2JARA

Crystal structure of d12n variant of mouse cytosolic 5'(3')- deoxyribonucleotidase (cdn) in complex with deoxyuridine 5'- monophosphate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
196
structure length
196
Chain Sequence
b'KRPVRVLVNMDGVLADFESGLLQGFRRRFPEEPHVPLEQRRGFLANEQYGALRPDLAEKVASVYESPGFFLNLEPIPGALDALREMNDMKDTEVFICTTPLLKYDHCVGEKYRWVEQNLGPEFVERIILTRDKTVVMGDLLIDDKDNIQGLEETPSWEHILFTCCHNQHLALPPTRRRLLSWSDNWRGIIESKRAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-DEOXYRIBONUCLEOTIDASE
publication title Crystal Structures of Human and Murine Deoxyribonucleotidases: Insights Into Recognition of Substrates and Nucleotide Analogues.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 72
structure length 196
sequence length 196
ec nomenclature ec 3.1.3.-:
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 2jarA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2jarA01
5IT4A 4KYTA 3SLRA 3BWVA 2B8JA 2WFAA 1Z5GA 3L0BA 5A3SA 2IYEA 3IRUA 1CR6A 1RLMA 1WPGA 3S6JA 3OCZA 5AKGA 3SMVA 2W11A 4ZEVA 3UMBA 2I34A 3ZX4A 4C4SA 3WGVA 5AW8A 5AW7A 4UU1A 1F5SA 2C4NA 2CFTA 3FVVA 3ZVMA 4E88A 3TLMA 2B1RA 4Y2XA 3WKAA 5JJBA 4NV0A 3QX7A 3I6BA 3L5KA 2PR7A 5AKHA 3AR2A 3M1YA 1VFPA 3KZXA 1VJRA 2G09A 4I9FA 5AM4A 5T41A 1U7PA 2HDOA 2RARA 2I54A 4L6CA 4JDPA 5AVZA 2WF6A 3KD3A 2WF5A 3NAMA 4KX3A 2IOHA 3WK4A 3SKXA 1Z4LA 2JAUA 3QUTA 3WKBA 3NRJA 4HYTA 3E8MA 3R09A 4G9BA 5AICA 2NO4A 2CFSA 3UMGA 1RLOA 4NAVA 3WK8A 1RKQA 2HOQA 5E0OA 3PCTA 4Y2TA 2I7DA 1L7MA 3OPXA 3KC2A 3D6JA 5ALGA 1QQ5A 5ALMA 4Y3UA 2YMLA 4BNDA 5ALFA 1T9ZA 1Z4QA 2G08A 2CFRA 4H1WA 3R4CA 3P96A 4HGNA 5ALVA 4ZEWA 2ZBFA 2I33A 1Z4KA 2B82A 2B30A 1X42A 2QLTA 5AVVA 2MU1A 3QUCA 5AK4A 3HYCA 3N8GA 1L8OA 2HHLA 3L8FA 2IOFA 3ZWDA 3NUQA 5ALWA 5AK6A 3QLEA 2FUEA 3U13A 1LTQA 1ZD3A 1N8NA 3AR8A 3L0YA 1YJ5A 1RRCA 3WKDA 3I28A 2BDEA 4BEWA 5AVSA 1SU4A 3B9BA 2HO4A 1WZCA 4CF5A 4HGQA 4UW9A 4IFTA 2W4MA 2GHTA 4UM7A 5AVRA 3ZX5A 3M9LA 2C9MA 1QH9A 3U7HB 3MPOA 4F72A 3IJ5A 3RFUA 4GXTA 3KDPA 3IB6A 2R8XA 5ALNA 4F71A 4UARA 3N1UA 2AH5A 4HGOA 2P11A 1U2SA 4GIBA 1Z4IA 2AMYA 3AR9A 3AR5A 5ALIA 2DQSA 2AUTA 2D2VA 4BKMA 2HX1A 4NWIA 2YN4A 1QQ6A 1AQ6A 1QYIA 1XVIA 4UMEA 4DW8A 3AR3A 3KBBA 5AIAA 1RLTA 5AK5A 2BDUA 4XOUA 5ALUA 1U2TA 2FPXA 3FPSA 1Z4OA 5AVQA 4CF4A 5ALJA 4O8CA 3W5DA 4BX3A 3OCYA 5AI9A 1N9KA 3L7YA 3NIWA 2YFYA 5AVWA 2B1QA 4KNVA 5ALPA 1RDFA 4UMDA 4BX0A 3A1CA 5ALKA 5AKZA 4CNQA 4UM5A 4Y2PA 4MUMA 3HLTA 4IG4A 3FGOA 3QYPA 4B6JA 3B8EA 2JAOA 4RESA 5AKIA 2IA5A 5AVTA 4UASA 1TJ3A 1RMQA 2P69A 3DV9A 4AS2A 1MH9A 3KOOA 2GHQA 2JAWA 3CZ4A 4DWOA 3ESQA 2FPRA 4C4RA 3GYGA 1ZOLA 1L7OA 1LVHA 3E84A 2RAVA 2RBKA 3QU4A 4MWOA 2FI1A 3QU7A 3ONNA 4RETA 1Z4PX 1FEZA 4EX6A 1ZRNA 2HF2A 2JARA 4YGYA 1NNLA 3N28A 4ZEXA 2O2XA 2PQ0A 5AI4A 2OBBA 3UMCA 3FZQA 2G0AA 3MN1A 3OCUA 5AM1A 2NO5A 2ZG6A 4KX5A 4OD0A 2WF7A 2R8YA 2P9JA 5AM5A 2R8ZA 5FP0A 5AVUA 4EEKA 2EAUA 2ZXEA 3I76A 3ZTWA 4CF3A 1T5SA 3ZWKA 4AS3A 2VKQA 4EELA 1K1EA 2WHEA 3ZW7A 4G63A 4Y2UA 5AW3A 4YIKA 1L6RA 1SWVA 1XPJA 2G07A 2YMMA 2ZBDA 3FM9A 2OA0A 5AESA 3UM9A 1L7PA 3WKEA 3ZVNA 3OCXA 5AK3A 2GMWA 5AM2A 3QXGA 5AKKA 4Y2YA 3U7FB 3NANA 4NABA 4UMVA 2YJ3A 1IWOA 5IT0A 2FPSA 3QUBA 1QQ7A 4FYPA 2HEGA 3OTQA 3ZUPA 2BY4A 4L6AA 3DDHA 3ESRA 1PW5A 3OCWA 2YBDA 4KNWA 4Y2SA 3WK6A 1WVIA 1XP5A 4HGPA 5ALTA 5ALLA 4BX2A 5AM3A 2FDRA 2OM6A 3DAOA 4Y2RA 1YNSA 3QU2A 5AHXA 3WKCA 4QJBA 2OYCA 3AR6A 2FEAA 1Y8AA 4UATA 3U7GA 2ZOSA 5AI8A 1ZD5A 3A3YA 3QU9A 4PNHA 1RMTA 5AW4A 4JB3A 5IS2A 1YV9A 2YJ6A 2JGAA 2ZBGA 5AW9A 4UU0A 1RKUA 5AKJA 4KN8A 3SKYA 1YDFA 2P27A 1ZRMA 4YIHA 2B0CA 4OHFA 5A3QA 5ALDA 2YJ5A 2C88A 3PGLA 2GFHA 2Q4RA 5ALZA 5AW1A 5AW0A 2WF9A 4BEVA 3SHQA 1RPZA 2WM8A 4YCLA 3U7EB 3AR4A 1CQZA 2WF8A 2NYVA 3L8GA 5AW5A 5AM0A 2R8EA 3QNMA 4NFLA 3L0CA 5ALOA 1EK2A 3W5CA 2I6XA 5ALYA 5AW2A 3MMZA 2EARA 2RB5A 1U7OA 2FPUA 3N07A 4Y2VA 3CNHA 2QYHA 3PDWA 3WK7A 4AP9A 4YCMA 2PKEA 2B8EA 2YY6A 1NRWA 1T5TA 2CN1A 5AKLA 3MC1A 4EZEA 5ALEA 3W5BA 3ZI4A 1RMYA 1ZD2P 4DFDA 4BNDB 2W43A 3E81A 4J03A 1ZJJA 4XE5A 4BBJA 4EX7A 1RC8A 4FE3A 3L8EA 1Z4NA 5AVYA 4EENA 3J7TA 4OFZA 5AKEA 1Z4MA 2GO7A 3WGUA 3A1EA 1WR8A 3RF6A 2Q4TA 4BYGA 1YS9A 1Z88A 4XQ0A 1VJ5A 3K1ZA 4YCNA 3OCVA 2ODAA 2EATA 5AI6A 1O03A 5AIBA 1O08A 3WK5A 5ALSA 2FUCA 4Y2JA 1TE2A 1L8LA 3WK9A 1Z4JA 4UAUA 1TA0A 3AR7A 2O9JA 5ALRA 1S2OA 3DNPA 3L8HA 1Q92A 5AI5A 3EPRA 3BA6A 1YMQA 5AI0A 2ZBEA 1JUDA 1TJ4A 3VAYA 2HCFA 2YMQA 1ZD4A 1RQLA 4OCZA 4UAVA 3ET5A 3E58A 2I55A 3EWIA 2AGVA 1L7NA 4C4TA 4DCCA 3QUQA 4CE6A 3L1VA 5AKXA 3EF1A 3PGVA 3I1YA 1SWWA 2HSZA 2X4DA 3ZU6A 2C8LA 3NALA 3QGMA 2HI0A 3U19A 2Q5EA 3SF0A 3ED5A 2IOFK 5ALHA 1J97A 3ET4A 2G80A 3F9RA 5ALQA 5AKYA 2G06A 1RQNA 3QU5A 1Z5UA 1Q91A 2G1AA 3B9RA 5AW6A 4XPZA 3A1DA 2FPWA 3N5KA 5AVXA 3EF0A 3W5AA 2C8KA 3ZTYA 1KYTA 4FFDA 3R9KA 5ALXA 3ZVLA 4HAIA 1EK1A 2HF7A 2YJ4A 4Y2QA 1S8OA 1RKVA 4YH1A 3U26A 1J8DA 1TJ5A 2MSNA 3SD7A 4QQFA 4J2TA 1U02A 5A3RA 4UMFA 4HGRA 3NASA 1NF2A 1ZS9A 3FPBA 4L57A 2YMPA 3L1UA 4I9GA
