4YIKA

Crystal structure of human cytosolic 5'(3')-deoxyribonucleotidase in complex with the inhibitor pb-pvu
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
201
structure length
201
Chain Sequence
SNAASGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of a bisphosphonate 5'(3')-deoxyribonucleotidase inhibitor
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 5'(3')-deoxyribonucleotidase, mitochondrial
total genus 65
structure length 201
sequence length 201
ec nomenclature ec 3.1.3.-:
pdb deposition date 2015-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4yikA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4yikA01
1WPGA 3ESQA 2FI1A 5ALKA 1RKQA 2X4DA 1YJ5A 1RKUA 4UM7A 3ZI4A 2FPRA 2JARA 1TE2A 5AIBA 4HGRA 3RFUA 2GO7A 5AM0A 5ALXA 3NIWA 4NWIA 5E0OA 1QYIA 3AR3A 1Z4IA 2I7DA 2G07A 3DNPA 4NABA 5ALIA 1ZD5A 5ALSA 5AVZA 1K1EA 1Z5GA 5ALMA 2W4MA 3FVVA 3R4CA 4YH1A 3KDPA 4YCNA 3U7HB 2HF2A 1L7NA 3I1YA 3KBBA 3OCWA 4UARA 2B8EA 5ALQA 3UMBA 2I33A 4BEVA 3TLMA 3NASA 1Z4NA 1WVIA 3NRJA 2JAOA 5AM5A 1T5SA 1VJRA 5IS2A 4B6JA 4C4TA 2FPUA 2FPSA 3WKBA 1L7PA 4JB3A 3OCYA 1Z5UA 2B30A 3K1ZA 4Y2UA 3WK4A 5AVQA 4JDPA 5IT4A 1RRCA 2R8XA 5AKYA 1QQ7A 5AVYA 2AGVA 4Y2VA 4EZEA 2W43A 1F5SA 2YJ4A 3S6JA 2B82A 2HOQA 2Q4RA 1L7MA 1U2SA 3A1DA 3QU9A 4UAVA 4CNQA 1Z4JA 5AKXA 3E58A 2EARA 3PGVA 4Y2TA 3M9LA 4ZEVA 2WF8A 2G1AA 1O08A 5AW8A 4YCLA 3QXGA 3FPSA 4XQ0A 1RLMA 5AKHA 5AW3A 3UM9A 5T41A 3SF0A 1ZD4A 5JJBA 3ZWDA 1SWVA 2GHQA 5AVRA 1Z4KA 2HI0A 5AI4A 1L8LA 2I55A 3N28A 4GIBA 2WF9A 2EAUA 3L0CA 1EK1A 4HAIA 3IB6A 5AVUA 2I6XA 2BY4A 3HLTA 3ONNA 5ALFA 4BX3A 3WKEA 1XP5A 1WZCA 4UASA 2B1RA 5AI6A 1U02A 3I6BA 1RQLA 2YMLA 1CQZA 4E88A 1CR6A 2CFTA 1NF2A 2JGAA 2G0AA 2EATA 1ZRMA 5ALOA 2AMYA 3QU5A 2Q5EA 2HCFA 4HYTA 5ALNA 3WK7A 4YIHA 1NNLA 3WK6A 3A1EA 1VJ5A 1TJ3A 4Y3UA 2FPWA 4EEKA 3EF1A 3KZXA 1LTQA 2FDRA 3UMCA 5AK3A 3PGLA 4RETA 4UM5A 4NV0A 4DCCA 2RB5A 3QX7A 5AM2A 3L8EA 5AI5A 4ZEWA 2WM8A 2I34A 3WK5A 4XPZA 4QQFA 5AW1A 2WF6A 3N5KA 1RLTA 5ALUA 2JAWA 1MH9A 2G09A 3U7GA 1QQ5A 4NFLA 2JAUA 1RMYA 3OPXA 3VAYA 2R8ZA 1RMQA 2ZBEA 2YJ3A 5AIAA 2FUEA 3I28A 3ZW7A 2QLTA 2ZBGA 3WK9A 3CNHA 3U13A 2YJ5A 2IOFK 4H1WA 3QU7A 2HDOA 3N1UA 5AVWA 2YFYA 2PKEA 2G08A 1N8NA 2G80A 3B9RA 3BA6A 1U7PA 4UMDA 4PNHA 1RLOA 1VFPA 1ZJJA 5AVXA 1RPZA 3WKAA 3ZVLA 3L7YA 3L8FA 5AM4A 4MWOA 5AICA 4Y2RA 5AK5A 2YN4A 3QUTA 1IWOA 3IRUA 1YMQA 5AHXA 3PDWA 1AQ6A 1Y8AA 2YMQA 3KD3A 3WGUA 5ALVA 3FZQA 3W5CA 3AR2A 3AR8A 3KC2A 3ZWKA 4KX5A 5AW6A 3U7EB 3L8HA 2IOFA 4GXTA 3SKXA 1Z4QA 1QQ6A 4MUMA 3F9RA 4F71A 4Y2XA 5ALWA 3P96A 3QU2A 4NAVA 3B8EA 2NO5A 4FFDA 5ALHA 5ALJA 2IYEA 1Z4OA 2P9JA 3ZVMA 1ZD2P 4BEWA 3FGOA 4Y2SA 4EX6A 4Y2PA 3U19A 3ET4A 3NANA 3EWIA 4KNWA 2YY6A 5ALGA 5ALYA 4YCMA 1L7OA 3WGVA 1L8OA 2WF7A 2MSNA 3QUQA 4J03A 5ALTA 3WKCA 2O9JA 2OYCA 3ZX4A 2CFRA 3NALA 1TJ4A 3FPBA 4BYGA 1XPJA 4OCZA 3J7TA 1J8DA 3E8MA 4YIKA 2GFHA 5AW5A 3ZU6A 2WF5A 3L1VA 4L57A 3QNMA 1ZS9A 5A3RA 3FM9A 4KX3A 2AUTA 5IT0A 3I76A 4FE3A 1WR8A 4UMEA 1X42A 3L1UA 5AI8A 1Z88A 3DAOA 3SKYA 5AKJA 3OCZA 4FYPA 4AP9A 3ZTYA 4Y2YA 3QU4A 2PR7A 3OTQA 2OA0A 4CE6A 4L6CA 3SLRA 2P11A 2D2VA 3M1YA 4F72A 1PW5A 2B1QA 3ET5A 4DFDA 5AW0A 2B8JA 5AESA 3QGMA 4XOUA 1U7OA 1EK2A 1RMTA 3A1CA 4KYTA 2NYVA 2OM6A 5AKGA 3IJ5A 4BBJA 4CF5A 1FEZA 1Q91A 2VKQA 2YMPA 4XE5A 3EPRA 2G06A 3MMZA 2ZOSA 4OHFA 2CFSA 4HGQA 3W5BA 2HEGA 4J2TA 3EF0A 3E81A 5AVVA 2P69A 4RESA 5AI9A 5AK4A 3DDHA 2QYHA 4BKMA 4I9FA 2YBDA 4BNDB 2HO4A 3OCUA 5AW2A 1TJ5A 4Y2QA 3B9BA 5AM1A 5AM3A 1Z4PX 3E84A 1ZD3A 3QUCA 3W5AA 2NO4A 5AK6A 2C88A 5A3SA 4C4SA 5AKLA 4EX7A 3R09A 2P27A 5ALZA 3L0YA 5A3QA 4UW9A 4UAUA 5ALLA 3GYGA 1T5TA 4O8CA 5ALDA 3L8GA 5ALEA 4BX0A 2B0CA 1ZRNA 3D6JA 5AKKA 3QYPA 1TA0A 3ZUPA 1Z4LA 2I54A 3N07A 4IG4A 2WFAA 2RAVA 2FPXA 1Z4MA 1Q92A 4DW8A 2C9MA 5AW9A 1RKVA 1L6RA 1S8OA 2ZBFA 4EENA 4QJBA 4UMFA 1YDFA 2IOHA 1JUDA 1QH9A 3SMVA 3DV9A 2ZBDA 4IFTA 2HX1A 1KYTA 3A3YA 2W11A 4UATA 2DQSA 1YV9A 5AVSA 4ZEXA 5AKZA 4AS2A 3CZ4A 2AH5A 4AS3A 1O03A 4UU0A 3ZTWA 1S2OA 3RF6A 5AI0A 3OCVA 3L0BA 3WKDA 4L6AA 2IA5A 1NRWA 3QLEA 4HGNA 3WK8A 4DWOA 3UMGA 3U26A 4Y2JA 3MN1A 4KN8A 3AR7A 3R9KA 2C8LA 2MU1A 2R8EA 3BWVA 3NAMA 3U7FB 2PQ0A 3KOOA 4UMVA 2HHLA 5ALRA 2BDEA 4BX2A 2CN1A 2ZXEA 4OD0A 2C8KA 3OCXA 3N8GA 2WHEA 1SU4A 2ZG6A 2OBBA 4I9GA 5AKIA 3ZX5A 4HGOA 4CF4A 1RC8A 1XVIA 1RQNA 3L5KA 1YS9A 2ODAA 3MPOA 5AKEA 3W5DA 4BNDA 3PCTA 2O2XA 3NUQA 3ED5A 3AR6A 2YJ6A 2HSZA 1RDFA 1U2TA 5FP0A 3HYCA 1ZOLA 1T9ZA 5ALPA 2FUCA 2Q4TA 2FEAA 3QUBA 2C4NA 2GMWA 4YGYA 2RARA 3SD7A 5AW4A 4OFZA 5AVTA 3MC1A 2YMMA 4C4RA 4KNVA 4EELA 3SHQA 4G63A 4G9BA 4HGPA 3AR4A 2HF7A 3ZVNA 2BDUA 3AR9A 1YNSA 2GHTA 2R8YA 1SWWA 1LVHA 4CF3A 4UU1A 2RBKA 5AW7A 1N9KA 1J97A 3ESRA 3AR5A
chains in the Genus database with same CATH superfamily
