4YIKA

Crystal structure of human cytosolic 5'(3')-deoxyribonucleotidase in complex with the inhibitor pb-pvu
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
201
structure length
201
Chain Sequence
SNAASGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase, mitochondrial
publication title Structure-based design of a bisphosphonate 5'(3')-deoxyribonucleotidase inhibitor
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 65
structure length 201
sequence length 201
ec nomenclature ec 3.1.3.-:
pdb deposition date 2015-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4yikA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4yikA01
5AM4A 4MWOA 1ZD4A 4AP9A 3B8EA 4KX5A 3QU9A 1TJ5A 3NANA 2ZG6A 4H1WA 3I76A 1WR8A 2B8EA 3BA6A 2FPWA 3ESRA 3QLEA 4YCMA 5AVZA 4AS3A 4IFTA 2JARA 3BWVA 3NAMA 5AM2A 4YIHA 5ALDA 3OCZA 1SWWA 1U7PA 3QU4A 5AI8A 4HGPA 3WK6A 5AVWA 2I6XA 1RMYA 3B9RA 3ZX5A 3L5KA 3OCXA 3ESQA 4F71A 3KDPA 4CF5A 5AM3A 3S6JA 3NASA 4NABA 4FE3A 5ALIA 3ZVMA 3WKEA 1Z4PX 1RLMA 4UASA 4PNHA 1Q92A 1NRWA 5AM0A 2OM6A 1ZS9A 5AKIA 3QGMA 4ZEXA 2HI0A 3TLMA 5AVTA 3A1DA 5AKGA 3QU5A 3N07A 1YMQA 4ZEVA 1AQ6A 3ZVNA 3ZTYA 1RLTA 3FPSA 1Z4OA 4CF4A 4UMVA 3L8EA 5AVVA 5IS2A 3PGLA 3N1UA 4HGQA 5ALJA 3D6JA 2CFRA 5AK5A 5AW5A 2NO5A 4UMEA 4QQFA 4Y2TA 2HOQA 2B0CA 3ZWKA 2FPUA 5AIAA 1NF2A 3CZ4A 1TJ3A 2VKQA 1Z4KA 1YV9A 2NO4A 3HYCA 3U7FB 2W43A 5ALKA 3IB6A 2B30A 4XPZA 4Y2SA 2B1QA 3ET4A 5ALGA 3I1YA 3DDHA 4G9BA 3DV9A 3SKXA 3FZQA 5A3QA 3OCWA 4DFDA 1VJRA 3UM9A 1Z4NA 2R8ZA 5AW2A 2WHEA 3AR6A 3R9KA 4JB3A 5T41A 3KD3A 2RB5A 3N8GA 3SD7A 1SWVA 2R8XA 3WK4A 3KBBA 3B9BA 2R8EA 1N9KA 3I28A 3QUBA 2ZBEA 5ALSA 5AW3A 2B82A 1XP5A 1RMQA 3AR9A 2ZOSA 1ZJJA 3SLRA 3ZW7A 1L7MA 2RAVA 2YN4A 2W11A 1EK1A 2P69A 2C8KA 1VJ5A 2HF2A 3WGVA 2I54A 1L8OA 2GHQA 2Q4RA 4Y3UA 3ET5A 1Z4MA 1QQ7A 5AVRA 1L7NA 1IWOA 3FGOA 4XOUA 4Y2UA 1XVIA 2OA0A 1J97A 1YNSA 4YCNA 3L0BA 2GHTA 4FFDA 1WVIA 4UATA 1RRCA 2WF7A 3K1ZA 4Y2QA 4UW9A 2FUEA 5AICA 2I33A 4HAIA 5AI4A 1LTQA 3U13A 4L6CA 5ALXA 1WZCA 5ALUA 5IT4A 1ZD3A 2RBKA 2C9MA 5AKZA 5ALVA 3M1YA 1U7OA 2G09A 2YY6A 5ALRA 2WF8A 5AKEA 5ALHA 3M9LA 1ZOLA 4EELA 3PGVA 2QLTA 2OYCA 2YJ5A 5AI6A 3ZTWA 2G0AA 1CQZA 1NNLA 3NIWA 3WGUA 3W5CA 5A3RA 3MC1A 3NUQA 2QYHA 1Z4JA 2IYEA 3SF0A 1S2OA 4BNDB 4JDPA 3OCUA 4F72A 4HGRA 2BDEA 4HYTA 4UARA 4Y2JA 3A3YA 5ALTA 4BEWA 1Y8AA 3ZX4A 5ALFA 4YH1A 3SMVA 2Q5EA 4GIBA 1YJ5A 5AVSA 4G63A 3L7YA 2HEGA 4EEKA 5AKKA 4CE6A 2JAUA 1Q91A 4Y2VA 3I6BA 1YS9A 3WK9A 5AW6A 2BDUA 3P96A 2DQSA 3WK7A 1U2TA 4BEVA 3EPRA 5IT0A 5ALPA 5AM1A 4YGYA 2JAWA 3WK8A 1CR6A 2C88A 5AW9A 3N28A 5ALNA 1QH9A 3IJ5A 3ZI4A 2RARA 4EX6A 3EF1A 3UMBA 3MMZA 1F5SA 1U02A 2EATA 1N8NA 2AH5A 4I9FA 1J8DA 3SKYA 4UMFA 1Z5UA 4KN8A 3N5KA 4EZEA 5AW8A 3OCVA 2WFAA 3E8MA 4BX0A 3UMGA 3RF6A 1ZD2P 2HCFA 4UM5A 5AM5A 5A3SA 5ALLA 5AVXA 2AUTA 1QYIA 2ZBFA 4NV0A 3L8GA 2NYVA 1ZRMA 4UAUA 4QJBA 5FP0A 4BNDA 4KNWA 1WPGA 5AKHA 5AIBA 4MUMA 3R09A 1Z4LA 1ZD5A 2FPSA 5AI5A 2I34A 1SU4A 1RDFA 3DAOA 4Y2RA 2G1AA 2G07A 1RKQA 1T9ZA 5JJBA 1RLOA 1ZRNA 2C4NA 2HHLA 2G08A 1RQLA 1EK2A 5AVYA 2YJ6A 4Y2PA 2G80A 3E84A 2WM8A 3U19A 4ZEWA 2X4DA 4CF3A 4CNQA 3U26A 1Z4QA 3AR4A 3J7TA 4BX2A 3FVVA 3OTQA 4BBJA 2P27A 3WKDA 3L0YA 2AGVA 4HGOA 2FEAA 1RKUA 3MN1A 1T5TA 3KOOA 3QUTA 4YCLA 2R8YA 4DCCA 2GFHA 3L1UA 1QQ6A 1RPZA 2P9JA 5ALQA 2YJ3A 2HSZA 2FPXA 3GYGA 5AKXA 2CFTA 3NRJA 3WKAA 4BYGA 4HGNA 3W5BA 5AK6A 4UU0A 1L7OA 2PR7A 3ONNA 4IG4A 4UAVA 2FPRA 3OPXA 3L1VA 2WF6A 3EF0A 2JAOA 1RMTA 3DNPA 5AKYA 2W4MA 4NWIA 5ALMA 1RKVA 5AW4A 3WKBA 3AR8A 1PW5A 3RFUA 1FEZA 3FPBA 1TE2A 2B8JA 3FM9A 4BKMA 5ALWA 3VAYA 4EX7A 1TJ4A 2YMPA 5AVQA 4KYTA 1Z88A 3L8FA 4BX3A 3QYPA 1L7PA 3HLTA 4C4RA 5E0OA 2ZBDA 5ALYA 4OD0A 5ALEA 2EAUA 2PQ0A 4L6AA 4UM7A 2FI1A 3KC2A 2I55A 5AVUA 4YIKA 4DWOA 3E81A 1LVHA 1O03A 1U2SA 3A1EA 4AS2A 3MPOA 1KYTA 1YDFA 1Z5GA 2I7DA 4RETA 3WK5A 4J2TA 3R4CA 4B6JA 4UMDA 2HF7A 2PKEA 2IA5A 2HX1A 2O9JA 4GXTA 2ODAA 2C8LA 3A1CA 5AHXA 4KX3A 4EENA 3QNMA 4UU1A 3AR3A 3OCYA 2HO4A 5AI9A 1MH9A 5AW0A 1L6RA 1X42A 2JGAA 5AKLA 3U7GA 3QU2A 2HDOA 4C4SA 4NFLA 3AR2A 2YBDA 3W5AA 3CNHA 4J03A 1TA0A 1S8OA 3ZWDA 2EARA 2AMYA 3AR7A 2Q4TA 5AK4A 1XPJA 2FDRA 2MU1A 2YMMA 3QXGA 4NAVA 3U7EB 4E88A 1RC8A 2YFYA 2YJ4A 4L57A 1RQNA 2MSNA 3F9RA 4OHFA 1QQ5A 1K1EA 4O8CA 1JUDA 3EWIA 3SHQA 4RESA 4KNVA 2OBBA 2GO7A 2CN1A 3IRUA 1L8LA 2CFSA 2YMQA 3AR5A 3WKCA 3QX7A 5AW1A 2IOFA 2WF9A 2GMWA 4FYPA 2IOHA 4XQ0A 3E58A 4XE5A 4DW8A 3ZU6A 2ZXEA 2O2XA 2YMLA 4OFZA 5AK3A 2WF5A 4C4TA 3QU7A 3UMCA 1VFPA 3L8HA 3ZUPA 4Y2XA 5AKJA 1O08A 4OCZA 5AW7A 2P11A 3NALA 3ED5A 2FUCA 5AI0A 2BY4A 2G06A 3U7HB 1Z4IA 3QUQA 5AESA 3QUCA 3KZXA 4Y2YA 3W5DA 3L0CA 3PDWA 2IOFK 2ZBGA 5ALZA 5ALOA 3PCTA 3ZVLA 1T5SA 4I9GA 2B1RA 2D2VA
chains in the Genus database with same CATH superfamily