chains in the Genus database with same CATH superfamily
2ZBVA 2QLNA 5EEHA 1Q14A 3ZZMA 4MK4A 1N3LA 5DIFA 4KG7A 5A2QA 1Z62A 1KXJA 5DGTA 5A1TA 3IAM1 1PJZA 1A8IA 3H3JA 2JD0A 1ATIA 1NI5A 3OCZA 4UVGA 1L8XA 1F12A 5KDDA 3K9LA 1KJJA 4L7QA 4LV6A 5B1EA 2FFHA 3TWOA 2G25A 1EP3B 3MGAA 4IIFA 5T4HA 4UCWA 5DYIA 1UZNA 1DKUA 4R8KA 4YR7A 4CDNA 3T54A 4DDTA 5EJ8A 1PEKE 1Q0SA 1U5BB 2UZIR 2H7XA 1JL3A 2CFTA 3EAFA 3TRIA 3ZS8A 3RREA 1XP8A 5DM60 4GBJA 4JLBA 4A27A 1C5KA 2W2VA 3HJBA 4H7EA 4TTPA 5EE3A 1JNYA 4PBRA 3NBKA 3S4YA 1H4SA 1DG1G 1FRFS 3I4CA 1U2EA 1QOPB 4LSMA 4OYLA 3WNDA 1O1YA 4XM2A 3FSGD 5EXXA 1QV7A 1XD2A 2PR7A 4IDAA 1TUBB 1CWUA 1M76A 3FNFA 4L7VA 4LTDA 1K5HA 1BOOA 2GETA 1K5PA 1HYEA 5LL6P 4IZOA 2C78A 1NV9A 3G9QA 4YCSA 1Z15A 2BEUA 4UQPA 3VNQA 1NKSA 1UOOA 3DTTA 5KYGA 2IYYA 4QPZA 5JZBA 2ZSDA 4RZ2A 1KMCA 4MWCA 1W6RA 2HMSA 3RIHA 3N6VA 4EPYA 2IOHA 3LXXA 1UIRA 3R23A 4FD3A 4BNNA 1G4AE 4DA7A 3AB7A 1PQYA 5F35A 1O9HA 2XTMA 4G0YA 4REOA 4YWJA 5IT5A 2WTUA 4EGCB 4K28A 1C9KA 5KOHA 3BFJA 4N01A 1EEXB 1H8HD 2GAJA 3HWSA 3PJFA 5FBRB 3JYOA 4ZVSA 5TJHA 3RS5A 4EA6A 3VO1A 4ABTA 4FT4A 4QUKA 4NAVA 1E1LA 3UB3A 3DJYA 2PMDA 4ZYWA 1MV5A 2QQ0A 4P5DA 2FRVA 2CE7A 1PZMA 1ZM2A 4JZYA 3QBVA 2GXUA 4NE7A 3KSDO 1TCAA 3MJTA 4HJRA 4Y3UA 2XMSA 3T1TA 3Q2IA 4INOA 5DM0A 1T3HA 3S81A 2A5LA 1IK4A 2AD5A 1Y4DE 5LPNA 1OW3B 5K0CA 3B1VA 2GDZA 2BM9A 4HGNA 3QVKA 1NJFA 4LXHA 4TL9A 1QGYA 4OB6A 3LT0A 1QS0A 1LBEA 3I6QA 1C3XA 2QZJA 4ZT4A 4L72A 3JU3A 2GESA 1Z2OX 3LVBA 2CW5A 1YRYE 1XAGA 4E2WA 5JRDS 4G1VA 1TD1A 1A4RA 2R1TB 4GWKA 3SC2A 3ZJ4A 3C3DA 1H23A 1MX3A 3RUHA 4APBA 1XFDA 5LR6A 1M6EX 2R8RA 4NULA 4QRHA 4C76A 3BYZA 2P2NA 3FFXA 2A92A 1YD7A 3QLEA 3PUJA 5EIBC 4M8KA 5ICFA 3WL5A 4FDMA 1T5DX 3HB4X 1ECFA 3UBTA 2A9FA 5C52B 1OH5A 1CJCA 4KXMA 3KQHA 1IVYA 3F6PA 4PE5B 3W5JA 1Y1SA 1PT9A 1ZNZA 3G8BA 4JKIA 1EG7A 1SU4A 2YWHA 3NPAA 4MKIA 6Q21A 2GAOA 2YDXA 4IFTA 2WKWA 3TW8B 5J5VA 3ZJVA 1E3TA 4KWCA 3GN1A 1YT5A 3JVUA 2PVPA 2PIAA 1QH8B 4G9GA 5F2OA 4TV8A 1E1QA 5E7IA 1DX4A 1SQ6A 2FLKA 4LGYA 3KSMA 2VF8A 1W0JD 5LLSA 5LQRA 3CGGA 3OLVA 1V3UA 1KOFA 1KP9A 2KS6A 5JCPA 3BWEA 4QT0A 2CDCA 1FUQA 3INRA 2P0YA 2QVYX 3A25A 3AIKA 2Z0MA 4NU8X 2AS0A 5LUBA 1EGVB 4LDQA 3D5TA 3PZRA 1SCJA 1JMYA 4XLZA 1U9IA 4DCJA 4DEVA 4M6WA 2DHDA 1E77A 3H1AA 3EQ6A 5C37A 2BUAA 1DQZA 4NH4A 5CXQA 4W5RA 3LOPA 2MINA 1XVUA 2V6MA 2YYYA 2DECA 3R0QA 4KXVA 4MCIA 5D86A 4D7AA 1B00A 5ICSA 2PS9A 4EGJA 1RXUA 4B73A 5JEEA 3FOZA 4Q1AA 1OTYA 2PRYA 3MJSA 2I91A 5DTRA 1CY4A 3PQ3A 5CDTA 2JPDA 1JDSA 4WN3A 2HNKA 2FN9A 1RWOA 2XUZA 4I4NA 1RI3A 1TKCA 1M2VA 3CEPB 3FCSB 1XTVA 2J3MA 1X7YB 4GO1A 5B4VA 1E6MA 4J07A 3BFKA 4LI0A 3WA7A 3GLGE 2X7HA 1EGMB 1RJDA 2XADA 1I4DD 2VHWA 4Q3KA 4TXNA 4BX3A 1Q57A 4HDSA 1T4MA 1YZVA 4KDCA 2RGNA 4Q6BA 4LCJA 1SUSA 3PHLA 3VR6A 1IE3A 3RYFB 2VP6A 2YFYA 4IFEA 3QKSB 5FPHA 3IP5A 5AVWA 1WHTB 5JMTA 2DQKA 1HDCA 3C1TA 4HYYA 2DB3A 1J4AA 1YQGA 3CX4A 3Q7SA 1F17A 1R4MA 1Z38A 1V3VA 1S7GA 1UBGA 1MO6A 4OHKA 3CE9A 1DXQA 2WJJA 5AKZA 3ZHZA 3K5PA 1FE8A 3OLQA 5J5AA 5E3IA 3IMKA 2VRCA 1XMOB 1C81A 3O4VA 3V7WA 1TB4A 5BSHA 3IEKA 1LBQA 5AHKA 3PUWA 2PFSA 3LNCA 2BFWA 3ETJA 3O9ZA 5FIUA 3VH4A 1FPMA 2YIVX 4RZ3A 3WGIA 2KYRA 2A4KA 1Z16A 2IZ1A 2E4YA 4FJ1A 2V97A 5CX1A 3ZGNA 3WWPA 1TJ3A 1RZRA 3MXOA 3GLIA 3IPLA 1GAXA 4UFPA 5DHUA 1TGYA 5CM9C 3VR2D 4KAJA 3GN2A 4PM4A 3PC3A 3PU6A 4RLSA 1DWQA 1UM8A 2VRNA 4HN9A 4BGUA 1WIWA 1ZLYA 1GUZA 2A0XA 3DZKA 2ZBRA 3MG9A 3PE6A 4C4RA 4U7TB 1I6WA 2H4WA 5KSPA 2NSDA 4B7CA 4EBBA 1QQBA 2P9FA 3GA5A 3NIGB 1MRZA 2VDWB 4PYRA 3LYUA 4FYHA 1VYTA 1JEQB 1X9GA 3GLRA 1GZSA 2HZBA 1Q5NA 3F4TA 4BQQA 4C0BA 5KJCA 3TCXB 3CZPA 4BFLA 1VCMA 1NJ2A 2NUAB 1E2MA 2NUPB 4DA8A 7MDHA 2B5VA 5EVJA 4ZTBA 2V65A 5ECGC 1CU1A 1BQEA 3I30X 4H3HB 1XZEA 1NU6A 4RFVA 3U1TA 4B3HA 3RYCA 2BFOA 2W6QA 5LYJF 4BFUA 3MWDB 1R9JA 3C43A 1U0BB 2VPIA 2BFCB 4ECEA 4EO7A 4L5IA 4LKOA 2R11A 3CLRD 3TG2A 4WK2B 4BNKA 3P9KA 2EJVA 4R71A 4C7JA 3QW4B 3CUUA 