4EHLA 2IUYA 5FO0A 5ECYA 3KSBC 3YASA 3THXA 4ADLA 5K5EA 1B8NA 1WPGA 3OHPA 4UJ5A 1HY0A 2X23A 1I9CA 4F3TA 2JIQA 1U4SA 2XGGA 1IU9A 3DDZX 1NBIA 3I5UA 2A1TR 4G26A 4CPDA 3UGQA 1AO0A 3FFTA 3WDKA 1TE2A 4H4DA 3DAFA 4KYIB 1QV6A 2B7LA 1Q3TA 1R0LA 3H8SA 4LYFA 3SEAA 1PS8A 1V47A 4Q82A 1F12A 1MAVA 3AHHA 3K94A 3UAOA 4DXAA 1EGAA 2VQ3A 4H27A 2B92A 4PHCA 4RDCA 4DDTA 1W36D 4AZ3A 5CYGA 4PM4A 3H84A 1H2AS 3HVKA 4G5OA 1WE2A 3TRJA 4X60A 3T15A 3MJRA 1ODTC 2Q45A 2NO0A 5JQGA 1TEZA 1SVLA 2WWIA 2NG1A 1AQJA 2CDBA 1XMXA 2OECA 4IFIA 3OZAA 4WK4B 4Q9IA 4DTIA 2HJSA 3MCTA 3HUDA 1NPYA 3BWDD 5CAEB 3UMBA 4W8HA 2JFYA 4WZAB 2ZJOA 3LVFO 1RI3A 5TQ2B 4F5YA 5JAHA 5TF4A 3KOZA 1G8SA 4FUTA 2P2YA 1NMSA 1L7VC 1ZAYA 2XWJI 3RUDA 4E51A 1FXWA 3LA8A 4C0AC 1ZHOA 3GFGA 3PTAA 2XYHA 1X1TA 2FLVA 3W7BA 4Z3DA 4F2HA 4BNUA 1XN1A 1ZINA 1WDLA 2AOXA 3O75A 3WLJA 4A0FA 2QU8A 1CHDA 1SUFA 3S2IA 3SAJA 1Y89A 3KYDB 3QLTA 1KMHA 3M1AA 1E0JA 3PDIB 3EF3A 2PWPA 5EUCA 1NBOA 1SBHA 4JJGA 1ADJA 3BD9A 2B82A 3K05A 3TW8B 2VXYA 4D74A 1GZSA 4XEHA 5ELLA 2WTEA 2O5EA 1VBFA 4YRSA 3T3PB 3UMFA 1CEYA 3LY7A 1OXVA 3PJFA 2O1XA 5ITSA 4LUCA 3JSXA 1K7XB 4UE2A 5SY9A 3K0KA 4RCYA 3V1TC 3IAM1 3VKUA 4BVJA 1UOOA 3C3PA 3SC6A 1HYGA 2VAVA 5JH7F 2JCGA 4GMGA 2DT5A 5D3ZA 5IMSA 2HTFA 2Q49A 2REQA 3INTA 4QT0A 2ATXA 2GBGA 2BFBA 3MVEA 4KR7A 2G17A 2VATA 3K73O 1BHSA 3W9BA 4OHKA 2O2HA 2RGBA 1EHYA 3QXJA 4KQ2A 4ENWA 2YV3A 2WZDA 5E2AA 3KJEA 3GBSA 3PLNA 1QZTA 4G1FA 3TG8A 4M54A 1A7UA 1Z4KA 1LNSA 4TKVA 1O96A 4KRXA 3CLHA 3WBJA 4CG0A 4E0BA 5BT9A 5JR3A 1I7DA 2FWPA 1GPH1 2XOKA 3JTMA 4CEHA 2OHIA 2R44A 3X1KA 3DV0B 5A4JA 5LMZA 3X1XA 1JVSA 2BKVA 3K9BA 1E77A 4U6QA 2RHJA 1D1TA 1HEIA 2BY4A 4NKRA 2HSDA 1XTJA 2DHCA 4PV7A 4LXQA 3ONNA 5E0KB 5F2EA 4MR7B 2VUUA 3OM9A 4HAVA 1WZCA 1E4VA 2WJ4A 3UAVA 2B1RA 3NR2A 4D9EA 4POOA 1RQLA 2XRMA 1BVHA 3DS8A 1TF2A 1JB1A 3LQQA 3K4QA 1L9KA 2QD2A 3EARA 3UYLA 2ZR7A 1RD4A 1MT0A 2EATA 2IPMA 3OE4A 3R3SA 4EQ6B 1K89A 1L8AA 3MW8A 1TW2A 4HQFA 3A58B 4CVNA 4KTVE 3OO0A 3I4LA 3PX2A 1YOVB 3TLJA 4DYHA 1FVXA 3KEGA 2AFRA 2IPXA 2BAGA 2VK2A 1FXUA 2YZGA 3HSSA 4V2IA 6LDHA 2ZIEA 3HU2A 1R0BA 1EFPB 2EL9A 2PSSA 3PGLA 5F1YA 1PFGA 2AW3A 4ZVNA 1X7HA 2OO7A 5I8WA 4YP1A 2WJPA 3II6X 1WQ3A 4MK4A 4UM5A 3RUFA 1XALA 3UG7A 5SZIA 3CINA 4BE9A 2JVJA 2C59A 2HFKA 2FPGB 3H4MA 4P7GA 5F9MA 4BY9E 1W88B 2OZKA 2GUGA 4QQFA 4XUEA 1BQ4A 1KEEA 1NM5C 3K9NA 3MLBA 3ISTA 4NCXA 2FRXA 4FOTA 1KVUA 5FFMA 3UB3A 3N5KA 2Q2VA 1SBTA 1BD3A 3T5CA 4L28A 4I5DA 3GPIA 1XBTA 5FTMA 2VHZA 1YQTA 4TXHA 5LJIA 1HNZB 4M83A 1NJ6A 4ZU6X 4X97A 4CLHA 4LFAB 2MSDB 1N36B 2M98A 1W85A 3AI3A 1H3NA 4C7KA 4XM0A 4NHEA 5LB4A 1V8PA 3GTDA 2EVWX 2A9RA 3BWXA 4UHCA 4ZVOA 2FPPB 4MIYA 4G1UC 5EPOA 1NX6A 1XZ8A 2I8LA 3PNYA 4RHYA 3H99A 4WMLA 1QONA 2PFKA 4QXMA 1CZNA 3B2EA 3F8SA 1YL5A 2Z0MA 3OKAA 4P93A 1P73A 4JYBA 5BQ5A 4DC1A 4ZO9A 4Y1FA 3WLAA 4F4HA 1TYDE 3Q7QA 2OLEA 1IY9A 5A9TA 2FZVA 5GGYA 2DOKA 1G18A 2M2IA 1SG0A 3FSJX 3HS3A 5D00A 4Z9AA 5K1ZA 3OJXA 3U61B 3L07A 5AM4A 1JN0A 1E2EA 4YJDA 5FBKA 2YV5A 1Z8FA 1ZISA 4K9PA 2AG1A 2HWUA 2QSJA 2DFDA 3RV4A 1PDOA 5EWLA 4KFRA 2HREA 1YO6A 4Y9SA 3NDJA 2HJGA 5DHSA 1B0PA 4HNAB 4KX5A 4QPPA 1G5HA 2P79A 5EWLB 3VYSB 1PSWA 5KOJA 1Z7WA 2BTOA 3OC6A 5EJAA 4CI0B 3CU5A 5T8KA 1C3VA 4HDRA 4N48A 1LSOA 1E5DA 1U7WA 2PXAA 3D2CA 1B1CA 4RSRA 1FTQA 1Z6YA 3F9RA 1G3UA 5CYPA 4NCAA 5K2MA 4Y2XA 4YRAA 2BR5A 3PF8A 3QU2A 4JK3A 4MQEB 2QR5A 2BR4A 3NYIA 4COOA 1JEEA 1NFFA 3ZH2A 2YW9A 3WYBA 4EWLA 4KAAA 3EXIB 4EBBA 1JG4A 3REFA 3UGJA 3ZVKA 4FDLA 4JWKA 4LYJA 1GGKA 5I9BA 1T8RA 1TPYA 1YRAA 1ECJA 2YC2C 3NDPA 4RCZA 2CF6A 3DDCA 4AB1A 2Y0CA 3CEHA 1O6BA 4LOIA 1EQAA 4K40A 5BW6B 1MW8X 3I5AA 3PTLA 1NDUA 1MFZA 3I9KA 4EG7A 1L7OA 2J3EA 3DBRB 2YXLA 3TZKA 1QGDA 5LP6F 3ETHA 1QFSA 1R4AA 1RSZA 2FSIA 3MPUA 4H7KA 4NOKA 3BFVA 4KWIA 2QT0A 2HJRA 3AVQA 2P8SA 4TTTS 4WNYA 4YRMA 1TVCA 1JI3A 1EPUA 1H2BA 1RRMA 2O05A 5ESWA 4CQMA 3WJ7A 1QRUA 2AUNA 2EF1A 2H31A 2UDPA 1Z7GA 5CT8A 1OLOA 5SV2A 1H93A 1OLUA 4MQBA 1OH7A 3DHVA 3SDSA 2WUDA 2CL6X 5EKUA 5D85A 5SZJA 5BN3A 5LQCA 2AI1A 3H11A 3WYGA 2C2XA 5LBIA 3DL0A 5BOSB 4J0DA 5ED4A 1EDZA 2Q1UA 5J5CA 1B23P 3A04A 2WF5A 2XITA 3TCKA 3STVA 2INGX 1T2EA 1TO1E 2EP7A 2QTVB 3CX7A 3KT3A 5KQSA 3RV3A 1D8TA 5KYXA 1XB2A 3QOXA 4CKBB 1WQ1R 3RVOA 2QLJA 4LBYA 1U6JA 1T26A 1QQBA 2JLXA 3QY0A 2II6A 1ZCZA 2G83A 3EMDA 1NI5A 3IQIX 4MUIA 3QU4A 3R24A 1AURA 1TOAA 3DFKA 5C5DA 2E5WA 1XXHE 2I9PA 3NGXA 4Y1EA 4BKOA 4CE6A 2JKZA 5H16A 1K68A 3VBEA 2K7FA 1QHHA 2P11A 2P62A 5TJ9A 4XVRA 5C31A 3KYBA 2JJ1D 1Z5PA 1T5DX 1HC7A 4N0QA 3T5TA 3ET5A 3ZXXA 1FUYB 1NVVR 2HMSA 2GS9A 3ENZA 3R5FA 5AYVA 1KE1A 2VH5R 5FBLB 2ADOA 3LPDA 2YYYA 4INPA 1MQ9A 2Q50A 4ZXFA 1AC5A 2HMYB 2AFVA 3KEMA 1KPIA 4ZJPA 1JX6A 2VCHA 4G4IA 4MVYA 2ZE5A 1DX4A 4YJ3A 4IH1A 1OKKD 4OGKA 2IEZA 4CYMA 1FBTA 1BX1A 1YR3A 2P2ZA 3ZBQA 3U6BA 2PWZA 1FEZA 2V5AA 3SJAA 3HGQA 1JPJA 3C3CA 4I6GA 4L2IA 2VT2A 3C7TA 3NEPX 4J3JA 3PXBA 1SAYA 1V1MA 4NJMB 4Q4JA 1QCCA 2BP7A 2MMGA 2PBZA 3KR9A 4JIMA 4K9QA 3EF0A 2ZWPA 3AV3A 2XDWA 3H87A 4PEVA 2AOVA 1LPAB 2KHZA 1YBVA 2WT9A 3KAQA 4HAZA 4OO3A 3SXUA 1Z18A 2JDIA 1G8PA 2JHFA 1X7WA 4NK5A 1ZI9A 5JAOA 1P4JA 2FRDA 3KJFA 4D97A 5DOZA 4QPNA 4HBZA 4F46A 2W7TA 3I39X 5T6MA 4AJIA 2PWBA 1DJPA 4IDNA 4P0QB 5CB4A 1NYQA 1PN3A 3FDXA 2GPSA 3SC2B 3BQ9A 4DV5B 1XCJA 4E6EA 3W05A 2C5GA 1Z4PX 2O8DA 4HEHA 3ZV3A 5B1DA 3W3AH 4P7JA 3PXDA 3EYAA 1L5ZA 1DO8A 2IPOA 3HWRA 1OXBB 1LZLA 4I0WB 1XU9A 4ER0A 3H11B 1K0FA 2JEYA 1YAHA 3R9IA 1YR9A 1NVGA 4MWEA 3ZPXA 4RMHA 1R0CA 