2JARA

Crystal structure of d12n variant of mouse cytosolic 5'(3')- deoxyribonucleotidase (cdn) in complex with deoxyuridine 5'- monophosphate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
196
structure length
196
Chain Sequence
KRPVRVLVNMDGVLADFESGLLQGFRRRFPEEPHVPLEQRRGFLANEQYGALRPDLAEKVASVYESPGFFLNLEPIPGALDALREMNDMKDTEVFICTTPLLKYDHCVGEKYRWVEQNLGPEFVERIILTRDKTVVMGDLLIDDKDNIQGLEETPSWEHILFTCCHNQHLALPPTRRRLLSWSDNWRGIIESKRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 5'(3')-DEOXYRIBONUCLEOTIDASE
publication title Crystal Structures of Human and Murine Deoxyribonucleotidases: Insights Into Recognition of Substrates and Nucleotide Analogues.
pubmed doi rcsb
source organism Mus musculus
total genus 72
structure length 196
sequence length 196
ec nomenclature ec 3.1.3.-:
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 2jarA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2jarA01
1IWOA 2DQSA 3QX7A 4BX0A 3QU2A 2YJ6A 4GXTA 4C4SA 2QYHA 1Z4NA 4CF3A 3FVVA 3SKYA 2W43A 4G9BA 4XQ0A 3AR5A 4Y2TA 2FPWA 1RMQA 5AK5A 4Y2YA 2W11A 4JDPA 3KOOA 1K1EA 2PR7A 2GFHA 3ET4A 2R8ZA 1ZJJA 3FZQA 3ZX4A 4YGYA 1YNSA 3B9RA 1QYIA 3EWIA 2I6XA 3QUQA 1L8LA 5AK4A 3E8MA 1ZD4A 5AKYA 2WF9A 3IJ5A 4FFDA 2Q4RA 5JJBA 5AVXA 4RETA 2B30A 2YBDA 2AMYA 4FYPA 5ALSA 1U2SA 4UW9A 4HGRA 4OHFA 3UMBA 2WFAA 2HOQA 2RAVA 2I34A 5AKIA 2OYCA 2IOFA 2WF8A 5AVTA 2EAUA 4Y2UA 3QU4A 3W5CA 3KC2A 1U02A 2MSNA 5A3QA 2JAUA 4OFZA 1RPZA 1N8NA 2YN4A 5AKGA 4BNDA 5AI5A 1Q91A 4HGNA 1T5TA 2YFYA 2ZBEA 1RDFA 1O03A 1Z4OA 3SKXA 3GYGA 3WGUA 3KDPA 1YDFA 5ALHA 2YJ4A 5AVYA 3ZX5A 3I6BA 4EENA 3WKDA 3SF0A 4UMFA 2RARA 2X4DA 5AK3A 2WF6A 4YH1A 2OA0A 3ESQA 1L8OA 1S8OA 5ALRA 1SWWA 3UMCA 4I9GA 3KD3A 4XE5A 2YJ3A 3B8EA 3OPXA 3M1YA 3FGOA 3UM9A 1N9KA 2ODAA 5AM5A 3R09A 2AH5A 2FI1A 5ALGA 3AR3A 3WK8A 5ALMA 1WVIA 2WF5A 2O9JA 1RLTA 3PGVA 4NABA 1AQ6A 3SHQA 2JARA 1TA0A 3QUTA 5AVUA 4YIKA 3E58A 3HLTA 3L1VA 4Y2VA 1O08A 4BEWA 3L8EA 5AVQA 2B8EA 1ZRMA 3PDWA 4GIBA 1RC8A 3FPSA 1Z4QA 4BBJA 5AIAA 1Z4MA 5ALEA 5AKEA 5ALXA 3P96A 1WZCA 5AICA 2C4NA 2ZOSA 1TJ5A 1CQZA 1YJ5A 2OBBA 4EEKA 5AM2A 1Z4PX 3WK4A 5ALLA 5AI9A 1Z4IA 5ALQA 4Y2JA 3NALA 1CR6A 2IOHA 3QUCA 4KNVA 4OCZA 1Z88A 3ESRA 5ALFA 2MU1A 1XP5A 5AM3A 2FUCA 3S6JA 1L6RA 3ONNA 3N5KA 5ALPA 3AR7A 2AUTA 4J2TA 4CF4A 1QH9A 2HHLA 2HX1A 1L7NA 3KBBA 4MWOA 1EK1A 2C88A 1L7PA 1RMTA 3CNHA 3AR8A 3AR6A 5IT0A 4BX2A 3MC1A 3U7FB 5ALYA 1Z5UA 2GMWA 3OCXA 3OCZA 2B1QA 5ALWA 2JGAA 3OCUA 2P69A 1KYTA 5AI8A 3U7HB 3WK9A 5AVWA 1Y8AA 3NUQA 1RQNA 1QQ5A 4L6AA 2CFTA 4IG4A 4NAVA 1RLMA 4EX6A 4ZEWA 4BEVA 1SU4A 5IT4A 3IB6A 1Z5GA 1JUDA 3A3YA 2HO4A 1U7PA 5ALIA 3QU5A 3CZ4A 2HEGA 1NRWA 3AR2A 5AHXA 1ZD3A 4KYTA 4UAVA 3R9KA 3I1YA 3PGLA 1RQLA 1TJ3A 5AI6A 3WKEA 5ALVA 5AW1A 5AKJA 3ZWDA 2RB5A 4DWOA 4J03A 4E88A 5AW3A 1U2TA 2R8EA 2W4MA 2IA5A 3L7YA 3BA6A 3ZVNA 1YS9A 5AW6A 1RMYA 2FPUA 2ZBFA 5AVSA 1ZRNA 3D6JA 1XVIA 1RRCA 3VAYA 4IFTA 2I7DA 2QLTA 3QXGA 3ZTYA 4HYTA 3DDHA 3QLEA 4OD0A 4Y2QA 5A3SA 2NYVA 3W5DA 3A1CA 4KNWA 3MMZA 5AW5A 1ZD5A 4EZEA 4C4TA 3E84A 2PKEA 2VKQA 4Y2XA 4EX7A 4Y2RA 2YMLA 5IS2A 1T9ZA 2R8YA 3UMGA 3PCTA 3I28A 4HGOA 1EK2A 3L8FA 4FE3A 3QU9A 1Q92A 3B9BA 4HGQA 5AI0A 1X42A 5AESA 2I54A 3ZU6A 3NAMA 2NO4A 4YIHA 3F9RA 5AW4A 3U13A 2D2VA 1QQ7A 2HDOA 1J8DA 4QJBA 3QUBA 4AS2A 3RF6A 4JB3A 3A1EA 2WF7A 2CN1A 3IRUA 3BWVA 4UATA 3ZVLA 5AM1A 3WGVA 1YMQA 2ZXEA 3SMVA 3ED5A 3I76A 5ALZA 4YCMA 4KN8A 2I33A 3WKBA 2P9JA 1PW5A 3RFUA 1YV9A 5AKZA 2R8XA 4AS3A 4C4RA 3ZW7A 4NWIA 2GHQA 5AW7A 4BYGA 2BDEA 2FUEA 4UMEA 2G09A 4B6JA 2G07A 1ZOLA 3QU7A 4L6CA 2NO5A 2BY4A 2G0AA 3DNPA 4BX3A 3MPOA 2GHTA 3A1DA 4UM5A 3L0YA 5AKHA 4EELA 3SD7A 4HAIA 4UARA 2B82A 2BDUA 2O2XA 3AR9A 1J97A 2IOFK 5ALDA 4ZEXA 5AVZA 3DAOA 1FEZA 3L1UA 4NV0A 5ALTA 2RBKA 1TE2A 3W5AA 4PNHA 3L5KA 5ALJA 2YY6A 4DCCA 5AIBA 4H1WA 2HI0A 1SWVA 2CFSA 2FPRA 5ALNA 4F72A 4CNQA 3E81A 1VFPA 3WK5A 2YMPA 4UU0A 2YJ5A 4NFLA 3NASA 3WK6A 4RESA 5AW0A 3L8GA 3OCWA 4BKMA 5FP0A 1QQ6A 2PQ0A 3N8GA 2WM8A 4UAUA 2AGVA 5E0OA 2JAOA 3MN1A 5AI4A 1L7MA 2OM6A 1RKQA 2EATA 4KX5A 1RLOA 3HYCA 3J7TA 5AVRA 2EARA 3NIWA 5AVVA 2YMMA 1VJRA 2G06A 1T5SA 1NF2A 2FPSA 5AKLA 3DV9A 1ZS9A 4O8CA 3WKAA 3U7GA 1Z4LA 1ZD2P 5AM4A 2ZG6A 3ZWKA 2JAWA 1LVHA 3EF0A 4HGPA 2FEAA 2ZBGA 4UMDA 4BNDB 5AKXA 4CF5A 3N1UA 4KX3A 3NANA 3U19A 5AK6A 3NRJA 3QGMA 2HF7A 5AW8A 3U26A 2G08A 4UMVA 5T41A 3TLMA 3QYPA 4AP9A 2YMQA 3ZI4A 3L0CA 3R4CA 4I9FA 2B0CA 4Y3UA 2FDRA 3OCVA 3L8HA 1RKUA 2G1AA 3EF1A 3ZVMA 2G80A 1MH9A 1WR8A 4UASA 4DW8A 1F5SA 5ALOA 3ET5A 3OTQA 2B1RA 3WK7A 2Q5EA 1NNLA 4XPZA 4G63A 3L0BA 1RKVA 1U7OA 2P27A 2C8KA 4XOUA 3N07A 3ZUPA 1S2OA 1VJ5A 2HSZA 4CE6A 5AW2A 2HF2A 4YCNA 4YCLA 2HCFA 1LTQA 1XPJA 2C9MA 2GO7A 3EPRA 4L57A 3M9LA 5AW9A 5A3RA 2C8LA 2P11A 3ZTWA 1TJ4A 3KZXA 4ZEVA 2FPXA 1Z4JA 2CFRA 4Y2SA 4Y2PA 3FPBA 3SLRA 4UU1A 2WHEA 3FM9A 3U7EB 3N28A 4DFDA 4F71A 3K1ZA 5AKKA 5AM0A 3WKCA 1L7OA 1Z4KA 2B8JA 2ZBDA 4MUMA 1WPGA 4UM7A 3AR4A 5ALKA 4QQFA 2Q4TA 3OCYA 5ALUA 3QNMA 2IYEA 2I55A 3W5BA
chains in the Genus database with same CATH superfamily