2P9HA 2QRVB 3NVKI 1TUGA 4V0MA 3A6JA 4O2AF 5EXSA 4TLAA 4BUZA 5DXAA 4A8TA 1VL5A 2JATA 2ASVA 2GVZC 3LSTA 1J00A 1ZI6A 1CQXA 1HLFA 1I01A 1E0DA 4QIHA 2WKSA 4BATA 4G0ZA 4LRTB 1RZ3A 4K1XA 4R1LA 4WZBB 2EBWA 4DG5A 1NUAA 5JROA 3LBYA 1FYDA 5TGDA 3NPMA 5HCUA 1YZYA 3T0IA 1J9EA 5C8ZA 4H4DA 1T5SA 2I6QA 1Z18A 1DRVA 2VHJA 3VYVA 4E3ZA 1J1UA 2A5JA 2VKQA 3E3MA 1OFVA 4J0FA 2IEIA 2G1UA 1KZYC 2WVAA 2ZJOA 2C4TA 5LBTA 4EAQA 1P9LA 2GARA 1L4MA 3BCHA 2NZYA 1QVAA 1XKQA 1KFKB 3IYLW 4J7XA 3BE6A 3IHWA 1G1AA 2G07A 3LG2A 1MF7A 2AR0A 2SCUB 2RHWA 2XJ9A 1V5GA 3NHSA 4QPPA 3SSAA 5KBYA 1FNMA 2VLIA 2XGSA 3QFFA 4RPHA 3RWOA 1MB9A 2ENUA 3NDBB 5F12A 1PK8A 3ACBA 3AHGA 3NANA 2HT1A 2J46A 3ESXA 1WVGA 2JHGA 3DB2A 1SOWA 1V9SA 1JHPA 4I6JA 5KYVA 4AN1A 5MGBA 2WJYA 2CL5A 3DC2A 1OZGA 1IWOA 2AX3A 1M6HA 3IOCA 3K0KA 4I50A 3EDCA 4MWZA 4R16A 3STXA 4G5OA 1YVUA 1DBPA 5F21A 3TRFA 1C9YA 1RJWA 4MS1A 1HA3A 2H7YA 3IFSA 2VHYA 3Q3VA 1I5OA 1P1CA 2FPGA 1X87A 2ISQA 1HE8B 4L6AA 3TQHA 4BRSA 4BQNA 3P9RA 3K9BA 2VWGA 3RIGA 2WSMA 5TQ0B 3IS3A 2XB9A 5JC8A 2A57A 1MAUA 2XCLA 1L4NA 3TPFA 5I7VA 3DLCA 2C5BA 5C0OE 1G3UA 3U49A 3IQGX 1I30A 4EFLA 1YNSA 2ASEA 2I2DA 5BO5A 1P2TA 2PMCA 3DOOA 4AX4A 1KYYA 3LHSA 3Q7IA 4IVPA 7ABPA 4I81A 1YJAA 5ARCA 5JH7F 4KKVA 3U4QA 4PLCA 4WKCA 4FDVA 2C9YA 1JQJC 1BXZA 4PC1A 5JPCA 3FGPA 4OSEA 1MD9A 2DU8A 4LWZA 5L3SB 2H1LA 1R8QA 2OK8A 2F62A 3JRWA 4X8HA 4JCOA 4K6HA 3MHTA 4PINA 4KXNA 821PA 1UC8A 2EW2A 4OY3A 3LGSA 1N34B 4YRPA 3FKSA 2CD7A 1XCBA 1CVLA 2R86A 4V24A 4IMRA 1NP6A 2ZRDA 4KR0A 1Y9AA 2RKOA 2WM8A 1FUUA 3NTQA 4HGYA 4RYLA 4WY5A 5TGTA 2WF8A 2YWFA 4D9HA 3HVIA 3KCQA 2PKRA 1U3FA 4X94A 1VYHA 2YHIA 3GWZA 1JJVA 3AUKA 4LGVA 3DCJA 1C4XA 2A1TR 3KG2A 4ZYUA 2WSSD 1IG3A 1PR9A 3CJTA 5AW2A 1MO2A 3UA4A 1EJ0A 4QTUB 4E0BA 2M1XA 3KX2A 1W36D 3IE0A 3FXAA 1W7AA 4G1MB 1W5BA 2IITA 4ML3A 4FB5A 1XROA 1YIDA 1TUIA 1CJKC 2WYVA 3MBKA 4G86A 4ZQFA 2I2XB 2BTOA 2XAUA 1NN5A 3L9WA 1QYWA 3KEMA 2IDJA 2XE8A 3DVQX 3GRKA 4A7PA 4ARUA 1VJCA 2CVFA 1QR2A 4LWQA 3ANSA 4X7RA 1L1FA 4ARCA 2QY6A 4PLTA 4ALJA 1S7CA 4CIWA 1USIA 2JCBA 5J63A 3UB4A 4R9NA 3W1WA 3ZIAD 2A33A 4BBJA 5H3HA 4MGYR 3HCCA 2WILA 1JEJA 3AUYA 5FUYA 1CV2A 3Q9SA 1MV8A 2BKEA 3BWYA 4LC9A 3RDPA 1GNLA 4ILEA 4NOMA 4IPTA 4FCTA 3CTMA 1G5FA 3M4ZA 3HU5A 4BLVA 4CV0A 4IWXA 2AT1A 3QPDA 2CMKA 5CFZA 1P4GA 2QU8A 2P4HX 4QHTA 3IL2A 5DW3A 3DUFA 4HRVA 3T1OA 3OP4A 2EWMA 3UJCA 3T3NA 2J3HA 3E18A 4M1KA 2X0DA 5LU8A 3DKVA 4YAIA 3KD2A 2FUCA 1KKMA 2IBTA 3FTDA 2ZT8A 1MQAA 4MO2A 2WFZA 1XLTC 3H6HA 5KI6A 3X1YA 4CLEA 1EFVB 2V1XA 3L4EA 3QWBA 1JU9A 3S2IA 1E3QA 2DBVO 3R6WA 4W1QA 4EVQA 5KC8A 1GTRA 4Q3LA 4OJMX 4Q9DA 4A0RA 1YDWA 1U04A 2O48X 3JYPA 3TLBA 1Z26A 4YWHA 2GBLA 1ZD4A 1LWOA 4URUR 3GBVA 3VO9A 4BMXA 2OCDA 4WKBA 4Z0HO 3VPFA 3MMSA 4E08A 1GHTA 5ELLA 5EJGA 2FSPA 4DCCA 2AGVA 1UZUA 5CFMA 1BX0A 5CU7A 5AXCA 3DE3X 3NAGA 4NBVA 5TPZA 2F64A 3KKOA 2YWGA 4N47A 1PV2A 2JFZA 4FDTA 1XCPA 2GAFA 5DK4A 2XZPA 4J90A 5F1OA 4CG1A 3QFCA 1IY9A 3R3XA 1IH8A 4TLBA 1FMJA 4S04A 2QD5A 1W47A 1H2BA 1O6CA 4RSMA 2GPBA 3GZHA 2A88A 2H85A 4R41A 4ER3A 2LKCA 3NR2A 1KI2A 3K0FB 2P2ZA 5HQJA 1OXBB 2AFIB 2JDIA 3TLKA 1YR3A 4OQQA 1UKEA 4ZEOA 1ULBA 3ANLA 3WGMA 2AF3C 1KAGA 2MYPA 3ET4A 4UNSA 2HC9A 3OIWA 5KX5F 3D7RA 1ODJA 3SK0A 3AYXB 3OSUA 4LFAB 1BCRA 2V7TA 3TMAA 1I2DA 3WLPA 2HA6A 2IYOA 2XRZA 5AKYA 2JFYA 2ZRMA 3DMYA 1GPMA 4GR5A 1DE0A 1RJEA 3OQIB 5TJ9A 4F5DA 2HBRA 3WICA 3CINA 4N5HX 2G17A 4POOA 3W5AA 1YQTA 1YA6A 4ZOCA 2OMKA 3D8TA 2GS9A 3L8CA 4MCJA 5ALXA 1QVRA 3GDFA 1WP9A 4M0MA 3VMFA 2IHBA 2OUIA 2EGGA 3S1LA 2UYQA 1WOYA 4BRWA 5JAIA 3KTAB 3K1JA 3NT2A 1J8DA 3EVGA 4KB5A 4DV6B 1ZI8A 1II8A 3BXEA 4U2DA 1NR5A 1SXHA 3CLTC 4ZQCB 5FTJA 4NCXA 1FVFA 1GDDA 2KM1A 3Q10A 1X74A 3T1HB 2XWPA 1LU9A 1LLQA 1ZCZA 3EWAA 4GYWA 4N5NA 3DPSA 3V4OA 4BKQA 5LLDA 3EYAA 2Y92A 4EITA 3L0BA 2ZCVA 4JL5A 4ZU3A 1JEAA 1O94D 3SBXA 5HK8A 1IONA 4G0XA 2JLCA 2PSDA 1Y5LA 5BOVA 4UUOA 1KF0A 1NGSA 4TMKA 3T0GA 5TQ2A 3IXQA 3NYIA 4S24A 2C9CA 2CSUA 1Q50A 3OX4A 5DTEA 2OCIA 3THXA 4M1OA 5DBIA 1BHJA 1GAJA 1I24A 2FPKA 4R1SA 4RY8A 1V48A 1P8AA 2DWOA 5IVIA 3SZOA 1XMXA 2DBYA 2VH1A 4BV9A 2HV8A 1JG4A 4D8WA 2I8LA 1RJ9A 4IDHA 4P3OA 5EMNA 1TZMA 4PNPA 4R1TA 3ZKWB 4KLCA 4O59O 4N0MA 1MEJA 1Z2AA 1Q11A 3PXGA 3M6LA 2VJKA 4FWIB 2HBYA 2I6UA 2R60A 2Y0EA 2WDPA 3LHFA 2X15A 4Y1RB 4BQSA 2RHGB 3UWMA 3KZXA 5BSRA 2YC2C 3CWCA 4EQZA 4H18A 1I3OA 2IU6A 2W6CX 4B3XA 4EZIA 2QV0A 1U2DA 3NC0C 1YL5A 5EP2A 4Y9DA 2F1RA 4L6CA 2B4RO 2CHUA 4R2KA 1L1EA 1NE2A 