1PTJA 4LZWA 1UMCA 3L43A 1K63A 2E4ZA 1P4SA 4GDFA 3O0DA 2EC5A 3KQVA 2CLIB 3I9NA 4BRSA 3PVCA 5A3QA 5DGIA 1M1UA 3A3KA 5JOQA 5EAIA 5EHQA 1AXGA 2RGXA 3LT1A 1NP6A 1SQSA 1US8B 2XVZA 4ZVMA 4O59O 5J5VA 5JRDS 4CEJA 1HR0B 1K0UA 2H4FA 1NOIA 3MEQA 4YT8A 4QM7A 1C81A 3OX4A 1JVNA 4HLCA 4A03A 4CR6A 5B5SA 1EJBA 4ZDKA 5KKNB 3MAGA 1DOAA 1SQGA 1TGYA 4CCYB 3TZHA 3VR2A 4NC9A 3BQNB 4TSFA 5EHNA 4FDVA 1KDYA 3DUWA 2PMBA 3KELA 4J07A 1P5JA 4IZHA 3MMNA 3TIIA 1YB2A 3A0RB 3OAAA 2FK8A 3HEAA 4MRRA 2GHRA 4PHGA 1NVWQ 1XAHA 2AXPA 1PGQA 3ZWVA 1VGVA 1T4MA 2YNMA 4IG9A 5HKKD 1QZXA 1ZMOA 3WV5A 1SD5A 2GPWA 2PSJA 2HJ9A 2PZLA 4RW0A 4LTDA 3QPVA 2JLYA 2HPAA 1U2PA 5F7OA 2DUJA 2ZBRA 2J1LA 3RHFA 4H08A 4RJKA 2GCGA 3BMQB 3W1WA 4DMHA 1W0JA 1TK9A 3QQ5A 2C9ZA 3LKZA 1WXWA 3GXBA 1AHHA 3JQPA 3MNFA 5BV8A 1I94B 2ZU6A 2IYZA 4Z99A 2FPLA 3DDSA 1LK0A 1JHRA 1VPVA 2DPXA 3DTTA 3KETA 5CX1A 2AH5A 1NULA 5LC1A 1CY6A 3Q8KA 5F7XA 4AJ2A 1BQ3A 4F38A 1LUAA 4I08A 4YMSA 4V0OA 3FY4A 4HYQA 1NRWA 2OGZA 3AIIA 3BDVA 1D4ZA 4FJ2A 3W3AD 3NJ4A 3SG0A 2JBHA 1L9XA 3GNTA 4DLAA 1OPRA 3CNBA 1MNAA 3MN1A 1QAMA 2RGEA 4HGZA 1ADCA 2BSQA 2EJBA 2DGDA 3QKSA 4J1SA 3RTGA 5B4VA 5CDSA 1P2BA 4BVHA 1Y6FA 3G17A 5CBPB 1HQCA 4IDQA 4I4NA 1JKJA 1YB7A 4BO2A 1GL3A 1L8QA 4X92A 5KJ1A 4FYYA 4KXMA 1DAIA 4BX2A 2CN1A 4RELA 3ZH9B 3U09A 1IHPA 3UC9A 1ZIDA 5FADA 1OX4B 1ZK2A 2FZ5A 2ZSUA 3Q1LA 1QB7A 5A4AA 1AUVA 3L3BA 1LB1B 3A2KA 4JNKA 1JU4A 3T3OA 3DTVB 2ZJZA 4HWKA 4PVCA 4TOIA 3RS4A 4P53A 2IBMA 1P2VA 5A5EA 2W4QA 5FUMA 2W98A 4QDXA 3A9WA 2YASA 3MYYA 2PYIA 1RQNA 2GJSA 4S24A 1SCQA 1L4GA 1NJFA 4XX0A 2ZUVA 2MINA 1NASA 3MPOA 5BSUA 4H6VA 3O8OB 1HFKA 1ZSVA 4M6WB 4WNAA 3W5DA 2AKEA 1YVUA 4NYJQ 1T2VA 3UK0A 4K28A 3NUQA 3ED5A 2Z3ZA 1H2RS 3A9RA 2YJ6A 3V8VA 4IAOA 3WQSB 2QRVA 1GT91 3JQ7B 5HZHA 4DCGA 3NM4A 5LMNB 2ERCA 1VYVA 3G49A 1BKYA 3SSOA 2VYCA 3KTDA 4FEYA 1NVBA 3QY9A 4BV2A 5LPNA 1EWTA 3UA3A 4ZV4A 2O54A 5B12A 1N7JA 4A23A 3ZLJA 1OZFA 2ODNA 1T91A 2QX8A 3V4SA 1P81A 3CZCA 1DBWA 3IOMA 3I4FA 2D5LA 5TR9A 3K1AA 5TX7A 5K3OA 2IK8A 5K6TA 2O8CB 4M0PA 3BGVA 3OKCA 1CUIA 2HRRA 4R0MA 4BO9A 1QGOA 3WFJA 4OQYA 5I5GA 1Y98A 1J1ZA 1ZL2A 3F71A 3OEHA 2PBRA 1A4IA 3TNFA 4JT9A 2GESA 4L07A 3U5TA 1YRQA 5KCMA 1DJNA 2QRKA 3NT5A 4PRYA 3UBTA 4LVUA 1T2DA 4ZYTA 1QHHB 2HA0A 2PWYA 2FUG1 5DCLA 2J9GA 5BMVF 1J0CA 4EVIA 1L4LA 1OYOA 2PH3A 3QFFA 1MU0A 4WUVA 1JLMA 2AKAB 1X9HA 4URFA 1A7JA 3ZCRA 2KBEA 3H2SA 2Z2KA 2XE4A 3GGJA 1BMQA 3B13B 5CG1A 1MH1A 5L9AA 2YXPX 4IGEA 2J0UA 1YZGA 5LQNA 2BD0A 3DF7A 3V1UA 5C81A 5CA1F 2GN2A 4OAPA 1DT3A 3COZA 1BDIA 1JKJB 1FVFA 2CXOA 4FSXA 4I1YA 4LXHA 1MB3A 2A9JA 4DR1B 4LZPA 2JARA 3VR6H 1FTGA 1WBBA 4GBGA 2PGDA 3ESBA 3HRKA 2XIQA 4Z49A 4Q39A 3ZDCA 3WJ1A 4G9EA 3ZCUA 5FRDA 4ARZB 1I24A 2XUHA 4KQ9A 4EL0A 3QP9A 2ZXFA 4NBSA 2MSEB 2QGFA 2QN2A 4R05A 4Z9FA 1OBFO 3DNPA 4LDAA 1ZD5A 1L4HA 1SZJG 3STXA 5JAZA 4XGQA 3H2YA 4P4TA 4B6SA 4QTYA 2G5GX 5JZ9A 1H2HA 3MWEA 2NZYA 2HGZA 2G4VA 2CJWA 2HF2A 4WLOA 4GKKB 2XMRA 1SUIA 2ZFUA 3ZGLA 5CM2Z 1E2IA 1OVMA 1Q95A 2WWFA 5DOVA 4B73A 4PX9A 4APBA 2K4MA 5J2TF 4YGXB 2XA2A 1KOFA 4FGSA 4RF4A 4W5HA 3E2PA 1HE5A 2QZ9A 4E7PA 5GINE 2O3RA 3T3DA 4M9ZA 1OJ7A 1KK3A 1SXGA 3CCFA 4O2AB 3KTAA 3G8BA 2F00A 5DT2A 2DR0A 3TV2A 4M7RA 2V0CA 1N6RA 4GF5A 2XGMA 3EBLA 4C0LA 2NVWA 3EXEB 3AU8A 3UWSA 3JYLA 3AG6A 1SOVA 3V48A 4C21A 4Y0VA 4ZHQF 4RTNA 4QKQA 4BO7A 3STHA 2HU2A 1KBOA 5L6LB 1OHHA 4IIVA 4FS3A 4RTRA 1TQDA 2DFTA 3OQVA 1MR3F 3PJEA 4ISBA 4NZ9A 1M83A 4KXLA 4BO0A 3ND6A 4DS3A 1DJLA 1U99A 1D5WA 5EHZA 4YCLA 4RK0A 4Z51A 2ZREA 4P4GA 3T7IA 2PM8A 4J0IA 3WWCA 1K88A 2JFVA 3RROA 5E6UB 1OPXA 2C5BA 4UE6A 5GY7A 4JWTA 1K4KA 1P1BA 1VJ0A 2J4CA 4ZOCA 4WV3A 1NR7A 3GNSA 1D04A 2QQEA 2SKDA 1JAXA 2OGSA 1Z5NA 3PFIA 4PZDA 4EA9A 3ETNA 2IL1A 4W9RA 2HI0A 1FLNA 2I55A 7ADHA 1DQYA 3ORHA 5EINA 1FP6A 2QTMA 1D1QA 1GU7A 1RLJA 2ODPA 4GSKA 3OTHA 2GERA 4MUYA 4MJLA 3U31A 2J0SA 1CF4A 1QOZA 1VCHA 4QEDA 4YB8A 1II8A 1M2EA 1BJRE 2W37A 3JQFC 3K9WA 1CQJA 4V38A 5D3MA 4CMEC 1CETA 4JYPA 5EY5B 3M1LA 2IF2A 2V7WA 3F4KA 2QX4A 3PXEA 3Q8WA 3HKEB 5ESDA 3PCXA 3EVDA 2W6MA 4QOGA 1B76A 3PQDA 5EXEA 4NOLA 5JASA 4B3TB 4ZA2A 2J31A 2I2FA 3TLEA 2O3TA 3HUFA 3I1IA 1D2GA 5LDGA 4PN3A 4Z6KA 4MZXA 1V1RB 2EJVA 3TSWA 3QKWA 3C6YA 3FHTA 3LZCA 4E7OA 4U7PB 1LLQA 2JGAA 2X8JA 3G9TA 4C3OB 4QDZA 3U4QB 2ZR9A 2AMYA 3IHKA 1MHPA 2W6ID 2J3IA 3QU5A 4HYTA 1AJEA 2X9GA 1HSOA 4TQ9A 4CLXA 4JYMA 3F7TA 3V33A 4M8KA 4XLZA 1XYYA 1T6ZA 2C7PA 1T9DA 4DF3A 5L8VA 1CYEA 5BUQA 4FC6A 5AK3A 2HRZA 1ONOA 1TMKA 3KPWA 1DSSG 3GLUA 3HJAA 1RCTE 1BMTA 1MPTA 1FPMA 1AY0A 1GSAA 1NKSA 1WG8A 3QE3A 1Z2OX 4TKMA 1ZCAA 4MA4A 1RNLA 4D8UA 1G7TA 1HTTA 3EJ6A 3G7UA 3WS7A 1JJAA 1SUCA 2R6CA 1RLTA 3CO5A 5A2QA 1F51E 3W8EA 5KC8A 5HJ7A 1QRSA 3EMKA 2D1YA 5HIJA 4RA9A 2OFFA 4YCAA 1F8XA 4NFLA 3GLGB 1RM5A 2OOKA 1RMYA 3OPXA 1GG5A 2CC2A 1HLPA 3OA2A 4S0XA 3ZIUA 2OC9A 4QARA 1G7SA 2D5CA 3DE5X 3COSA 1LZKA 4YUVA 3V2UA 5IAAA 3ED1A 3W5VA 4LAFA 3ZCPA 3WWPA 3F3KA 4K9MA 1AS0A 4QPCA 1BEUB 3GZNB 5B3AA 4BO1A 5IJ9A 1O0BA 3MHTA 1FDVA 2PT7A 3D7MA 3KV1A 3MCWA 4TWAA 3UC5A 3ZTTA 3PPWA 3DQPA 1A0OA 3BXEA 2DWUA 2O48X 3C8UA 3P5SA 4MRVA 4WJLA 3E27A 3AM1A 5LSAA 4GEKA 3VHRA 