2WINI 2JFUA 2VHTA 4ZI7F 1XNHA 1ODSA 3RVRA 2IUEA 2QG4A 3PC4A 3GFQA 3PTAA 3LS2A 3NANA 4X90A 3W2GA 3G0HA 2ZRIA 4JUIA 1OBFO 4PHFA 5A6VA 3D7MA 1FQWA 5DN9A 5TPWA 1NM5C 2IBMA 4DDWA 5JY6A 2R7MA 3H2BA 4N54A 5IRCD 3P27A 3ZXUB 2DPMA 2RBGA 2ZZNA 4NY1A 5G53C 1PIWA 3NHZA 5AVZA 2PT6A 4ASUA 1P62B 4YIHA 3RYTC 3CNBA 4BAZA 4RWZA 4XWTA 2FEXA 4P1ZA 5D5PA 1CNMA 1U28A 3HL4A 1T5BA 2WVHA 4B2YA 2QTZA 4CM3A 3UG6A 3SBOA 2FPGA 1OWOA 1K62A 2M1XA 1P8JA 1A9SA 3B9RA 4YI3A 4L5CA 3H5WA 2ZB3A 3ZX5A 2JLYA 2AEFA 3LT5A 2IUYA 1EUCA 2KBFA 3BJIC 4OREX 2IYUA 4W9NA 2XJ4A 3RS7A 4C21A 5C51B 5LXTF 3CZMA 3LT4A 2VYND 3O74A 3HLYA 4PBSA 3EZNA 3NR2A 3WL8A 1EFAA 2QZZA 4DIOA 4FBMA 4XB6B 3RYFB 1CP2A 5CX1B 4FFVA 2PNFA 1ZIXA 3I3SR 4LTDA 2GPTA 4CLRA 1LSOA 5C52B 1DJMA 1RPJA 3AERA 3N2NA 1T6BY 1EEXB 1JDBB 5KVCA 2V96A 2CZQA 3C5VA 1E94E 4E33A 2WWVD 1X70A 1A8UA 3EOAI 3IUYA 2YHAA 3KJZA 2OKGA 3DEYX 4JEHA 1U1IA 3FB4A 4CN8A 3PCRB 2P0YA 2PMCA 2HI0A 3EVTA 4Z4EA 1XZPA 1P45A 3AEUA 3PFCA 2NVOA 5A5GA 4EKDA 2QM8A 3JXEA 4WOKA 4F6LA 1X7WA 3NIGB 4CIBA 4UFPA 2WJ4A 2LUOA 3GJRA 3S7ZA 3B1ZA 1FW8A 2AXPA 5CCBA 3BMNA 1I80A 2Q21A 2JIMA 2R6JA 3HC7A 3KS9A 1L4KA 3RVLA 1CWUA 3NWEA 1O95A 4MGYR 5HILA 5B1YA 1RRPA 1CZRA 4TWJA 3T3EA 1A0OA 1XTUA 3M6UA 4MQMA 3GAFA 2F2TA 4CQMB 3RD8A 5BXQC 3PGLA 4K0RA 3F6CA 3LQ4A 3R7SA 121PA 4LJKA 1GN9A 5HJ5A 2OHOA 5JU6A 2XGOA 2BD0A 2FG7C 4EPTA 1I6KA 3AUXA 4IDQA 4PQGA 2RHLA 2GN8A 2P6RA 3REQA 1L4FA 4FZJA 2CLIB 5JRZA 4BNTA 1K4YA 1KRHA 2D62A 2IYVA 3CMMA 3EG9B 1EGHA 1UPBA 5EE9A 4ZAXA 2FZVA 4ZIRA 4LF9B 4M1ZA 2LWIA 4IDGA 2V97A 4J7UA 1ZR4A 2VRCA 1VRCA 2PAAA 3ESAA 3RVSA 5E6SB 2PUDA 2JF0A 4EQ6A 4R3WA 3EQ6A 4U9UA 1A2OA 3SC6A 1K4KA 5LU8A 3BMCA 1DBIA 1CUXA 3BRQA 1YZLA 3GOQA 1TLTA 1XZQA 4KZKA 4QNRA 3HJGA 2E55A 2UYYA 3FJOA 4MB2A 2WHEA 3ULKA 1RD4A 3TBHA 4BPBA 4BKQA 3DV0A 2C2YA 2H65A 3ELUA 5F7JA 2JFQA 1E77A 1JQBA 4DV0B 3DBRA 1SXQA 4DNXA 5IVPA 3FCAA 4HJRA 1T26A 5B7NA 5F5LA 1X2EA 2PTQA 4OHKA 3NDBB 2BIFA 4AURA 4PWZA 3R7FA 2B82A 4J16A 1QNLA 1XD9A 1UDRA 1Q6YA 1HYEA 4J07A 4Q34A 4YP1A 1TQ8A 3H5LA 4Q4DA 1L5SA 5C46F 2DQ4A 1G8PA 2BE7A 1L8OA 1O94D 1N2SA 1QLHA 3F3SA 4G25A 5BNIA 3CYFA 3O73A 3TN7A 1E2HA 1HE8B 2AUMA 1EFTA 3N2KB 3REGA 4BMCA 3E9ZA 4Q15A 4IPTA 5FNVB 2OA0A 1N1GA 3OM8A 2Z8YM 4GPAA 4BX8A 3FG9A 3TYXA 3GLIA 1PG5A 1OHHA 3LDUA 4K2AA 4EF6A 1CJCA 2R7LA 3I45A 3JAWB 4EL0A 5LYJB 4ZOLA 1IOWA 4XI9A 2G9VA 1HOTA 1CUCA 5EZ6B 2QPOA 3KPYA 2C7QA 1ULSA 1GNQA 3FYCA 3V2IA 1U0FA 3PITA 3C5EA 5COQA 1SEVA 2OV2A 2UYOA 1ZW1A 5AHWA 3F1LA 3ZXSA 3VKFA 5J2TB 5L6LB 1BDIA 4C5AA 1SXGA 3IP8A 1BJTA 4DM4A 3THYA 3C14C 1HT1E 3PKJA 2WF8A 3FH0A 1GQ2A 1GRNA 4L95C 3OPYI 3L82B 2IU3A 5G2OA 4OH7A 3WLTA 1G5PA 6YASA 5L6MB 1WDTA 3NAZA 2PS9A 3LHSA 2BTEA 1VCMA 1ELOA 2JGJA 3LLMA 4R2IA 5A0FA 4QPNA 1NNLA 1XU7A 2AK3A 2O3JA 3NIWA 1E3QA 1W5TA 3PLRA 4L07A 1W30A 3SAJA 3WAGA 2CUZA 4MYDA 1B0UA 3WDMA 1Z8DA 1WAMA 1MVOA 3FYHA 1OIVA 3H5AA 3T3GA 5JNRA 3I92A 3ZV4A 3A1FA 1Y9EA 5F4BA 1XROA 1FRNA 3D4OA 2J9GA 4BMPB 5BWCA 3AK4A 1W0KA 3C8DA 4JDPA 2VJQA 4COOA 2XQIA 2HMUA 3GA0A 1DNPA 2AWOA 5DEIA 4OYHA 1ID1A 4HOYA 1CF9A 1XZCA 4KK4A 4EPYA 1TF2A 4O4JB 1OXUA 2RGUA 2EEPA 1RTTA 4DAEA 3Q7PA 3TOCA 3QX9A 1G5RA 3HMQA 2R3SA 4HWTA 2XDWA 4MKHA 4U2BA 2Y1GA 3M9XA 3MLEA 4FNOA 3EOZA 1O97D 2ZSKA 3TKAA 2OB1A 5I7SA 4IDEA 3LWDA 5HRAA 4LISA 2VSOA 3IE2A 4C4YA 3BXOA 3TDMA 3V4VB 6NULA 1VHQA 4AJ9A 5KHLB 2JBAA 2QRPA 2IP2A 3D7SA 2IX9A 3NIFB 2O0JA 2FPMA 1M2VB 1G5HA 3LPAA 1DV2A 3N7TA 3TW8A 1DRUA 2AI2A 4GP9A 1CRZA 5T67A 5M34A 5PGMA 5KQRA 3GARA 4D02A 1R9JA 1ZUD1 3NIBA 3TZEA 3HWX1 3ZW8A 1W1WA 4E1VA 3UUEA 2OFPA 4B83A 4U7DA 1YF3A 4ID9A 2I67A 5AW9A 3WRWA 4DVGA 4K26A 2P5TB 4G9EA 4QFDA 1C1DA 1QHSA 2FCRA 1WBDA 1RZ3A 3CCBA 1SCJA 2YJTD 2C4VA 2YYZA 1FS4A 2B2XA 5TQJA 3B2EA 3MG9A 2OGSA 5FUMA 3GLGA 4KLNA 1U31A 2HVGA 1JEAA 3OOWA 1JR3D 4IDAA 4LAFA 1IB6A 4NYIQ 5I9TA 4I9FA 4I99A 5IAJA 1J8DA 3N7AA 4OBXA 3DKIA 4UMFA 1N2HA 2I1LA 2YRFA 2MSWA 2ZIGA 2YL2A 3AUTA 3B1VA 4KN8A 3I34X 4CQLA 4DV7B 1D03A 1ZRHA 5K3EA 1XD2B 1JEDA 3AJRA 3E1SA 3MUFA 3PG5A 4I6GA 3TOVA 2FTKE 4B6QA 3ENZA 3MTBA 4NJEB 4G09A 1DI0A 1YONA 2PH7A 3H3XA 1G16A 1DOHA 4AY6A 1EFUA 2VDPB 3LGAA 5A5VA 3UBTA 1FSFA 2GZ2A 1IPFA 3RASA 5I48A 3KQPA 4JV5B 1Q2XA 3GA7A 4QBGB 3GVHA 5I4BA 4TYWA 3HSYA 3H8VA 4TWRA 5TF0A 5FPQA 1JDZA 1YL7A 2EKDA 2QXTA 4KE6A 5EKUA 3VHXB 1FXWA 1IOVA 2WSIA 5BT9A 3QVWA 3H3FA 1ES9A 1I3NA 2HIAA 1JHXA 4TTQA 1NWCA 2ORWA 1Z17A 1V7PC 1VPEA 1ZUNB 3G1WA 3KTAB 1YCHA 2Z83A 3R0ZA 1TYZA 2Y99A 3C1TA 4D8XA 1ZWKA 1YRAA 3FNGA 5DYTA 2AA3A 4I1UA 3C97A 3DFUA 4MP3A 3LWNA 3U4DA 4FVTA 3PNQA 2BPOA 2DSTA 2VHJA 1OGJA 2GYWA 3JALB 4G97A 4NBRA 4N3BA 3W2FA 4ZVLA 1SZPA 3NB0A 1G18A 2D1TA 1WDKA 3BXHA 1R1DA 2OTCA 1NLZA 3KLPX 4CF7A 1HDZA 2PX3A 3V7UA 3TLGA 5LNK6 3BGOS 2IGTA 4J2OA 1VL0A 1ADBA 1P9RA 2ZSFA 3MIZA 3OAAD 3PNYA 4DV6B 1UR5A 4A0FA 1E63A 1E9CA 4ZQCB 4PR0A 3K6SA 5MDHA 2JLVA 3AFOA 1UMBA 2C5AA 1Z5VA 1IN7A 4OP2A 3TLYA 4CKCB 2O57A 3X1ZA 3DT8A 2VEDA 3EXFA 3FGPA 4CCYA 3KCNA 3OP4A 1FYDA 2PL1A 1W4AA 2QSJA 3GAAA 4I4LA 3EEOA 1F1BA 2OFOA 2X8AA 5IJ9A 2IYRA 4ILEA 3PQ4A 1SCAA 5DHAA 1PGPA 2E4UA 2I7CA 3U7HB 3EA5A 4TZTA 2D4AA 3AY7A 5ADWA 1ZVVA 1EFDN 4EB3A 4RACA 3RB8A 3M89A 2PO7A 1EUDA 3GGPA 3AYZB 1DAEA 4RYLA 5FBWB 2H1VA 5FTNA 4KQGA 3N0RA 3MMXA 4RD6A 4C0XA 3ZCVA 4IG4A 1XRJA 4NV1A 3QEBZ 2FOIA 2CJWA 2F1OA 1KYWA 1T5OA 2ZJFA 1WEKA 2C3MA 4GLBA 5GJVC 4D8TA 1IVYA 1IBLB 3HPRA 1NDHA 3IP6A 4DUGA 4DA8A 1CUWA 2YV2A 1FRQA 2NTNA 3L84A 4LMPA 2QTHA 4F7WA 