1ZMBA 4MV9A 2QG4A 4GX0A 4WIAA 5IEBA 5JSYA 3WJ7A 3GAZA 3N2GA 3IQXA 4N0QA 3AEUA 3V8QA 3NP9A 4LJ6A 3WHLA 4HYTA 3SSNA 4PZZA 2V59A 1R0SA 1O5IA 4XVRA 4URVR 1XTQA 3SHOA 5DTQA 2W8BB 3RFFA 1DCFA 3ECCA 4EHLA 2FW8A 1E1CB 3AGPA 3ZWXA 4ZDKA 3B6MA 4BEJA 1HYHA 3LL4A 4B3FX 2C3YA 2D28C 2B5OA 5K2MA 3IDQA 4M53A 3W3ZB 3A2KA 2Q4EA 4X8OA 3DV0B 5TS3A 1NQUA 2WYHA 3PCTA 3OPXA 4PFJA 4UNQA 5DN9A 2QI9C 1BVRA 5LUAA 5JDCC 1L4BA 4LK3A 3ABRB 4Z5XA 1QQ5A 2QAGA 3AKEA 2X1LA 5EYPA 4DQKA 5HR5A 3DBRA 2IXEA 5CW2A 4H1WA 1FTQA 3PA6A 1I7LA 1U3UA 1KVUA 2HIGA 1IZ8A 3W79A 3X44A 3MFYA 1T25A 4D8XA 4YRIA 3C3EA 2ZB8A 3HWX1 3D9QX 2R7NA 3E5NA 2H3HA 4MARA 3MERA 4B34A 5TMEA 4HDMA 2ACWA 3JQAD 1X7ZB 3RVNA 4BQFA 3BN3A 1ZISA 5FUWA 2C0CA 4B4VA 4CHTA 1OHHA 1W1IA 5AVVA 3LPDA 4MRRA 1JDUA 3ESAA 2VR1A 3SHVA 3TTTA 3VSEA 1IHPA 4IIUA 3N8GA 5D6BA 1GAQA 1LDYA 4MWEA 3H9BA 3IP9A 2OZLB 3TK1A 1MC4A 1DIAA 5CT4A 5JCJA 2FG5A 1JT2A 2B34A 3A6DA 1HORA 3EVNA 3HLYA 3RU3A 4MIYA 4L78A 2QVXX 4RJLA 5LC1A 3VNAA 2I2AA 1YJ5A 3GPLA 4J1QA 1OROA 4HXGA 1P0QA 4ZCSA 3PUKA 5JAHA 4R68A 3ND6A 3RJ9A 2B61A 3O8BA 1TTTA 3SBEA 5DNDA 1E3DA 1SU6A 3WDMA 2H1OA 4MMYB 1RYBA 4ZGGA 5JWRA 1QE5A 1C7FA 4B7UA 5JWOA 1DAGA 3TBKA 3PWTA 4AUEA 2OV8A 3L01A 1QH9A 3R7WB 4DGSA 4KRGA 3A2NA 2Q27A 2PQMA 4UBLA 5GJVC 1U2RA 5HM8A 2P1DA 3GGOA 2WG1A 3GFFA 4GOMD 3TN7A 4CKBA 4RVSA 1W75A 3E9DA 5FBWB 4BEBA 4MZDA 2PWBA 2DQYA 3GFTA 5C5IA 1X7XB 1EVJA 1XC7A 5LXTA 3L0SA 2Z5FA 3NM6B 1DO8A 2X8WA 4MLDA 4OSOA 2NM0A 4B7XA 1IM8A 3MZ0A 2LXNA 3ODGA 5HX7A 2RGYA 3DO5A 1KDVA 1MA0A 1ZMXA 3M1AA 1BXGA 1Z0IA 5CBPA 1G98A 3GGJA 1T3SA 3HYRA 3SC3A 5BVHB 5JSZA 2YIMA 2CVHA 3AERB 4DW8A 3L3BA 2GPSA 1BMFD 4X84A 1YQ9A 4CIVA 5DMHA 3HTXA 2IF0A 5KKAA 5JW6A 2F8TA 4L4XA 4Q48A 1UMBB 3PFWO 1PBNA 1DRJA 4F9FA 3BFVA 4B46A 1N6HA 2JEYA 3L46A 3OETA 3G7UA 3EODA 4GKVA 1TMGE 1Y5NA 4JROA 3KOXA 4C7KA 3ZCXA 4OVKA 3UK2A 1TKAA 2V9PA 3KSAC 2O23A 1T4DA 3HXLA 1IPFA 3DOHA 3KVNA 1Q7EA 3MWKA 1RCTE 4H35A 4UMDA 2R7LA 3WY9A 4A9AA 5KYUA 4BX0A 4MUBA 4U7JA 5JANA 5FUVA 1TC1A 4OHOA 3GFPA 3WIVA 5IHPA 1FP4B 3C3YA 4MEAA 5DM4A 3UN1A 3SR0A 3I72A 3LDFA 5ITSA 4Y9SA 2QXYA 3EIQA 5ED0A 3AM5A 1BVHA 4KVGA 4FK8A 1OPRA 1N2CA 1U3TA 1COZA 5IARA 2BF7A 5KOJA 4MB2A 1DEHA 1M0TA 3CA8A 3FIUA 4PHCA 3OD1A 3HUDA 1XRNA 3V1YA 2ZAGA 2P69A 3M70A 2NTEA 3QPCA 4XQGA 4AS2A 5IW8A 4IDBA 2FWPA 1UOPA 3A6KA 4JLSA 5T3YA 4B3JA 4KHPB 3EISA 1J20A 4IQGA 1SCQA 2ZM6B 1Q0UA 1LVHA 2WHYA 3KUDA 4IUYA 2O1WA 4PXSA 4KP7A 4R01A 4RVDA 3X1XA 4BPBA 4AJHA 4WGFA 3C5VA 2AA3A 3HY6A 1PJSA 2HEIA 4UDOA 3T7CA 3BSSA 4LSWA 4M4SA 1U2PA 2YXPX 3BRWA 4AECA 3A27A 3A05A 1YBAA 1OYVA 1XA0A 4IYRA 4LCEA 1T10A 1U7UA 1VHJA 5IUNC 1JIUA 2MSEB 5F78A 1JJ7A 4OB8A 2HRZA 4MI3A 2QVZX 5BP7A 4DBVO 3PGKA 4O2AB 1SD1A 1ZVQA 3LLVA 3WNZA 1IC6A 3CMMA 5F98A 1Y63A 5JRZA 1EU1A 4JP8A 3RSSA 1KYXA 4ZGWA 2EFJA 4MQFB 3MINB 5J2TF 1EFTA 1KI3A 2GJ9A 5CT5A 4EI7A 1QGAA 1WB6A 5FKJA 2IP1A 3V4VB 1U9IC 2R8YA 4MWDA 1THGA 4H0CA 3U7QB 5JNRA 1H9CA 5FPKA 3HKDB 3F4BA 3INTA 3OC0A 4WOPA 1XK6A 2GEDA 1MABB 3G85A 3FCYA 1Y1KE 4A6XA 4M1ZA 4E5NA 5DHRA 2QA5A 4X93A 3W05A 2JFUA 3R6QA 2WKQA 3OMXA 2PH5A 4O4LA 2OXTA 4AMYA 2PRKA 1A82A 1OD6A 4ZOLB 1D6JA 5U1PA 4DN6A 1V8PA 4RD0A 1ZZGA 2WP8J 4RGYA 1X13A 2G9ZA 3GP3A 4MYCA 4X1YA 4WWHA 1CXZA 1EHCA 3KYCB 2C94A 3FOWA 4RK1A 5FLKA 5FT9A 1L4EA 2LIVA 4Q4JB 3ZOKA 5B36A 2J87A 3H4IA 3VR4H 3H4TA 3IR5A 4I0WB 4KVZA 3ZLJA 2ZBDA 1I0AA 1O8CA 3FM9A 1JZTA 2W90A 3HVJA 3JR7A 4KO8A 4YMIA 4LXTA 2VH2A 3IDFA 3MWYW 3OIGA 4K6OA 4R31A 4RBNA 4X1OA 4DLXA 5AM2A 4PZ9A 1DKQA 2BVNA 3EH2A 2M9MA 2PUCA 2RH4A 1DFHA 4EL0A 1F3LA 3Q8KA 4U6NA 4R5HA 3UOGA 4ZYVA 1J2EA 3FHTA 4DLTA 1D8AA 2C7OA 1SXJC 2OFPA 3O31A 1ORVA 1N9ZA 3A32A 3FI0A 4CUZA 3NXKA 1OJLA 1MBZA 2ZTSA 1F48A 3LDHA 3OTQA 3QELB 4MV5A 1TO6A 5J40A 1FX0A 3QENA 4KFUA 2RG7A 2Z83A 3DKKA 4QXMA 2CBZA 3I92A 4DR3B 4IYJA 4N40A 1A9XB 1BW9A 3PNLA 1M5UA 4RIFA 5EXEA 4EQ6A 5LDDC 3W6PA 2AQIA 1OA0A 3UK7A 3QG1A 4CTMA 2WUWE 3REOA 1CNMA 2Z3VA 2H6EA 2J3KA 2O4UX 3GHYA 3KPUA 3F8TA 5HFJA 3VXKA 4DIUA 3M8KA 3WKCA 1I10A 3WQSB 3T9EA 4JDUA 1WTCA 4ZHQB 3E0QA 3HM9A 5FL7D 1BAPA 1X7HA 1ZD8A 1EFPB 1LPPA 1T1RA 2QLLA 4CV1A 2ZKLA 3HCOA 4DBZA 3A6PC 1OX5A 1P4RA 1SQSA 1UKVY 1NXPA 4UU0A 3NWJA 4DCUA 3BAFA 3I5YA 1GPUA 1Z25A 2B0CA 2QGNA 2R79A 4DUZB 1CUBA 3F74A 5KB3A 4L08A 5ALZA 1WSWA 1YS4A 4NPAA 4Q19A 3R5XA 1O95A 1M2NA 1RPJA 3Q3HA 2FY8A 2HPAA 3OM8A 4P7JA 2W2LA 2XVXA 3K1AB 4XYGA 4MUXA 5E2BA 5K3CA 3EC7A 1ZM7A 3PL5A 3RVMA 3LLCA 4F2GA 4F9GA 