4AY2A 2NP7A 1QU3A 3Q3VA 1TW3A 4AQDA 3PL1A 1XCBA 3AI2A 3IESA 4EKEA 3Q88A 4YPVA 3DZBA 4HVAA 4I4TF 2Q7DA 2IEIA 1P45A 2JFFA 2C83A 4NPHA 4RVHA 1YMQA 2QS9A 1IBKB 2GYUA 1G16A 3HBFA 4LV6A 2A4KA 4JCCA 4M98A 1UJ4A 2D13A 5ALVA 4MJXA 2YYSA 3UF0A 1DVRA 1YU9A 2O1EA 4MQ5A 1XEXB 2V97A 4C6RA 2AZ4A 3R5SA 5H3HA 4C3UA 1EGVB 2BJVA 1Z2EA 3L8HA 4BJ6A 4R81A 2F43A 3VR4D 1RVV1 3GA7A 1Q0TA 5LZ4A 3TW8A 1L3BA 4NP6A 4QU8A 4IINA 2ZTUA 2ZSIA 3A9UA 2I2CA 3Q12A 2BFNA 4L0DA 4RIGA 2J3HA 4TTQA 4RFSA 2CLSA 2WT8A 4BLWA 1UJ5A 1VJTA 5EOVA 2VN8A 3BMXA 4FFDA 3RVLA 2R8RA 4BKPA 1G2PA 1JV2B 1UQUA 1G2QA 4X93A 1T8YA 5IDYA 3LUJA 1PQUA 5HYVA 1N6KA 1FMCA 1EP2B 4I9HA 2JK1A 3BB1A 4KNWA 4P3YA 3Q0IA 2D62A 4X24A 1UJNA 1A9PA 4PS1A 1EAYA 1U0JA 1CUXA 1XZBA 2RONA 1NF8A 5F73A 3FPAA 4PZ0A 3UK2A 2CDAA 1RAAA 1BH6A 1Y3HA 2OXFA 3JXEA 2ONJA 1X3LA 3UXYA 1SELA 1RTTA 5CVDA 3VO8A 2CNDA 3VNRA 5JJCA 2BEVB 1E66A 2IVZA 3Q1KA 5F52A 3VO1A 4CHGA 2C2OA 1UWKA 1V7CA 3D59A 1CY2A 2R47A 1DRKA 3OWHA 4WHMA 4ERXA 3TRIA 3A25A 2YZ7A 2J30A 2PT5A 5D2CA 4Z0NA 1QIGA 2QUZA 3UVEA 4EG1A 1D1PA 1H85A 3D2AA 4OCZA 2P90A 4HWTA 1PZEA 2PGAA 1EFTA 4AY5A 3R1IA 5EUMA 1FRQA 3MT9A 4GPBA 4AMYA 3V4RA 3EYWA 4KGDA 3WBKA 4W7IA 5JARA 1K6IA 5AW5A 2VH2A 1TO6A 3N2GA 2R4TA 1GKLA 1J21A 3LC1O 1P31A 1V5GA 2QU7A 5CGZA 5DGCA 1KAQA 4HUTA 1NW6A 2QDXA 1UXHA 3BB4A 2QM8A 2ES4A 4GOOD 3MTDA 3P52A 5IP5A 5AVOA 5IT0A 5K3FB 4C43A 5DMXA 4TZTA 4RJLA 3VKFA 4XWWA 5B7QA 3DB2A 1LDMA 4HNAA 3ROKA 4LYDA 4J16A 2Q3JA 2QP3A 3EDCA 1U0HC 5AKJA 4R98A 2M32A 1GL9B 2ST1A 5FBWB 4F2GA 1GJRA 1T15A 4IIBA 1Q15A 2C1EA 3A3NA 3DP7A 3DVQX 4L5IA 2HMVA 5IM5A 2B9VA 2V98A 1WZIA 2VHQA 4UTNA 2GKGA 1Z22A 4XX1A 2EW2A 1BDJA 3P0JA 1ZZEA 2XR1A 1BKSB 1ECBA 2DETA 1RJDA 2OILA 3AF5A 1EFPA 4LCJA 4MGEA 1XE3A 1X87A 3M1YA 5GZ6A 3M3DA 3VC3A 3VFDA 4BU1A 3SDZA 1L5HA 2VAMA 1VKOA 4WK6A 2YJTD 1EFVA 1ZY2A 4H3HB 2B8JA 3P2KA 5L3QA 3S1SA 4ZKDA 4KZKA 3PVSA 3E4DA 1SQ6A 2I91A 3B89A 3DM5A 4P2GA 1FNCA 2EZTA 1NKTA 1GUZA 2VDMB 2H1RA 2R84A 3GLSA 1B00A 3LXRA 4Z2AA 2WKRA 1G2IA 2CDNA 2VKQA 4IX1A 4XE5A 1EVQA 4IGAA 5EESA 2AJBA 4DNPA 4TTRA 3AUUA 2JBAB 5EHIA 2WFZA 3HZZA 1ONPA 2PZFA 1KMCA 5IWAB 4LNUA 4HB2A 4MWSA 4LHZA 2PGXA 4N7MA 3W2FA 1E1MA 1PU2A 3ODGA 3S1AB 2QD5A 2XE7A 4C2AA 2IHYA 1R9JA 1ZRSA 4LPSA 3WO1A 2YZKA 4BKMA 3BXHA 1UEXC 4DV6B 3HJRA 3CVOA 4WE3A 3DV0A 3LLUA 4PYNA 2E37A 1JAHA 2E89A 5U4XA 4CM7A 2VWQA 1K2WA 2OMKA 4BB0A 2Z2YA 2R65A 4EJSC 3NRBA 4L5CA 2LPMA 2XDYA 4OTZA 4AVYA 5EERA 1OLSB 1UBMS 2BE9A 4W1PA 2AT1A 4PAMA 4JIGA 3MWDA 1G21A 1MHTA 1RWXA 4YRCA 2EKBA 2WV7A 4J4BA 5JATA 2QMHA 4O3FA 3V6MA 2PYDA 3VR2D 4F12A 4YMGA 3E1KA 4HSEA 1YTUA 4L4XA 1JMKC 1GPMA 2XCQA 4J1TC 2ZUTA 3WMXA 4EECA 5AXAA 2PVCA 3Q11A 1H65A 2ZP1A 3LDGA 3JQ8A 4R83A 3GRVA 2I67A 1E5XA 5FPPA 4B3BA 4E31A 2H4WA 2HCJB 4UBKA 1NDQA 4XUDA 4YACA 4CTJA 5KTKA 5ALEA 4WNAB 2WQ7A 1PJSA 1TU0A 3FPGA 2B0CA 3F6CA 1CZHA 3QG1A 4AZWA 2WYHA 1CEQA 3GOQA 5FFFA 4D8VA 2RJNA 1V3VA 1JW9B 4CG1A 2BMAA 5E2IA 4G6ZA 4UKDA 3RSHA 1R6AA 5KNDH 4NBUA 1KMHB 2C58A 2RAVA 3CZPA 1BMFD 1NJGA 3ELYA 2POQX 3PQ4A 1O6CA 4M89A 4DW8A 2PWAA 5DBFA 1G4UR 3KQPA 1K4YA 1YZHA 3PEFA 1GGMA 5KYXB 3NBKA 3DLPX 5HTKA 4L4YA 3ROFA 3I37X 3IAFA 3ZWMA 3H3FA 1HPLA 2UYCA 2OVBA 3MD9A 2R96A 3DV9A 3RRYA 3PWZA 1CUDA 2J5XA 2BMEA 3NTOA 3T1OA 3ZS9A 4EUEA 1ZU4A 1XQYA 3OQHA 3RK0A 1R10A 3EIUA 3K5WA 1XXHB 4IJKA 1Q0PA 4CTNA 3PTZA 4ABTA 1J8YF 1OLUB 3D6TB 2ZPUA 3F3SA 1C50A 3KYCA 1KDTA 4R01A 4COKA 2YFHA 4IX9A 3IAM6 2K6GA 2Y0PA 3ZZUA 1GNLA 4Q00A 1S3IA 3VHQA 4NL4H 5HR5A 2DBRA 1J49A 1XCGB 5JIBA 4WI1A 3DEKA 2EGHA 3HFRA 4LV5B 3B1YA 4RU1A 4TT3A 5AUPB 1E7YA 3IP8A 4NLLA 4UBIA 5CYOA 2W2TA 3SZGA 4W6QA 5HKAA 3PC8C 4NNJA 3W6OA 3FWNA 4XJTA 5CX4A 4B3IA 1J33A 2OB2A 3EC7A 3OFNA 4LIPD 3TRHA 2WZQA 2Y1FA 1QDEA 3RUCA 1PL8A 5ICCA 4H0CA 3F5DA 4JLPA 3NHYA 4Y98A 4YEDA 3T3NA 3DZFA 1QIFA 3UH0A 4MCJA 3EVEA 4HAXA 1G0OA 2Q5HA 2J5BA 1FRVA 4B3JA 2R1VA 3OM0A 5KSWB 3U3MA 4GDMA 2J0VA 4YDHB 4E32A 1R88A 2ZRDA 3DL2A 4PLCA 3N8KA 3U7QA 5B4TA 5JD4A 4GX5A 4ZO8A 5MFPA 5T6BA 4EABA 4FI3C 1B6SA 4BLUA 5GIPE 3UAZA 2H1OA 1YQUA 2PRIA 1XZMA 2NU8A 4KGZA 1J70A 4DLYA 5CYFA 1WMAA 3ZIAD 2VT6A 3PI6A 2SNIE 4LZJA 4RZ3A 5ENZA 2O7NA 1W6UA 2KBFA 1P18A 3OLVA 5C51B 4B34A 5LJLA 3OZDA 4LI0A 3ZDZB 5L7WA 2QR3A 2ZYAA 2JJ2D 4YR7A 4XGIA 4ARIA 5KBYA 3LPAA 4TZKA 1RDFA 1HE8B 4AKSA 2B7BA 3I8XA 4JEMA 4R5MA 1UFKA 4J9VA 2OV4A 2CLKB 5FTNA 2X0EA 4RTLA 4TVKA 1QFJA 3A32A 9ATCA 1OXSC 4KE8A 2YUTA 1UM9B 4RSGA 1T9CA 4RIIA 1TCCA 4TMWA 1P60A 1EKXA 1JQDA 2WQ6A 5CB6A 1KZ7B 1KL7A 2GEVA 5ADHA 3VXKA 3CF6R 3ZZTA 1V5FA 1BVRA 2RARA 2F43B 4L0MA 5AW4A 2ZIAA 3UGTA 2HU8A 3EQ7A 1TYEB 5IJXA 2RHGB 3CUYA 4BNJA 2BVNA 3HJTA 1M72A 3WRXC 5ELMA 4QTZA 1O6ZA 1TI7A 2NPIA 1XKXA 4KE7A 4DSZA 5LZ9A 4A10A 4DA9A 5C1PA 1ESMA 1UDWA 3LLVA 1LRKA 3ZHRA 5CM9C 5FDFA 4ZU3A 3RT9A 1VKHA 3IUYA 1JQJC 1NIPA 2OB1A 4ZMSA 3FZGA 4LE1A 1XZPA 4HZIA 3ZI7A 4IOKA 4K6HA 3VHXA 3LHDA 4NH4A 1XRQA 3HYRA 1AKRA 1QP8A 4U0JA 1G5QA 3NTXA 4Z9XA 2AWNA 3UFBA 2FPGA 3B6IA 2QLFA 4TS3A 1MD9A 4QAQA 1NG9A 4D4IA 5IBRA 2IXAA 1RKUA 3RD8A 1JT2A 2C9BA 2CXHA 3MJVA 4PVDA 5IDQA 2VL7A 4W5RA 4RDXA 3CURA 1DHRA 3DFFA 3EZ6A 1K86A 