2JVKA 1XZDA 3Q8WA 1G64A 5AW4A 3O83A 2DT8A 5LMUB 3A1VA 3H2KA 2MINB 5U9CA 4G3XA 4MQ5A 1VMIA 2ZSDA 5HGXA 1HSOA 3OZRA 1PNOA 1YR8A 1E66A 5FHRA 5JADA 3DVLA 5LQRA 5G4KB 4R4JA 2OUIA 3WTCA 2W8BA 4F6RB 3L4JA 1KI3A 3OFND 1W19A 3RABA 1VIAA 4ER7A 3KOYA 1QFZA 5DCYA 1MB3A 1XMVA 1Y9JA 4D57A 2NO0A 1HDGO 1XVUA 3FDXA 2ZBDA 4UCQA 2E4VA 1J24A 5D2CA 4XOUA 5L51A 2JLWA 4D9NA 3O4IA 3D7NA 2JJQA 4UNQA 4UNPA 2R7KA 1K8QA 2I8LA 1EXMA 2QLJA 3KUXA 1ISHA 2QEQA 1MEOA 4QGHA 3ZHYA 5LBTA 2W6QA 2X1VA 3IQZA 2ZB4A 3ER6A 4MVJH 4C04A 2JB9A 4KNYA 2W4QA 3LDFA 4IXDA 3KEGA 2ZBVA 1ULZA 4CDRA 3S2UA 2QI9F 2QN8A 1Z5GA 1UBEA 2CHUA 2VT7A 2QS9A 3BL5A 3NS7A 3P9KA 3V55A 3WK5A 3ND9A 3IBFA 5DRYA 3HU3A 4QTXA 4V0MA 5EWMA 4ATNA 4DCGA 3R4CA 1XQ6A 1H9BA 1U8FO 2P0EA 3D3KA 1PDVA 1YRHA 4O3FA 2IV7A 2P4HX 3GUYA 4F96A 2IH4A 2G8NA 3RJ5A 1N4DA 2X1MA 2GJ4A 4KGXA 1U1EA 5DNUA 1H4QA 3SP1A 2XGMA 2I3AA 4JB8A 4MR9A 5BSTA 3COPA 2FUKA 2ODAA 3KXLA 4ITVA 2CE2X 1G8YA 4ZT6A 4DG5A 5JJ5A 3HBJA 4KX3A 2PD3A 2KSQA 5LKRA 3F97A 1AKEA 1Y7PA 1YS4A 1YGPA 4QSMA 3AR3A 5EGSA 4A2CA 1VJDA 2ERXA 3E53A 1E8NA 4BRZA 3DKKA 2YWCA 3KLNA 2Z5FA 3OEYA 4QYWA 1ABEA 4TLDA 5K0JA 4DLBA 3R6LA 3PPIA 3U7GA 1RQ7A 2BUBA 2EX0A 3GQVA 5LZ7A 3SYMA 1S5PA 4R16A 3BDAA 1G3MA 4NLLA 4KXUA 3X2EA 3MJTA 1ADGA 1EFKA 1VCNA 1V95A 2CXPA 3FWHA 3WBFA 1ECGA 1EXVA 1WB4A 1M34E 2JFYA 2PJDA 3ONWA 2DHQA 2BDTA 1KO4A 3O2QB 1QANA 2J6HA 4Y1FA 5KQPA 3NTVA 4AYXA 3GP3A 3FKQA 1ZRSA 4M9ZA 4U5XA 4QM6A 1JFRA 1NMEA 4GRIA 3TRFA 5ARBA 4OATA 2C1ZA 4QZVA 3ZJTA 1NUAA 3RKRA 3QLVA 1L7XA 2ZI4A 1KP2A 3PQ7A 1FFWA 4QTYA 4Z2AA 1YJAA 5J58A 1U9IC 3UWKA 1HT2E 1TC1A 3BXXA 5SV2A 2FU5C 4A82A 1K1EA 1TUBA 2CF6A 3SHQA 3UB4A 3KT3A 1OZHA 2G5GX 4AJIA 2BFBB 1JJBA 4YRGA 3CUKA 3THXB 4P5PA 5EGNA 5JAIA 2NVUA 3H5RA 1T8UA 3MT0A 4G5OA 3SF8B 5B2FA 3GPDG 2HJSA 5CM8B 1Q14A 1GFIA 1A7JA 2CWDA 3CF6R 3H04A 1U8CB 2QMUA 4AULA 1A7KA 2A0XA 1S3IA 4IGAA 1GNSA 1XKQA 2OAEA 2P4SA 2IE0A 1COWA 3C1UA 3FX2A 3ROEA 1AXRA 4GC5A 4ZZ3A 1ISJA 2OQ2A 1DJQA 5CJJA 3O95A 3LDHA 4Y2XA 3KYIB 1BFUA 3G6KA 1XCLA 3WSVA 1NUPA 1T9GR 1Q3KA 1G5FA 1LEHA 1N2IA 2PX2A 3GQBB 5HBGA 4A8HA 5JMTA 3U61B 2GB4A 5AQ1A 1FMTA 2WIAA 3MILA 3OLQA 1W1IA 4EMUA 4WZBB 1O6BA 2AZDA 4I1IA 3QKSA 4PLZA 2ZBGA 3W06A 3DLHA 5EYPB 3T1OA 4WBNA 1EK0A 4B79A 3PQ6A 4I7EA 1JLSA 2COUA 2NXJA 1KAGA 4Q3AA 1XPOA 5EL0A 1GNTA 4EIWA 1HURA 4YRNA 4WESB 4X61A 3EBLA 3PHBE 4WCFB 5KAPA 2GK6A 2VWPA 4FBGA 3U6BA 2ZZKA 2BJHA 1MJ5A 1DWQA 1EWRA 4WGGA 2PEZA 4FMPA 3SQWA 1OLUA 3LPCA 1ZCZA 4X8MA 5J2UB 1RXVA 4LF4B 3FZYA 1NLMA 2HPAA 3L0PA 3UOAB 4S2EA 1PFWA 4EY3A 5K0CA 1ZIPA 4QGSA 1QMGA 1GA1A 4AY3A 4UM9B 4YXWD 4GBGA 3TRDA 2FR0A 3V2HA 1PGOA 3MMPA 2QAGA 1BVYF 1MVLA 2C4UA 1XCOA 2QU8A 3EZ9A 2IYNA 4R1MA 2Q1SA 3VPGA 1RVV1 3PF9A 5HFNA 2VA9A 3HJRA 4RJIA 3SYTA 1JKXA 4BRUA 1TVKA 1NSYA 3MINA 2ZUCA 2OBMA 3OA0A 4JHLA 5ESRA 1QTQA 1SVSA 1JZTA 1TRKA 3U49A 2PRSA 3RV3A 1JZQA 2J9XB 1ZSVA 1G7RA 4C7VA 1IHYA 1ML4A 3PK0A 4CQMD 1CZLA 5A4JA 1JFSA 3N6XA 1KDOA 1E6CA 4MP6A 1E3WB 2JJYA 1P39A 2VSYA 1BDMA 3D4LA 3H83A 4L9WA 4FXPA 4MQEA 1HK7A 4G23A 3S6JA 4M83A 1YVPA 1DG3A 1ZC4A 4OQZA 4NABA 3RWBA 1P1JA 1YU6A 4O4IB 5E1DA 3SIXA 4GUAA 4IBOA 3LQRA 4F2GA 4BFSA 4DJ5X 3TJRA 5BUCA 2Z2IA 1YS2X 4O2LA 5K9ZA 2JNWA 2Q3DA 2Y3IA 4R7GA 1FA9A 2BGJA 1PK9A 3PI7A 5I6DA 1NRWA 2CXSA 4QXMA 4WX2B 1QK4A 4AROA 3P4XA 2FPLA 3UANA 1G8FA 3PJDA 4OUDB 3G59A 6CHYA 2PZGA 1ATIA 4RTSA 3SZRA 3G9TA 1Y1TA 3TLMA 4YAWA 5BSKA 4LX8A 1QH0A 3PR1A 1AK9A 2E5WA 4H7PA 3ELYA 4RD0A 3MQ2A 1MR3F 1NNI1 1TW2A 5EP1A 3HI4A 4MWBA 2O2SA 4BQEA 4KXWA 4A03A 3RSLA 1C7QA 1KZ1A 3PE3A 4N0EA 1S4MA 2VDJA 1RLTA 2GH1A 2NACA 3KQTA 1OLSB 2VG8A 3QBJA 4D3FA 4DSUA 4ZCPA 4EW6A 4ZCTA 5ABPA 5IF3A 1XHFA 1QCZA 2TMYA 3PD1A 3ESDA 3GGCA 4ZQBA 4BLQA 3RTEA 3ACDA 2XJ9A 4FM9A 3FSGA 3M1LA 3D3JA 4F3CA 3NHAA 4U7HA 3KPUA 3II6X 4M1QA 5ED0A 1GPH1 1KI7A 3F67A 1E0JA 1K5PA 1F8UA 1PBNA 3K0KA 4DYHA 1B6SA 4J1NA 2FEPA 4UC0A 2PGJA 1MIOA 3MYRA 3QV1A 2D7DA 1QTNA 1JEYA 3LXRA 1GGNA 3GFPA 5CEEA 3QZUA 1I3LA 3K53A 2B30A 2R8RA 5CAEA 2HN9A 3MCZA 3ITDA 3OZTA 3Q88A 5EHQA 4EJ6A 3SKXA 1SHLA 3OZSA 5IJAA 4KOEC 1Y8ZA 2XNSA 4AI6A 2HIHA 4X0EA 2B2CA 4P92A 1WY7A 1TTQB 4XYLA 5EUMA 3R8XA 3G5UA 2YZMA 2GESA 1DLJA 2K87A 3DEAA 3UUWA 2XMGA 1N78A 4S1WA 4PNPA 5K0BA 2IXTA 1N3IA 3GGDA 4D3XA 4KGDA 1XL0A 3B3JA 4A36A 3NJ4A 1C9JA 4LFBB 2R8XA 2ZIUB 1FX1A 1KKUA 4HQLA 1M8GA 1Z2CA 3LKZA 2ZYGA 4Y6LA 3HXOA 1N9KA 3CT4A 4A26A 1N2CA 1FS6A 2FFAA 1KPGA 4OQXA 3M3HA 2YHBA 2QNIA 4P53A 2XGJA 2FR8C 1ZJJA 5KNCA 3GJ3A 2MIIA 1PBTA 4JA0A 4DXDA 2X0FA 5C8ZA 1QV6A 3GNTA 4IJQA 4QXPA 1PJRA 2FUSA 2JJ2D 2H07A 2ZUUA 2J9FB 3A9CA 3C8UA 2FW0A 2YW2A 3ET5A 3GLTA 1CW2B 2GTIA 3H16A 3H2HA 3IURA 4K40A 3SVTA 3GJSA 1C8BA 3IOYA 2OBNA 1CE8B 5H4GA 2A1UA 5DBGA 1KJQA 3BREA 4KOAA 1TUEA 4MVWA 4TPKA 4YCNA 3LCRA 3EGVA 1XXHE 2BFFB 4EUKA 1FLAA 5I7VA 1NDQA 5SYAA 3QBVA 3A3PA 1ZUWA 3KALA 3ITNA 1CC1S 3EY9A 1L4MA 3D4BA 1T2AA 3BE5A 2J1LA 3G89A 4LWOA 2O7NA 4K9LA 3I1FA 4LJLA 3UMMA 1T2VA 3GBSA 3KB6A 1JKMA 1HQKA 4IMIB 2O8EB 3DBLA 1CZNA 1I14A 1N1DA 3DW1X 4E5KA 2CDCA 3K4HA 4AYWA 3RUFA 3LY8A 5B30A 2RH5A 2YVQA 1F2UA 1R2QA 4J4TA 1OI7A 1FVFA 1KSGA 1JAXA 3OCJA 