3PX7A 3QNMA 3NYQA 3PVSA 1WD5A 4B8ZA 3NNDA 2GVDC 3K05A 3ZQUA 2YWXA 1E3EA 3NAQA 2VA9A 4FJ2A 4JBXA 2BGIA 3SR4A 2HLHA 1DBSA 2IDKA 2OO7A 2WOJA 4C3OB 1QQAA 3U6BA 5IJXA 4L8VA 4NOLA 2YFKA 2IHNA 2NACA 2VJAA 1U5BA 1QLHA 4RUKA 1J8FA 1C0IA 5KC9A 3C4QA 1KO8A 4M7PA 1L3BA 2VYND 3WL4A 3QE3A 1JAZA 2QM0A 5H1YA 5BN5B 1K66A 1X92A 3E1GA 5KTYA 4F8EA 2PL3A 1P73A 1PVDA 5ALEA 3KETA 1TUBA 2G0TA 2QORA 5EIXA 1ZD2P 1OV4A 1UR5A 2OVFA 4CTOA 1QLJA 2G77B 4AX8A 4EJFA 4NENB 3R77A 4MHTA 4DCNA 4MPPA 3E5RA 1N2EA 4QBHA 1LLFA 1JR2A 4RXMA 4YEDA 5E7QA 4NCKA 3VVMA 1RU3A 4RDXA 2C84A 1GARA 4J1TA 3VR4A 4F3CA 3PXXA 1NXWA 2C3OA 1NWCA 1E69A 1C3LA 3GO4A 4F3YA 2O19A 4XQ0A 1NW3A 1JEDA 2IWRA 1U0OC 2PHZA 4R2LA 4KDRA 2YQZA 1T5IA 5JPIA 1DAPA 1JYFA 2QJTA 1PX2A 5T4BA 3UJ8A 4DQXA 1XZBA 2PAFA 3W4IA 1Y7LA 4HLNA 3PNMA 3AZPA 1XRRA 4EG0A 1NOIA 4YT5A 2IC5A 3GRRA 3D7KA 4FX2A 5LNK6 2FSVA 3KQPA 4QELA 4ZZ3A 1G2PA 3AUXA 3IIKA 3WB0A 4O5AA 4DE5A 1EP1B 1N6PA 1P81A 2O2HA 3BS4A 1Y5RA 2X8LA 3AR7A 1TIKA 3LI2A 3PG5A 1IPEA 4KLNA 4MVJE 3BT7A 4OP1A 3BGIA 2OPHA 5T6MA 3BA6A 3LKBA 5KOIA 3AETA 2NO1A 5EJAA 5K0LA 1MX9A 2P6MA 4NYIR 1RAGA 4U7PB 3D5EA 3WGGA 3ZHXA 2OSVA 1DAHA 3B7PA 4H7HA 5DN6D 4X65B 3GF4A 4LZWA 1CY8A 1GZVA 2HPHA 4J0JA 3C6XA 1L5OA 5BNTA 3QUQA 4MR9A 2VTBB 2VOEA 1R16A 4C7OA 2JJ8A 1MC1A 3PGVA 3ZV7A 4RHXA 5FH9A 1CUVA 1IK6A 3FVTA 4BKRA 4ENTA 3LY5A 4NRDA 4E4YA 4ZI7F 3DXYA 1B8NA 1FNDA 2AK3A 2KLBA 3LP8A 3N8KA 5T6BA 1PX0A 3KS9A 1BEZA 1Q7BA 4GP9A 4Q4AB 2QROA 5KX5B 4BWYA 3UGJA 2Q5EA 3K9GA 2XTZA 3PF8A 4FWTA 1QV9A 2Q29A 3AP2A 3C8UA 4RF4A 3D6VA 4KIWA 2FPOA 4RJJA 3UXYA 3KSUA 5AQ1A 2OBLA 1J0DA 3ESYA 4MDFA 3F9RA 1US8B 1ZR4A 4QTYA 1GGHA 2NZJA 4KMOA 4M2LA 4IINA 2J85A 2DPHA 1MORA 1SXGA 3BKWA 4EH1A 3FHJA 3EZXA 5EQJB 1WY5A 4EY8A 2YINC 3IT1A 4WSOA 1IY8A 3ZTYA 2WM9B 4NZ9A 1SIWA 3KZCA 3P9XA 1G5RA 3K70C 1T9AA 3V1KA 2IY7A 4JXZA 4HZIA 5EJIA 3EARA 1LF5A 3GEPA 1QAOA 1S8OA 3W3AD 2HDHA 2JLVA 1BKYA 1H94A 2R7KA 3JASA 4QQFA 4E12A 1G16A 1PEYA 3KM0A 3LH5A 4YQZA 2QRGA 3H86A 1KVSA 3DAFA 4N8EA 3BMOB 1YHYA 5D5HA 5EA2A 4EDFA 2D0OB 3OEYA 4YALA 4V1CB 1UAGA 5BMVF 1WUJS 1XLWA 4KYTA 10MHA 3CLHA 1PJ4A 1K8RA 5HS4A 3BWBA 3H04A 1B1CA 5BN3B 6CHYA 3VU3A 3ZDDA 2RJ3A 3GNQA 1RYZA 1TIBA 1H2HA 3UT0A 3CHYA 1DBWA 3QHPA 4O4IF 2QRZA 4PLGA 5K0BA 4HQKA 2BGWA 4JT2A 1SVMA 1AURA 3UGKA 3JAWB 5THKA 3W8NA 2BCEA 2ZR7A 4QZVA 3QXHA 4M3NA 4YQFA 1D0VA 2I76A 4OJTA 1F5SA 4ZMSA 4CTNA 1PR4A 1UPXA 5JNSA 1VLHA 2Q9AA 3QKSA 4ND1A 1NVKA 3MWJA 3D8NA 3GUVA 5D3MB 5GM2A 4TUYA 4LXIA 4Y6OA 3NTLA 4YV7A 3RRMA 1H2YA 2GTHA 3KV1A 4DB4A 2Q49A 3DL2A 4D4HA 1M2WA 2NSJA 2A0FA 3VR5A 3EJWA 4FOOA 4Y2HA 1AA6A 3K3PA 2ZYIA 3P45A 1EWKA 1VFPA 2W58A 1SCUA 3HDJA 2CL7X 1SCNE 2IY9A 3L93A 3PUXA 1FJ2A 5D1HA 3F97A 2NYRA 3KXKA 2PT6A 1DQRA 3T5BA 1W93A 3GT4A 3GA7A 4B71A 4OXYA 8ATCA 2B35A 3OZVA 4FVTA 4N54A 5JO0A 3KEOA 4JODA 2F9MA 2PGOA 1XPRA 4PGFA 3VJLA 2WF5A 3IBGA 1Z28A 2J6CA 3HKEB 3VNBA 2RJOA 4CM5A 3K31A 4G0OA 3RUAA 4XWYA 4XIIA 2PTQA 4YAWA 1NURA 4IIJA 5JSFA 2VSFA 2XKKA 2WDZA 5CURA 1COWA 2HAEA 2ORYA 2Z8ZA 3C7CB 4G9BA 1N2ZA 5HS6A 5IAJA 1GG2A 1BKSB 4LQCA 1JF8A 4QXRA 2D2FA 5K51A 4KPUB 1CJVC 4YVFA 3M3DA 1N1MA 4HI0E 2NMVA 1NVAA 5E0OA 2YQ4A 4KQ6A 5HKKD 3FDIA 1XEXA 2VDWA 3MCWA 4IRUB 1L7QA 3JSAA 4WFIA 2JJ2D 2JGRA 3TOSA 3I01A 4FFNA 1BOFA 2NUAA 4JLAA 3NBUA 3R76A 4BMVA 3KJHA 4B4KA 1WSBA 2Z6VA 2FSGA 1QTQA 4HR7A 4LMBA 3W5HA 3QEMA 1VE6A 4TTAA 3K1TA 1TLLA 4YMHA 5JTTA 1FFCA 1GL3A 3QYFA 2ZRCA 3U9SA 2ZBFA 4FQ7A 4ALLA 1P19A 4ZO7A 1Z4KA 3LW8A 4PCLA 1GXSB 2FW6A 4J16A 2HRDA 1G5QA 2JGNA 3O21A 4D4JA 3DE4X 4P2GA 4GT1A 1QONA 4WZ6A 1C1YA 2XB6A 4Q66C 3SBOA 3TOZA 1F6WA 3CF6R 4W6QA 2A9PA 3CZQA 3UV3A 1NT2A 4JVSB 1CQJA 3ZLUA 1ZOPA 3NUQA 5ALWA 1QHFA 4FXOA 1TD9A 1ZN7A 3WHKA 2OCGA 1G8MA 5KSOA 4WAUA 5HBGA 3TZBA 3HMQA 4WZBA 5B4UA 4BEWA 2IYTA 2FHPA 2J67A 3I2HA 1Q84A 1XEWY 4TQ9A 5D5PA 4CW7A 3PEVA 3G49A 3D43A 5EGNA 5IWAB 4UW9A 4G1BA 1ZCBA 1HNZB 1KO4A 1QVWA 1RWVA 1T4GA 2POQX 1PZGA 3RVJA 2MSWA 4MEJA 3Q7TA 2Q8NA 2PKCA 2PU5A 4LF7B 2F3TA 2FE4A 2OCPA 3ZU5A 3MPOA 4KH0A 2BW0A 4KPFC 2I6SA 4JY7A 3P7MA 1AV6A 3JARB 3RFUA 1H1LB 4IJMA 2QZSA 3RV3A 1MG0A 4IJ6A 4B85A 4ZJZA 1NT4A 5K2OA 1OILA 1EB9A 1YDMA 4G36A 2GHRA 4RTNA 2ZSAA 1CEQA 3HA3A 5ALNA 5IDXA 2AOTB 2W9XA 3OJEA 4INAA 3DR5A 3KKEA 4HGOA 1N5KA 5JEDA 1J2YA 3SWWA 1FQKA 5IP5A 2Z8XA 5E1BA 4HQRA 1Z4IA 1V71A 2FXIA 3IIJA 1HRDA 4FYXA 4G0UA 3BWDD 1RBMA 3RE1A 2VJMA 4A6EA 1JJIA 4BGDA 2CKDA 4LYEA 2P79A 3C8MA 3ORRA 4A2PA 4DQUA 