1Q84A 3IUQA 4TSKA 3LHIA 1SURA 1YSCA 3IIEA 2OBNA 2WR8A 1ZW1A 1E18A 3TSOA 5MN5A 2WJZB 4EH1A 2X2FA 1CERA 3USES 1U7DA 1YOVA 2YWHA 3EWNA 1QYIA 3U9LA 4B7XA 2OY0A 3F0TA 2VZ9A 3M5PA 1U8CB 2C4WA 5G3YA 1OF1A 1F6DA 1M34E 1GNSA 1ZIXA 2D1QA 3NUZA 4K2AA 2CB0A 2YVKA 4EMBA 1QYCA 2E4UA 2VBGA 4NYMR 2DPGA 4MV0A 4JC4A 4YH1A 4C6TA 1E6EA 1LLUA 2LW7A 3PUHA 4Q19A 1P1HA 2UUBB 1WMDA 2FG7C 2ZKIA 1UBUS 3G2PA 4KJXA 3ZLTA 3FOEC 3EC2A 3FLAA 5DT9A 3DBVO 3JWJA 4U4AA 1M73E 1X38A 1O54A 4L2IB 4GLFA 1QHIA 2B5VA 1Q74A 1WVIA 3K1AB 1H4TA 1KIAA 1P77A 4OHPA 3OFSA 4HJXA 4NBRA 3GCXA 4RH3A 3CPEA 3DKPA 3W1EA 3KB8A 2JJ8A 1N2SA 4X95A 1HLGA 4G4SO 4QXQA 2GWRA 2XNHA 3EFOB 4RAQA 3L4EA 5HW2A 1UL1X 1C1YA 1RAHA 2ZAYA 5JCOC 2RDMA 2OZPA 3PGJA 4ZI7F 3G82C 2C2HA 2G1KA 1EK5A 1NQWA 2IYLD 5EJFA 1HDXA 4XWGA 4M6WA 1TZCA 1OI2A 2ZIZA 5B1HA 4B83A 1LDNA 2DQ4A 2CZCA 1JBEA 1ULBA 3L2OB 1P91A 3PHHA 4N3BA 4X1KA 4CL2A 4F92B 1ORDA 3RM3A 3CRQA 3D3WA 4FCWA 3ZQKA 5FTJA 5JH7A 3D4NA 4RHTA 3EVAA 4Z8YA 3O4HA 2X9LA 2A0FA 5CNMA 3PNLA 5K4AA 2OD9A 3G0OA 3EQZA 3QEBZ 4OJQA 1FTWA 3MWGA 4XQ0A 1QX4A 4G85A 5JYCA 3BB3A 2RK4A 3U1BA 3D6VA 3RIMA 1NUSA 4RMGA 2BF7A 3T9AA 3JV7A 1NGSA 3D4LA 3LVQE 3F1KA 3NATA 1CJMA 1Z8NA 3WYEA 4Z3KA 1OBOA 3FBGA 1QUEA 3KYDA 1KO8A 3ENKA 2E9SA 3VJLA 1K6JA 1TJUA 5BR8B 4PCLA 5BN4B 2QXYA 2W8ZA 2IIVA 1R4MB 2CFIA 1IHYA 1O5TA 5U4QA 5B53A 1FBNA 4KMSA 4R9SA 1AU9A 4QICA 2IDMA 2TECE 2V9CA 3HLTA 1KJWA 3MF4A 3DEAA 3RVMA 4R3UC 1QYWA 2FYTA 2NUAA 5A7HA 3AG5A 3T54A 5K3FA 3NTRA 3T9DA 3VPAA 3PNBA 1DIBA 2Q46A 3GV0A 4TN1A 4JVLA 4QYXA 1ISSA 1N6IA 4N49A 5E9WA 5U9CA 2YMLA 2H2WA 2EP5A 3ONWA 2BI8A 1KEPA 2G6TA 2GAJA 2W00A 3EVFA 5ETJA 3FMGA 4RVDA 3S28A 4DXDA 1O9GA 5DTIA 1EXVA 1LDBA 1ZRMA 4R1OA 2YVQA 3QPUA 2D1SA 2N9UA 2AN5A 2A33A 1ISHA 3ZY2A 1TJ3A 5D6BA 3M6FA 4Z4QA 3CRMA 1MAAA 3HZRA 1IN4A 1J6UA 3T5MA 1NJ8A 3EF1A 2AMLA 2BFWA 3DD1A 3WLSA 1Q7TA 3QLUA 2GEDA 1LLCA 2HADA 2CKDA 2HLNA 1UXKA 1Y1LA 1PT9A 3BCUA 3G8YA 3HNPA 4RZ2A 4DSOA 4GX0A 3OMWA 2HRCA 1MXHA 3CVWA 4BFVA 3SF8B 1HETA 4MVXA 4B33A 2FPMA 5BO5A 2H1LA 5DTQA 3UJ8A 2W90A 1ZUD1 2CZQA 2P5TB 3IMCA 5B55A 5IZ4A 4X1IB 2IHNA 2WM8A 4B4UA 3BE5A 3D8TA 1LPNA 1UFOA 3DW3X 1XA4A 3IJPA 3WWZA 1K9SA 2JI4A 3KKQA 4QVGA 3ZWNA 3LK6A 2D7CA 1BKDR 2QY9A 2YYAA 4GG1A 1UFVA 4ZCLA 3AEKA 4EEZA 2H00A 3BBPA 5COQA 3U7GA 1KTIA 1HLFA 3Q8MA 2K7ZA 4K8OA 1CJCA 1KY4A 5F91A 4E22A 1HY1A 1UBCA 2HRBA 1WCV1 2RGGA 2ZBEA 4OU5A 2FUEA 3E5RA 5FORA 5CJPA 4CW7A 1EUDA 2BGIA 2DHEA 1ZXBA 4DUGD 4FS8A 1B0UA 1JSXA 2R6ZA 1P39A 1T34A 1XL1A 2BKEA 2V6JA 3DHEA 4AURA 4H1WA 2O8FA 1JPNA 1NG1A 1YOBA 5F1KA 5HKLA 4DMRA 1FNBA 4JP8A 3K9FC 1Y8ZA 1U8ZA 4MRNA 4TROA 2G80A 3BA6A 1A5SB 2IY9A 3C48A 4NONA 4DY6A 1RPZA 2CGEA 1PFWA 4ILKA 4ZHSA 3CRW1 3DMHA 2CCKA 5KSZA 4WY8A 1WB5A 1A9OA 4A1FA 3L8FA 2HA4A 1R9NA 3OPYA 4X1KB 5JO9A 3UPTA 4WOJA 2ZRAA 1RRVA 1GR1A 2EZ9A 3UCXA 1DXOA 2GBCA 3FDIA 3BD6A 2ORIA 3A3PA 1HK7A 3AESB 3WZLA 2WK1A 3RABA 4ZEOA 2HIMA 3PU6A 1Q7CA 3KVVA 4JJZA 2Q1WA 3ZV4A 4F9EA 3VVCA 721PA 3OETA 4KXWA 3WHKA 1RZRD 4P36A 1WXFA 4MIOA 1DPGA 4A2CA 1OA1A 2O8NA 3BMOB 5CT9A 2IBTA 4WTOA 2C2GA 1GYQA 1M2NA 1K7YA 4DIKA 2Q2NA 4I1RA 3OU6A 1SBZA 4O4HB 1N3YA 2M6SA 4JQZA 3TTWA 9GPBA 2HRQA 4AJPA 1N2ZA 4Z4EA 1QKIA 3JAMA 4NEHB 3OO1A 4D1YA 2FSVA 3BJZA 4TZ6A 2P2CA 1L4FA 5CVCA 3DR5A 2J0UB 2AG6A 2X86A 1JH8A 1YT5A 2X40A 2YYZA 2P2SA 2VLBA 1FFGA 1A8HA 2N47A 3I2YX 3W9UA 1A8IA 3RU3A 1RKXA 2K87A 4BV9A 2ZSJA 1XNGA 3X1YA 1XLUA 1JIJA 3AWIA 4BDTA 3ERCA 5EZ5A 2XIJA 3MCZA 1F60A 1O94A 4Y6QA 3D7NA 2JBAA 2MSNA 2A7XA 2HHCA 3Q3IA 1CQWA 1N6OA 3U44A 5ALTA 2ZRIA 2EKPA 3GN1A 4J7UA 3HO6A 4RIFA 1OX4A 3W4KA 4DJAA 3MBIA 4ZAFA 2Y1OA 4RC9A 2C2KA 5INTA 2PUGA 2JJYA 3EXG2 5BN3B 3T3MB 1VYTA 4F06A 1GAXA 3IT0A 3FAZA 4B09A 2NTNA 3W2TA 3ZQJA 4DA6A 3ZDXB 4D9IA 2YHBA 1E1CB 2VNKA 3QKIA 5ICMA 4O3MA 2DMRA 3TM4A 1ZSNA 4DQLA 4V0KA 1AKEA 2ORVA 3A2LA 1KI2A 3RHSA 1V7ZA 4EK9A 1ZS9A 3DWGA 3KXLA 5KINB 2M6KA 1IVSA 2YR0A 3AVWA 3K7EA 4AYWA 4R9UC 5CAEA 4WLFA 3RARA 3ZWWA 2CNWA 3M6AA 4BPBA 2VYVD 4LF7B 1X42A 2FN8A 2XUJA 4GOXA 3TDNA 3OIVA 3DCYA 1ND5A 2H1VA 3GJ4A 4YAJA 4YT2A 5IC4A 5T7BA 1EM6A 4C7VA 4F7WA 3OIWA 4PG8A 3PGKA 2GD6A 5K8IA 5KHOC 3SQOA 2H11A 3CG0A 3PRYA 1S4QA 3HVHA 4X62B 3P8ZA 4L6CA 4HVLA 1EX6A 2HIGA 5C7YA 1MG0A 3EXIA 4J76A 1ADBA 2VDKB 1I4WA 1GRQA 1QCYA 3PDIA 2NV6A 3LRTA 4X1YB 5JEDA 1YUMA 3I64A 4EGAA 4ALKA 2PUCA 1HT0A 2HA2A 3OZEA 1R00A 1RXIA 1XFDA 2OSBA 4TTAA 3R0IA 4OHVA 1CRPA 2JH9A 3JVIA 5FNVF 2BM8A 1JBKA 1MB2A 1YA4A 1Z5VA 3C14C 3ZQ4A 1XEWY 4WZAA 4NJOA 4N6GA 1E3EA 1IW7D 3MMZA 1MABA 1ULZA 2R68A 3UMJA 1CDDA 1BXKA 4RQTA 1A9ZA 1MT3A 1JQLB 1LSJA 1MVLA 1WMFA 4HXFB 5YASA 4YI5A 5HRAA 1V3QE 4I81A 4OBEA 1IXZA 4H0NA 4RZSA 5DX8A 3AHEA 3V8PA 5CX1B 1G9SA 3FHCB 4XVCA 1Z39A 1E6UA 1M9NA 3VPCA 5B36A 4LC1A 4N8SA 1CUVA 5F33A 2FU5C 2J6CA 3D81A 3PFKA 4AZ3B 1BVUA 1ST2A 2J9XB 2KS6A 4R6XA 1DBRA 1JSZA 1WMBA 2FR8C 4ZGWA 1I10A 4WA8A 3MA0A 2OG1A 5DJ5A 5E38A 5DK4A 1D2CA 1ZGHA 3WNQA 3FPLA 1XZIA 3M1IA 3L7DA 4K46A 2IYWA 2C88A 1FY2A 4N6OA 1U4OA 4B8ZA 3O94A 3SJZA 1MX1A 1CJKC 1V16A 2IUFA 5AXCA 4LOAA 1ZJ4A 2DFVA 5CB0A 1HE4A 3MIIA 4UC0A 2QXUA 3T4UA 3U40A 3UTDA 3EUAA 