2GGSA 1W6UA 1JNXX 1FUEA 1RWMA 3LUGA 2PTRA 1JFLA 3ZVRA 4CDMA 3W78A 1XTRA 1YKFA 3FN4A 5GAJA 3T61A 1P7VA 1G21B 3KKPA 3DJFA 5BR1A 4CIDA 1YFLA 2G0AA 1DAHA 4Y7CA 5KVVA 4J90A 2VNSA 4OM7A 1KI6A 3WGUA 5GONB 1CY7A 4C6TB 2W2MA 4D1YA 1GCGA 3AZOA 3HCPA 4M0FA 4N3CA 3ADPA 4RD1A 1CX9B 2VJMA 2HRRA 4JWTA 1XCMA 2R751 5DF1A 1EZ4A 1R4MB 3H9GA 4LRXA 4ND1A 1KZ6A 2J31A 3RTBA 1RBQA 4L16A 2DBVO 4Z51A 4JLSA 5FAXA 2HA3A 3HBAA 5I7WA 3LUFA 1ISSA 5C3UA 3ZK7A 1L4GA 2B5VA 2EV9A 2E82A 2PH5A 4JFAA 2RCNA 4ZOQI 5IVIA 1MN6A 5KSYA 2BFMA 4HYTA 4TS4A 3OMLA 3OUTA 4Y2JA 3H0KA 1FU4A 2V98A 4YH1A 3IUJA 2EYUA 1H05A 4I36A 3AUKA 5AR1A 1F06A 1XRNA 2BMAA 1NKVA 2R9VA 3KG2A 1L7DA 2JH8A 5JC1A 3PHIA 3U9TA 3PX7A 1CLUA 3L46A 2QIOA 3WVNA 1SVMA 3UPUA 4YJHA 2ZSHA 5IVKA 1USKA 1N6NA 1FIUA 3X1KA 4AKEA 4ZT2A 2WYOA 2R85A 5FBLB 4AP6A 2W2OA 2C94A 3BRWA 3CE6A 3I9JA 2O1WA 2BW0A 3IESA 4IWXA 2AEEA 2HCJB 4WOCA 3K2EA 2QUKA 2YQ4A 4I55F 1JQJC 5TIIA 1EG2A 5JMPA 3X2FA 1FFXB 3WSTA 3H5NA 2IGBA 4ZEOA 3EZYA 4BNXA 3B6EA 1TVEA 4YUZA 1H3EA 2IS4A 1RAIA 1NM5A 4Y2GA 4BMYA 4YRBA 2QTGA 4NZPA 1Q0HA 2Q8PA 3G88A 4RPCA 2JLUA 1JBKA 1XQXA 4DSNA 3KZNA 1J0CA 5EPOA 2EATA 2AFIB 4GLFA 1SKUA 1W94A 4F1WA 3RVKA 3L5OA 3QBEA 5F78A 1GGVA 4MV7A 3B2NA 3L6OO 2FVXA 4E07A 4FQ8A 9ATCA 2OBXA 4HDOB 4Z7OB 1VCIA 2RGGA 2G70A 3I9V1 1W49A 5CNMA 5HX7A 4O4LB 3GP8A 1GNPA 1R8YA 2Q0QA 1WWKA 4D97A 1SOMA 3OLWA 1NG9A 1N6OA 2GFIA 1N2ZA 3W8DA 2GBLA 4MZXA 5HFAA 3W2IA 1KDVA 3AVYA 3H19A 4B44A 4BLRA 2R8BA 2PVSA 3IHLA 3ZU3A 5A4KA 1F6DA 1XAGA 3CR7A 5E9QA 1DUVG 1E6KA 1RM5A 2HTFA 4KXVA 3UHJA 1QYDA 4BUJA 2Z1NA 5K0ZA 3BTUA 4XDZA 1NR1A 5FWDA 1YJQA 4D9GA 1L5ZA 2JLCA 2VF4X 1JJAA 2A30A 3ODPA 2XUKA 1M8KA 3JQ7B 4N6NA 3L40A 3Q3EA 1UEIA 2ZUBA 3NETA 3ZJUA 5CRIA 4Q01A 3TX2A 1T0PA 5BRAA 5BWMA 1FMJA 4FQ7A 1VE7A 1TU4A 1C0IA 1TQ2A 3B70A 4XWAA 1Q3HA 1AB6A 2A4MA 2COKA 3TDNA 4B3TB 2G07A 4KVGA 4XIYA 1GKLA 2OO5A 2VK2A 3EA0A 3LE8A 3BMXA 1GU0A 4BZXA 2CEAA 2X40A 3O4VA 2VLBA 4WXEA 1V1RA 2C61A 3AB8A 4MPDA 1KQNA 2G08A 2WP8J 1WG8A 5EI5A 1EK2A 3AINA 3W7BA 4W1RA 4HB0A 3GRYA 4EVQA 5HDBB 2EJUA 3W5JA 1KK2A 4S3MA 5BURA 1UP7A 4W1SA 1P0IA 1RZUA 4IILA 2QW1A 2VYNA 4KMSA 5A0TA 1E64A 3VQTA 3KSZO 2P27A 5HCNA 2Y77A 4LJYA 4YP0A 3CF4A 4MQ6A 5ESXA 2ENUA 2Y4NA 3KZCA 4YUVA 3GCWA 2ARKA 4YLYA 2PFKA 4JLJA 4LOIA 3LY9A 4B6OA 3JQFC 1LNSA 4EHLA 1QQ6A 1UJ6A 3DHVA 1SZCA 5IBQA 2YJ3A 5HXAA 2D5LA 3G49A 2AOVA 3AVPA 4QQNA 4BYGA 1SUCA 2EP7A 2OCLA 3NFYA 4IJVA 2J5KA 1OA0A 1NRXA 5DOVA 3I12A 2FH5B 1EIZA 4LJSA 1TJYA 4JB0A 2BN4A 2CNOA 2FPRA 1QGOA 4HEA1 2DUUA 3N58A 1K06A 3VUEA 4B75A 3HBLA 2Y0EA 1RACA 1ULBA 4MW4A 3K6RA 3DEZA 2P9ZA 1UAAA 4LV5B 2NO1A 2W4MA 3KPVA 3PHGA 4NWIA 5HE8A 2V7GA 4YPFA 2ONKA 1EAYA 5HS4A 1JA0A 3KOZA 4CDGA 3U4QB 2J8ZA 4J9VA 5K3FA 5C8DA 1TKCA 3AUUA 1LWNA 3M4XA 4DRYA 4I2VA 4MQUA 2R2AA 3G79A 5DNYB 4QDOA 5KNBH 3RAGA 5B1HA 1NXWA 3VO1A 1W52X 4P6VF 4CL8A 2NXWA 5D5HA 5DHFA 1QKJA 3KHUA 2AZTA 3KHTA 3I9MA 5GOZA 3FMGA 1ISFA 3F71A 3HN2A 3PYMA 4IF6A 4BVHA 2F00A 1EFLA 4LY6A 4YMVA 4F92B 4HNSA 3RH0A 2VJDA 3QX3A 2FX5A 1RIFA 2EAUA 1L4NA 1THMA 2O2CA 4NONA 4RHXA 4YVFA 1L1FA 1Y1PA 1T0IA 1GPKA 4O33A 1U2SA 2WQ7A 3F5MA 4EA6A 4F0JA 1OWPA 2H1WA 4RFSB 2X9QA 4TLCA 4YP7A 4UPEA 2CLMB 3KETA 4DIEA 4F56A 1K7EB 2YVKA 5CK4A 4RZIA 2CMDA 4YAOA 4MKIA 2B69A 4PHHA 4AZSA 3BIOA 2CC2A 2ZIFA 4LOAA 3AG5A 4X1IA 4QWWA 3IJEB 4MVCA 2WMYA 5LBIA 1MFZA 4FONA 4TLLB 2O23A 3U4AA 2V58A 5ADUS 4MOWA 3AF6A 2I6SA 3IP3A 1LPBB 2HJVA 5T64A 5JW6A 2B2NA 4TKVB 4FOPA 5ICGA 1DIAA 3QPBA 2HWUA 5KNDH 1LC3A 1U0GA 2I2BA 2FWNA 2QZJA 1HL3A 4NSLA 2FW8A 4MIKA 3VJRA 3FSRA 1O94A 2QYTA 3VH4A 2QLBA 4JQSA 3PUZA 5COBA 5CXSA 1PL0A 1MUUA 4I4IA 2BMWA 5BPHA 1QHGA 3HFRA 1FDTA 4IIJA 1L6RA 1X42A 3LNCA 2EIHA 4HAWA 4CFSA 2GLXA 1GGKA 4LBVA 3NOVA 2F7SA 3QU2A 4IFIA 4NBKA 2K4MA 1NAHA 3TVYA 3PE4A 2IPAB 5G40A 1QRTA 1N2JA 3H6KA 3AHEA 1LCIA 1ZITA 2J0UB 1YDEA 3WS7A 4YRZA 4J4BA 4N18A 4ZTZB 1TA0A 2OZVA 1C7JA 4F85A 3ORYA 4FB4A 2UUCB 3EFBA 4R1PA 3QE9Y 2C3OA 1H0KA 2QNRA 3BEOA 4OLHA 1G5QA 2CBXA 3JQBC 3QXGA 2YFHA 5CNIA 1N3BA 3W7AA 3FCYA 4HS4A 4OU5A 4XYGA 2RGWA 1IUPA 1QYXA 1R0ZA 1JSZA 3BSSA 4OFBA 1QH1B 4TMXA 1RPNA 4DZTA 1PNRA 3QNUA 5BMVF 2X14A 4UUPA 3L0DA 4UCFA 4OHFA 4YEDA 4EBBA 5KKCA 3WYCA 1JU9A 1YQUA 1DAOA 4ZI3A 1AHPA 4KHZA 3DZIA 2GO7A 2CN1A 5D85A 5EJMA 2XT9A 2WIBA 3QF4B 4PO9A 1LDGA 5SZIA 5DTMA 1SD2A 1EVEA 3VKUA 1YRWA 1U0OC 3OZ7A 1NW4A 2BT4A 4YJ3B 1KJNA 2ZXEA 4JR1A 1Z74A 5FBQB 4E2WA 4RA6A 1AQLA 1O58A 1QX3A 1T2FA 2J9YB 3ZC3A 2H1RA 1THGA 4MR7A 5DLYA 4QKQA 1Z0KA 3T52A 2ZJ1A 3IAUA 4PIVA 3L07A 3F9CA 1M7GA 1R8JA 1UK8A 4HO1X 5FXMA 3W8RA 5AKJA 1GL6A 1JXQA 1NXOA 1GFWA 3IKTA 1N0VC 4FCVA 4LMBA 3ZWMA 2NO7A 3KTDA 2PKQP 4BGUA 2ID7A 3ZY5A 5DM60 2X86A 4O3MA 2XKKA 2I80A 4C03A 2G36A 3LFHA 4QUBA 1U5CA 3JZIA 2BFDA 3SBDA 1JWAB 4HVCA 1USWA 1VYHA 2W83A 3SNKA 4MWCA 1ZNZA 1ZGHA 2JD0A 2LD4A 2PRYA 3HVJA 5JSKA 1OOEA 2GLTA 5HKLA 1MZVA 1Y4SA 4MVXA 4B4UA 5BR4A 2AYZA 2QG6A 4YDHB 1OH5A 4O0LA 4UBNA 1LPNA 2NLOA 3DPSA 4HWGA 3B8EA 1CUBA 4TKUB 1P1RA 4JI3B 3NHYA 3NAGA 4DMRA 1QTIA 2LBPA 1C9KA 2GJSA 4OHVA 4JELA 2PU7A 5HIIA 3SJ7A 3JPYA 1D04A 3Q8KA 3SZLA 3VH2A 2RK3A 3BA6A 