1D4AA 1YFLA 1LSOA 2ISSD 2JK0A 2O3RA 4CI0B 2OHOA 3BMCA 5JAMA 4NXMB 2IIVA 4B6EA 2HK8A 2HSDA 2OCYC 1U2DC 1QDLB 3ZHYA 1ZIYA 2A4MA 3UJBA 1Z4OA 3A37A 1QFJA 5TQ0A 1W5SA 4MQEB 5DFAA 2WAAA 2VQEB 1BD3A 2C5AA 1VKOA 3H2ZA 3W5DA 4M8LA 1DQNA 4XYEA 1WXQA 3O47A 4TKZA 5IBPA 4IEFB 2X3FA 4GOKA 2PBFA 3B38A 3FCEA 4M37A 5IN4A 3CBGA 4B32A 3ETDA 3UOAB 1JZQA 2P2CA 3LFHA 5J47A 5EJ2A 4YUWA 5KDOA 4EECA 4NKRA 3ZNOA 4CKYA 1YUBA 1NMSA 1Z08A 3TLGA 4PS1A 1QMGA 3FY4A 2WPDA 4D8UA 2FMIA 1ODLA 3RS8A 4R2HA 3ZNPA 1VA4A 5L3SA 4EW3A 4DR7B 2PT7A 4RKRA 1V4VA 4OHPA 4N3GA 1ZUNB 3HB9A 2O8BB 1DWOA 1C1DB 4TRJA 5EERA 1U9YA 1MB3A 2EX4A 1XCJA 5KHOC 1CSEE 1WWKA 1CD5A 2H4XA 2WWHA 2EKLA 2K87A 3D6TB 3T4XA 3RSHA 4EGSA 3TV2A 2HHAA 3BMNB 3PT5A 1GTVA 4FT2A 3H16A 4G0MA 4C06A 4GSYA 4I1RA 3LXUX 4OM8A 4WXPA 3W6OA 1D1PA 2HRRA 4MGEA 3X2FA 3TUIC 1R0WA 2EF0A 1P60A 3BM5A 4BX8A 1N78A 1F4PA 2VHCA 2GPWA 2I1QA 2IA5A 2V3VA 1C4WA 3LQ2A 2BR4A 3ZGXA 4CEJA 2QZ4A 2RONA 1ODCA 4B3SB 2BMFA 4ZMRA 1PR2A 1RBQA 3KOOA 2ETXA 4EGFA 3U9TA 4YP5A 3K4QA 4YYZA 5JHHB 2BP7B 3VX4A 4NICA 5DBGA 1JFRA 1E3WA 1ZVKA 4CDRA 4QYIA 1E1KA 3GGGA 1BS9A 1I2MA 1EDEA 1NSTA 1N2BA 1RT9A 2Q62A 2VDQB 1SKYE 1U7TA 3ETLA 3OIDA 3ONNA 3ZQ4A 4MWTA 1LPOA 3B48A 1FEZA 1VSVA 4EX6A 1TVKA 2X13A 4ESHA 2V6BA 1DC5A 3EQ2A 4NH0A 5DCYA 4ETWA 2DX7A 3CF4A 4NE9A 2QTHA 3PYXA 5BSEA 1M2OB 1TM5E 5CYFA 1TECE 1VB5A 1NOJA 1JIIA 2A14A 2PL1A 1TU4A 2EYUA 3V1NA 2WQZA 1IXKA 4G84A 3UMCA 5I7FA 5J2TB 2DWQA 4DUPA 2VA8A 4K05A 3WRYA 5C81A 4P4NA 4G25A 4LY9A 3DTVD 3IH5A 4G0VA 3IBFA 2WF7A 4FEAA 4WADA 3JCZA 3MTJA 4DDVA 3I83A 2AJDA 4H17A 3GRUA 1YDGA 4U8HA 5EJ9A 2HK9A 4N65A 3CKMA 2BH2A 4BO6A 2CV2A 1G21B 1K88A 4ZV4A 1BWPA 1U81A 1JKIA 2N3ZA 2GD0A 2L82A 3G02A 3KB1A 1HE1C 1NXSA 3KLNA 4IRXA 1AX9A 3C3KA 4H9GA 5K4HA 3GROA 1S0UA 4RPCA 5E6UB 4JI8B 1HFKA 1IB6A 1QTRA 1SC6A 2Y67A 3DBHB 1QF9A 4BP9A 1SG9A 3PHIA 1G8KA 1YUMA 4UEWA 5DGIA 3UPTA 3U31A 4DMCA 2ACEA 2AMFA 3ZU3A 1CDOA 3AVOA 1CW2B 1OIVA 1MJ5A 3COPA 3FPEA 3R3HA 4K46A 2WIFA 1AQYA 5AK3A 3DDCA 2GN8A 4H1HA 4HDRB 4OHMA 2XBLA 4AIRA 2ZB3A 1QMPA 3I3SR 1ZONA 5DBOA 1J8YF 1ESMA 4GC5A 5CEFA 1NUPA 5F92A 4V0ME 1H2RS 1PWYE 1ZAKA 2B25A 3DM9B 4JI7B 2OL4A 5TY0A 2IW3A 4JLPA 4FYMA 2AFIA 4HQLA 4Y1EA 5C9ZA 1H3NA 3V33A 1KMIY 1QVZA 4N03A 4Q3BA 3N53A 1FY2A 2PUFA 1CS0B 4J1NA 4I3GA 3BILA 4C2UA 3WLOA 5EIAA 4F45A 2BFDB 1QDUA 2HK7A 4FN4A 5KNCA 1ZHOA 4Z0NA 1SHLA 2DR3A 1FFDA 4DVGA 3OWXA 2PVSA 3CW9A 2JJMA 1L4YA 4EHKA 1B2LA 3DAOA 4MDYA 3VKWA 3I12A 3PUHA 4CQLB 3O1LA 3G0HA 3KVVA 5AHXA 2PFMA 4OLAA 2JKYA 3H05A 1JE1A 3ELYA 1HEUA 4DZZA 3HCEA 4PSCA 5FPSA 1MIHA 2OO5A 2BKAA 1M7HA 3EZLA 3Q5GA 3EYWA 4GLLA 4XJSA 3SEAA 1WU8A 4EJSB 5THXA 4MJ3A 2IZ7A 1ZVMA 3CVVA 4TX1A 4QPNA 2NTNA 2WZBA 5REQA 4DSNA 2GERA 1SC4A 1YS1X 2JGFA 2Y77A 3KWMA 3FLEA 1P2BA 2H65A 2YNMA 4DPMA 3CUWA 3T5PA 1J7KA 1ZRMA 4QHYA 5J3JA 1M1ZA 3ROFA 1LDMA 4RV4A 3HS3A 4R69A 5GJBA 2ZAYA 3OWHA 1JXAA 3QKRB 2CWWA 4RO0A 1BDHA 4RZHA 4GM4A 3WLHA 2NYVA 4HAVA 4YAUA 5J1TB 4RVOA 4R2MA 5ERGB 5KPDA 3G9XA 1NQXA 4ER0A 3O26A 3UWSA 2I6XA 3L1JA 3RCBA 3DO6A 5ALYA 4LJ7A 4QXOA 3VPAA 4ENPA 3ORYA 1WZEA 3IBCA 1T0HB 4KXFB 1XAIA 3KE9A 4BNGA 3IOMA 4D4IA 2FPUA 5GJCA 3U5TA 3BCRA 4FYJA 3VNSA 4MKGA 5DNUA 1CE8B 3MBIA 2HD4A 1DJOA 3DUWA 5AKLA 1UBCA 4JC5A 3VM6A 4Y1RA 1H0KA 1Q0TA 2IEAA 4TKUB 3W5BA 2BUBA 3PGMA 3MQ2A 3VSAA 3O5AA 4EHJA 1QIJA 3E81A 3BXZA 2N0SA 1HE2A 4Q00A 4EPVA 3P5SA 4MRPA 3RH0A 2ZJ7A 4YCCA 4JT9A 4HFJA 5T8KA 3DVAB 2FMTA 4V0KA 5HFAA 4NZZA 2QJFA 3PKIA 3WS7A 1PYOA 1NUSA 4ZI3A 3JAKB 4REQB 3VZQA 4NMMA 1UPFA 2DSNA 4LCBA 4QXQA 3ZCSA 2REQA 3NOOA 1NMYA 2IYWA 2NIPA 1T15A 3GJZA 1PG0A 3JQQA 3VTKA 4YO7A 1W36B 4QGGA 3AEQB 2ZJAA 1E1CA 3WMXA 2ZI6A 1T0IA 3L06A 5DSZA 3UK6A 4D3FA 2CMFA 3O8NA 4B9EA 3DOCA 3A1WA 1DRKA 4AJ2A 4ZT5A 1XF9A 3EMKA 1VECA 1L7VC 3ICOA 2VAWA 5EKXA 3KPJA 3HEMA 4FFRA 5A1JA 1OKKD 2O9JA 1T2NA 4D9KA 1WXXA 1DTWA 5H3LA 4IDNA 3AJAA 3B85A 3QEOA 1M1NB 1PT6A 3M3PA 2O1EA 1BO6A 4ZKEA 3DZ8A 4LYDA 1J0XO 3K2EA 3TJRA 4RFSB 3MWFA 3TVTA 2QEQA 3N8DA 1IRIA 1UJNA 4GNRA 4C4TA 3G7NA 3O2SB 2DXIA 1EJBA 2VRWA 1V0JA 5BPHA 4GP7A 3W3AH 2BLNA 4HDNA 1GYPA 1Z8HA 4QYWA 2UVPB 3N5CA 5BT8A 5AJWA 3VZPA 3JYLA 2OZLA 2FFAA 3KPWA 4TTQA 5L40A 4OSPA 1K86A 3K0SA 3A10A 3HB5X 3QGMA 4GGOA 4YUXA 3C8ZA 3GG9A 2OG1A 3O2NA 4URWR 1NMZA 4ROSA 3TLXA 4D8VA 2PZJA 4JUAA 1VZ3A 4PRZA 3F7NA 1ECPA 4I8DA 4D4KA 1NN0A 4AP6A 2QP4A 4MH0R 3NGMA 2Q8QA 2FW9A 2Q6OA 3RVPA 1QPGA 3ECAA 2ZE6A 3IJRA 4JWKA 4DXDA 2G80A 3O9MA 