4B6RA 1MOZA 1NUAA 1QFMA 16PKA 2J9RA 3QEOA 4Q7MB 4DA0A 3FI0A 3B6MA 2JGDA 3DO6A 5KVQA 4BWFB 1SRRA 3JQDA 2C3PA 1L4EA 1WABA 4ITVA 3SQDA 1GNTA 1I6WA 3IOCA 4EYEA 4NZNA 2I76A 4C3ZA 5IDWA 4IDGA 4TUYB 4TL9A 3DP9A 4C78A 1ZP6A 3ASUA 1N2CE 2GXUA 2Z04A 2WKWA 3QJGA 6GPBA 4FK8A 1K2VN 1M8KA 4LJSA 5LBTA 4I55B 2FW9A 2Y05A 3AKYA 4IBOA 3PENA 2QWXA 4CV0A 1XEFA 1YGPA 3BH0A 4HQNA 3QITA 1LCIA 4LHVA 4OAQA 4NU0A 4HB4A 4ICIA 4RFVA 4E11A 4OP3A 2C03A 3R77A 1IZ9A 4YLYA 2HU5A 2V54A 2VTKA 3QWFA 4A8HA 2HX1A 2VJLA 5J23A 1QDUA 1SCAA 3GLHA 3AV0B 5I9LA 4MJ7A 2ATEA 1X8JA 4MULA 4BLTA 4P2BA 2ZSKA 3TWOA 4KSYA 2X19A 5A2GA 4GI5A 3ABZA 5I5EA 5PGMA 4OFBA 4NU8X 2NSYA 2JGLA 3FMPB 3HDGA 2JEOA 1ZPDA 3HB9A 5LA6A 5ITVA 5DCWA 3ANNA 1PGJA 3AF0A 3IT2A 2V0NA 2H48A 3PDUA 4CFSA 1QHEA 5HHTA 4QRIA 1S1CA 3WKDA 3WK8A 1SFRA 5M34A 2AZXA 2ZROA 3EE6A 4D82A 4U2DA 2LDXA 4DSNA 4KYVA 5K8VA 5TQ0A 1VECA 5K6AA 1Q3HA 3IUMA 1V4BA 2WWXA 1G21B 1BE8A 2GAIA 4NBTA 4YAWA 5C37A 1CY0A 3C5VA 3RTCA 3V4PB 2XB6A 4V3CA 3DOHA 2V4ZA 2FUNB 5LQSA 4TYMA 4Q1VA 3GA0A 4RPCA 4PYJA 5ADWA 1Z68A 3K92A 1K6EA 3PQFA 4OSEA 5I4IA 1DU4A 1N6NA 2ZE7A 3SXJA 2C8JA 4WKPA 4GC9A 4YAOA 3MERA 4YMWA 5F92A 1WSAA 4S1WA 5CDFA 3TOCA 4S05A 3S1AA 1BZYA 4FMDB 1DXHA 1XD2B 4FNGA 2EFYA 4ZK6A 1EE2A 4IFBA 3PYXA 4Y6GB 4ETIA 3H65A 4WLNA 1ZCBA 2F1RA 1A88A 3LD9A 2RCYA 2V8BA 1L7EA 4U0KA 3FNEA 4P31A 3X3HA 4PC3A 3FUUA 5JNSA 3SP1A 2IKSA 1CQJB 1V3UA 2X6QA 4PBSA 4ZOLA 4ML3A 2X42A 3GFQA 2JD1A 1JXOA 4IWNA 3THWB 1TFRA 2CV0A 1W7AA 4PR0A 3CVUA 3KB6A 2BTEA 4B9AA 4EGCB 3KB1A 2ZLBA 1PR2A 2Q4TA 2ET6A 3A6EA 5B37A 1QMGA 3J7AC 1N75A 2ZCUA 3RDPA 4YMVA 3JX9A 2V0GA 3KZ1E 4MTCA 1WP4A 2AHOA 3GP5A 3D0RA 2BONA 2BGRA 2I87A 2XWBF 5FOSA 1RW4A 3B1ZA 3AEXA 4GFDA 1W5TA 5JTUA 3F4BA 4TMTA 3IMFA 2D1FA 4QGBA 3PD0A 2FXIA 4HGPA 1V39A 2HF7A 4WXPA 1NN5A 2BDUA 2P9HA 1ZXLA 1XDBA 3AR9A 3REGA 1GGHA 3C45A 3FRHA 3TQOA 2PLAA 4EVSA 1ACMA 3G1TA 5JS1A 1E1LA 4FMCF 1NW3A 4YXWA 2RG1A 3O2JA 5I8ZA 1OZAA 4LRQA 3L4JA 4RTSA 3WSTA 3GEDA 4R3WA 1ZIOA 2I65A 4P5PA 1QR2A 2F2TA 1JR6A 4X94A 3ICOA 4YMTA 4U2CA 3AUFA 4BDSA 1HO3A 4Y6SA 3MRSA 4L0CA 4A6PA 4P4NA 3ZI4A 3H86A 3K72B 3VTAA 2HH9A 5HTOA 2CV2A 4IVNA 2MHCA 1VJGA 4CETA 3AEQB 3LPCA 3EK2A 1MXFA 5T4BA 3AOEA 1WSBA 2QDKA 4C06A 4XYMA 5AK0A 1Z4IA 2I7DA 5DSTA 4GVPA 3C6XA 2Y1WA 3VI3B 4YYEA 2HMUA 4WBSA 5BRJA 3RSSA 2H8GA 3H4IA 1VSVA 5B7NA 3SR3A 5C1DA 5HJ5A 1ZUNA 5BSEA 3RHZA 1G98A 1XJCA 3FGNA 3O9ZA 3R7FA 1E3MA 2KWIA 3R41A 3QIAA 1JLKA 2UXCB 1TAGA 5L4LA 4LDZA 2EQAA 3QE4A 1N3LA 4P4UA 2HCRA 2Y8EA 1SMKA 3LPMA 3RVSA 3UJ7A 2GBPA 3EH1A 3ZJYA 1SGWA 2Q4OA 2X75A 3VTFA 1I3OA 5BY2A 1FNNA 2GETA 1VJRA 3ZLUA 3JATA 4YASA 5IS2A 3L6RA 1QHYA 1U1DA 4GKAA 3L01A 3PNSA 1L4YA 1GGVA 2C95A 4PWZA 1QK3A 4JI1B 3TFWA 4C4XA 1HFWA 5EA2A 5EZYF 2VRBA 4DREA 3SC2A 3H5IA 3FSEA 4JQCA 4IO0A 4AMVA 1RAEA 2QN7A 3A1FA 5IRCD 3FTDA 1MA3A 2R00C 5AKYA 3TS1A 3UJHA 2I8AA 4P9NA 4JBYA 4TTSA 4EZEA 1JDBB 4QBGB 3SXUB 4YQYA 4C29A 4NZMA 3S6JA 4U9HS 3ZHCA 2L18A 4C6SA 3RLFA 5A4IS 1Z4JA 1QH8B 2W6CX 4HXGA 2V6FA 4O02B 4OVKA 5CHEA 4BTEA 3U4MA 3M9LA 1LGYA 1UXJA 2FETA 1KA9H 2WF8A 2V59A 4HWSA 4ESHA 4D8WA 5BW4A 4LRTB 5HBRA 5AVZA 1W47A 4QATA 2F3PA 4ENUA 1RLMA 4GE3A 5AKHA 1L3CA 3GZJA 3SC3A 5JXGA 2AVNA 2RHOA 4U2KA 1LX7A 3H5RA 1Q12A 2A7QA 4LGMA 5TE9A 2XZTA 3ZHVA 1XOIA 5BVHA 3VR6D 4PQYA 1KZGB 2SKCA 1WX1A 3DDOA 3OM8A 4Q02A 1P5ZB 4ND3A 2WAMA 4R41A 4FYIA 4YO7A 3V4ZA 3C3BA 1KC3A 2GEJA 2OMEA 1ZX1A 4GBED 4Y2HA 3IQXA 4CT4B 5HE8A 3A37A 3LA6A 2JFUA 4MYUA 2A4MA 3GJ0A 4OATA 1HQYE 3NTLA 2HPHA 1FQWA 3SHOA 3PG5A 1KQ3A 5TPZD 3IQWA 2NO6A 4RYLA 4KWHA 3WKEA 2C1XA 3WXMA 1IPFA 2OHVA 3LCVB 1TCBA 2VDQB 2XMDA 3HJGA 3H9CA 4P32A 4I14A 4DLRA 5KTNA 2HLDD 1Y7TA 3KR2A 2WSSA 3NVMB 3ZE2B 1HDOA 1I51A 2JS7A 3PRJA 4OJTA 1KKUA 1D4AA 1NBMD 2JJMA 5CLHA 5AVKA 5M04A 4HTFB 3HB5X 2YZMA 1JR4A 1YI1A 2RAPA 5LZ8A 3AILA 1BWPA 4K6CA 4MMYB 2G88A 3LIPA 2F1KA 5FA6A 1G42A 3WLTA 5EJ4A 5CFLA 1S3SA 2IZ7A 1EQUA 3T5DA 5AOCA 3QPDA 1ZN2A 7REQA 1GTZA 4P0TA 1V9LA 4Q1EA 2BUBA 1Z07A 3HY4A 4UBLA 3SE0A 4BUJA 4AKIA 5HG0A 3OC0A 1XG5A 2PO7A 3NJ8A 1XP8A 2NU9A 3IV7A 2VUTA 1CLEA 4IDBA 1OASA 3E7PA 1GZHB 4CIBA 5HSGA 4E2XA 2BFBB 3CUSA 2C29D 3L8EA 1I2BA 4LYGA 5AI5A 5AJWA 2HWXA 1YNOA 1VE7A 4I7EA 5B58T 5LIPA 3HA5A 1PDVA 4DPMA 2WF6A 3ZNPA 2CUZA 3JS5A 2BW0A 4KLRA 2ZYVX 5I4KA 4OX9B 4ZV9A 5KCZA 1JHAA 1M2OA 1TFUA 4UD6A 3ZEAA 4CMHA 4LC0A 1KVTA 1U1FA 5F51A 2VO1A 5EJMA 2XXAB 1KYXA 2AN9A 5JWHA 1ZD1A 2R8ZA 3MK31 4M86A 4NZOA 2ABWA 4TMZA 2HWWA 4TXJA 4UBOA 3CIFA 4NR0A 3NPMA 5DM4A 2G7MC 3I1JA 3NHAA 1XXLA 1YQWA 5ELXA 1ZMBA 2HLDA 4JLKA 1C9MA 1CUJA 3OOYA 1ZM9A 1NQUA 1SXHA 4JR0A 4MS1B 3SGLA 3UICA 3WA6A 3GVCA 4JVSB 3A8TA 2XXBA 1N6HA 2G9QA 2WIAA 5EMNA 1L1FA 4V1CB 3CIOA 5AVXA 4FFPA 5SY6A 4KDCA 3DJFA 1O97D 1KDVA 1CXZA 4ZCPA 1QIKA 2PEZA 2FEMA 5AICA 1N2IA 1BCSA 4G1BA 2WD9A 1PQYA 5I9SA 1Y82A 1TLLA 4P0PB 3PDWA 2BZ0A 1W0KD 1F8GA 4N5HX 5SICE 3KD3A 4U39A 3T7AA 2AOTB 1Y8QA 3M0EA 4YHBA 5LLSA 1B73A 3UH1A 4CKZA 2C9DA 2RAUA 4C0XA 2LR0A 4EI2A 1J39A 1ZKDA 1J8MF 3CLSD 5BN5B 1XN4A 3OURA 1W5AA 3O2QB 2QJTA 4LHYA 5I9TA 1FRZA 2CSUA 3JCZA 3JQCA 5IKXA 4W1QA 5JSUA 1T6NA 3JAWB 5HMLA 