2AN4A 2AJDA 2GBLA 4AJ1A 3EUFA 2DQSA 3TCXB 4E5SA 1XTTA 4MJ3A 4O1MA 3DONA 4FFPA 1VIMA 2YJ6A 1YACA 1RC0A 3PXDA 4EYQA 5ERYA 3WR5A 1NBME 4WUTA 5CT5A 1KFKB 2P90A 3GNQA 4CEIB 2ZGVA 5ES3A 1UBUS 1BZYA 2JCVA 1D0VA 3JYHA 4F3NA 1KI6B 3B1WA 3DV0B 3L7LA 4RDCA 5CM9C 1I3MA 2W11A 1MU0A 1QG4A 4NK4A 1JDZA 1F0NA 1K1EA 2W22A 1Z34A 5TY0A 2GI4A 1BFUA 3PGKA 4XOIA 1KJZA 3ZHXA 4PO3X 3W8DA 1QJCA 3FZQA 5CJJA 3WHPA 3ZBUA 3SY8A 4G0ZA 3I01M 5B6JA 3ETGA 5HGXA 1JDVA 4MW5A 5K6AA 4I7EA 3FPEA 2JBAA 3TDMA 1E1DA 1FP2A 4JUDX 4NZOA 4A36A 4OA8A 2NV2B 4RQUA 4WVFA 2X23A 3CUYA 1VMKA 1RJEA 4R01A 1XRNA 3QUQA 1KK0A 3RNLA 3NTXA 4Q3AA 4ZJPA 3RD8A 2JFVA 5A4JA 3DHEA 1X19A 1NDUA 1CR1A 4EATA 4MV6A 4KQHA 1EB8A 5AXBA 4D41A 4MCJA 2Z57A 2Y4OA 3CRVA 3GPCA 2ZQ5A 2K7FA 2H1RA 2QM8A 1S8FA 4K88A 1LXCA 5F2OA 1HORA 3HKDA 1I13A 4DDVA 2OYCA 3LIIA 3HCCA 3WB0A 3LPMA 1K3FA 1XV5A 2QN3A 2XA2A 4UHEA 3TN7A 3WB2A 5E4FA 3WQSB 4I36A 2D2XA 4L7VA 4Q9AA 5L40A 1DKRA 1T13A 1QIFA 1T29A 2AD1A 4HTFA 4HB0A 3E9NA 2ZETA 3O1LA 1IRXA 1R4MA 4IDDA 4Z3DA 1SA0A 2VJCA 3HR7A 1N2GA 3FJ1A 3RSSA 5ARBA 1Q91A 2DBYA 2JGFA 2IXDA 3Q5DA 5EI5A 2LV8A 4LOAA 1SXJA 2JZOA 4KXLA 4E2FA 5IJ9A 4XGRA 1OBOA 1X2EA 2X2OA 3GAAA 2WU8A 3FBWA 2WMOB 3STVA 1G21A 1MNAA 1SK9A 1Z07A 2OGUA 2WE7A 2YJ4A 3U49A 3ZV7A 3IT0A 4Q7LA 5K0ZA 1AMUA 3N75A 3M6UA 2LPMA 2XWPA 4O4LF 3AERB 5IWAB 1QE3A 3ER8A 1NQAO 1E1RD 1NWCA 2Y3IA 2AQ8A 3D0QA 4UMFA 2Q9CA 4DLBA 3DBLB 2I4LA 4PN7A 2V7PA 3R8FA 1ODJA 5BNWA 4DQKA 4MA4A 3NQ41 2OA0A 3BSSA 2IIVA 2NQTA 1I8TA 2XKJE 5FWXA 1NJFA 4A9AA 1RI1A 4ZXFA 4CG1A 1XDGA 1OV6A 1RBZA 3KD3A 4P1ZA 4F2GA 2XUOA 5LDHA 1F7UA 2D7CA 1BN7A 5KNDA 3SVTA 1E0AA 5KVCA 4WN3A 4C4AA 5EUBA 1G0OA 3L6DA 4N41A 2HO5A 1ORVA 3SC2A 4YUAA 5CFQA 1M7BA 4FONA 1DAOA 2VHXA 2Z2JA 3VSDA 4CMIB 3DOUA 4UEJA 4YMTA 4HY3A 2UZ0A 1QZXA 1UBFA 2F9LA 2HCTA 2V5AA 4F1WA 5LMNB 4RKQA 3HKEA 1MHTA 3HLTA 3BXGA 4P82A 5DT9A 3OH8A 3ZLJA 2HV8A 3AU8A 2B5VA 4MUJA 2NUBA 2O3QA 3EBOA 3IQHX 3CT4A 3NHKA 2NV0A 4BO6A 4MS3A 3TNFA 1Y3HA 5BRNA 4PVDA 2QM7A 2QM3A 3EH1A 1CUSA 2AI2A 2HRZA 2O05A 3P96A 4BO3A 4NCHA 4CCYA 4ZHQA 1PTKA 4I4CA 2PBZA 3FWKA 4QFDA 3CGWA 2F43A 1O0SA 3QEJA 5FO1A 1TD1A 4PNZA 2BMWA 2DE0X 4GXQA 1F2UA 1Y9ZA 1QOZA 3FGZA 5HJ2A 5LP6B 2O23A 2ZJ7A 3U0BA 2IOHA 2A4KA 3EFHA 4HQLA 3IAHA 4CLRA 3TCKA 1A4IA 1AGYA 5JSHA 5IBQA 1I01A 3WYFA 1ZK3A 1DAFA 2XGOA 2XYGA 3FAKA 4I8DA 4U2KA 2WZQA 2MR6A 4DILA 3R23A 4IQJM 3WGHA 4DA8A 2Q6LA 3WSWA 2HIGA 2HAEA 3VPBA 3PUJA 3FPGA 1PWEA 2WP0A 2C9YA 1SCDA 3ZWNA 4EBFA 2EDCA 5JAQA 5A7FA 1LSSA 3GFGA 1TF5A 1NY6A 5GONF 1TI7A 3KB2A 1GTSA 4JCCA 4LSGA 3BE5A 4YJ2B 2PFMA 4HATA 4KHPB 2H2GA 3E22B 4IJUA 1KKUA 3STTA 3MC1A 1GSHA 2F3TA 2Q3FA 1YRWA 1Y6RA 1QQAA 3VJKA 3Q72A 1UJBA 2C7BA 3UEOA 3BJRA 2DUUA 4IW3B 1ENYA 4M1TA 2IVFA 4E5DA 1JE1A 3GLHB 4PWZA 2BMJA 1DIRA 3NH6A 4HBZA 1Q84A 3VDNB 4F91B 2O8CA 1N5OX 3RTCA 5HJ7A 5LBIA 3WIBA 4YCAA 3VDMA 1U8FO 1XKXA 3F6PA 2BF7A 3PNLA 4RHTA 2P65A 1SKUA 1VOTA 1TYDE 4N3BA 2YXPX 1N2HA 3DBRA 3UB2A 1RAGA 2WFLA 2XXAA 4IXMA 4S2EA 3AEKA 1TRKA 2LUOA 5KTNA 1Z06A 1J33A 1ZOPA 1E79A 1JXMA 2BBTA 2H1CA 5D1NA 4PW0A 3PJGA 1O4VA 1G3RA 5GVSA 1V25A 1E0SA 3TKAA 2B92A 4ITVA 4RX1A 1IMJA 1C1XB 1DUVG 3RC3A 3N76A 2I7CA 1F7VA 3OQBA 2YV2A 4G5GA 4Z7NB 4QUGA 3QX9A 2QTBA 3IPRA 1J00A 4ME6A 3BWXA 4HQNA 4XGKA 4R8LA 3VC2A 1N1EA 4JT4A 1OXVA 1GTVA 2IK8A 1QE0A 2B9VA 5C2JB 4Q9NA 1F2DA 1A76A 4XYBA 5AKJA 1D0IA 4W82A 4BJ1A 3RSLA 1WUTA 1SH7A 1LDBA 2ZXFA 3EQ6A 4AMBA 4CUJA 5EZQA 3L1JA 3WNBA 3TV2A 3KT8A 3NXSA 3ZY6A 1DJQA 1E4EB 1R66A 2HREA 3CSUA 2ZW9A 5LUBA 3L7YA 3GB9A 4EUHA 4BIMA 3E9DA 3O5AA 3ZTTA 4D9BA 3WLFA 5JC8A 3KQLA 1JPVA 2QRVA 3V8EA 3LTNC 2GXSA 2X58A 3VSBA 3JV7A 3WHLA 1D07A 3UB3A 3A2KA 1M10A 4YMGA 4Q9DA 4DADA 4C87A 3CLTC 4BNXA 4ZRNA 4KYUA 2Q2VA 2V6BA 5IDVA 2PMCA 2HA7A 1GGNA 4IWYA 2J0VA 2PZAA 2YNMC 3ESBA 2C2MA 2NXEA 3OPYA 3Q9NA 4HTFB 4P7GA 5IVIA 4X1IA 4HUQA 1R4MB 2XECA 1DOFA 1SA0B 3FCSB 3FPHA 1FDRA 3Q3CA 3H1FA 1GQQA 1JSLA 1C7QA 1CQJA 2YRWA 4ZC8A 3TX2A 4LRUA 4QVGA 8MHTA 2WUGA 2JDID 4WFKA 1SXJB 4LNUB 4MEJA 4MW6A 4NU5A 3BT7A 1ZONA 1RLIA 3G59A 4UPVA 4XRGA 1M73E 2F1KA 3DVRX 2IF0A 1MW9X 4HDAA 4ZDWA 3OMWA 3PQ6A 3W8EA 3FGPA 1BOFA 1V47A 1ZP6A 2HW8A 1K08A 5JEDA 3PCTA 3CW8X 2C4TA 3DOJA 1RSZA 2VP9A 4AZSA 1G6KA 5LNK1 3K9FC 2GCOB 4B4DA 1MDFA 3C3KA 3C4VA 1QV7A 3P2JA 2GPTA 5KYYA 2WU1A 3K9LA 3NGLA 1MA0A 2C8JA 1L7QA 1U7ZA 3DP9A 4BNWA 4DB2A 4BZZA 1A9SA 4FPXA 3ZR4B 4WK6A 5KNCH 3JWJA 1WAMA 4C0WA 3T9DA 1YR1A 4UVDA 1M1ZA 2IPAB 2ZB7A 4CN9A 4PC1A 5BYBA 2V58A 3W05A 2ZYRA 4RLSA 3OE7A 3QUBA 4QUEA 4R6WA 2JI9A 1K6EA 4DJEC 4WKOA 5IASA 1Y34E 4MYSA 4BX9A 1XK7A 5KPJA 2L0XA 4PG8A 5AM1A 1Q21A 1LQTA 3HCAA 3D8NA 3RWBA 1BXGB 5DTJA 2QTTA 2FZVA 1JWBB 2CXNA 3BTOA 4LVOA 4ROTA 3PC4A 1SY7A 5BVGB 2NZUG 5JI2E 1ZFNA 1XDUA 1RJWA 4PLYA 5BNIA 4DV6B 4KTVE 1PW5A 4OHZA 4AY2A 3LX5A 1YMUA 3BB1A 1OXXK 2F3SA 3RS3A 3KJXA 4L2IB 3KJQA 2VCHA 4PZCA 3EZYA 4CCYB 3DFFA 5G2OA 1Z47A 2EFDB 3RVJA 3TCNA 1T3SA 2RC6A 3HYNA 2GHQA 1BG6A 4QNMA 3RC1A 1WXIA 4E30A 2EQ5A 3OSZA 4ZI5A 1XAJA 1OF1A 3K4PA 1IQUA 2X0FA 4CIXA 1DG3A 1XXHB 1J2EA 2P62A 3WIOA 2QWXA 6PFKA 4Q7QA 2DTEA 1NKVA 1ISSA 5H3LA 4BZQA 3O8RA 1Y1QA 3DQPA 4XCXA 4B2IA 4PQRA 3GI1A 3NEAA 3FOAA 1U28C 1J09A 1QPZA 3A1DA 4W8OA 3EGDB 3R24A 3RRNA 5HRAA 2YN0A 2C2HA 3CUEF 5AD1A 