4RF2A 4X1OA 4X3PA 5E9WA 3TQSA 1PJQA 3OPQA 4JITA 4EFNA 5HF5A 4GI7A 3IRVA 4UBKA 1X7ZA 2FUG1 4EUNA 2PV0A 3F4SA 1HV8A 3AEKA 3TLAA 5ALDA 1YI0A 3AV3A 1BHJA 2IXBA 5LYYA 3BH7A 2RIPA 1JR3A 2V54A 2R00C 1Z7GA 4EPXA 5F98A 3TZBA 1UXHA 4PX5A 4CTKA 4DRXA 2O48X 4H27A 2RGBA 1FX0A 4U00A 1Y5MA 1V9CA 1N7JA 1YBFA 2G5CA 4A5OA 4B87A 1M7BA 5KTNA 5HQTA 2RC5A 2DZDA 2WMNB 4XFJA 4Y6SA 1EHYA 4BLPA 3RC1A 4IS2A 4WY8A 2Z5VA 1YA4A 1L5VA 3AM3A 3GLSA 1APBA 3HKDA 5FPYA 1DT5A 4URFA 2XNCA 3OQJA 4NJMA 1JG6A 4R51A 3WG9A 3A2KA 2YFQA 1JVNA 1EX9A 4XPIB 2GWRA 1IM2A 2WFLA 3AKCA 3WMRA 4S2UA 4TV9B 3A1DA 1SPBS 1VDMA 2GBPA 1T8RA 1NTRA 1IY9A 1RJDA 4MV6A 2O2IA 4PPGA 3O4HA 3Q5EA 5L7YA 1DHTA 4LG1A 1YMQA 621PA 2XAUA 3BG5A 3NHSA 4RCZA 4JUAA 4E4RA 1PS0A 1HDEA 3DHNA 3A11A 1R27A 3QKUA 2VUSA 3DEHA 4P4GA 4ISBA 3C98A 1I51A 4II7A 4MRMA 3P1JA 4YBRA 5ILGA 1OPRA 1U5BB 3AUYA 3H1GA 3P4UA 4ZCSA 4WN9A 5HDQA 5JUWA 1GG9A 3N2YA 4QYMA 2AD5A 2NADA 3W79A 3AW9A 1YFMA 1D4ZA 3BXEA 2HJGA 3CPEA 3FDFA 1P73A 4QXOA 2E5LB 1UBRS 3ACBA 1TZJA 1BJKA 1X38A 1HY1A 1A88A 1LLDA 1NLFA 2OOKA 3HSKA 2CNKA 4JLOA 3RHTA 1TJ3A 2C5FA 3GT0A 1LTKA 1REQB 2A94A 2BGMA 2R6DA 2Y1KA 3EUFA 2W37A 4K3UA 2XZTA 3O1JC 2H4ZA 3ZCRA 5CDTA 1KL7A 3HYCA 3OAAA 2OYRA 5CXQA 2X41A 2GZMA 5BVGA 2P6MA 4F4IA 2YWGA 3X0DA 2HNKA 3KSAC 2A7XA 1CK4A 1RQ2A 2P2LA 1BEEA 3I8SA 2GHIA 4N9WA 4AJHA 5AVOA 4HNQA 1SUFA 4HAUA 2WWGA 1Z4NA 4ADMA 2XUAA 4ADSG 1CJBA 5FWXA 1E7MA 1Q50A 4MYHA 3JYOA 4ZICA 5AW2A 3CEHA 4P7KA 5T41A 3TSYA 2RB5A 1N8KA 3KKLA 1XDBA 5DMHA 5TQ0B 3DQZA 4EG8A 4NOLA 3FUUA 2HK6A 4JC5A 5CITA 3TECE 2JDID 2NN3C 1UXJA 3BH0A 4MUIA 5GPBA 1P6QA 3NCHA 1GCOA 4CV2A 4CKBB 2A2ZA 4RZUA 5TQVA 1CJTC 1RPTA 2LDXA 4HDQB 2ZOSA 4FFBA 1R6AA 4WK0B 3WIOA 5I01A 4L8GA 4UXJA 3LX6A 2EXXA 2HF2A 2YIJA 4M98A 3IO5A 1HF3A 1HETA 1PWHA 3LA8A 3O26A 3PYXA 4RV4A 4BL5A 3EYAA 1ODKA 5G0TA 4GYKA 4CMIA 3PDIA 4WZ6A 1AV7A 1P1CA 1T3LA 2P2CA 3AGQA 2PBFA 3HWRA 3A4YA 3H5IA 4JT8A 2QVZX 4K6OA 5D8DA 3WLOA 1RW4A 4E5NA 1G4HA 2ZPAA 2BTQB 3OWXA 3GIWA 1QQTA 3L04A 5EJ4A 5E1MA 4YLGA 4FU0A 5I9NA 1G2QA 2JIPA 1SOAA 2O8BB 1GPNA 1UEXC 3BM5A 3OVMA 4G1EB 3ZKAA 4LF7B 4R05A 1MOPA 4JJZA 3OFNA 5TRTA 4BO6A 1LI7A 1LTQA 3ONVA 4NFHA 5FLYA 1OW3B 1PT6A 3O5AA 1FNDA 1FQOA 1FUUA 1E69A 3ND8A 4K88A 4OGWA 3UATA 4ZO9A 1UWVA 1KS9A 1UPAA 3OPYB 1F2TB 3SJBA 3K71B 4LTNA 4QWMA 4P93A 2XV1A 1XIVA 4HMOA 2DH5A 1L4YA 5KCMA 4CFYA 5KTOA 3RAEC 4IMRA 4YK7A 4GGOA 2GO1A 2CF5A 3KV3O 2BEWB 4KAJA 1F6WA 3SJZA 1FLNA 3K09C 1VL5A 1EWQA 1JR4A 1KMCA 2W2VA 4MI9A 4L7VA 5REQA 4A0GA 4QXQA 3OF5A 4TN5A 3T3HA 5HR5A 1IBMB 4AX8A 3HWWA 1BU8A 2XWSA 4NYIR 5DOZA 2QXUA 4KFRA 5C80A 5JARA 1PU2A 4C5BA 3PGXA 5CVJA 3FYUA 3IOMA 2NM0A 2BFEA 5DX0A 1EFRD 1TJPB 5KU7A 3QEKA 3PHLA 4II2A 3QELA 3A9WA 4QLBA 3IT2A 5A9SA 1YI1A 2G17A 3OTGA 5AT1A 2P5YA 2BELA 5FQNA 4FXOA 3ZY4A 1SA0A 3PXBA 5JVDB 4AJ2A 3K20A 4V03A 3K8QA 1MJFA 1IM5A 2RH8A 4D9MA 1WABA 2B1IA 2IY9A 1KJZA 1I0ZA 5ECGC 1LRKA 4O4HA 5AVSA 5JS1A 4BLWA 2NTYC 4GMKA 2CMFA 2PXXA 3U17A 1HG0A 1LBSA 2A9JA 4RZ2A 3WK9A 4AD8A 1FTGA 3CEAA 4QDXA 4H7KA 1SRRA 2R47A 3WE7A 5AH0A 5K5EA 1UOEA 1TEVA 4NXNB 1QWOA 1RQRA 1C30A 4U8GA 4RULA 3WK7A 1L9XA 521PA 4V0KA 3RUIA 1X80A 1U7XA 4U6SA 3NLLA 5ELLA 3E04A 2GLUA 3LDGA 5FYDA 3QE4A 1R0LA 3EVBA 2JJ1D 1JALA 1ZZEA 5L3QB 3KB1A 1GLVA 5GJCA 4PYLA 4O5OA 5F64A 4MNTA 4PLFA 1B6TA 2DTEA 1H2EA 2RARA 4EX6A 3HEBA 3VSAA 1J0EA 4W5OA 1PQWA 4DQVA 2YWEA 3MK31 4R31A 4F46A 2NNLD 1DX9A 1N9ZA 2R4QA 3G1UA 1H0RA 4O25A 3A6DA 2Q27A 3VNSA 2F9LA 4UEWA 1XR3A 3WHLA 4BAGA 4QVKA 2RGDA 4L9AA 1ADFA 1VSQA 2ZAYA 1TX4B 2J67A 4P7GA 4RMGA 5EKTA 4C6SA 1F8GA 1UIRA 2P2DA 5JWHA 5C8YB 5I4IA 1B7GO 3AEQB 2E1RA 2P7HA 2PSDA 2Q9UA 4K6CA 3UMGA 1U2EA 3LC2O 4BX0A 1W88B 1QIGA 5LB4A 5JH7B 1QRDA 4U2KA 3DXZA 5DM2A 2Y1XA 1E4OA 5J4LA 3AU9A 3KYJB 3M9WA 1F38A 4L50A 2BZSA 1YHNA 4TOIA 4C0SA 5FBKA 5LB2A 3CR3C 4Q9AA 3K5HA 3KJQA 4BB6A 4Q7LA 5B3JC 2C0PA 3MCWA 4F3KA 5KX5B 3WRYC 4MGHA 3LO8A 3W1VA 2CV1A 1LTHR 3MXTA 4L22A 5T4HA 2PMEA 3MVEA 2D2XA 2NU7B 3OQ6A 2JGRA 1IXRC 5CMLA 3IQXA 4LGMA 3RYFA 1BOFA 1GQOA 1Q15A 3LHDA 4KHPB 1QJ4A 4N39A 4L76A 4DA9A 3B6KA 2AHOA 2ZAGA 3SOZA 1JW9B 2QTTA 2W2PA 1QYCA 1Y4AE 4JENA 5I7OA 5EIOA 1Y8RB 3LF1A 2Q28A 1R5NA 1Y7IA 3L6RA 4TV8F 4X92A 3LKDA 4IMJB 3ICQB 4MWZA 1Y7TA 3A6EA 4YXWA 1DELA 4BFZA 2YZ7A 3B85A 4IVRA 1NVKA 2FZWA 1QH8B 3M1IA 5FDFA 2YWDA 2OQVA 3WGKA 1P4SA 3OX3A 4JZKA 5IZ4A 3RU3A 4FWBA 1KERA 1PNVA 4CQMA 2V8OA 1SUDA 4PO8A 4PN7A 4P0QB 5T7BA 2EG9A 4ZYXA 5I3ZA 3G9ZA 4XVUA 1I3MA 1R9NA 4GQIA 3A2NA 4XX0B 1DEOA 3B1XA 4W99A 4HAVA 4C3UA 2PJRA 1E89A 1KSHA 3BVPA 1K6MA 2ZP1A 3L93A 3RFFA 3TTUA 3L3BA 3AM5A 5JIBA 2ATIA 1B93A 3FBGA 4MUHA 1GIAA 1I1HA 2K6GA 2WIDA 4QOFA 1RYDA 4PRYA 3EG9A 2X9GA 3RC2A 4BASA 4LSMA 3C5CA 4E5PA 1D1PA 4CTOA 2HV9A 3IHWA 3D7LA 4E2XA 5F76A 4LZJA 5EJ2A 3SU8A 3NRJA 2GRJA 3K5IA 3SC4A 1WB9A 3MJRA 3Q7SA 4LC9A 1QG6A 1L5NA 1HMYA 1PE0A 1RYMA 3FOFC 2A5DA 4UAVA 1Z62A 1BEUB 4RDHA 1AQYA 2BFNA 2QN2A 3GXOA 1AUQA 4OYYA 3F2IA 3DZ8A 2W6MA 2OBYA 3G2KA 3IFSA 2P79A 3CZPA 3LHFA 1U2GC 1X0XA 4XB1A 3B60A 3N70A 4H1HA 3UIEA 1YVEI 1OV6A 4KXYA 1FEZA 3K96A 4HAYA 3SDZA 3ISTA 1SCNE 1L5RA 1BXRB 3B48A 