3KTAB 3PXCX 4WBNB 2ZKLA 1QQ6A 4ZT5A 2ZB7A 4CM6A 2OHJA 4RY2A 1DUSA 3RVRA 4B9EA 2VI5A 3AYZB 4B4DA 3SLKA 5DP1A 1WO8A 3QHQA 4IDHA 5KNCH 3F7OA 1A5AB 2JKVA 2QF7A 3WYDA 3B8EA 3OEYA 5BR7A 3EFBA 4J0EA 1I1OA 2PFSA 2GCNA 1JHQA 1W46A 1TT7A 4Q3EA 1EWRA 2WNIA 4BJHB 1SXJE 3ZXUB 1FUPA 1C80A 3MWEB 4EFMA 2VJOA 3ZJUA 4GKBA 3HBAA 1GPKA 3QVJA 4RVCA 3TZLA 3ZCTA 2HUPA 2X41A 4LYYA 1RHKA 2Q9CA 1JG3A 2XYPA 2F17A 1UMBB 1XTIA 1BAPA 3O3CA 3OEHD 1QH1B 3L79A 3O21A 4HL6A 3RU7A 4AWAA 4CGYA 5LQAA 3ZD6A 5CXXA 2Q3HA 1ECLA 4WEOA 4ZQFA 2QP9X 3DCJA 1F4PA 3HDVA 3T3EA 3W8FA 3CVXA 4Z4FA 3TNDA 1HG1A 2PJUA 2YX1A 2VTBA 1BD4A 1FP4A 1GG8A 3EHDA 1P8AA 5JSYA 1JSWA 5IKEA 1HG0A 1KSGA 2OYCA 2NMVA 2C42A 5A05A 2E49A 3G85A 1BHQ1 4XYEA 3SHVA 4DLWA 1P4RA 2I6UA 2XH8A 2O8DB 3WL3A 2OPBA 4B31A 1EUYA 4TX1A 1XZAA 3GU3A 1XK6A 2EXXA 1DEAA 2GK4A 3L6DA 3PHCA 1TM7E 2HSGA 1I4DD 2JANA 3CH5A 3K32A 2PJDA 1Z0FA 2PPVA 1F0PA 1YZVA 4KO2S 3L1VA 4KBYA 5BUSA 3TJMA 5JSZA 1JA9A 3M89A 2YIMA 2P6RA 1YQXA 3FOWA 5PNTA 3V97A 4G0YA 4NZYA 3P1JA 1E6WA 2FX3A 2OD2A 3GCGA 4YCCA 2OZVA 4Q48A 1BVYF 1KGSA 2HMTA 1QWSA 4ZGGA 3CNQS 4AP9A 5DHFA 5EKXA 1S0UA 5I47A 3OTQA 1E9VA 3TR0A 3DZGA 1GVHA 4L50A 2IUTA 4REQB 4TXMA 5JJLA 4N8EA 5KNCD 1AGRA 1UBRS 3KQQA 3L41A 4IVPA 4KPYA 5KMGB 5KYYA 4NCBA 1Q1QA 4LS3A 1J0DA 4XGKA 3NDBB 3UMVA 1MIOA 3ZD9A 2JEZA 3EUWA 4JBNA 3FBTA 4PSUA 2XUAA 1PW5A 1RLIA 2GLXA 2ZZNA 4XPIB 4OXKA 3OF3A 1JH9A 2H51A 3V4OA 3RYHB 1SO8A 2ZJ1A 2R5WA 4XOUA 1CE8A 1U7OA 1WHTB 5GGXA 3O83A 2HQRA 3UZUA 2HTEA 3RG8A 1M6WA 3A1CA 4KYTA 2I6TA 1MENA 3O8LA 3FIJA 3A4YA 4QYSA 3TLXA 2GRUA 4RZQA 3RPEA 2BFEA 4YWHA 3CX6A 2LV8A 2V6IA 5HS4A 1QS0A 4R8SA 1GD1O 2BL4A 2G06A 3RVKA 4N3AA 3P9QA 3GC6A 3CZ9A 5T3UA 3U3KA 2UXBB 3EZXA 3W5BA 4EPRA 2VQSA 2XNDD 4B3RB 1EGQA 1UXGA 1YCDA 4B3DA 4Y67A 2QTCA 4KQCA 4DMCA 5H1YA 1H8HD 4MQLA 2HJHA 4JLOA 4QOHA 4C5AA 2WTAA 4WA7A 5LD2B 3VZCA 3OFKA 1N57A 1JIQA 1RWWA 3JD3A 1EUCB 3HVIA 4FOSA 4GXRA 4FXPA 3GVXA 3P2IA 2I3BA 2ZYSA 4ZIRB 3B5IA 3B52X 4ODIA 4AMBA 4Z54A 4YJ2A 3OTOB 1X86B 3FWHA 4FU0A 4DA8A 2WIFA 3DZDA 3EGXB 3SS8A 2ZJ6A 2FOLA 4B85A 3JYOA 4MI1A 821PA 1YZ3A 1P0QA 3VYRB 5KSYA 3IVGA 3LDFA 5IASA 3D7SA 2IV3A 2Y9MB 4DUGA 1FP7A 1ELOA 4ENSA 1SA0A 3D1LA 1E98A 2EWWA 5CCBA 3TLGA 2HB6A 3KJQA 1PD1A 4NBVA 1VLJA 1DWOA 2GAFA 1DRJA 1WXGA 1QQTA 4HLUC 2BOVA 3ZU3A 3T7RA 2V7XA 5CNKA 3B1VA 3B48A 5LQKA 1UDXA 3QYPA 3ZUPA 1F2TA 2RHRA 3EAQA 2X14A 1KAEA 2HNKA 3MSCA 4QDJA 5KU7A 2QN1A 1IM5A 5I4BA 3GP8A 3SZUA 3U4GA 4BZPA 1JEYA 3DCIA 1IUOA 2C9MA 2C94A 5TT0A 1RKVA 4AG3A 8LDHA 2PUWA 3EGIA 4HNTA 2G0TA 4QGFA 4MAMA 4C0WA 1CC1S 1A5TA 1WB4A 2PX8A 2PS0A 3DZKA 3P4XA 3RVBA 2Q6LA 3HG7A 4WK2B 3LTNC 2FEPA 4ROSA 1Z16A 1MTZA 1WW3A 4B3CA 4ALMA 2ZBDA 4N41A 5IF9A 4P34A 5A0TA 4MKHA 3A2NA 1J2RA 3NETA 3MOIA 2A0YA 3RFTA 1NQXA 3F6YA 3L8MA 4WNCA 3RD5A 3ZDFA 1XTPA 2R1TB 1C5KA 3CRRA 4DR7B 3CA8A 1USVA 2HIHA 2GVDC 3OQPA 4EHBA 1BGXT 4KRGA 4F21A 2UVQA 3PNMA 4GMHA 4KIGA 4YRNA 2WPDA 4RZXA 5L3SA 1SVNA 2ISSD 5TEVA 4D9FA 3OY7A 4L6AA 2ASEA 3FZYA 2V7VA 1C3EA 2J59A 3L7LA 4BO8A 4ZZIA 2QZSA 4FMCB 5CDUA 1GAEO 3TQCA 1H5UA 5C8VA 1FFAA 3HU5A 3LECA 3QYAA 4M8SA 3Q7PA 3HVJA 1M67A 2XHZA 3IE0A 2Q5CA 3EUEA 1FU8A 5I7FA 2A5FA 2WSMA 4IWXA 2Q6OA 4H59A 4JP2A 4O0MA 4O4IA 1IAVA 3C3DA 2H1CA 2PQ0A 4KLZA 2PG3A 4KQIA 4OY3A 4OLHA 2C04A 1ZC4A 1EE1A 2L17A 3KCQA 1P61B 3WZ2A 4OD0A 2J45A 1Q21A 3OLXA 1ZVVA 3OLQA 2BPOA 3PVZA 1CFZA 4DQXA 1VKNA 3VUEA 1OIXA 4EB0A 1TVEA 1I2CA 3SVZA 1HGXA 1E0DA 2RH4A 3WFIA 2HO5A 1Y5MA 2ZRJA 2NUPB 4HGOA 1GTRA 1ZVMA 2WRZA 3D6FA 5DNYB 1R8YA 1XVIA 3EXHA 1JEAA 3PHGA 1A9XB 3L5KA 3N8HA 3U6KA 5SYAA 4MVJM 2YRXA 2MMCA 4KIUA 3IL2A 2JIDA 1HMPA 2PL9A 3VZRA 3IP1A 5DBIA 9MHTA 2B78A 4DYDA 3IKTA 1F20A 4L5AA 3OHSX 1DV2A 3LYUA 1X70A 5DF1A 2AOWA 2EDAA 3M33A 1U2TA 3Q6MA 4IF6A 5K8UA 1U0SY 3N0WA 5DLPA 1PK7A 1FS6A 1GFIA 2IDJA 1OAOA 2ZQYA 3OFJA 2XOKD 3OH8A 4RENA 4U5QA 4AG5A 1L1QA 4DILA 3HXTA 1P33A 4CGZA 4FMDF 1WXIA 1RYEA 2FEAA 3FJ1A 4A2PA 4X66B 2ZRFA 1JU9A 3QUBA 2Q07A 3B3JA 3BXGA 1U7TA 3FOCA 1FZQA 5A3VA 4DNXA 5CFPA 2R8PA 3M5DA 2NYAA 3OD5A 3INGA 3IUNA 4CV2A 1VSBA 2A59A 1RRPA 3WIBA 1VHJA 2PZGA 1T8PA 4I4CA 3ZW9A 1FX0A 1VLQA 1N2CB 3KOYA 2EIXA 2H7VA 4JL6A 1FA9A 1QGYA 4AQ7A 1ZH4A 4DVJA 2BLLA 3GUHA 5LL6P 2UV8A 3E3AA 3GWZA 1AUQA 3KL2A 1SXJC 3CG4A 4I4TB 5EFZA 2GHTA 1NTOA 2OV3A 3AHFA 3BXFA 4ITRC 3OJEA 2RGYA 1G1AA 5FO1A 3TTUA 1CY4A 4K1XA 4DAOA 2QTVA 1DAPA 1HMYA 3LNCA 3FA2A 1LVUA 3RJZA 2BCEA 3REQA 4I1SA 4DSAA 1EFDN 2LKDA 4EFDA 4F6LA 2W2MA 4CDMA 3AW9A 2VNJA 2W9XA 3G6KA 4PZZA 3SKVA 1OXTA 5G4LA 3GT3A 2X4DA 3DUFA 5ADVA 3S70A 5BYJA 2CLFB 3AFGA 3HJCA 2H3EA 1P75A 2OAP1 2FA9A 3HV2A 1MIHA 3FMVA 3QVGB 3LXUX 1R4NB 1VLHA 3HUEA 3EWSA 4V0ME 3O8BA 2IV7A 3G8AA 2FMFA 4L4UA 1JEQA 4MRMA 4ZQEA 1OE0A 4ZRMA 5E0OA 3N76A 5GM1A 4EIWA 2WTBA 1V11B 5B6JA 1S2MA 4AN0A 1QJ4A 2ECFA 1UP7A 1PG5A 1VKJA 3HDTA 2AX4A 5LYJA 4JSRA 4D4MA 3OE1A 2Y76A 3HSYA 2BFAA 3AUAA 1NBME 5ERGB 4IS2A 1TAQA 3DGEC 4IYJA 4QG7A 1X7YA 1C4OA 1SN7A 3FNRA 2QRMA 3LCUA 1O3YA 4KREA 3EAGA 2FX5A 5IC5A 1IH8A 1RPNA 2AJ8A 3C5EA 1Q1EA 5GOTA 3R0QA 4BN4A 3P27A 3TLMA 2E6KA 4DQVA 2QTNA 3LSYA 1SD2A 4KE9A 1FTYA 3PDJA 