1A9PA 5LP6C 3T3EA 2RFLA 2OKCA 3OZFA 1AY0A 5FBQB 1O96A 3WL6A 2JVKA 5ALDA 4MTLA 2OR3A 2HQSA 3SX0A 3QVGB 2GETA 1QYCA 3FUVA 4GX0A 4BNNA 3QPBA 2IUTA 4DJFC 3IELA 1QAOA 3EDOA 2OECA 1BVYF 3VAAA 3BEDA 2N9UA 4W1QA 4WK4B 3DVAA 5B1EA 3A3NA 4E2WA 2YOFA 2Q45A 5IH3A 2HI0A 1SWVA 1UBOS 1NIJA 1OAOA 3TFQA 1H42A 1IHOA 3DWIA 4JLNA 5E9WA 2IX3A 2QX9A 1UK9A 3O8OB 4E07A 4QKQA 1YR2A 1XYVA 1M2FA 1NZDA 3BE6A 3ZYZA 4RC9A 1G18A 3LUJA 4DLZA 1NVTA 4AJNA 1HNWB 5EPUA 3TBHA 3RAJA 2GBLC 4RZSA 3HJCA 1HNNA 5HHTA 1BU8A 1OT3A 3ENQA 3PGXA 5ECGC 4URUR 3AEKB 2NVWA 3IV9A 4TYMA 4JLKA 2YUIA 3FI9A 3MQ4A 4JK3A 1Y3DE 5G1OA 1P29A 1C1DB 4G0WA 2IS2A 1KPIA 2WSSA 3DWFA 4RTLA 3TGPA 1JAZA 1YJBA 1CUYA 2EDAA 2ZJYA 2C2BA 1P4RA 2BZ1A 2MYNA 1IM8A 1L4FA 2RJOA 3K0AB 2G4LA 4IF4A 4N9QA 1XZBA 2RAPA 5CDHA 3RI3A 2WWIA 2JHAA 1T5LA 1QZZA 5E8RA 1ZS9A 2ZUUA 4DLPA 1R4NA 3D43A 4WDRA 1GEEA 1I7NA 2DTXA 2ZG6A 4WLVA 2JAWA 4KBFA 3IMCA 4OHUA 2WAAA 2YWCA 1FCJA 3QFSA 1ZN9A 3WXMA 2PLNA 3I0MA 2R48A 3B6MA 1X3LA 5THXA 1G8HA 3CI0K 1WD7A 2PSDA 2FR0A 3CZPA 2WTNA 4Z1MD 1Y1KE 1EFLA 1UEXC 1ZPDA 2FF7A 3GLVA 2GVZC 4MUAA 4R2KA 7MDHA 3NANA 4BZWA 4DJDC 4QTZA 1DC7A 1FDTA 5EUMA 1TUEA 4JMLA 4QBTA 4TM7A 3B1YA 1QRTA 1I1QB 3C3DA 4K9DA 1EHIA 2FDCA 4JI4B 1ATZA 4YQFA 2WD7A 1PDWA 1Z74A 1MB4A 3AB8A 2IBSA 4TZ6A 4F56A 5JZBA 4DCTA 1HQCA 2BFBA 3OPYB 1S01A 1HQKA 3KD2A 3KZKA 2DSTA 4PHHA 4WESA 3ELDA 2C7OA 3JZMA 5FUWA 4F3TA 2NU8A 5EJ8A 1H6AA 3T6KA 2BFWA 1FRZA 4DIMA 1CQJB 3QOFA 1NC3A 4UBMA 4WY2A 3A26A 3ZDXB 3OJXA 3LK7A 5H83A 5KAPA 1I4EB 2JI4A 2WQZA 3FH0A 4GH5A 3B60A 4QPCA 1R4AA 1Q20A 4IXNA 1UOPA 3OE5A 3PI6A 4PSKA 1FF9A 1G59A 2DBVO 2IQIA 3FZGA 3L0BA 3PCXA 3QOXA 1JIJA 4LW8A 4MVJP 2MSLA 5CGQB 5U4XA 3OZDA 3RU3A 3AI7A 4PRLA 5EJ5A 3B6EA 1QQBA 1SXJC 2ONYA 3MTEA 3VR6H 1E1QA 2HGZA 3FWPA 4V0RA 1QBGA 3CRMA 5KYYB 3L0ZA 4A91A 3SNKA 1I0ZA 4HAVA 4Q37A 5DU2A 3OZXA 4HNSA 4PINA 5AW9A 1USKA 4NJEA 4O33A 2GF0A 1ZUD1 3QE0A 4BO0A 4FHFA 3L4KA 3QBEA 3TIGA 2ISSD 3JQDA 4WSOA 1N3YA 4RCVA 3DTNA 1A4UA 1Q1EA 1RRFA 2P2NA 3WLHA 1O87A 1QHHB 3VU1A 5K0FA 2ZSBA 4KUHA 1SB9A 4GP6A 1LS1A 3FM9A 1JXAA 4O63O 3RM3A 3RWOA 1FUQA 3U7EB 3EH2A 4AKTA 4UPEA 3DAGA 2FUKA 3C5CA 4E13A 1XNQB 4GDFA 5REQB 1WCIA 3VR2D 1L9KA 1E7RA 1KA9H 1NRXA 2FWPA 4G97A 4NYIR 4Q4AB 4CZ2A 4YBZA 5JNWA 5K0BA 5DYIA 5TF0A 3Q3EA 2F59A 4O2BA 3GMTA 1T1IA 4OBWA 1FU7A 1YMVA 2WW8A 2WB4A 4OUDB 5ALUA 3TLCA 4PZLA 5AW5A 3Q3VA 3TVDA 2D1YA 3O8QA 1JQBA 2X4GA 3QX7A 4NAUA 4MVJG 4RIEA 5CURA 5DN6D 5A06A 3C8TA 1P73A 3LHSA 2W6JD 3WO0A 3KKQA 4F4DA 3PD0A 821PA 4WLNA 4KXYA 3T7TA 4B4OA 4HRAA 2J7PA 2Z0MA 4CRWB 2FPWA 3EYAA 4CFSA 3W7BA 1UOOA 2SKEA 4FFBA 4B6RA 1NSFA 4LFAB 4DV1B 4F0JA 5BSHA 4JIGA 3OTIA 4LF6B 5JVDA 4ZCLA 2O6HA 1SK8A 3U4GA 2KI5A 1S1CA 4KACA 2B4YA 4QXMA 4ZCSA 4GSLA 4DA0A 3MIZA 5GJVC 1W85B 1WUYA 3P5BA 3QLVA 3RIHA 4D97A 4FT2A 5CA1F 1CZUA 3JYPA 4ZQIA 1ESMA 2JPDA 3LCVB 3OPMA 6ADHA 4I81A 4BLVA 1NMSA 1T2VA 1Y33E 1P7ZA 2R6DA 3CBQA 4OGWA 3EEFA 3EQ8A 1C14A 1LX7A 3EAGA 1LZLA 4L8YA 1O9GA 1E6LA 4X7RA 3TMKA 2W48A 4M0PA 4UDNA 2I4MA 4XVHA 1QB8A 1JBQA 3D59A 3PZBA 4E2YA 4FYPA 2UUOA 5ALSA 1XKQA 1ENPA 1FUYB 4HGRA 5I48A 3GG9A 2Z56A 3LU1A 5DM2A 4KVGA 3FWYA 1R0CA 4ZALA 4ZVVA 5JW6A 2Q0QA 1V43A 5DGCA 4DYVA 3NZEA 1CR0A 2IOFA 3FMPB 3OJWA 2A0XA 3CO5A 3FFTA 1IY0A 4MRMA 2E2WA 3VPXA 2I1LA 1OA1A 1SVLA 1BRTA 1T9GS 3EZ6A 3K94A 4X6XA 2AFHA 3TTVA 4LTDA 3H5RA 4UVGA 2YN4A 2NPIA 5AKGA 1JJVA 2J41A 2VK2A 4BNHA 2JH9A 2OAP1 2MYTA 3THOA 2P8JA 1XD2B 1FXWA 1G0NA 3BSWA 2GX6A 4MVJI 2C2KA 5EJ4A 5JRJA 1XZ8A 4C0XA 2JCYA 4L5BA 4EYEA 3PQ5A 3G2QA 1CY1A 2VJKA 1N3BA 2ZROA 1LK5A 3GYGA 3ZHCA 1WF6A 4D5EA 4N8EA 1QRSA 3DDWA 1ULSA 4Q5IA 1NQUA 3IS3A 5CFPA 4HUJA 1ZITA 3O2JA 4B73A 2BJHA 1HL3A 3HU2A 4RIIA 2OYSA 4B17A 5JMWA 1GKUB 1YGYA 4DJTA 4QGSA 3NR2A 3CVOA 2EBHX 3IMEA 3P0IA 4V24A 2J8ZA 1PS0A 1QF9A 4LOLA 2RARA 4UUPA 2Q5JA 1CVRA 2ORVA 1MB2A 2BGMA 3H4IA 4II7A 2PZ8A 1S0UA 4MKGA 4BE7B 1Y6GA 2NM0A 2Q46A 3H0EA 5CYOA 1X1TA 4E33A 2WJ6A 3FMVA 4RHEA 5FOQA 2P4UA 1G5IA 2B4RO 4S04A 1DCMA 4RSMA 3KU1A 4NZNA 1N2CB 1N9KA 2IYUA 4JU9A 5DK6A 5J23A 4ZVLA 3I4CA 2WB2A 3CXRA 4QBKA 3QW2A 2Y92A 3EQ7A 3E3AA 7YASA 3G2MA 4WHMA 5IPFA 2MWMA 5D6BA 1P4AA 2WD7B 1WVIA 1NVMB 1A72A 1H8EA 1T4DA 3SYTA 1YU9A 3HYTA 4RH1A 1QAQA 4NABA 2RK3A 2HQ1A 4RF3A 3HJRA 3WXBA 1VECA 2PK3A 2ZYTX 4BMZA 2QRLA 3QUAA 5DN9A 4R0NA 2VF4X 4NU8X 1H8HA 3IB3A 4FIZA 4TMZA 4DV3B 4H9GA 3KU4A 1G20B 3WNQA 2R1TB 5F2KA 1DEKA 3WLNA 1N2EA 1SVIA 1SUFA 3KV3O 4L9WA 4RFVA 2BHTA 4YYEA 3NOOA 4AO7A 1OLSB 1MVNA 3AHEA 5CITA 1O77A 1DBWA 5ALXA 3VR3A 4HYYA 3FZNA 2HU5A 2A9KA 1TYEB 1USGA 2E89A 4ZI7A 3S28A 3VUFA 2VA9A 5DI3B 2ZUFA 1Q0UA 3TIIA 1T2UA 3WV4A 1W5BA 3B12A 3Q1KA 5AI9A 4Y2JA 4XLZA 1XEAA 1TECE 3A1UA 4QULA 1YZGA 4IH1A 1MF7A 4CTKA 4M9SA 4AP6A 3UY4A 3DEYX 3NBXX 2W8BA 3LWNA 1OIXA 3CTPA 3COZA 2BONA 4TLDA 4FGSA 3ONNA 2QVBA 4BO5A 2GWHA 2Z83A 4RWEA 2Z6QA 4TYPA 1KY3A 4F2PA 2RHDA 2VA8A 2HPHA 3AIIA 4NONA 4LQCA 5CIWA 5A2GA 3DD1A 5CR9A 5C8VA 3QKUA 2KE5A 2P75A 3T15A 3TAXA 4D1YA 5F3WB 1WCIB 1PR5A 1JDNA 4GOXA 1RMTA 2G1UA 3ZE8A 4PGHA 4ZQFA 4BQIA 4L74A 2DERA 2PUVA 3LO8A 3LC0A 1EVQA 1KO4A 1SVOA 2YINC 2Q6OA 2D3WA 3WWEA 5EE5B 3ZCVA 2OWEA 4YMWA 