4Q1BA 3MSCA 4Q9LA 3UNXA 3QI2A 3W05A 4AF8A 2ACEA 5TDHA 5JPCA 4R5MA 4TVKA 2C5EA 3PS9A 4AX4A 1HTWA 2Z8XA 4KYTA 1MT0A 3V8BA 1DFGA 1DAPA 4KB5A 5BQ5A 1KDRA 1VJCA 4TUYF 2XB6A 4LF8B 1Z25A 3FMOB 3K9HA 3OFJA 3Q15C 4YP9A 4JI5B 3TXXA 4B6SA 3K31A 2ZUTA 1G2IA 4PLGA 3LUDA 1IJKA 2Y27A 3BS4A 3ABRB 1SBZA 5H0IA 3N2KA 4ZGGA 2GEVA 3K9NA 1PJ3A 2E4YA 3K05A 3UVEA 4E2ZA 3C15C 3GMSA 4F3NA 2R44A 3O4RA 3K0HA 4Q1AA 4B5KA 3BBPA 4KODA 1LVHA 1U0TA 5F52A 2ZRMA 2DWCA 1HM5A 3H9EO 3W5VA 5K0GA 1CS0B 4JK3A 3MW8A 5LYJA 3JAWA 4WACA 3QWIA 3GELA 2LVBA 4HWSA 4P0TA 4E2FA 2AI3A 5I8ZA 2EFJA 4AC9A 4A15A 4YJFA 4EY7A 2H9AA 4D4LA 3STHA 4EI7A 2WILA 5KB3A 4CM9D 3BJZA 2V6MA 4XYEA 2BFCB 2I99A 3T38A 2J3KA 4GMFA 3TLZA 4OJYA 4TTRA 5J2TA 1VSTA 2BJVA 2R87A 4GXTA 2QJFA 5HS6A 3QIAA 3DMNA 4BQSA 3OHMA 3K9QO 1U15A 3FRHA 1GUDA 4NCIA 3Q6IA 1RI2A 2CLOB 2JJ2A 2W2QA 2BLNA 2H18A 1UKVY 2Q41A 5DXFA 1E3IA 1NN0A 1JZSA 3HCFA 1PI3A 1WA5A 2NXEA 1M2JA 2NSDA 5L3VA 3WOHA 5D3KA 1SUPA 3JSAA 1JTVA 4RD2A 4A0SA 3A3KA 2ODBA 4OB8A 2HDOA 2WHYA 3EGWA 5FULA 4HN2A 4IGIA 3W90A 1W47A 2AJBA 3A8TA 4PAQA 4P4LA 4RXTA 2IHBA 2YBDA 4FOLA 2VK8A 4HQRA 1MAAA 3A25A 4POAA 1NJ8A 2ZI6A 1LJLA 1X15A 4IFBA 4F9FA 1S8OA 4CW7A 4R6XA 3WBBA 2IU4A 2GZRA 3CRNA 2AOUB 2V0CA 1ONNA 4WZAB 4UHFA 1FL9A 3ZZMA 2I22A 1YCGA 2WPNA 5HWSA 5HZHA 1HI9A 1OFUA 3KOUA 1RC8A 2CXQA 4O4JA 5FO0A 4MV8A 1YNOA 4A3SA 3D0QA 3DXFA 2UYQA 4M9XA 1W9MA 2GERA 2QAJA 2YZ2A 3A9UA 3NVAA 5L53A 3I72A 2CL0X 4PVCA 5IX8A 2A78A 1NBHA 3IP9A 3MGAA 4IIGA 4JZYA 2ZKLA 1TEHA 3LUAA 2YH2A 1WMAA 1PFVA 1RYYA 2DR0A 3OJXA 3QX7A 4QDZA 5FLEX 2PWPA 3U16A 1VECA 1XLVA 2YHIB 4HLUC 3GFRA 5CDSA 1MXFA 3P94A 2NXNA 1PSZA 3IL2A 1MB4A 1JJVA 3PQ3A 1B00A 1IW7D 2CLHB 3NP9A 1R6DA 4RSRA 2WV7A 3UJPA 5KYXB 2KWIA 1QU3A 5KSZA 1MEJA 4TXMA 3P5SA 3L7AA 2HJRA 2EWVA 4TLBA 1JJIA 4B6EA 4DR7B 3SHVA 1FMLA 1Q7CA 1YZVA 1XTTA 2J59A 4BUCA 2GD1O 1R0SA 2FFJA 4IM7A 3VU9A 3PA6A 1E4YA 2O0KA 3HZRA 2P3LA 3OOHA 1O08A 1H42A 1ZA1A 1ODLA 1E5XA 3OIVA 3V7YA 3I0ZA 4RK6A 3VMFA 3ZWWA 4S0ZA 4TTJA 4YUAA 2CNBA 2Y0BA 4GSYA 2E18A 5JAHA 3HKCB 4GXQA 3D4PA 3VPXA 2IH5A 3TDKA 3VRHA 2P9CA 5K99A 1D0SA 2EGUA 4QOHA 3CPHA 4POOA 5LQUA 1TTPB 1DC3A 2BFOA 3PDWA 5BNFA 3T7IA 2OHVA 4RHCA 2UZAA 3JYHA 5A9RA 1DIOB 2ZSEA 3RREA 5E7MA 1NR5A 1PWEA 1XD2A 2D2VA 3OEWA 2Z9BA 5AM4A 2AOXA 3C3XA 3LSTA 1FTYA 3EIXA 4J4HA 2IUSA 3NTUA 3WWYA 1JMKC 4NJEA 3QU9A 4HSEA 2G4VA 2AN1A 3UTDA 4I8IA 1ATZA 1NTOA 2PLWA 3CRRA 1RZRD 1ZO8A 3VR1A 5ERYA 3CHYA 3I9V6 1ZU5A 1A9QA 3IGFA 3AVTA 3VYUB 5EIAA 1W7AA 1P31A 1PV1A 1Y1SA 4XRGA 2B8EA 3EYWA 2I3ZA 3S1AB 4LJ4A 3DM5A 4ZGBA 4C01A 5KJCA 4IQFA 2GKGA 1DZIA 3DZKA 1YTUA 1J8VA 3NAMA 3WWPA 2UUAB 2XUHA 2PQMA 1X3LA 1ORRA 3B5IA 4ON9A 1GG2A 1AQNA 3OCZA 1RXWA 4TTSA 4P36A 1JBQA 3VHXA 4R1LA 1UFQA 3CF4G 3PNPA 5FPTA 1HQYE 1AO3A 2FQXA 2EJTA 2OAQ1 3T7RA 1Q84A 1ZG3A 2EHDA 5DX1A 1B14A 2H11A 4QU5A 1ZUNA 1U63A 3KTAA 5AM3A 1YIAA 3TXAA 2AEMA 1RRGA 1X7HA 4E1AA 2NZUG 2P78A 1SB9A 2QRNA 1Z2DA 5BSVA 2V5UA 1F4LA 3N2ZB 3JALA 2CDBA 4DKJA 2PFMA 4HG2A 3UAWA 3AI3A 4YECA 3FCCA 4PNHA 2OM6A 4H6XA 1Q1AA 3HJHA 3Q12A 3WYBA 3ADOA 3E5NA 2R79A 5FO1A 5ELXA 5E4TA 3TS1A 2PA3A 3TJZA 1IXZA 3PDHA 2A6PA 3L4EA 3CEJA 3HKBB 4XZ3A 3T35A 4CKCA 4ETIA 2X2FA 4QFMA 1L5GB 4YMLA 2XPCA 1ZI8A 5HFJA 2XY4A 3DAHA 5MF6A 8AT1A 1CQWA 1GPYA 2Z57A 5K6RA 4YCSA 1GTVA 1OZFA 3ZVNA 4YDSA 3C6KA 1OI3A 2OV6A 4PX3A 5DM4A 3UQYS 3SYLA 2OP0A 1FJXA 3UGJA 4TKMA 1SKYB 4YRSA 4LE0A 4D99A 4DR4B 2VT2A 4NE2A 3KJHA 5ALJA 1OX4B 4W5JA 1M1XB 2RHTA 1MZPA 2OXCA 1FNBA 1U0JA 3H9QA 1TUGA 4UVEA 3VPAA 4ZI7B 1WULS 2ALJA 2H3EA 4A1OA 3S2SA 3UAXA 1TQHA 4UZFA 3KOXA 5HIJA 4BWGA 4V0RA 2F90A 4AMGA 3USZA 3FCEA 1T5DX 5LDHA 4S1VA 2WNSA 1Z4KA 5TS2A 2Q62A 2M98A 1YB4A 1WV0A 3TOXA 4XQGA 2XD9A 3VVCA 1F7VA 5EMNA 2B1QA 4FGLA 1TUIA 4HQ6A 5BW5A 4BZPA 3DL4A 1IG3A 3DV9A 1HDYA 2ZSUA 4R8MA 2NAFA 1S1CA 3T3IA 2MINA 1Q0RA 1A9YA 2XOKD 3DTVB 2I4TA 3QLUA 4JUDX 4KN6A 5H02A 5TXGA 1W29A 2W6ZA 2IXGA 5EUBA 1IZ0A 2DBRA 3W5SA 1OH7A 1H1TA 3FOWA 1PT7A 2H2FA 4QNNA 5F3RA 4F6RA 3THWB 1X1DA 5CEFA 4FE4A 2D1SA 2EX1A 1T9DA 4NNOA 4DF3A 4B3SB 2CCKA 3A26A 5IJWA 5HMLA 4MGZR 2XYRA 1RC1A 2QGNA 2PHZA 1D5CA 5G1PA 1SCKA 4AXXA 4DREA 3U40A 1RC0A 1I7QB 1Y98A 2VR1A 2XF8A 4JBXA 3E4CA 3A4VA 3UV6A 1NQWA 1ZVJA 1N5MA 1FVOA 2BHLA 2FMXA 3P45A 4FYYA 5D84A 4YONB 3SS9X 1T2EA 2Q6IA 1QO0D 3UC5A 1H1DA 4CU5A 4EHNA 1CIVA 3K70B 1M0SA 3UK6A 1NXTA 3GLFE 4NL4H 3IULA 1QIDA 4YFYA 4JXXA 1KBQA 1E1CB 1AD2A 3QSGA 4YR7A 3MERA 1SELA 3CRVA 2B9EA 3AM4A 1U8AA 3IMEA 2D1RA 5JISA 1SURA 5JHHB 2P40A 4AZVA 2O8NA 3M6XA 2L69A 4PCUA 2IHKA 3OQNA 2JFZA 5H68A 1ODCA 2GJAA 1WVIA 5HTKA 1E0AA 16PKA 1BO6A 4QU9A 5CDFE 5HIAA 2V6IA 2ZRNA 1UBNA 2ORED 3LD9A 3V8MA 5KEIA 2WIGA 4BO9A 3MAJA 2P0AA 3NC4A 1G0NA 4UTVA 1LC0A 3HJBA 2HFKA 2D3WA 3DVAB 1D6MA 4GZLA 2QTCA 3GJTA 4YT2A 4I46A 3QMVA 1NVGA 4X41A 1D1TA 2R66A 2ZQ5A 4IHQA 4OQNA 4TXHA 4ALKA 1P2SA 3GO4A 4AWXA 4KREA 3ILVA 4EJSB 1XTZA 4EBFA 4FNAA 4O5AA 5ALVA 3AUJB 4B2PA 1JECA 2IEZA 1G19A 1YJXA 3WO1A 2EKBA 3M9LA 2K5UA 2D2FA 1VP9A 5I9LA 4DSAA 1KAEA 3DLPX 3FKJA 2ZR8A 4HMQA 4QGGA 3W7VA 2ZT7A 1SXJE 5HA5A 2XCTB 5CT9A 5F2NA 2OZPA 3F3MA 3OKAA 5JJLA 