3NNSA 4BGIA 3ZGOA 4TSRA 1USKA 4RSRA 4FNMA 5JECA 1O95C 2R4QA 1P9WA 5AHOA 1Z5UA 1Z6GA 2XUDA 2H54A 3UCEA 1SVKA 3B9RA 3D8SA 1E2QA 5BQ5A 2WYUA 1V1RB 3HA2A 3GDGA 9LDBA 2UUAB 8MHTA 5KTSA 4JP3A 1TA4A 1RCFA 3JQGB 4D43A 2XRFA 4C88A 4DDUA 4J7CA 1YACA 1EK1A 3I05A 3LJKA 1E9BA 1C9DB 1TTHA 3G89A 2GN2A 5A0TA 1QO9A 3BJRA 3EVBA 4L0CA 4WD3A 4UNIA 4GKKB 4M9RA 4FFOA 4XDHA 4XRRA 3T9DA 1PJ2A 1XCGB 5E2IA 5SYMA 5P8WA 2FUG6 2UYGA 3FPBA 3CEJA 1BDJA 3RTGA 3TLYA 5BMVB 4PLFA 3EXIB 5B53A 2XYQA 4HBGA 2YKGA 3FR7A 3AFOA 3SLRA 2LCFA 4BE4A 3ZGZA 4WA7A 5A3SA 5ICCA 1IY0A 3OTOB 3ZXUB 4YI3A 4I1PA 1LGYA 2X5JO 3CSUA 1P9NA 3QXJA 4L50A 4YDRA 3HCDA 1OSNA 1IFXA 1RXCA 2G82A 3FG9A 3FNBA 2GCIA 4V0QA 4TLEA 3WGOA 3GJSA 4KODA 5FRDA 3K4PA 3H3FA 1A96A 2VTKA 4C6TB 2YV4A 1F8GA 2YJNA 3R3SA 3V7UA 3IDAA 1L5RA 1OI4A 4AJEA 1VKRA 2JNWA 1NASA 4JLVA 2ALJA 3Q0IA 3RO7A 1N1DA 1VTKA 1KETA 3JPYA 3PITA 2AFHE 3NAZA 4PZYA 1U28A 3ZS9A 2B1RA 3CE6A 3OFVA 3PPIA 4MRMA 5AJTA 1EZ1A 1FP4A 1SEPA 3LF1A 4AP5A 1SCDA 4PCAA 3DHYA 5MF6A 2O8CA 4ARBA 1SUIA 1FUKA 2QKYA 2ZUVA 1CY0A 1QHXA 1W4LA 1O4WA 1G17A 4O1IA 4PQEA 3T4EA 2ZFUA 2Q50A 5C5DA 4C78A 4RQAA 4JLDA 1IXRC 1QC5B 3R8XA 2EKQA 2C2OA 1JU3A 2QRHA 4NONA 1X3SA 4WQMA 1E2NA 3EBLA 4KX3A 1HMPA 2E4UA 4WCVA 1GKUB 3AL2A 1BIFA 4F11A 2WYOA 3QUTA 1B6RA 2EJCA 2G67A 3NRJA 4HZGA 4EP1A 1S8AA 3MIZA 3F9CA 4TYMA 4FYVA 3IUMA 4YAEA 4IGIA 3IV6A 2JC3A 4JQZA 4ZT3A 4XD7A 3UMGA 3UMFA 1KK3A 1HYQA 5DX1A 2ZR0A 2J9FB 1ACLA 2ZJYA 3CN9A 4EF6A 4LGCA 5BMOA 1N2GA 4BN5A 1VDKA 3NCTA 3BWXA 3HJCA 4IJQA 3SLGA 2X4GA 2XHZA 3AB8A 4QDJA 2A0WA 4PCUA 2XMDA 5LN1A 3DFFA 3B1WA 1FRZA 1TI7A 3F3YA 5JD4A 1U65A 3EIXA 3FCXA 5LYJA 2F17A 1YQXA 4QU9A 1Z83A 1W5AA 2CXUA 3CUEF 3P96A 1GPLA 2Z1DA 4U39A 4MGIR 1OYWA 1MAHA 3IUPA 1CUDA 1WQ1R 2G76A 3F6SA 3T9FA 3TKLA 5CBKA 7GPBA 1O87A 2HA2A 4ZEWA 2ZRAA 1X7GA 4XGKA 2WNIA 2Q6TA 1KZ7B 3ONEA 3QLJA 3D7NA 1TNDA 3N0VA 2B30A 3MRVA 5DNYB 3K94A 2YY5A 1AQNA 3L4SO 4MP3A 1U0GA 5FLEX 2C92A 2YW9A 1L7XA 1CDZA 3FPJA 1KH2A 2XRYA 2W0MA 1UDWA 4IGAA 4J7UA 4NBLA 1KERA 1UMDB 2DQZA 1P77A 3MINA 5KYXA 1PTKA 1XKXA 1LTQA 1J0EA 1IATA 1O54A 2PR2A 4H3VA 3DFKA 3HKDA 1DAKA 1PT8A 3D54D 4ZU6X 4G1UC 3GFGA 1VI6A 1FTSA 5F2EA 3C3JA 3THRA 5C80A 3AUAA 1LY1A 2LD4A 1WZCA 5I7HA 3WVNA 1Z8DA 5CB4B 3OIVA 2W93A 2VP0A 1A4XA 4K0KB 1K9VF 3OPYA 2LZ0A 3SZLA 2WD7B 2YXLA 1WMBA 3CMCO 5IJ9B 5K6RA 4P34A 3BERA 5CVTA 3AF6A 4E5PA 2EBUA 1BMDA 2FW1A 3H99A 3KYCA 2Q5OA 3PQEA 1RE0A 4O2RA 3I04A 5JBNA 3DE6X 3JQAB 2XNKA 1JHUA 1EUCB 2GBGA 1HKUA 1DIGA 2HVGA 3NHJA 4K9RA 4XQEA 2K7FA 3GG2A 5DLQC 1F1BA 1Z5OA 5EE5B 5MN4A 3GNLA 1KIMA 4QBGB 1FRNA 2TMKA 3L4BA 2Q45A 3OEEA 3TR0A 1G5PA 1TEHA 5F1PA 1E9CA 2PMBA 3VOTA 3ZHSA 2Q2NA 1P5FA 4X9XA 5ALIA 2I9KA 4D9GA 4JJ7A 1FBNA 1I4TD 1YR8A 1YRAA 2D2VA 3S2UA 5KSZA 3TMKA 1J9ZA 1YKGA 2VP2A 3IRVA 4JJEA 3RT1A 3QELA 1D2HA 4MQFA 1XVIA 1D4ZA 4UMEA 4LJ8A 3S8EA 3ITKA 1Z6PA 2G9QA 1A76A 5SYNA 3AINA 3OQPA 1NVGA 5FULA 4JLWA 3ZD9A 4YHBA 4EW2A 1A9XA 2SKEA 1ZW1A 4P6VF 3E9RA 4HP8A 4K6GA 2XDYA 2GRJA 1JA0A 3OIUA 1DIBA 1V37A 2JIQA 4WECA 1VLJA 1JDZA 1GGVA 1LC0A 2A7XA 4XAQA 1FFXB 2DTXA 2GYWA 2OBMA 2QT9A 4QWWA 3TQIA 3TRHA 4DRYA 5JH7A 2PPLA 2X4LA 4KH1A 5CAEA 3H5AA 1C80A 3NW9A 4D0GA 2VHVA 3EFEA 4B79A 1JLRA 5A5VA 3TQQA 2ZT5A 1ONPA 4HADA 3IR7A 2H1SA 3L7NA 1W581 2GA8A 2OYSA 1EFPA 3KQMA 3B3AA 4RHUA 3RLFA 3TW6A 1J25A 1LFAA 2VP5A 4NFYA 1NY6A 1ZK0A 4B9AA 3WJ2A 5K3EA 1ZICA 4NBWA 4OGWA 3VR3D 4CM8B 4X7PA 3IUQA 5HUJA 3UH0A 1QWOA 3P2MA 3EOAI 1RXYA 3MYRA 1DKLA 4O8ZA 3KVOA 3HBFA 4RACA 1SXQA 1AD2A 1GRQA 3GDWA 1GV0A 4RM2A 2ZQ5A 4JP1A 1SZDA 1G6KA 3K70D 4PXYA 4B76A 1HM5A 3HO6A 1GFWA 2I1LA 1Z0JA 3LTNC 4OI1A 1VP9A 2AIRA 1ZCFA 2OILA 4J16C 6GPBA 4AK9A 1GGKA 3DV9A 1P80A 2V6GA 3NHKA 4R1QA 3TEJA 1SJ9A 3GRFA 3NEAA 5FUBA 2NAFA 3R5TA 2GHQA 1CQWA 2Q1UA 3KPVA 4LQDA 5CA1A 1YL6A 5FR2A 3LXMA 3SVZA 1J70A 2JFBA 4N7MA 5IYZA 5DRTA 2GD6A 5BR1A 3I6MA 2IEDA 4L15A 2H2FA 1RM5A 2HJ9A 3VU8A 4QJIA 2ZEJA 1PJQA 1RM4A 2CWDA 1C3OA 1N6NA 1U2QA 3U0VA 1TAUA 5ILOA 1WUYA 2FR1A 4N8SA 3VKVA 1YJ8A 3RV4A 3ISTA 5BOSB 4F1WA 1DC8A 2OXEA 3IB3A 4QOIA 2IUEA 3AEZA 4W5WA 1UBRS 3PXEA 1IXSB 2CLDX 2H08A 3PRHA 1X1TA 3COYA 2C4VA 3DDUA 3A3OA 5G0VA 4J94A 3GIDA 5HWSA 1Q3TA 1QRSA 2CYBA 3OZTA 4G09A 1XI2A 3WV5A 1T3LA 3R9WA 4WW0A 1Z2DA 1B93A 4TL6A 1DZ3A 2V5VA 2QTTA 4OJNA 2VI5A 1WBJB 4Z9XA 4M88A 4AJKA 1YAJA 4LNUB 3VHLB 4E33A 4CEIB 5BWLA 4ND6A 1QB8A 4X20B 4B80A 3ER9A 1WCIB 4JB2A 4EG3A 3OHMA 5FWDA 1JX6A 3AILA 3HCBA 1PBTA 