1JQKA 1Z5UA 1SPXA 5ALYA 4AZ3B 4MVJE 4NBUA 1RZ3A 2ZI5A 4HEHA 5I4CA 3HVRA 2BP7A 2INGX 3GFOA 1YR7A 4XIJA 2F1JA 2QT1A 1GPLA 4EY3A 1Q0ZA 4JVMA 3J81k 2XIJA 4D6XA 4CM4A 2Q9UA 4G65A 3DEFA 3JVIA 3JS5A 2ADOA 5HR5A 2ILVA 5F4BA 1UM8A 4IZHA 4Y0NA 3W3ZB 4ON9A 3N2LA 3E9MA 3NUQA 2YJGA 2NZYA 2W2NA 3D6AA 3GRPA 1VYHA 3LUAA 4MGKR 4FFBB 2QTGA 4ES6A 4DGSA 2DPHA 5JVDB 2QQFA 3SEQA 1H1DA 3TQIA 2HO4A 2FGJA 2FDXA 3A2NA 4YHBA 2OO5A 4MQ5A 4QOJA 3KSZO 3LE8A 4MRNA 2O3TA 1G9SA 2V7QD 4BB6A 4EGQA 5DLQC 2RGAA 1TLTA 3EGXA 3DMHA 3FKQA 3EZGA 2FGKA 2FG7C 4I5EA 1WUKS 5HQJA 2WNHA 4LJRA 3U81A 1DKLA 1VTKA 3IJPA 4IQ8A 1V9CA 1WUHS 3KOMA 4GPIB 4ALIA 3VH1A 3VJMA 1LBEA 3GN1A 1NTRA 3OEHD 4DWOA 4RA9A 1ZK0A 2GEUA 2P6PA 3BK2A 1U2TA 1QS0B 3NH9A 2B20A 4XYLA 2J6BA 4RPHA 4I4IA 1CRQA 1PL7A 1SUPA 3R4VA 3AC0A 4LS3A 2P2YA 5DTQA 4K86A 3WNZA 1N2XA 4KXXA 4UEKA 4EMUA 3ZHTA 1I4TD 1PGJA 3DEHA 4HMPA 3HRHA 4N7MA 1GTG1 5ADUS 1W52X 4ANFA 1X1EA 2AFHB 3TZEA 4AWAA 4V0QA 1E4VA 4MKZA 4PLVA 3LFTA 1C4XA 3ELUA 3RKUA 3S2YA 1NMXA 2Y6VA 4Z4IA 3EQ9A 2I62A 1F6DA 5IK2A 1GQ2A 2ZB4A 5EIXA 4KH1A 2CHUA 5KC8A 4JAVC 4FDTA 4OM8A 1FW8A 3MSCA 4R40A 3RSGA 1Q44A 3T9AA 3EFBA 2P7HA 3ES9A 2C00A 1NNEA 3AUFA 3LLVA 4GI7A 1TD9A 5BWBA 2PKEA 3NC1C 2AZXA 4KPUA 1B3RA 1CJSA 2LKCA 3OMLA 6CHYA 1GR1A 1K75A 5IKMA 4AKGA 1E9DA 2GCIA 1IQRA 1LJUA 3DKVA 1QFSA 3E0XA 4ZVPA 2Q4DA 2VWQA 1URPA 3AJ9A 4FE3A 3HHEA 1FTQA 2IY9A 1BDBA 4BFZA 1BW9A 4HWSA 1ESZA 4TV9F 4BLUA 5EJ7A 2ZI6A 4B6PA 1PRYA 4Z3OA 4O4JB 2C5BA 2NSLA 2ZUDA 2I54A 3RRMA 4ZAGA 4L4XA 1ZESA 2QE7A 3NOXA 4KXQA 1L5WA 3WIEA 5JXIA 1EX1A 1KVUA 1UMCA 3AY0A 3A1WA 4IM7A 4REQB 1DTWA 1WV0A 4EMTA 3MERA 4LGCA 1RPNA 1C5KA 3MJSA 4J0GA 1V1JA 2H9YA 4JVOA 2EJVA 4YGXB 1MCZA 2BZSA 5T5QA 2PPVA 2G9RA 3LLMA 4CQNA 4BQOA 4C5CA 4JB3A 1AB5A 1Y3FE 2CXHA 3FCOA 4KQ1A 1JEOA 2EC5A 2OAQ1 1KI3A 2V7TA 2XBUA 1KJ8A 1UT8A 1QMPA 2AOVA 2GILA 4TUYF 3R7AA 1I2BA 3THRA 4IINA 5DT2A 4RV4A 1KEVA 1SHKA 2XUAA 3HA5A 4JR1A 1C7FA 1GGVA 4D99A 5ALZA 1NAHA 1WHTB 1CC1S 2C03A 4E5YA 2FMUA 5I7WA 5KPDA 1I24A 2I8CA 3CN9A 4DPMA 3I2KA 2EZ4A 5CU7A 4RQAA 1ZL0A 3F98A 1S5PA 1TQHA 2GUGA 2Q9AA 4G1BA 2ZIAA 4G3XA 3TGWA 3W2TA 2ZANA 3OJFA 3EPPA 1P61B 3ICWA 3GP5A 3HJGA 5EAIA 1CTQA 3I8SA 3DKRA 1KJWA 4RADA 4ZVQA 2MSWA 4C4RA 3IE1A 4ARIA 2Z5VA 2NNWB 4IHAA 5EKDA 1M8PA 5F7XA 4BP1A 2RHRA 1UF9A 1DAKA 2NYAA 2Q5HA 1UJ6A 3ANTA 3OJEA 2Y1LA 1R8YA 4DPKA 3EPLA 2JAPA 1KMHB 2JHCA 4CFYA 1ZOLA 3KYCB 5GINE 3FOFC 5LA6A 2R47A 3ZZUA 4UM8B 1J5EB 4R1SA 4OUKX 1OX5A 1XT6A 2BY4A 4EHBA 2ZJ6A 2ICAA 3C85A 2W8BB 3K96A 4HDNB 3R7SA 4C06A 4ZV4A 1SCQA 2YIJA 5I8ZA 3E27A 3AL0C 1J2UA 1CRZA 3CE9A 3QSGA 1C3LA 2CDCA 1FX0B 2IUEA 3K71B 3MBIA 3SGLA 4UHFA 5CLGA 4J76A 5CBKA 5IYZB 4HPXB 3TXYA 3GOHA 1ZNXA 1WEHA 3GR6A 1S2GA 3I04A 3HMQA 1LPMA 4FHZA 1E2LA 2D13A 4KWEA 4U7PB 1Z83A 4D57A 1E59A 1GA4A 2QI9F 4LKRA 2FLKA 3IHKA 4K6FA 1SU7A 2E1PA 4H3SA 4JJ7A 4PNHA 2V96A 4PQGA 3Q5GA 1BAPA 3WO1A 3W04A 3KVVA 1NMQA 4Y1GA 2BP7B 5ENZA 5M3BA 4BLQA 3OZSA 3JASB 3U17A 4ITRC 4IZIA 4L28A 3CZQA 2HSGA 1QCCA 2B6NA 2IYSA 2Y66A 4GMGA 3E3OA 4M53A 4WOBA 3V80A 3GLGE 2HMYB 3CUWA 3VDXA 1GQOA 2QVZX 2UZ1B 2OZEA 1LD3A 4KIWA 3WWYA 4QOFA 4DHEA 5CGZA 3VU9B 2IT1A 4NHOA 1RJDA 1H66A 4DLAA 4RE5A 3KUKA 4H60A 2AMVA 5F73A 4J16C 1FFGA 1U31A 3ANSA 4GZMA 3VO9A 1HNZB 4DUPA 4GNKA 5ENVA 2VHJA 1G17A 4MUEA 4XJTA 3R8XA 4DBVO 4YI5A 4DYHA 5AVKA 3DPUA 1XZPA 2BGKA 5DE3A 1U7HA 5DYWA 3W2HA 3EXAA 1N6IA 1VJRA 1EDZA 2GBCA 1EB9A 3EJWA 4PS1A 1QHGA 4PZ9A 2H4ZA 2RB4A 5AHKA 3A0UA 3E1GA 4FFRA 5KNBA 2XLCA 2IHYA 5DBEX 3BHGA 4DCVA 2AJCA 2C04A 3CLUD 3U7GA 3VV3A 2XPCA 1IZYA 4PX2A 3ZQKA 1WUJS 1L1FA 4OK6A 2JIMA 5JZOA 3KHSA 5K0SA 5BV8A 3QLVC 2C97A 1ZSVA 1JDBB 3PT9A 1CEXA 1E3DA 1F3LA 3H2GA 4BNDB 1AC5A 5EP2A 3F73A 3GEPA 3H6HA 3NHYA 3SDBA 1EP2B 2ZRIA 1UWLA 3OQJA 3EC7A 1II0A 2EF1A 4KIGA 3C43A 3NBFA 1Z82A 2H06A 1SEPA 1SQFA 1SUWA 1X1AA 2IOQA 2WRZA 4IV0A 1GEGA 2ALJA 3N0XA 4ZAYA 4B46A 3S40A 3E9YA 4R8RA 4AP9A 1RE5A 1HLGA 1V8PA 1FFDA 4IXDA 3TLJA 1YBVA 4HX5A 4FHGA 3ICQB 4CEJB 4IJ6A 1HT3A 3L8ZA 3IUBA 3L7OA 2ZT6A 1Y80A 1QKJA 2QVGA 4GBJA 1NX6A 3S29A 3TEJA 2JLUA 4HAUA 4XDHA 3BRSA 1T9GR 3ITDA 3OQHA 1KQ3A 1TF2A 4LY3A 2CZGA 4GYWA 4E4YA 1RTKA 5LIPA 1GZ4A 1YTUA 3PVSA 1GR0A 2ZB8A 1MC1A 3PR2B 5JJIA 2ZJ3A 3N58A 1ZIDA 2C0CA 5AOAA 2OAEA 4MVJH 5BN3A 5AHOA 1SD2A 3F8WA 1IU9A 3DBOB 1VGQA 4KPUB 5HGJA 3OC0A 2C8VA 4XGQA 2EU8A 4RTQA 4KRYA 2JLRA 1VSUA 2BI7A 2PBRA 4KW7A 2O3JA 4ZOLB 4Z0NA 2OPHA 2EW1A 2PH3A 4Z86A 2ZR0A 4TX1A 4AP5A 3I37X 5A3JA 1NM5C 3T1VA 4JLSA 5BN4A 1EUCB 2A5FA 1C1YA 1HTTA 3LUCA 5MGBA 2G63A 2FY8A 4N7RA 1WULS 2FN8A 3FLMA 3U09A 4A6DA 3EXIA 3H2YA 3TL6A 2P68A 3O03A 4GI2A 1O8CA 1E2DA 2H1LA 2YYAA 3HCDA 1E6CA 1QO7A 5I47A 1E69A 1HE3A 2V1UA 2Z3WA 2WKPA 3DAFA 3KPWA 2H51A 4LTMA 3THSA 2NOAA 3I23A 4IJKA 1IK6A 3KAKA 1FFWA 3ETHA 1OXTA 1XTSA 3F6EX 3OZAA 3BERA 5LXTF 3LFHA 1N5KA 2C5FA 1NF9A 4O0MA 1M76A 1KSGA 1IN8A 3OTOB 5LNK6 3PQ8A 3QM1A 3RIYA 1RI3A 2DC1A 2DFDA 1K6JA 2FETA 2P5YA 2X9LA 3LQ2A 1BJTA 2B35A 2IYEA 1MUUA 2JANA 3IOEA 3KZCA 5TPZA 3WAGA 1JYFA 3GT3A 2XI4A 1MOQA 1KO8A 2OFXA 3QU2A 3WYEA 2E9FA 3A9WA 4U0KA 4YJHB 2F4VB 1JIQA 1E9AA 1C3OB 1I80A 2IYWA 2GFIA 3AP3A 1OB5A 