2XZDA 1VMKA 1OA1A 4WNCA 4UHCA 5LA6F 1OU4A 2PUHA 1SU6A 1Z38A 4C06A 3TW6A 5TE9A 3EH1A 5DM70 2JGDB 1QE5A 3LPDA 1ZD1A 3W3AD 3G8BA 3WHPA 5BSEA 1W44A 1KP3A 3LY7A 1E1MA 2FR1A 4HDNB 4QA9A 3U4GA 1EZZA 3GRPA 4K7JA 3K0SA 1YFZA 3R3SA 3T99A 5FORA 4DQLA 1R9MA 4K86A 2YCBA 2V4MA 2XLBA 3THXA 2NTEA 1IHOA 4KO2S 4QHTA 4Z2YA 4MQLA 2VAVA 4JP3A 2AW5A 2IL1A 1UJCA 3IILA 5G41A 3SF8A 3CUVA 5DFAA 3C6MA 3OJFA 3R1IA 2D4HA 4LF5B 3KJXA 1MV8A 2NTVA 3ES9A 4OAOA 1PR0A 5CNJA 2Y1LA 2OO7A 3D3NA 3BDVA 1JG7A 1I3OA 3EQZA 1KQ7A 4L4YA 3HK2A 2W0MA 3N6RA 4M7PA 5IZCC 1VLVA 1Q0TA 2PBRA 5LLSA 1E0DA 2PA0A 3WC4A 1JB1A 3FKSD 4F06A 5DXAA 1HE1C 4Q0MA 1Y7HA 3GQBA 2VXBA 3C43A 1QZXA 4LXQA 4LRQA 4NBLA 4Q1FA 3B13B 3KVNA 4XIJA 4EGSA 2JAWA 1NBOA 2F4NA 4JBYA 1QDUA 2C88A 3HSSA 3EZXA 4PLYA 4WZBA 5DPMA 3INRA 1FOEB 4WUVA 3U9SA 3TI9A 1E0KA 2FFHA 2Y67A 5KYKA 4S1NA 1QIKA 5EYPA 4DR2B 3VHLB 2EG5A 2PTHA 4LHWA 1NULA 3PHHA 3OIFA 4B35A 3ZLUA 1QHFA 1IRIA 1FTSA 1RI1A 1JG3A 2EZUA 4WE3A 4WESA 1WOYA 4WCFA 1IH8A 4Z0NA 1OFTA 3MMZA 1GDHA 4I6JA 5K3DA 4DQKA 4F45A 2YUTA 2VDVE 4ZAGA 1SD5A 1M6NA 2OCGA 1YA8A 2ZVPX 3W04A 5J2UA 2VDKB 1CKEA 4AICA 3UXYA 4PEVA 4ZOEA 3IEKA 3COSA 4IIDA 5JCOA 4M7RA 3B6MA 4LV6A 1X39A 3ZXIA 5JECA 1P60A 2O3QA 2HK8A 2OD9A 3G0CA 4KBYA 3HDTA 2YXDA 3BUSA 5AW8A 3OU7A 4G0MA 5EEGA 1CF4A 3E8MA 2WVAA 1B23P 3AKEA 5E1OA 1QKIA 4NNJA 4D0SA 4B6GA 3CBGA 3S2GA 2HCFA 1K6JA 1KY3A 5AM5A 4BWFB 4M89A 1M74A 1AZWA 2CB0A 3FWPA 4OBEA 1MO4A 5SZHB 1YQGA 3COWA 1XLTA 3VGJA 4DDVA 2C7BA 2RG1A 3GJ6A 3QMMA 5ECWA 3RK4A 3WYNA 2D59A 5BWOA 4NCBA 1XN4A 2IDKA 2QRUA 1R4AA 2CHQA 3I9LA 4BNKA 2O05A 4DBVO 1XWWA 4JLDA 5IYZB 1QHXA 3VU1A 2OCBA 1T9KA 4KIUA 1T2UA 4NCJA 4PYJA 1QRUA 4D44A 1NF8A 4RJ2A 2OK7A 4C2AA 1PAUA 4WZZA 3CURA 4O4IA 3JZDA 3WDSA 5AIBA 3TNFA 3FMFA 2RHBA 4MUMA 4ZQIA 4ZANA 4DS3A 4J1QA 3UY4A 4LJAA 3KAKA 1Z4LA 4EHBA 2I91A 2FSVC 1LI4A 4JIGA 4MRSA 1KORA 5CJ2A 1QAMA 2JHCA 5DH9A 2OPHA 5I7HA 2AL7A 1E7RA 2IIBA 1BRTA 4GICA 3JD0A 4OUDA 1BG6A 4K1LA 4IFEA 3CC8A 5L9AA 5BUQA 2GF9A 4I08A 5L4SA 2ZBRA 5AJYA 1JDUA 2WAOA 3I2KA 1KEZA 5LP6C 4PS0A 1V5GA 2EZ4A 4TZ6A 3E5HA 1E6EA 1NZFA 2IITA 1M2OB 4GBJA 2IDMA 1GV1A 4RKFA 3VOBA 1J49A 3JTMA 3DR5A 1OLSA 3GF4A 1SK8A 3TE6A 1SU7A 4Z4GA 2YR0A 2QVGA 3MMNA 3F98A 2B61A 5CYGA 2PGIA 1WHTB 3T7EA 1U4NA 1O0SA 2CHEA 5D87A 3VPBA 3T0IA 2FEAA 5HOEA 4D6XA 1KMHB 2WYUA 3NV7A 5F9HA 4R68A 1XG5A 4NU8X 1PJCA 1TZCA 2A5LA 4OQDA 3O8BA 2PXHA 3C4JA 5KSOA 2VL7A 3AIKA 3HA3A 4OQPA 3KQKA 5BSGA 1KYXA 2HCRA 2ZT5A 3UZUA 3PNLA 2NQ2C 2XYHA 2WT4A 2I8AA 4WA7A 5HSGA 4A2PA 3W5BA 1SD1A 5EE1A 5F9MA 1ISRA 1BX0A 1G17A 5CVCA 4AUNA 2GEFA 1BH2A 1ARZA 2X5OA 1HTTA 3QWBA 4C87A 5JZSA 2NSLA 2OO3A 3ZBQA 2HLNA 1SEPA 2VPXA 3BGIA 3JR7A 2H51A 2CW5A 3L1VA 3R5HA 3RTGA 3ZHCA 1OH6A 4K9PA 4EW3A 4DB4A 3E48A 2XIJA 5EKSA 1JSRA 5DNDA 2J5RA 3WB2A 4DM7A 2W42A 4AMBA 1KEPA 5KWJA 1AKVA 1ZONA 2C9YA 2WWWA 2F6RA 3BQ9A 3LXMA 1H2RS 3JAKA 4M0KA 4JYMA 2ZJ7A 3HXMA 3RTAA 2FVYA 1YCDA 4MWEA 1XRQA 3QVUA 4U6QA 1YQXA 2P35A 3NJ8A 4KDEA 2YMPA 5FUXA 3VAYA 3N6VA 3O31A 4C3OB 3GMIA 5KSPA 1J1ZA 2GN0A 1FP1D 2EC5A 2H52A 4ALIA 1DWOA 1FTWA 3UUFA 1YBVA 3CZQA 5CH5A 1ITZA 1DDOA 3VX3A 2WE8A 1JIQA 1MVNA 1CE8A 3W4JA 1XKXA 4UM7A 4FPXA 1MOSA 2PGXA 2PSHA 3O8LA 1LLUA 2BFFA 2FNAA 2MDTA 1L4BA 3FTQA 1V3UA 1AE1A 4ZT5A 4AMZA 4DQUA 4M1MA 2WIFA 4M60A 1M1YE 1EJ0A 3C6XA 1VTKA 2PN1A 2HBYA 4EGJA 1PYDA 2JRCA 4C4ZA 2GCOB 4MXDA 4LCJA 4RMIA 2O8EA 5JSZB 5A9TA 3AQIA 2JDIA 4R8SA 4WEOA 3U3MA 2NUTB 4F6CA 3FPCA 4ZYVA 3O2SB 3ZDZB 4IP0A 4PLVA 1GPJA 3H2ZA 2WJZB 1SXJC 3DDNA 3SVZA 3F3YA 5CVUA 5IXYA 5DHRA 2I65A 5KOJB 1DC8A 1E9DA 4UU1A 2ZKIA 4WI1A 2XUIA 4YRTA 1H22A 5AI9A 1D2CA 2K7FA 3DTNA 5C37A 3TR0A 1BDHA 4L8VA 1XYYA 1G21A 4OU4A 2EFDB 2JGAA 4FDAA 5AKLA 5EUCA 4RH3A 3T95A 1Y37A 2AMFA 2ORVA 3NWJA 4XRRA 5GONA 2X0IA 3NYRA 4C6TA 1XTVA 3V6MA 4Q9IA 1L5OA 1NOKA 4J91A 2Z30A 2D0IA 1VZ3A 2Q5LA 3BK2A 2X6QA 1R4MA 2V0NA 3C48A 3CGWA 3WO0A 3O8DA 3U62A 5JDIA 1DT3A 1V8FA 1J0DA 4FEAA 3X2SA 2FDRA 4GXNA 3C24A 3C3AA 2BEUB 3PEFA 1OGIA 1DLIA 3A31A 4NULA 4RHFA 6LDHA 3A6FA 1KAQA 3KSBC 1XU4A 4Q39A 4JVLA 4UUQA 4HNAB 1KJYA 4NBVA 4KC0A 3VZBA 3ELDA 1E18A 3PVCA 1V2GA 2ZYHA 3F3KA 1I7NA 1Q0PA 1RBZA 3IA2A 1RWKA 4GR9A 4XSVA 4ZV9A 1V11A 2FV8A 3PENA 4YJKA 1RXEA 4MV5A 4JVOA 4K9SA 5J47A 3D0KA 5K0SA 5A7HA 2XBMA 3KU1A 3R75A 5G0VA 4EUSA 1SHUX 4AO6A 3FPKA 3PJFA 3S2IA 2X22A 2GMWA 2N9UA 2XX3A 3M4YA 4M8IA 4N4AA 4QBFA 4F8JA 2OEPA 5L8VA 3FLEA 3RG2A 3ZCXA 4D5GA 2Q2QA 1ZGBA 3MMSA 2OXTA 4EFKA 5H4HA 3C39A 4GGPA 2WF5A 3CH4B 4O0MA 1U3VA 2GEBA 2W2LD 4GW3A 4KDFA 1MT3A 3ETNA 4M1EA 5D1HA 1FFXA 1YVDA 4XGIA 4PO3X 1EFRA 3JD2A 5GWXA 5T5QA 1KE2A 1IEVA 2A33A 1CVIA 1YMUA 4NMMA 1Z3IX 4Q3EA 5GV7A 3SC3A 3UA3A 4Q1EA 1ZBQA 2ZYIA 2P11A 3MBIA 1MJHA 2HL6A 1ZNYA 1K8ZB 4ZOLF 2QF7A 4FLEA 3WNDA 2BFPA 4L27A 2Z6AA 1XCJA 2PMKA 1XWOA 3JRNA 4V0QA 5C81A 4RVCA 3L05A 3I2IA 3QXXA 3AKZA 2NU8B 1ORVA 1U0RA 4DC1A 2BI8A 4O4LA 1ZIOA 4DCTA 2C5HA 1CHDA 1Y3AA 1VLQA 3EIUA 4DC0A 5JO0A 2R25B 4UCWA 4K9MA 4XEUA 2F3UA 3X3HA 3LVBA 2IJGX 3JTEA 3UT5B 2BBWA 3ETGA 2H5JA 5FPPA 3GEHA 2HXYA 3VSDA 5A5DA 1O5IA 1DMSA 4CLDA 1YB6A 2JJ1A 3TW0A 3DQQA 5JXIA 4PSUA 