4WZBE 3IKLA 2AC2A 5F9HA 1JLLB 3DBHA 4C05A 5JNTA 4GC5A 3ELBA 4DRYA 4RPHA 2JASA 2D4AA 1Z37A 2N3ZA 4WLEA 4G1MB 1WCIB 2BEUA 2OCIA 3JSAA 3R0XA 4Y2UA 3WK4A 5AVQA 1MRSA 1T3GA 2OFXA 4QQNA 1TB4A 1E9EA 2R8XA 1SCKA 4G1VA 1N8SA 3JYPA 1HKHA 2J48A 4Y2VA 4BVEA 3G1UA 5C8ZA 1ORTA 1SQ0A 1V8BA 3NBZC 1RYYA 4EUSA 5JDIC 2HOQA 2CV1A 2FKAA 4F1KA 2ZUEA 2WJGA 2D2EA 1KORA 3JWGA 1J5XA 2DPMA 1FYWA 1H5QA 2QR2A 3PUKA 2OBYA 4RLSA 3QBVA 5JALA 1E92A 1WULS 4TZ0A 1O08A 4M9RA 4HDMB 3LW7A 2H4XA 1FDIA 2PSFA 1PFKA 4FKMA 4X20B 1LC3A 4Q3KA 3WV4A 1MFPA 2R7KA 1QF6A 2A8YA 3FB4A 3D64A 5EVCA 4XFKA 3CF0A 3MTJA 4I8IA 3UM9A 4RTMA 1PJRA 3IIKA 4OGLA 1IMJA 3D6UA 3QX8A 1T5OA 2AD5A 3BL8A 3K0AA 4U3JA 2P30A 1S89A 3QK7A 4NK4A 3STYA 1UDRA 2VSYA 1QZ3A 1YB4A 1O94C 2JGRA 4DCNA 2W2KB 3MMPA 3W34A 1FQJA 2RAFA 3N2EA 1N7IA 4P5EA 5K0LA 4YUYA 5P21A 2GVZC 3GGCA 2FSPA 1P9LA 1T5LA 2WB2A 1MGPA 4H6PA 4HDAA 4R1UA 1UBTS 1VPEA 4S2UA 2QRLA 4ZARA 3VSAA 3X0DA 2EAUA 1XKTA 5FJJA 4QLBA 3FOZA 3QVMA 4MKRA 4BEJA 1PWYE 4GPAA 3LPNA 4Q3AA 3IB6A 4H6XA 4DARA 1FFBA 2HXGA 1KEEB 3NHFA 2B37A 3UUGA 1FDWA 1C0EA 4U8HA 1EH5A 3KKZA 3P9XA 3QVTA 3ANLA 1Y1TA 4ZVQA 5B3JA 1SQ5A 1S3GA 1U0GA 2P6NA 4EAQA 1SHUX 2WJYA 2YINC 1DOZA 1IEQA 3PQ7A 4AZ0B 1BE6A 4CODB 1J0AA 2O2EA 1KXZA 4BMNA 1V71A 6Q21A 3V2GA 1VI6A 5KVSA 4BGVA 5JDCA 4MLPA 5DTEA 4AULA 3NVKI 1SVOA 3PK0A 3GLFB 2POCA 3IV6A 5ALNA 3UJBA 3WK7A 5L7YA 1HBJA 4U02A 4JQYA 3BHIA 5A5DA 5KYNA 4MJ3A 3NWBA 1LI4A 4KQ1A 1IZ8A 2ZDGA 3KZXA 3WYNA 1B1AA 4LF4B 4HV4A 2ZTHA 3BJEA 3AHCA 3UW1A 1JE1A 2ZCVA 1JG6A 3QOWA 1FDSA 4WLUA 4GSLA 1UAYA 2GZMA 1MBZA 2XT6A 1MJGA 1QO7A 4LCEA 2A78A 3SSNA 4DANA 4LJLA 4JB0A 4PG6A 1ZHFA 2Y2UA 4QO8A 5DNWA 2VHJA 2PX0A 4KLNA 3AZPA 4Z1MA 4BLSA 4G0QA 1QXSA 4BQQA 4UD2A 3IIJA 5I8PA 2NLOA 3ME5A 3WK5A 3QMMA 3CHYA 1QP7A 1B8OA 3NQ41 4G0VA 5CW1A 3WGLA 1D2RA 5AJHA 1PQWA 4IL5A 4UEKA 4PQEA 2WT4A 1WXXA 2BFFA 2XVMA 3JALB 1KI1A 3QQPA 1MH9A 2C4KA 2IW1A 3OPNA 4GR5A 4JJ8A 1QQ5A 3UAWA 4BC1A 4C0JA 1E2LA 1U3GA 3GLHE 1B74A 3LNTA 5BVGB 5JZSA 3VOSA 5IDVA 4M88A 4NE2A 1RMQA 4UBMA 3WIEA 2YCLA 3I28A 4C4PA 3IEUA 4K9DA 4P33A 2YJ5A 2QTRA 4PPNA 5G53C 2J67A 4CU2A 3QU7A 3DEYX 1Z82A 1P7CA 3OZRA 1SK9A 1E6CA 2XCLA 1P3Y1 5I7OA 1OLXA 2YFYA 3T5BA 3G5MA 4ESOA 2G08A 3JQ7A 4FC7A 4IF4A 2QJRA 4WZBB 5BURA 3T06B 4FQ7A 2C4VA 3CRZA 3WKAA 2J5QA 2YWJA 4UDYX 3WNDA 2L0XA 4L8FA 2B1JA 5KUTA 4WRRA 5DSXA 5JFTA 4YP6A 4JXZA 4I8DA 4EB6B 5M7EA 6REQB 4ZN6A 1OVGA 2XT0A 2RSLA 3HN7A 3GPDG 1IWOA 2Q1YA 3UMYA 3A1TA 2P9CA 1Y8AA 3MGBA 4TYYA 3H5NA 1OAAA 4RH0A 2I0FA 4OYLA 1G38A 1Z56C 2G3YA 3AR2A 4R40A 1ITZA 5DDIP 3AR8A 1DEKA 1KDZA 1XYGA 2ZB3A 3AKDA 4AAYA 3LM8A 4NU5A 4J1TA 3BE8A 4PLPA 2SBTA 5DYGA 2ZTMA 4ZO6A 4IR7A 5A4KA 2P3OA 1JFTA 2EOAA 2R62A 3U16A 4DCTA 5BUCA 1UAAA 5CT6A 5JCXA 3CZAA 1PZXA 3AQIA 5DM1A 2G7ZA 2VCEA 2QL5A 1P9WA 4KIFA 3IALA 4W8OA 2LUOA 1G60A 3V8EA 2Q5FA 2DTXA 4RVUA 3VJMA 2HQBA 5IULC 2P9JA 3UIEA 4OA8A 3UJCA 1C0KA 1GRRA 5E1DA 1FSFA 4XPIA 2XRYA 2WMOB 5M2QA 3NANA 3CWQA 5I7AA 1Z25A 1E2JA 4R1TA 5AJXA 4RD0A 2IDKA 5IDXA 3RH0A 2AS0A 5DVZA 1NHGA 1Y1RA 2BFPA 4JL5A 5JVDB 4FCCA 2QG9A 5AQEA 3TE6A 3RYFA 2E3JA 2OCLA 2PLFA 1X92A 2C98A 4Q6WA 4CJXA 2IS4A 2JW5A 5HZGA 2XNJA 1ZNQO 5FEUA 3EPJA 2ONYA 4PZEA 3RQIA 3BSYA 5DK6A 2ZXUA 1B43A 2JG3A 1IN7A 1U8AA 2CFRA 2ZAIA 4MPRA 5H70A 2RI0A 2GN6A 5L53A 2RC5A 3L6OO 1UINA 3PUYA 4QFBA 3J7TA 4CM4B 3GL9A 1XKQA 3HACA 3SR4A 4WFKA 1IIBA 3DC7A 2HQSA 2OAEA 1JDUA 2D5IA 3ER8A 2GFHA 1SRQA 2XTZA 4ZQGA 3V2HA 1DG3A 4PRKA 1DARA 1PJ8A 4ND1A 2V8OA 2FCRA 1AGXA 8GPBA 1OX6A 1THGA 1QRDA 2PZBA 3NEJA 4KX3A 2SCUB 3AHGA 4NMLA 4RIHA 1PG0A 4FZ3A 5EZQA 4PQGA 4Q7QA 1GARA 2CNKA 4CEJB 1KY2A 2QNRA 3DAOA 3S7TA 2HA5A 3OCZA 3PDHA 4FYPA 5CXSA 4P3KA 5DYIA 4UBNA 5JCOA 3RBXA 4M0DA 2Z08A 3EZFA 1NNI1 1BU8A 1UMCB 4Z5XA 5JMTA 1A71A 2OA0A 4S35A 2VPPA 1QVVA 2R0QC 2F3QA 3GLRA 4KPFC 2XZLA 3HO8A 4MTLA 4O4JF 3VNQA 2A9PA 3S40A 2WD7A 3O74A 4N54A 3OZCA 1W48A 1OV4A 4UCFA 3UUFA 1YZYA 2GCOB 2DLNA 2BISA 3KS9A 2G5CA 4RY9A 5KWJA 2JGFA 4EA6A 2GN8A 1WWKA 2CMDA 4MKFA 1VMAA 2V1XA 1VA4A 4FGZA 1PJZA 3H19A 4RHXA 3EZNA 1RQRA 5IEBA 3RRFA 4UTPA 4W5OA 2NZ8A 1M2WA 4BFZA 4ZVPA 1ZNYA 4N3GA 1NAIA 1QR6A 2ZUBA 4HEJA 4YS6A 1P1RA 3DEZA 5SY4A 4ZHQA 3KXPA 3TW0A 4DLTA 3CZMA 4GLBA 1VSTA 4HH1A 4KK3A 4WFIA 1SHTX 3LP6A 2Y1LA 1Y4UA 3BEOA 1H0HA 5JG7A 4JKIA 1RIFA 1GKUB 2IY7A 2HEGA 3ENWA 4FOOA 4RS3A 2ZSEA 1UBEA 1GILA 1M2HA 4KZPA 1LXCA 1T9KA 5EIAA 3R7BA 3DMDA 3ZVRA 1NZJA 2DWOA 4B2IA 4EW3A 1RC0A 3ELDA 3I6ZA 2I1WA 2C5FA 1NSFA 2QYHA 2VDUE 4W5WA 3ROZA 5CVJA 3T9EA 2YBDA 3WLPA 4YDQA 3TMKA 1GPJA 1N1MA 1OGYA 1KIMA 2ATIA 4FE4A 3SJUA 2GEKA 3N58A 1F6BA 1CZOA 2XMCA 3OEED 5JHGB 5BNIA 4FILA 4Y2QA 2ZT7A 4MVCA 4JA0A 4LG1A 3QPCA 3ZHOA 4RHFA 2L69A 1OGIA 4EEXA 3CH6A 3W5AA 4W9NC 4HUQB 4LBVA 3GLIE 3D5QA 2V03A 1M6HA 3ENNA 5D1NA 3CVYA 4LXIA 4KH1A 2D74A 1C41A 1ATIA 2FMKA 4KR0A 4NBKA 4TQAA 1QE5A 1VIYA 3KVYA 3LTEA 1UXIA 3QSGA 5CP8A 2OPHA 3OCEA 1UPXA 2B3DA 2NW6A 3MJCA 3CUVA 4X7BA 1DAOA 1JLLA 3DBHB 4U6NA 4UW9A 4NNOA 1FSGA 1OFUX 3BFKA 2P9GA 3O7WA 4MRPA 4RK6A 1E94E 1GQSA 2VF7A 2DG2A 3N3AC 4TRJA 5DLDA 4KDFA 5JSFA 4J6EA 2BMJA 3PIIA 5I4CA 1CDEA 2WTUA