4OQNA 3H5TA 4RW0A 5JG7A 3VX3A 3ZN2A 1LWOA 1PI3A 1RAFA 5FKJA 4YS6A 4N9WA 4B4WA 2PZGA 3P1JA 4PLZA 1G2QA 1II8B 4Y2YA 3SG0A 1NW5A 2EFYA 3F5FA 3KOOA 4PAOA 2H7YA 2HBYA 2J1LA 2DR3A 2GFHA 3KTDA 4TXNA 5E2IA 5LBUA 4K81B 4ZCRA 3UJ3X 2ZSHA 4B5LA 5CLIA 4BWFB 3F4SA 2R8ZA 1G21E 2CC2A 5GIPE 3HP1A 3PTAA 4YGYA 3N7TA 4NZ9A 1B74A 1RWOA 1Y8ZA 3WIVA 1Q7CA 1QYIA 3GPLA 3GEEA 1D09A 1E2NA 1ZSYA 2EFEB 2UVPB 3MG9A 4MUIA 2NZJA 1BWSA 2W2OA 3LT5A 2AN9A 3GRVA 1CQXA 2DUWA 3O4FA 5EXXA 1CV2A 1A50B 5DO9A 1W0JD 4M4SA 2XNDA 1GSAA 4O08A 4IRXA 3X43A 1QGUB 1P7VA 4BY9E 2NUPB 4O5OA 4BNUA 3ZW8A 5KYUB 1MAUA 1ENZA 4FLMA 5DCLA 3DTVD 4EPXA 5IM5A 4N12A 3NONA 1OH6A 3EBLA 4QOEA 3S1SA 4Q82A 2QQ5A 4I55B 2VDWA 5JO0A 2YN2A 5L7TA 1GQFA 2ZVPX 3IXQA 5EP1A 4Z9XA 1J9EA 3V1YA 4R83A 5C46F 3K73O 4BMDA 4HNAB 2BI4A 4F9EA 5E9JA 3HI6A 2B8TA 3PD7A 2ZQZA 2BHLA 2H16A 5JSZA 4G0UA 3BCRA 1YB4A 2WY2D 3NAZA 1C2YA 1C8LA 3DO8A 2L42A 2WP8J 5KOJA 3H18A 1PNTA 1BCRA 2JFFA 4IIJA 4BGIA 3K15A 2F48A 4TV8F 4AJJA 5F7ZA 1AN9A 4M60A 3WYCA 5CK4A 3U3OA 1EESA 3N2GB 2BN4A 4RPKA 4DARA 1QHEA 1KQOA 4MJLA 3ZCSA 2R6ZA 4Q7KA 4U2FA 3E3MA 2FX3A 1E5QA 1AQLA 1HKUA 1U3DA 3PNSA 5JY6A 5HDBB 1N6NA 1Z29A 3A4VA 4HLNA 1Q6ZA 1VPWA 2ZUSA 4BVBA 2OO5C 1T9HA 2GLXA 3LM8A 5H4GA 1PSDA 3L7CA 4MH0R 4NG5A 4J1TA 3UAGA 4DQVA 2PWZA 5TQJA 3FOCA 2Y6UA 4LBWA 4MUHA 3TQSA 3NM6B 1N5MA 1NR1A 2W00A 4JOCA 3FA2A 1KU6A 1ETHA 3HEMA 3O2QB 5ILQA 2Y1CA 1JDBC 1Z26A 5ALGA 2GPSA 1DO2A 2EBUA 4GDMA 4LJ6A 4PZZA 3WK8A 3MUFA 4B1FA 1T36B 1QTNA 4PQEA 2Q41A 4Q24A 1NYTA 5K4AA 2VK1A 4BQRA 4BUZA 1K62A 1HBJA 2P0EA 3JX9A 4MQLA 5BSKA 1CK4A 1H0KA 1VGRA 3KQTA 4XH9B 3R7DA 4B6OA 3WBJA 5AJXA 1R6VA 3E58A 3M6LA 1M1XB 2FZEA 2H0AA 2ZRMA 4BKPA 3VUEA 3W77A 1KERA 1M2NA 1TM3E 2EKPA 1HDGO 1BD3A 1BX3A 3BGVA 1ESCA 3F6BX 3R40A 4PYKA 4RSRA 2AKAB 4N1AA 1Z4QA 4BBJA 4ZT2A 4JV5B 1Z4MA 2PMDA 4BN4A 1CE8A 1EP9A 4MIEA 3GAMA 4ER7A 7ABPA 5JC1A 4FGUA 5IAAA 4U2GA 5F9HA 1KOGA 3BTUA 2ZOSA 1TDJA 2C78A 1E3EA 1GSOA 3IBCA 1YT5A 3B3FA 4LGMA 3BIXA 2Q4BA 4WTOA 3CSDA 5IAGA 1VB5A 2EV9A 2E5WA 2JRLA 3OX1A 4MS4A 2OSBA 4QELA 5AP9A 1PT8A 1CR6A 1WVGA 3LY5A 2ZJ5A 4TRNA 2YW2A 5ICMA 3F1LA 3ZVRA 2AB0A 2W2LA 3GLUA 4HB3A 3RPEA 3FHTA 3O9MA 4K5QA 3IH5A 4KXWA 4P4LA 5KS2A 4LNHA 1JT9A 2OZKA 4N7JA 3NI2A 4UAJA 5LQJA 4I3FA 4PU0A 4ABYA 4B32A 1RHUA 1OCEA 1YSCA 3A10A 1LC3A 2ZIXA 4XFDA 3KTAB 4N5IX 4DLYA 4RD0A 1AKUA 2Q0SA 5IG2A 1NBHA 4E11A 5A6SA 8LDHA 1ESNA 5DXJA 4MWOA 1HE1C 2XEXA 1L7PA 2BTQA 3HR4A 1P4HA 3O4HA 4ASUA 3JVEA 1YF3A 4CIDA 1PDOA 4L95C 4J0DA 2P6UA 3CNLA 4KCGA 2JVJA 2RIRA 4TWAA 2NO1A 5JYEA 3T5MA 5CIYA 2IEDA 1NIPA 4GKBA 1FSFA 2QN2A 3IAEA 5F52A 2R1ZA 1PEYA 3PDCA 5JZ9A 2H85A 2PKQO 4MR8A 4B44A 1CZLA 3FCEA 5CDTA 3LYLA 1W4ZA 1XZKA 2FCAA 2WTMA 4N0PA 2NXJA 5K0LA 2O0KA 3KJZA 3H83A 1X2BA 1YIOA 4P0TA 3TAHA 2DQYA 3TR0A 4CKBB 1S2DA 3BD8A 1Z6PA 4DXHA 1GTJ1 5CW2A 1Z8FA 1ZW1A 1SKYB 3IO3A 2VSNA 4JJFA 4XGNA 5FFFA 2XF8A 4OK3A 5FULA 5ES4B 3TLEA 1GUAA 1OASA 3I2IA 4P2BA 2B21A 4A8PA 1VC2A 1G4UR 2I9PA 3JQBA 3VPSA 2P35A 1PD1A 3LRXA 1Z2NX 4HXEB 2CL5A 4ZOBA 5JQGA 1OXMA 4S35A 2YFKA 1K9SA 4FMCF 3NDPA 4W5TA 2X0JA 3S2IA 4R7GA 1JHQA 1SUAA 3ETNA 5K51A 5C1OA 2VBGA 5ICSA 2WJWA 1CFZA 2FW0A 3GBPA 4KGXA 1XRMA 4XARA 3ZW9A 4IS3A 4M88A 5T3UA 4DJAA 1OC2A 1NLFA 1XXLA 4FNAA 2PLAA 4M7WA 5TT1A 2QJOA 3SYMA 1SR8A 2PL9A 3F4BA 4I8XA 4Q3BA 3NM4A 3BEOA 3OHPA 4WBXC 3U4QA 3R3YA 4ZAZA 2XDWA 5AW6A 3BGSA 2VAWA 4A0RA 2Q6IA 3FVWA 4TVBA 1K89A 1KQPA 4KP7A 4ARAA 1ELOA 3CF6R 2RE8A 6AT1A 4RYLA 2J9FA 3AUXA 1W5EA 4HDMA 4H2DA 1TYAE 2IYAA 3OU2A 4JQCA 5FUVA 1XTZA 2FOIA 4U6NA 4C3OB 5TPWB 1E5VA 4HDKA 1SUIA 1WKVA 3NBMA 1TKAA 1G63A 2ECPA 2OV6A 4HOYA 1SU8A 1Z0JA 4B74A 5JSZB 3IT3A 3FTEA 4GOND 3QWAA 3OM1A 3EULA 2DQ4A 2UVQA 7REQA 1OH8A 1UPXA 3ZQUA 1DQZA 2RI6A 3EPJA 1NWHA 3NYRA 4WXEA 2A6PA 2PT5A 4PZUA 4BU1A 3W90A 1HOTA 4C4TA 1QFJA 1VRWA 3ICPA 3MYRA 4X8HA 5T6MA 3LECA 5JO9A 5B64A 5DYNA 1P2DA 2VHWA 2EJUA 2A86A 2QRNA 2J4DA 4QYIA 4E14A 3N0WA 3KUDA 2WMDA 5A0FA 1UDBA 3B36A 1CRWG 4YUZA 1BQ4A 1N2OA 3AEQB 4L5CA 3FDZA 2XVMA 4FEYA 5AI0A 5AESA 1UMDA 4DLSA 2IXAA 3L7NA 2COEA 4UNQA 5J47A 2ZTVA 5LDGA 3ROFA 3ZU6A 2BMAA 2GYYA 2QS9A 4J91A 3W6PA 5BMVF 1OB2A 2D4HA 2QUHA 3GLKA 3M3DA 5KYNA 1SCNE 1ZC4A 2XGJA 1RAAA 2W70A 1N6HA 2D2VA 2YCBA 5BURA 2VRCD 4X3PA 4BE9A 3H5AA 3VJRA 4Y7CA 5CYFA 3K0FB 2ZU0C 2DR2A 2HT1A 1UMKA 3VOAA 2ZU6A 2YV3A 3QJGA 1BWQA 4MKHA 1AUXA 4IMPA 3I64A 3R7NA 3WISA 4EW1A 3KQQA 4K9KA 4K9OA 2BV3A 2CYAA 3L9XA 1DHRA 2DT5A 3I3SR 4LJ9A 1QV6A 1VIVA 3LVBA 2AT1A 4G8CA 3U4CA 4XB6B 3V1LA 5B7PA 4CETA 3KS9A 5JCPA 1ML3A 3GEHA 3QVWA 3DMDA 4EQZA 4QM7A 2FWNA 4F4UA 5KNDH 5KEIA 2B5WA 1O58A 1L5LA 1CE8B 5KIAA 1UXOA 3FPAA 3WLIA 5IDQA 1JP7A 4BB5A 4BYGA 2VUUA 2JFQA 3BWCA 5TQ2B 1Z6YA 2J5KA 3DMTA 4N3GA 221PA 3L9WA 4DUGD 5JEEA 4UXIA 4WXPA 1L4UA 3AZPA 1F4PA 1V37A 1TQ2A 3NBUA 1U8EA 2CL6X 1EWKA 5CFOA 1LB1B 2IH2A 3DR5A 1F9EA 3R5XA 3C87A 3TVYA 1TA4A 2GHTA 3OTHA 4MWSA 1VSBA 1V4NA 3CVYA 1YZFA 2EYUA 1YI1A 5K1ZA 2GXAA 3EIEA 3NUZA 1Z13A 5ARDA 5JD5A 1EEXB 2XMCA 5EIBC 1ZCFA 4LF9B 1O57A 1SXHA 3SCZA 2C94A 9LDBA 4BBPA 5A6SB 2VQFB 4ZEXA 1JVNA 2FJPA 4O1IA 1GOTA 4PCAA 1CZOA 1T6YA 4GS5A 1BTOA 3AO0B 3LA6A 2DCMA 