XA 1II9A 1V4NA 1SCUA 2OCIA 3HPQA 2PGJA 4GWLA 3O3OB 1GG9A 4EM6A 1DEKA 2P62A 3E18A 3WYGA 5BUQA 1J0XO 4AKGA 4UQPA 4IH9A 5ERGB 1SCKA 3AUTA 1Z0DA 1XDDA 2WZBA 3H9JA 4QVGA 2AIRA 4C7KA 1C3VA 4OKNA 1TJPB 2JHCA 4LZPA 3YASA 2Q3DA 3I30X 3ITEA 1NVDA 4U3JA 1QTRA 2P69A 3H05A 1ZR4A 3RS8A 4PFSA 1K5GA 4LI0A 5AM2A 1TA9A 3DCJA 1CZKA 3G6WA 4AUKA 6YASA 1P44A 3TOSA 4JT9A 3L93A 2OHVA 4PONA 1CRQA 3MFYA 1INLA 3RUEA 3OEHA 1W8DA 2ABWA 1P9WA 1R0BA 3LCJA 4L73A 4MWGA 4ROSA 2VPZA 4RZ2A 1HYGA 2J7KA 1RAFA 2VQSA 4L07A 1M6NA 3H86A 3T1OA 3T52A 1R6BX 2B99A 4UNRA 1H6BA 1XMVA 2R4TA 4IHQA 4QEDA 5AVJA 1Q1QA 4ZOLB 3NGLA 5EEGA 2YXBA 4XPZA 4IDDA 1BCRA 4P93A 1QH0A 4OMFG 2ZRDA 2RHCA 1ISJA