2VNIA 5CIQA 2JAQA 1LF5A 5TJHA 1UMKA 3OOJA 2WG0A 3IX7A 3NORA 2BM9A 1IXKA 4D98A 3OT1B 3JVVA 1QRSA 2MSKA 2XQVA 3COVA 2AKAB 2XCLA 3JQ7A 3HVIA 3V8QA 4G0PA 3D8UA 1EH5A 1H3NA 1GAJA 2PBLA 1RMYA 3AF4A 3FDZB 5A3JA 1FDWA 1FLVA 3E3MA 5IM4A 1VLLA 2HJHA 4L74A 5CLQA 4RTLA 1YVUA 2X76A 3UJHA 4F71A 3HCEA 1ORDA 2H31A 3KDPA 3MJFA 4FFRA 4N01A 2IV3A 1DARA 3AUSA 3L8DA 3A58B 3NASA 3D3QA 2YCLA 5EIBD 4BJ6A 3DONA 3PGJA 4MDHA 1NXPA 3Q3HA 2ODPA 4FE3A 5ALIA 3EIFA 1A72A 1JKJB 4F5EA 2GCGA 4GOKA 3TSCA 1O3YA 1ZI9A 1RLMA 4G8JA 1EVJA 3Q9UA 1ZNWA 4RNDB 3ILYA 1NVAA 2FEKA 4DE5A 5CU7A 4DDHA 3WWDA 4AN0A 4CMGA 1AUPA 1HFEL 1CEYA 3DOOA 2V6BA 4F5YA 2BBSA 2ZR9A 3K6JA 1NI5A 1RP1A 2NUAA 4ADLA 3DMGA 2HW8A 1PG0A 4K5QA 4ENQA 3DZBA 1ZM4A 2PMFA 3R7DA 4QBTA 4F11A 3KOWA 2G63A 1EA7A 3DTVD 4QVGA 1AF7A 4GMHA 1ZUIA 1RYHA 1U81A 1AKNA 3DF7A 8ADHA 1B43A 5TGDA 3LIPA 4LVUA 1ESNA 2RGEA 3PFIA 4JROA 2POQX 5DBIA 4CF4A 5DBFA 4EO9A 2PZAA 3N1UA 1GILA 5I8WA 4C89A 3N8NA 3KYCB 4MP8A 4IZIA 4Z0PA 3ZWKA 3LX5A 2EW2A 2IDJA 1XDZA 3VPSA 1NYQA 2BM1A 5BSWA 4KQFA 4LW8A 5BOVA 1RHQA 2YZGA 4PQRA 2FN8A 1XCPA 4IW3B 3UGKA 3Q0IA 4IOLA 5CH8A 1JFVA 2DPLA 2FKNA 2I2FA 1QPZA 5JRDS 1NT4A 1Q1BA 3LCMA 1T3TA 4OOEA 5JC8A 3BKWA 1TC2A 4JKYA 5FBZA 5IARA 5HF9A 1FP6A 1Z6TA 2VA8A 5IDVA 2YKGA 3T7KA 1CJUC 4K6KA 1BYIA 4AWBA 1HSZA 4ZK2A 3EXHC 4KKVA 5DKFA 3I01M 2GZHA 2G25A 2P4EA 3VR6H 3KUUA 3AJ8A 3QVGB 4UUNA 3U4QA 1L7AA 4LE2A 5B7PA 4KR7A 3ZZTA 2PSSA 2JCGA 2UZ4A 2AFHE 4E94A 3H2GA 4AJJA 3NCTA 4G5SA 4KMRA 3S5UA 3ZZNA 1XZJA 3SYKA 3EQ7A 4JNCA 2A84A 5IN5A 2NV2B 3GIDA 4H3VA 5TT1A 4DV2B 4RD4A 3KBBA 1SBHA 2XYPA 4X63A 3G2OA 3PUHA 5HF6A 1RCUA 1WDLA 4J0JA 3ZE2B 1WW8A 5IT9A 1K2VN 1FXWF 1G6Q1 4RE5A 4BVJA 2OCDA 2L42A 1Z15A 1IBRA 2BKVA 4MX8A 1ZN7A 3CTMA 1ZEMA 1P9NA 4AIRA 3ZJYA 4ZZ2A 4Z0TA 3LBYA 3UK2A 1WLYA 3ZLBA 1H2FA 2G04A 4YTEA 1RRKA 1SCUB 2UZ1A 3GPLA 4PYRA 3SHTA 1J97A 1G98A 1ODIA 3D2LA 2WICA 2F59A 3EQ9A 1TT5B 3O1IC 5K0TA 1GTZA 2JGIA 1J56A 3B5JA 1IUNA 1ZH8A 4KIJA 2OCPA 1KQ3A 3BHMA 5CH3A 4TKVA 3AWDA 1I5OA 4CN9A 3NEJA 3G0GA 3GT7A 2BKEA 1PR3A 4IXMA 1B26A 3A4MA 1Y3IA 2PZFA 3GGSA 3QLJA 3ROFA 4ZYYA 1XP8A 2ZWPA 2GCIA 4HGZA 4UHBA 1LPOA 2QTRA 3DLCA 3JYQA 1Y8CA 2W0SA 4KI7A 4QELA 3J81k 1RAFA 1OWMA 1Z13A 1W9HA 1Z9BA 3IVAA 4W7HA 1IZZA 1YBHA 3GL9A 3STUA 5LQKA 3R9WA 2V7PA 3KKEA 3WMEA 2HWKA 4RKYA 2J0UA 3HQ4O 4Z7NB 4HLDA 4R7ZA 3ZGVA 3BSYA 3DFFA 3PXEA 5J3JA 4KPEC 1FFEA 3EF3A 3T9DA 2CBZA 4P3YA 3VOAA 4BFWA 2IEBA 2YBEA 4Q4AB 4J76A 5FD8A 3UAGA 2JI4A 4AQDA 1T3SA 2WD9A 2XIQA 1RWVA 4ZVUA 2RCYA 2ZIAA 1VBFA 4CM9A 2Q3MA 5FF9A 2X23A 3QJGA 2XUQA 1BA2A 4Z8YA 1YGYA 2OAGA 1QH1A 1C81A 3VV3A 2C7GA 2FOXA 3NBYC 2PUEA 4CHTA 3P2YA 2DQKA 3ZLTA 4Y6PA 3AESA 4MW2A 2QM3A 2HLHA 3FLBA 4FLFA 1NBIA 2VC2B 1EE9A 1ZKMA 2JW5A 1FYWA 2CWWA 3WGGA 3PC2A 4GI1A 1RRFA 1ZL0A 3ZH2A 3QF4A 4O59O 2FLWA 5HYVA 4BTLA 3KYBA 1YE8A 3TSOA 4DLXA 4CG0A 3RROA 5BSFA 3ZR4B 1GPBA 3WIUA 5U4QA 4B17A 1ZJYA 3FJYA 1OVMA 2VQSA 2VXCA 5AYVA 5ALFA 4YJ3A 5B58C 1V5IA 4IV8A 4TMYA 3S8YA 4Z9XA 5BN1A 2A58A 1BE1A 1YJ5A 3LBAA 3RNLA 3UKJA 1CS4C 3L0OA 4DLUA 3A6GA 4DXAA 2WW8A 4LI0A 3PRKE 4MVJF 1VG1A 2FFRA 2HTEA 2A1TS 3RJ9A 2O1SA 3IPAA 3QKWA 2XXAB 4LYGA 2UVQA 2DQSA 2XVYA 2AFRA 1QCYA 2BMEA 5FOUA 4U7TB 3I58A 4CJXA 4DCOA 4EOGA 2GVNA 1BTOA 1G0OA 5LIPA 1TJUA 4BV2A 1X8XA 4AO8A 4HXGA 2KW5A 4GVLA 2XNHA 2C2XA 1I24A 1BSVA 2I78A 4WTOA 2ICAA 4MROA 4P82A 1SO8A 1J20A 2P90A 1LBHA 3PFWO 1GPMA 4E1BA 3UMBA 2Q5FA 4OQQA 5CGQB 3GVXA 3DT6A 3HZZA 3OZDA 1U02A 2FWMX 2JHFA 4G0OA 1JWBB 4GNRA 2AH5A 1I1OA 2WOJA 4KU4A 4TKUA 1V37A 4ZOCA 3J81A 2X4GA 4JI0B 1H1LB 2OC4A 4RIFA 4DCVA 4R9SA 2JFNA 2VWQA 2VDWB 3FWYA 1C4XA 3KQWA 3Q1LA 1D5WA 4FUQA 3EIOA 4L15A 5LD2C 1Z3CA 2QD5A 4EY5A 3PXDA 1XA0A 1Z8HA 3C1AA 3KJGA 1PZHA 3R3XA 4PPFA 1LK0A 3EDOA 1NNSA 5C1IA 4JBWA 5HKKD 1JI3A 1GAQA 4PY2A 5ICCA 2ZBFA 4G0XA 2XI4A 4FIDA 4JP1A 3IAS6 1B2RA 4KP7A 5B1EA 4RPIA 4ARZB 1PZXA 3T5PA 2H16A 3S1LA 3K15A 5JV5A 5IABA 1ZH2A 2AJLI 3AF2A 3HM2A 5T6BA 4M8KA 4C7KA 4ZMBA 3IVMA 3F6YA 3ZU2A 4G0UA 1RAEA 5HOQA 1QG4A 1RM4A 1Q7RA 1KFJB 2O0MA 4RSMA 2B36A 5LOVA 2PO5A 4MMXB 3S40A 4OA5A 4Q3LA 4FTWA 1RZRA 4RHTA 4CBVA 1NN5A 4IIFA 4CT4B 2DWQA 4YQEA 5CA0F 3UQZA 3HXQA 1V41E 4JGIA 4FKBA 2ZYUX 5HQJA 1TVMA 4XPIA 4YT5A 1C1HA 1SBNE 4IXTA 1S3SA 3SEZA 2R97A 2JBHA 1DKPA 1DS6A 1CRPA 4J0IA 4UBJA 3C70A 4TV9A 1UKEA 4ND4A 2XCRB 3NOXA 1M8JA 3IIMA 1ANKA 1ST3A 3PUVA 4I55B 1O96A 2WTAA 4KFSA 3UPDA 1AVTA 3UW3A 4BVEA 2GZDA 4FSDA 2WKQA 2WJ6A 3C7TA 1K08A 1TK3A 3KLMX 4TSRA 5EFZA 4QTTB 1UBMS 1N5OX 3GG2A 1U5BA 3T4EA 2GN6A 4IUYA 5DVZA 1N5KA 4CTMA 1MO5A 1C29B 5JNWA 3F49S 3FVVA 4XD7D 5HEKA 1P0FA 3RT1A 1DXOA 4LYHA 1CQXA 2IP4A 1KY4A 4W1PA 3KOOA 4PANA 1P61B 3KWFA 4TT3D 1T9AA 2YC2C 2H54A 3LW7A 3CVVA 2C97A 3TFOA 3H0CA 2YVLA 1Z2EA 2JEZA 3MFYA 1REQA 5G3YA 1SHTX 1K9VF 4WBNF 2HJWA 1ESZA 1ZMTA 4K6GA 2JL1A 4OJKA 2H92A 5DWQA 3R7BA 1D4AA 2J6CA 3QA3E 4QQKA 4IDNA 5FOTA 2UYGA 3KHSA 3BTVA 4TWBA 1C4KA 1E5QA 1H6DA 5E3HA 3BD9A 3VDXA 4K87A 1UT8A 2C31A 2J45A 1E5DA 2WUDA 1GM5A 1D8TA 3BXGA 1FW6A 3M6LA 3G3EA 3R0XA 3R6QA 4GAEA 1JQDA 4OSEA 4BMZA 4LPSA 1TEZA 3E7DA 3LK6A 4R5HA 2PVCA 3W2TA 3EZFA 4QLOA