3ZWYA 3TBFA 3F5MA 4P9NA 1GAQA 1NP3A 1H85A 4K87A 3DHYA 4BMPB 3JY6A 1XTKA 1KPGA 3GVIA 4IQFA 1H0HA 3B2QA 3TNYA 3O93A 4WK2B 4Z9FA 4F5EA 2EJBA 1KDOA 4C88A 4CM1A 5IRCD 3SXUA 3ZDBA 1JHUA 4NFLA 2JFOA 1FUPA 1YCHA 3PUIA 4RESA 2ZRHA 2J0SA 4C89A 2P78A 3N8IA 2JATA 2X8JB 3FYHA 2HM7A 1SOMA 2OENG 4F8YA 4DRYA 1T5BA 4U4AA 4E3ZA 5T64A 1YR8A 2A5GA 3GBVA 4UFNA 1MHPA 1LJLA 5DWVA 1K8QA 2CLCX 3LGXA 3VR4A 4E3WA 3J7TA 4AJEA 1P81A 2OV4A 2J3HA 3F5SA 2ZRLA 2E18A 1VCNA 4EO4A 5CK5A 5A0VA 4ZAFA 4E70A 2A59A 4A2WA 3FRHA 5JQGB 1UXHA 2D5AA 5FHQA 4C3UA 3WQRA 1WB9A 4IIFA 4BN5A 1UKEA 1XYGA 4H7KA 4X91A 5G0TA 1KK3A 1Z4LA 1ZD2P 4NSNA 2H2HA 3GFTA 3KR0A 1U2EA 4MW4A 3Q9UA 1LVHA 2J5BA 2QEQA 4KVZA 3AVYA 4CVNA 2AMJA 3L7BA 1RRGA 3W3AA 5GOTA 3OD5A 4H7JA 1KY2A 4CTMA 2JFHA 4L8GA 1U9CA 3N1UA 5FBRB 1CUUA 2V6IA 3U4QB 3QVUA 3A4NA 3D8TA 4X1OA 3WMXA 5JT1A 5LIRA 3I9MA 5DW3A 3AL2A 5FRDA 3UMJA 1KQGA 3KHTA 2P0YA 4HDMB 4MCIA 2EKDA 2I2XB 3G2JA 4UBKA 5HKAA 3ML1A 1YA8A 3THYB 2RJNA 1ECFA 4KITB 2VPQA 2ZJAA 3FUTA 1X1QA 4HDKB 1I9GA 1DQPA 1SMKA 4GR5A 1RWXA 2OM2A 3UHAA 1Q1GA 4ZZ3A 3RF7A 5DM60 1VI2A 4A2QA 3BMNB 3M34A 1QR6A 4MP8A 3PC3A 5ITZA 5EJ9A 1PE0A 4EAAA 1AU9A 5IT5A 4E5VA 1WR8A 1JN0A 2LXNA 3MCUA 4C0BA 1VSTA 1U1IA 2EBFX 2IIPA 4GOMD 2E9SA 4JODA 3RS9A 3S5JA 5TEWA 3VO8A 4B6FA 5KOHB 4H1TA 4JROA 4I2NA 1HE2A 5EYPB 1GTRA 3O26A 1DZIA 1FYXA 1DCNA 4ADMA 3AFIA 4QYIB 1O6CA 2OD9A 3MS2A 3K70B 3BJMA 2BEUA 4TWJA 1GHTA 1Z0KA 2HWUA 3N07A 3OPNA 3C6ZA 4CE6A 4JMPA 4YCNA 1YVEI 2HCFA 2J3QA 3BSYA 1PJAA 1UMDB 1XMXA 2GO7A 1BKYA 1AA9A 4LY6A 3T5CA 5DHSA 2JLXA 5FPQA 2IHBA 1L7EA 4HGZA 4ZOQI 2CZCA 2JL1A 1BGWA 3ASUA 1BEUB 3K0SA 5JPIA 1YU6A 5E8JA 4IL5A 5CEEA 3MAAC 4ECAA 4UU1A 4J1TC 4C6TB 1E92A 4DMKA 3UJDA 3HCWA 3EG9B 4P4NA 5IT9A 2R6CA 4DTCA 1ZGAA 3LCRA 4RPJA 5AM0A 5FNZA 3U16A 1EX7A 3D7RA 3HS3A 1BA3A 1XZDA 3I8XA 1E6UA 3JQFA 4KQEA 2BL4A 2KM1A 4AJ4A 1NPYA 3SHFA 1M8JA 3VNQA 2QE7D 1S8NA 4OP2A 4UJ5A 4AK9A 2O7RA 1DDIA 4GI1A 2VATA 1AS0A 1VYVA 1VMEA 4FZRA 2B8NA 1EX9A 1R7RA 3BICA 4WINA 4CKCA 3AF6A 4AYWA 5BW5A 1DXHA 3K9HA 4G1FA 4C7OA 2J3KA 1YZ3A 1UPUA 1Y3AA 1A9XA 3ACDA 4TVOA 3N8NA 1CUFA 2UYYA 3D1LA 3ZY4A 1W8IA 2D5IA 1N8SA 1PJ2A 5EKSA 1SBZA 1GUFA 3NHMA 2G9VA 5KYKA 1RMQA 1PNRA 5A71A 4DOMA 1WDKA 2P2DA 1AGPA 2BI8A 1ZA2A 3TE7A 4AMVA 4H6VA 4DVJA 5EJGA 2C7GA 3A6ZA 4F9TA 3TFOA 4LECA 4OSOA 2ZI3A 1QP4A 3LVFO 1V35A 4RKYA 2G76A 4WGFA 4YTEA 4F5YA 2PD6A 3ND6A 1ZJJA 2NVUA 1F0KA 4M9QA 3PJRA 3UAYA 4MV1A 4L02A 4CUKA 4E0BA 4C76A 1MJGA 4OJQA 5DFAA 4B3HA 1EAMA 1YKFA 4PHFA 1KZYC 1PJ4A 3T9FA 1J20A 3EZNA 5HILA 3V8VA 2I6XA 3VR0A 2JJYA 1JU9A 2Q21A 3T0GA 3AHCA 4ISBA 3MMNA 5JANA 2W5UA 3S99A 3A1FA 4HS9A 3BQ9A 3UHJA 4X54A 5EKTA 4ZMSA 5C4GB 3TOXA 1NE2A 4JT9A 5DNCA 2IP1A 4D3DA 3IQIX 2ZRBA 4KYIB 2MCFA 4F85A 2XE6A 4BNMA 1U0LA 1Z5ZA 3LTEA 4F86A 5EWLA 4R05A 1GAEO 1TA9A 1DBVO 1XA4A 1G8FA 3LWDA 3RJ5A 4RTPA 1MB3A 2ZAGA 2I1VB 1PV4A 4AN0A 2YKGA 3AUAA 3W5HA 5JJLA 4L9RA 3KKNA 4JI0B 3NRBA 2MSEB 3O90A 3ZE6A 1CUJA 1F1BA 1RZRD 1DRWA 4BQEA 3RRZA 1EDEA 5DP2A 5KBYA 1SQSA 2JAUA 2HMSA 3E9QA 3ADDA 3AJEA 1HDYA 5AO9A 4NBRA 3MOGA 4P36A 3D6VA 4N0EA 5JRDS 1NVFA 2ZBEA 3E3NA 3O0DA 1VDKA 4GEKA 3ED1A 2I8AA 2BM1A 1KEKA 1TEXA 2BEVA 3CV3A 2GZRA 4QBFA 1FVHA 4QX6A 5D3ZA 4DANA 6YASA 5BWCA 4JP2A 4R8VA 3WMRA 1XJ5A 2Q3HA 3SBOA 5C7OO 2SICE 4F3RA 4R5HA 2HBQA 3L07A 1W94A 1RZVA 2P9HA 3JQBC 1IYZA 3L06A 4QFBA 3UXEA 4CLHA 3UYKA 4QBHA 3C3JA 3N87A 4WX2B 4B81A 3K8QA 1QG0A 2DFVA 5BUQA 3OJLA 5K3EA 5J2UA 4NAHA 5F23A 1ZD9A 1YQ9A 1TGVA 2WM9B 2X0KA 1S2MA 2PH5A 3FPJA 3IQDB 3M1YA 3QBJA 4RZ2A 1N9ZA 4HRXA 5KSYA 3C24A 4JJ8A 4APAA 1L7XA 4RD3A 2QW8A 3ZXYA 4RTKA 5CP8A 1LU9A 2AG8A 1RLUA 3B9PA 2VEOA 1X7HA 2NSYA 1PJZA 4HWKA 2YHIA 1M3SA 3CZ5A 1XDZA 3I9FA 4GL2A 4QNRA 1VIDA 3G8YA 4Q05A 2O3UA 2PJZA 1T2EA 3V7NA 2XQJA 3JQ7A 5CH5A 3X1JA 1N8KA 1TA0A 4I9HA 1SHTX 4NG4A 4PAGA 2VCYA 4WQMA 4YC7A 2I2DA 4ZAWA 1B26A 1FYDA 5SZIA 3R6QA 2W93A 1MA3A 1SCIA 1TM1E 1SVSA 3ZY5A 5BNZA 2JLYA 2P4QA 3N6VA 2G28A 3V6LA 4D3XA 1SIUA 1SUCA 4V38A 2JC3A 2FZ5A 3R75A 4B3BA 4PLFA 5CFRA 1RC8A 3VSEA 2C2OA 2HTEA 3Q3HA 1JFSA 1K8YB 2XMRA 5U1PA 1Z25A 1I5OA 1E3WA 2TSYB 3LWZA 5G0WA 2QJRA 4FWIB 4TMXA 1EIWA 5BR4A 1XC7A 1F8XA 1YBHA 1Z0ZA 2WG1A 3MT7A 1QGAA 1SXGA 3H9CA 1SBTA 3IHLA 1N25A 1FP4A 2Q3MA 1D4OA 3RB8A 2ZUEA 4NE9A 4HUTA 1KZGB 3I09A 3OF2A 2O6LA 3FOZA 3WLJA 4KNVA 1RHKA 1KY5A 1XRQA 1Z88A 3PV0A 2Q4OA 1O8BA 1VRVA 3A32A 3MAGA 8GPBA 3LZDA 5JZVA 2HA5A 1F2VA 5H70A 4CQMA 4TKLA 1SJ9A 4P3PA 4F8JA 2OGTA 3AZQA 4OKIA 3ANLA 2Y67A 5EJIA 1K7XB 3BKWA 4QQKA 5AW4A 1GCUA 5DHAA 2Z3ZA 4BRWA 3X3HA 4J2TA 4UNIA 3VMMA 1O94D 1XG5A 4QARA 4CF4A 2R44A 1N0VC 1SBNE 4FSXA 1GUDA 2PX2A 3PFHA 4PTYA 3WGIA 1YJQA 1FMTA 5LOVA 1LEHA 2ZE8A 3BGWA 3LSTA 1QMGA 1ZNQO 4E5UA 5IT0A 4WOJA 4IPTA 2ZZKA 2QPTA 4FWTA 1PJQA 3ODGA 2IY7A 3SS7X 4R1QA 3MRXA 3RUDA 4MV3A 5K3AA 2HK7A 1JMVA 1SQ0A 2HFKA 3IYLW 4AC9A 5C7LO 3OCZA 2HZBA 2ZBVA 1CUWA 1FLAA 2O2JA 4EY5A 4AJPA 3FIUA 4IUCS 5HRCA 2RG1A 3I45A 3R7WA 4XVUA 2PLRA 5NLLA 3A4MA 2XRFA 4R3WA 2WJVA 4HQOA 2P69A 4LIPD 1FMFA 2IW1A 5LSAA 2EJTA 1NMZA 1CNMA 3M3HA 4NFSA 2QKYA 1N7JA 5ER9A 2JH3A 2NYUA 3CH5A 4PC2A 2ENUA 4OJTA 1ZGBA 4MV4A 4NV3A 4PCVA 4QTYA 4U39A 5KTTA 5EZ5A 1B8VA 1QQ5A 1YL7A 4IFIA 1SKBA 1RWMA 4BB9A 1LW7A 4BEVA 2O5RA 3IB6A 3MTAA 4XTRA 2A5YB 3RSOA 2ZTUA 3ICEA 4KLAA 1KZ6A 1B7GO 5DCWA 4YAFA 1CR4A 2EKQA 5DHQA 2HEGA 1IC6A 1M6VB 1ZD3A 3EXFB 4LRXA 2GN8A 4CR8A 4OK5A 4EG0A 3PC2A 4Q3DA 3ZOZA 1C8VB 4FE4A 2HD4A 3WKEA 3DM5A 4LWOA 4FQ5A 2J08A 4P4GA 3H8VA 3N2ZB 4KWTA 1VA5A 3GGPA 4N82A 4WIAA 4DAEA 3LNTA 2SECE 3NKLA 4FYKA 3RHSA 1OWLA 1QVRA 2P4HX 1KY4A 3FFXA 2QX6A 3JCZA 1A8PA 1M8KA 2VAXA 1UWCA 4PHGA 1MJFA 1AQYA 2K5UA 2DX7A 3T7JA 4A5SA 4UD2A 1M7HA 2WZBA 1E2GA 1CJBA 3QFTA 4PYQA 1PYDA 2MMGA 2QNRA 4M37A 5FT9A 1N9GA 3E05A 1R12A 2IYPA 2PKWA 2Y1GA 4EJSB 3DFIA 5JQWA 2VT7A 2X19A 1L7RA 1KRHA 2F1RA 2OFFA 1PQWA 4PHTA 1GZSA 2KHZA 3EVTA 3OLWA 2X3FA 2E1RA 2XNDD 1R0KA 4MWDA 3W9SA 1Y4DE 1JG1A 1Q0QA 2H0QA 4QYSA 1IVYA 2CDAA 3PJFA 4G2TA 3IE2A 4R6XA 4UOQA 4I1PA 4AL4A 4PRKA 2R6R1 3H5WA 1VLMA 2EX1A 3PLNA 4M1MA 2C1EA 2ECQA 2WI8A 5PNTA 3TPZA 3WZMA 4B7UA 2BEVB 1H1TA 1GPKA 5DBHX 4EZEA 1P19A 4M38A 1Y8CA 4MPTA 3ZKAA 4BVEA 3TSOA 1DIBA 4UBOA 5JH7F 1G5PA 2YMLA 4PLTA 4YAOA 2O57A 4DMCA 3MS4A 4QU5A 2AG5A 2VDPB 1SCKA 5HW0A 1YDMA 1AUOA 1UM9A 5FI0B 3KQNA 3F5QA 1IEQA 3FCYA 4O2AF 1DTEA 5C8ZA 1BX0A 3NP9A 4LBYA 3DEIA 3PHIA 5A9SA 1KYZA 2VZ9A 2W6PA 3VRHA 5K9ZA 4A0QA 3OM8A 4R81A 5D01A 3UJ8A 1G1MA 4Q3LA 1T26A 4QXOA 3RYHB 3F9RA 4KFRA 5KVSA 3CRZA 1V7QA 3M1LA 4FSDA 1RBMA 4OH7A 4PSCA 1JXOA 1UZMA 5L9AA 2LRHA 1L7DA 2J3DA 1TZCA 3TSWA 2XCQA 1C9MA 1VCHA 2WYUA 3K8YA 4NBVA 4Q1CA 5FBVB 5JYCA 4MP6A 9ABPA 1JSZA 3MWEB 3T3IA 4KU4A 3STUA 1TVEA 3T4UA 2OC4A 3C6KA 5I7SA 3AMVA 2W6OA 5BOSA 3AVVA 1Z6ZA 5KJ6A 2F67A 2PV7A 3WGGA 4HJXA 2E5FA 4QVKA 3AF5A 2I33A 1WHSA 3N2KB 4YJGA 2IYFA 3LBAA 2X9QA 5EG5A 5K03A 3OCFA 1TOAA 1UK8A 3IMFA 2UYQA 3A9RA 3NBQA 1UPAA 2CBXA 3R3UA 5J4KA 3KYDA 5JFTA 2W2KA 1HFEL 5HMLA 1XNGA 3QX8A 4W1SA 4UMEA 1R9JA 3QEMA 4V0SA 2G09A 3MINB 4DWVA 3UMFA 4ZYVA 4KODA 1OI7A 3BTVA 3GRUA 3PC8A 3VC7A 1NJ1A 1A5TA 2R87A 3PB3A 3HNOA 4RDIA 5T3YA 5LYJB 1SOUA 4UHCA 1W87A 1HFKA 2IHUA 2CNOA 3PA8A 4IKOA 4U8GA 5C53B 16PKA 1EVJA 1VG1A 2XNKA 4I1UA 5JCJA 4AMGA 1CUVA 4Z4QA 3IAXA 1NUQA 1AKNA 4GPBA 4CLXA 4CQMB 4ZDKA 2PGJA 3DTVB 1Y1LA 1YQEA 4NCXA 2CNKA 4BAUA 1NZFA 3P9RA 4HAIA 4BNYA 3IT2A 2PZKA 1EJ6A 5GY7A 4CKYA 3FPLA 1CETA 5IBRA 2HLPA 2OBYA 1W36B 3L8MA 2PUDA 3BJEA 3IUSA 4NI5A 1XZHA 5JZSA 3TJRA 3L1UA 3OWHA 2WWXA 2BMDA 3PUZA 1WL8A 5LOVB 3WFJA 1HQDA 5KOIA 1E4OA 5MN6A 4K2HA 1WD5A 3K6SA 4Q47A 3V48A 3GO4A 3K92A 3OI7A 2QR5A 2WHYA 3KEQA 4J75A 5IUKC 2AYXA 5EZ6B 3BCHA 1JMYA 4ZRDA 3ND9A 2AMLA 3R7WB 3JQFC 3E81A 1TIPA 2KB0A 3NBZC 1R8QA 2JRCA 2YMPA 3IP7A 3KQPA 3QPWA 3WK5A 1PG5A 3ZD8A 2QG4A 1FYWA 5BSMA 2GJKA 1NXPA 3LBHA 3HXPA 1ZUWA 1NXSA 2VUSA 1NSTA 3HWRA 1H3NA 3G5LA 1JDPA 4GVLA 1COWD 2EWVA 2PSSA 3HE3A 1YHYA 1VSVA 2DETA 1DG9A 3BMCB 1RKQA 3G2IA 2C29D 3GLSA 4Q39A 4INZA 5CA1A 5JATA 1G9TA 1Z45A 2R7MA 4IVPA 2C5SA 1JZSA 4RTOA 3V4RA 4TMVA 5FTJA 2GZMA 4LYAA 2NU9B 4HNRA 1NF2A 1CWUA 2VUHB 2IV7A 1T5HX 3QPDA 2C3PA 3AETA 5MGNA 5J3JA 4B3MB 4REOA 1E8NA 2JAQA 3PRHA 3CT6A 5IBPA 2IF2A 3TOVA 3ROTA 3NFRA 5HZMA 1NUAA 3KELA 5IHPA 2FMFA 3EMBA 2GTHA 4S1PA 5CXQA 5U4QA 4ZQCB 3RVMA 4EF5A 2JGJA 2VF7A 5D86A 2CZQA 2ZBUA 4XVQA 4I3HA 3IIJA 2DH6A 4CM9A 3I8OA 4S2UA 1XALA 1R3UA 2ECOA 3PXEA 3L41A 3A37A 2W6ID 2V6MA 5JTTA 5DM4A 3K9QO 2UDPA 4BNGA 4QWMA 4QOHA 2X8WA 1TQ6A 2CGEA 2HA4A 2JKVA 3OMXA 2QTRA 4JP8A 3J81A 4DR1B 3P9KA 1TEZA 1YDGA 3BIOA 4LXHA 4PN3A 4JXXA 2RC5A 1X1DA 2NZ8A 3LOQA 3DXZA 3QYPA 4Q34A 4XSHA 5E6SB 5GGXA 1UJCA 1N6PA 2Q5OA 2JA2A 4XGIA 4JI8B 1N0UA 2CVQA 2X2PA 2XMBA 3H8JA 3IKVA 1XTVA 4I9FA 5LZ2A 1BDMA 3HO6A 4YDRA 2YWJA 4MSUA 2HJWA 3UWMA 3AVOA 3NWOA 3DVSX 4KIJA 4FQ8A 1DMSA 1BYUA 1W4RA 2Z95A 4TTIA 3VZCA 5FEMA 1W1UA 5LP6F 3OKFA 5I01A 3MTBA 1D2CA 1ACJA 4MUBA 4HHEA 2FHPA 2R5FA 1TTHA 1MDBA 4HFRA 3RRXA 4EJ2A 2QJTA 4IUDS 1EXVA 3BF7A 1GRQA 2A8YA 3IKJA 5ALOA 4A2CA 1RS0A 2CW5A 1OBVA 3JQ9A 3NV7A 1G64A 3PEVA 3R3VA 5D3MB 5JZMA 4G5YA 1MXHA 5C4IA 1UJMA 4P4SB 4YHHB 2C9CA 5A7GA 2E6KA 1UM9B 4C0KA 3SJ7A 1MORA 2HF2A 1ZNWA 4YMVA 4YJFB 1KYQA 1VMDA 2QP4A 4D9JA 4EB6B 1AN0A 1BWPA 2XZLA 1Y8RB 2OORC 1IPFA 1TJVA 1EGHA 4LYFA 3WSVA 2BSAA 1NZJA 3BD9A 1TJ4A 1SUEA 3KZXA 3STHA 1KJNA 1JG6A 4KKXB 4TTAA 4EPVA 2NN3C 4C3VA 1T6NA 2WINI 5DM70 1Y1PA 2UXDB 2XADA 3DDZX 1TGYA 3UFBA 2KX7A 3ZIAA 5HBRA 3SZGA 4TPKA 1U7DA 4ZMBA 3LZ6A 3ZWCA 4NH0A 2NMVA 1ZIOA 4UTOA 4G8DA 4D6YA 3LUDA 1SNYA 3W79A 3ZLBA 4BMYA 4MK4A 1L7OA 1Z4KA 5FEUA 5ICEA 3PHHA 4MYHA 3GJTA 3Q8WA 1P2VA 2QTVA 3G0GA 1HURA 3NM5A 4QOGA 3ZUGA 1QRAA 3B52X 5BUCA 4P0PB 4E46A 3ZDAA 1E5DA 1I1HA 2Y9PB 2RK6A 4QSMA 3KUUA 1ZIYA 3EA0A 2JK0A 4P7FA 2PT6A 3TMAA 4E1AA 2JVIA 3TGLA 3M5PA 2W8ZA 3D5QA 4Y6OA 5LWQA 1P1IA 3COSA 2NUAB 1IJEA 3GTDA 1PWZA 2QUIA 1WPXA 1OZHA 2R85A 2LE0A 4FNGA 1CIJA 3TTTA 1DEXA 4BQQA 4CUZA 3OZ7A 1PK8A 2HH9A 2WJ3A 3DR3A 3AI1A 4Q6WA 2H7VA 1CUCA 4EA6A 2WVJA 2XT6A 3KXIA 3IO5A 5CH8A 2O2SA 1G2IA 5DEOA 1G42A 5I5EA 2PR7A 3OCEA 1P5JA 2OO7A 3R5TA 1DEHA 1I7DA 2H57A 3T12A 2GRJA 3D5EA 4E51A 2VI5A 1IULA 1YA4A 2Z58A 1BROA 4YUVA 3QKRA 4XDYA 3E6AA 4L0MA 3ROMA 1ODCA 4EMBA 3SWWA 2OUKA 3DZCA 1QHYA 4QDTA 2E4XA 4QGGA 1SN7A 2CWWA 2X40A 2VSQA 4NOJA 2PGXA 4YAGA 1I4DD 3ZHUA 1YIDA 3MGKA 5KVVA 1VP3A 2DU8A 2R1VB 4K9SA 5KREA 1WCYA 1PZEA 4YLGA 4GKVA 5C4MA 5JADA 3U7JA 3TXAA 4M1KA 4P84A 5MF6A 3KQYA 5GPBA 3RRFA 1IM5A 2VZLA 4HLQB 3NHWA 1QDUA 2GM9A 3JZAA 4DBLC 1W36C 2YBDA 4O25A 2YFQA 2HXGA 4P98A 4HDOB 3BIFA 1HT1E 4EHKA 1A95A 1HDOA 1EJ2A 1K9VF 1ZMRA 2FR8A 3O7WA 3Q9LA 4OHFA 4XX0B 3VOTA 1HZJA 2RAVA 4CT0A 4JX9A 5TMPA 2OD7A 2XDAA 3MBKA 1N2IA 1OFGA 1VL5A 4F4HA 4O0LA 3GT0A 5C8XA 3G6KA 4JC5A 1YB2A 1EQ2A 1LLDA 3H5VA 1D5CA 4XJVA 1UKCA 1RPZA 3H6GA 3P0FA 2DXIA 4HNVA 5KWSA 1V71A 2X13A 4FBGA 2GXQA 4J4HA 1WW8A 2HL6A 1QHIA 1YCDA 5FOTA 1QWSA 4NBLA 1J6UA 4G81A 1T5IA 4IDQA 2QGAB 3JQAD 1GGEA 1Y7PA 5A5EA 1GZ3A 2OC9A 2A0WA 4A10A 1JB1A 1XHEA 4DIUA 1RYHA 2W42A 3IDSA 3VC3A 1IDOA 3GVHA 2IYNA 2PV0A 3OFKA 4GC9A 3RUPA 3DEKA 5EJAA 3AETB 1DO0A 1KSHA 4W9RA 2J09A 3UWOA 1VL1A 4ZZ1A 1QAMA 4AN4A 3NTUA 2A57A 4ZGBA 5KSOA 2PH7A 4EVRA 1FSPA 4LDJA 2Z6AA 2Y77A 1KC3A 2QRGA 4KVFA 5AK3A 4RTJA 3WHIA 3UTDA 1KEEB 3M4ZA 3MBOA 3Q15C 3I9JA 4WGGA 5I9LA 3VR4D 1SWWA 3EUWA 4A26A 3GFSA 3RADC 1EDOA 3TLAA 3GN2A 2VDKB 2VO1A 3ZZ0A 1JR2A 3AP2A 1THZA 2VTVA 1QSGA 2IUFA 2C9OA 4IMIB 4XEHA 1JILA 3TZBA 5T8KC 4DMRA 1CEYA 4MQ4A 3NOQA 3ZXSA 1S3GA 2JD0A 2IGBA 2VDQB 4N5DA 2ZJ8A 4FB4A 2BF4A 4FGWA 1Z15A 4F12A 1RP1A 3H3JA 3E1KA 3SI7A 3U1VA 3GLQA 4B43A 4TKVA 4ZHQF 4KNYA 2FEWB 1GV1A 4BO9A 3FD8A 3BMQA 1CRPA 1TZBA 1RVDA 2OB2A 3GJ3A 2EX0A 4LPKA 2HV9A 4FGZA 3UNXA 2GK6A 4BEWA 4GIBA 3FF4A 3B6IA 1LRLA 2FK7A 4Y6GB 2XXJA 3B48A 2PUHA 5FIUA 2K2WA 4MA0A 5EHXA 3O8CA 4NU6A 2IEYA 1QGOA 4DVGA 1EP1B 1JPUA 3FUUA 1I1OA 1FU8A 3EDMA 3OLCX 3MCTA 1JIKA 3PEUA 4TV9A 4F3KA 2GDJA 5KDDA 1P91A 1MO5A 2O2EA 1BMFD 1CF2O 1Z4PX 2QQEA 3L6RA 3WK4A 3ER6A 5C3MA 5KHAA 1TAHA 1EMDA 1UC5B 5G0SA 4OCZA 4A0GA 3H17A 1DBRA 4ACAA 4JC4A 4EHNA 2QYOA 1RWQA 2FE4A 3H2HA 1J7KA 4PC6A 1DT3A 1IH8A 4OQDA 3QKSA 3RJ9A 1OZAA 4KQMA 3T61A 2AKYA 3TSCA 2CNDA 3MHPA 3HB0A 1AGNA 2FQYA 2DUMA 1U9ZA 3OEYA 4QEDA 4ZODA 4TLAA 2QMYA 1YHNA 4KN5A 3PIRA 4M22A 1QYWA 2UVDA 2Z8YM 4K46A 1F17A 1GKKA 5FX2A 4U02A 5FTMA 1O0BA 4E08A 4MJ7A 1Z3IX 4I4TB 3BMOA 1US8A 1D2AA 1RHQA 2HF8A 2QTVB 3KQVA 2DFLA 4RK0A 1K8ZB 3SZLA 4GX1A 3ZK7A 4AYTA 4INPA 1Y1SA 1U0TA 1PLJA 4ZTBA 4XIIA 5BQPA 4P35A 3WB1A 4QPDA 1KDRA 5ALWA 3WMGA 1QX4A 1JL3A 3DEAA 5EJMA 5HWSA 2P9ZA 2QW0X 2YYYA 4I50A 2CD9A 5IMBA 3ZJVA 2HLNA 1L3IA 3OU7A 1FNNA 3OUZA 3O91A 4P7JA 5B2ZA 5TS3A 5A62A 2DFTA 3RVSA 4PYRA 3WMEA 2PU5A 3VPFA 1FPMA 3H2KA 3L84A 4D96A 1MMFB 4DG5A 3L7MA 1TZ2A 5CDFA 5I9NA 4OJYA 4JHLA 4L78A 1YVRA 1XD9A 3K8ZA 1YUMA 1U7PA 2GNOA 4LC1A 2HLDA 2C4WA 3QKRB 1Z7YA 1EUDB 4GZ3A 3QU5A 2BH9A 3CZ4A 1Q16A 3FYTA 1NRWA 3DE4X 1U7TA 1XJWA 1QH8A 3PC8C 4GI3A 2PRSA 1YI8A 4JOSA 4PGGA 4TYQA 1KTIA 2GD0A 5K45A 3OF3A 1EBBA 1QIGA 2BE7A 3WL3A 1RQLA 3RUEA 1UBJS 4BNLA 1RR6A 4LDNA 2PAAA 2CB0A 3Q2OA 1XMPA 3D4LA 3DNMA 3INTA 4CG3A 4MKXA 4NULA 3ENVA 1Z75A 4LK3A 4E88A 1A71A 3TUIC 2A9QA 5FV7A 4X1YB 5AW3A 1IHPA 1TCAA 1V5FA 4ZT7A 1QFYA 4KKVA 1PVOA 1H05A 1NVAA 1CUAA 1VLLA 1HSZA 4HDCA 3P32A 2ZDQA 1KP3A 3GY0A 1FS6A 4M0LA 1WU8A 1ZINA 4P3XA 5C8YA 4KDCA 1WOYA 3SBEA 2VPWA 4JNKA 4UDYX 5H81A 2HJGA 5IAEA 5FTKA 2CUZA 1YJCA 3HGQA 4KR7A 1VJTA 4IEEA 1N6OA 5KSPA 2OFPA 2QGZA 2ZBFA 3UWKA 4M8KA 4ERNA 2Q27A 4BNKA 2VAPA 1MC5A 3H16A 1GLGA 1XTJA 3H9UA 1W96A 4MGYR 3Q88A 4MV5A 2I7DA 2QLTA 4WUVA 1U65A 5EXDA 2RGBA 3BD7A 3R9XB 2CXOA 2MINB 5LVAA 3OX2A 2OHJA 3ZLVA 2KWIA 3AEUA 4OJKA 4OD0A 1JKJB 5E1MA 3HJAA 3R5HA 5FI3A 1W581 2ZJ0A 3MMZA 1ZD5A 1ZH4A 2FEPA 2HA2A 3GU3A 1UZUA 3L49A 5YASA 3FPKA 1J0EA 4Z7QB 3F7MA 4I5IA 1H0SA 2Z5GA 2QSJA 1O4WA 3GAFA 1JGTA 3IRVA 2F64A 1NFQA 2I2AA 4XWYA 1VDZA 3V1UA 3RSHA 5CPFA 2PKQP 2ZRGA 1GU0A 4KG7A 1EFKA 2ZYSA 4UCQA 5THQA 2PDAA 4YECA 5JAHA 1JR6A 2GJ8A 1Q77A 4HGQA 5TB5A 1UPFA 3PQ3A 1RYYA 2KLHA 3ZIDA 3HO8A 2WKSA 5HBGA 3DT8A 4Z3KA 4NL4H 3UGKA 2H9AA 1DBQA 2ZRJA 2GQ0A 2WJGA 4HDRB 1Y48E 1E2EA 4M7RA 3HJNA 1M6HA 2BMFA 4B6SA 2QTFA 2QUJA 4JJZA 1TLFA 3QXJA 3T94A 4J7CA 4DC1A 1YZVA 3UZUA 2I2CA 4PFSA 1G3IA 2C59A 4LWQA 1T1EA 4TKVB 4EQ6B 1HM5A 4F4CA 3SQLA 2QUAA 3P9QA 4EMSA 3RYCA 4HQFA 4QO8A 4FHCA 2C5EA 4D56A 4LFCB 1R8XA 2WSLA 1TVMA 3HH8A 3KKMA 4K9LA 4XFJA 4XM1A 3ONFA 4BRSA 5D8DA 3OQMA 2D5BA 3I92A 3TOZA 3LKVA 4D9HA 4NBWA 3NNDA 1LPAB 4CQLA 1O5TA 3CPSA 2ZSDA 2OZLB 3A9SA 13PKA 2XUQA 3FYDA 2R8XA 4B4VA 2G9ZA 1Y7LA 2X2EA 3BH7A 3HDJA 4YPOA 1FQJA 2Z2ZA 1UJNA 3ABQB 1EXDA 2JFYA 3QK7A 4AXBA 2A33A 1DC4A 2BDEA 2YZGA 1MJGM 3WRWA 1XTQA 2VJMA 5HJEA 2YWBA 5LMZA 3AM1A 2IP4A 2V0NA 3KFVA 1GPH1 2FR1A 4KGDA 1FTYA 4LZZA 4NATA 1XFAA 4BCBA 4C4ZA 2QUZA 3NOVA 3S55A 3F67A 1GPDG 3USES 3B7PA 1OY1A 3JQ9C 4PX9A 2GM5A 1T1JA 1U2RA 5F3RA 1FDOA 5F98A 3EDQA 1LJ8A 2VHQA 1AKYA 1GCIA 3PLRA 4ZTZB 4ZZ2A 4LOIA 4EELA 3A6GA 4EI9A 2AXPA 1YR3A 5AJVB 2YHAA 3SD7A 1K6XA 4D6PA 2WHPA 1M6WA 4AFNA 2HQRA 4UVIA 1LFDB 3I5YA 1OV4A 3JU3A 2W7TA 4ENWA 2O3SA 3OE4A 1ZO8A 2R65A 1LRKA 2JB9A 4O2LA 5ALTA 3LKZA 4KO2S 1P0MA 2PJUA 2MHCA 1LI5A 1NU6A 1GG8A 2FOLA 3RRPA 3I2JA 5L3ZA 4CCWA 2V3WA 1OZ0A 1M2GA 3I5XA 1CVLA 3FYUA 4UHKA 1VMIA 1NN0A 1XRRA 2EZ8A 1BJKA 3ZJUA 4YMSA 3L79A 1LBIA 3CWQA 5AK0A 4BAZA 1IAVA 3WSTA 1M1YA 2VYND 3LHDA 4MB2A 4AY5A 2WKRA 2B37A 2LDXA 2DLCX 2F2TA