3IVCA 4GLFA 1K6IA 4QDUA 3GC6A 1TKBA 1J5XA 1TU3A 2QD1A 2X8BA 2W6OA 5WRFA 2NO5A 4C6RA 2DCMA 3OZXA 2ZCJA 5L6LB 2HSEA 3VU9A 4B3IA 1GADO 2IJGX 5EG5A 2R8ZA 2TMYA 1Z56C 3HC7A 3MCUA 2IZ0A 2CFOA 5TQVA 3TIGA 1SRRA 3NATA 2RB4A 1N3IA 4H4EA 2WAOA 4OF4A 4G4SO 4JJZA 3NBAA 2ZE7A 1WUIS 2VHEA 1TCCA 2PH7A 1CTQA 2AVDA 1EUDB 2EKZA 2VFAA 4FS3A 1GTG1 3TIVA 3ZWKA 4AS3A 4GC9A 4CM6A 4ZC8A 6ABPA 4OI0A 5LLTA 1XAHA 4JSYA 5H82A 5KNDD 2UXDB 4RMHA 1G3IA 3NUGA 1W4BA 4BO7A 1ZRHA 5AW3A 1QOQB 2VJYA 3HFSA 2IK8A 1EE1A 1SWVA 2HLNA 2IHZA 1E2IA 4HKTA 3T5CA 5AESA 2VTBA 1MIOB 4L2IB 3S7ZA 3ROXA 5ARBA 3OA0A 2X2FA 5LMUB 5FLXA 3ITEA 3WB2A 3H17A 1WUHS 4I4TF 2ZYGA 3TG8A 4P7BA 4OGLA 3GQBA 4MW6A 4MX8A 2V8OA 2XCOA 2OCLA 4G4IA 4S2EA 4CYMA 5BXYA 4UOEA 2JLWA 3EGDA 1H2ZA 2HA3A 5KX5A 1ZJ6A 3UFXB 2FCRA 3NC4A 3TSOA 3F6EX 1BC5A 1KPGA 3ZUPA 3QLTA 3CVYA 2TYSB 4YB8A 3CNOA 2IX9A 2G5GX 2Q41A 1L7RA 4JHXA 3SDSA 2PCJA 1R12A 1PIWA 3CEAA 4MIEA 3VYWA 1DJNA 4EATA 3DWIA 3DBLB 3LE8A 5C18A 1P3DA 1WB4A 4RH3A 1CY7A 4US2R 3ZHTA 2AF4C 4GD3Q 5C5CA 2W2XA 1OUMA 2Z43A 3DE5X 4H6VA 3INGA 3IQEA 5BUSA 1OU4A 3PFGA 2CK3D 1F38A 4C4OA 3GEGA 5K8LA 4AZTA 1NJGA 4DR2B 1WAMA 2IPAB 1MKYA 3NT5A 4YRTA 2QUHA 1RMTA 3NHLA 4EVIA 5AW4A 1Z5PA 2JIPA 3ZQKA 4C7XA 2QS9A 1GA1A 3REQB 2ZBGA 4E2XA 3BZWA 3OBIA 2CC2A 5JE8A 1ZWKA 2BM8A 4BNIA 3EQ7A 4ZJPA 4V0NA 4URYR 4JYAB 4F0JA 2PKWA 1GSIA 4GKJB 4U7HA 2VBFA 2CB0A 3FUWA 3L1HA 4R0VA 4Z9BA 5HXAA 4YXWA 4F21A 3AVTA 2GBIA 3OQ6A 4Q9JA 3Q9LA 2R8EA 4RANA 3WL3A 4AB1A 1KI1A 3EPLA 1LDBA 1IHOA 4Y98A 3VYRB 2RH5A 1TA9A 2ZSKA 3W2IA 4J9VA 4EB6A 4K5QA 3NFYA 3SQMA 1AB5A 4ZCQA 3I58A 1L0BA 3KWJA 3WRYC 1IEXA 1T6BY 2A9VA 3WRXA 3T06B 3L7DA 4I55B 4ETMA 2SHKA 2YXBA 3KB6A 2C59A 4OHRA 4RVCA 1Q44A 5FI5A 1BA2A 5FOWA 3F7OA 4AP9A 2G71A 3DE7X 4PAGA 1I2BA 1OB2A 1HTWA 5ISMA 4PF1A 2AXQA 3RVSA 2ZYTX 1I8TA 4JX8A 2YY6A 4LE2A 4GPEA 1NWHA 1FP7A 1EWQA 2YS7A 4XUGB 3WBJA 1CJSA 1N0IA 1DTEA 5H4GA 3ZH2A 3SVLA 2EJTA 4B48A 1CUUA 2Q2WA 4NU6A 4J03A 3HUEA 2ICAA 4DKXA 3WAKA 1M8KA 4YX9A 4JSTA 2CCGA 4IEIA 1O6BA 3TL2A 3TPCA 1NVMB 1Z4NA 3ETEA 4F6RB 4E7OA 3SAJA 4YRSA 1B6SA 3IX7A 3QF4A 1MOZA 2OLEA 2Z9DA 4KR6A 5GAJA 1ISFA 4RKEA 1NN1A 3HKEA 5JDIA 4MYSA 5GP1A 1U0HC 3OZDA 4ND8A 4YCNA 5G02A 3DT9A 1CHNA 3N39C 4LZOA 4JKYA 3QKTA 3PC6A 4MI6A 3M34A 2QNIA 3MJVA 4KC0A 5DM2A 5F9MA 1TPYA 2VP9A 4RQBA 4C30A 1GILA 5U4XA 3TTSA 4DHWA 2QRNA 5LBIA 2W42A 3DYBA 3VPXA 3OFND 4F91B 1YE5A 2B3DA 4FX5A 1EA5A 1Q0HA 4LYAA 2A67A 1GVNB 5DGHA 5DWDA 3T7RA 4CEHB 4LAFA 3F98A 3E70C 3ZDRA 2ZB4A 2V4UA 5BQFA 1H4VB 1V4NA 1H5QA 5KTPA 1UT5A 1X80B 2LCQA 1EI9A 3BUSA 5AJXA 1FZQA 5IM5A 3VYSB 1P7ZA 2O2GA 1JUDA 1PWEA 2P4UA 2E4WA 4IBOA 2JB9A 5LQCA 1HT1E 1XZMA 1YFZA 4NR0A 4KL8S 3ENQA 4K9LA 4JLUA 4TXJA 3HVRA 2P8SA 4Q18A 4NF2A 5CB0A 1RM3A 3MCZA 3ZH9B 1XVVA 1F1JA 1CY6A 4IOKA 4O1MA 4L74A 1MEEA 4GQBA 4OJYA 5DH9A 4QOSA 3JQ8B 1XTSA 2QTWB 3TAUA 1E4EA 2QGZA 3SIXA 4X5OA 5TX7A 4NJEB 2HGSA 3OO0A 5KYWB 3AI2A 4RL4A 1HTTA 4JV5B 3OU2A 2P5SA 4R1OA 1CT9A 1BX1A 1R5BA 1FLAA 2PX2A 2QRMA 2RGBA 1ML3A 1XZIA 3OFSA 4IIXA 3N76A 4IILA 5AO9A 1J97A 1G6OA 1P6XA 2DFKB 2YNMC 1L5KA 3T6KA 3PR1A 3TLEA 1QDEA 2GEFA 2AOUB 3ROGA 1E1RD 2PAAA 4MRAA 4ZZ0A 3TNFA 2G06A 2OKCA 2G0NA 3W1EA 1FS4A 4OREX 5FNVF 2OAEA 1R0CA 2TECE 3SNHA 1X14A 2OHJA 1QGZA 1XMQB 1EXDA 3E1SA 1IZZA 1A04A 3ZW8A 1XFAA 2RDMA 1R0KA 3H87A 1N9GB 4LDZA 5FWYB 4H7DA 1ZA2A 1EBBA 1BFDA 2FLWA 1EG2A 2P3QA 1VHDA 3I1IA 3ST7A 1E99A 1J0AA 1NONA 4OJKA 4EG7A 4FEEA 4C6HA 1RSZA 2CLLB 4URZR 1T4CB 2MSDB 3T15A 1X2BA 4GW3A 1C9JA 2HU2A 4HQ0A 5HSGA 4Q16A 5KYTA 3INYA 2EZTA 3CR8A 2JVIA 2XVYA 4FZJA 4LWOA 3AEKB 4XLLA 3T3PB 4E5DA 2B4QA 5KYYB 1FNBA 5FYQA 4EG4A 5KQSA 4BNYA 4NMWA 2B8JA 2PZLA 3M4XA 4BUCA 5A03A 1JMVA 2VUHB 3LKZA 4FOTA 5EGSA 3WZMA 1HT2E 1B41A 1DFGA 2HCTA 3GJ7A 1LUAA 3HWRA 3QMWA 1KKLA 2D59A 5FX2A 1C29B 2FSHA 2Q9BA 2IODA 3FJ1A 4H77A 2BGGA 1UP6A 1PSWA 4C4SA 5IXSA 3SQWA 1P2DA 3RFTA 1SQ0A 1W0JA 3SYNA 3WGLA 2J5QA 3JATA 1GU0A 1JBEA 4R9UC 3I0NA 3N3AC 4ZZ2A 5LCXA 1VSUA 4ARZA 1FW8A 4Q6WA 2X1MA 3B1JA 4XB1A 2PNJA 2BIFA 1KDOA 2NXWA 4F9TA 3CH5A 4KKXB 4R1MA 4EHHA 2HB6A 3U80A 4DYHA 3L6DA 4M9CA 4NV0A 2R66A 4PQGA 2XGJA 1T9KA 4Z86A 1SQ5A 2QTVB 3FCOA 3I6BA 4WE3A 2RBGA 3AR2A 2O8BA 1L5VA 1LH0A 4ZCRA 4RX1A 3ABOB 4KYVA 4F4JA 3O6VA 3B53X 1FYXA 1V7CA 3P0HA 3R0IA 4NCNA 2BV3A 1T1GA 2JLBA 3I2IA 4FHZA 1EKXA 3P32A 5H80A 1R4NB 5HF5A 2VSQA 4Q9NA 4GZ5A 2Y3IA 3CRNA 2ZTUA 2H9AA 4WNIA 3HPRA 4WGGA 3W7VA 2VDUE 3BHJA 1VIDA 2FP4A 2C99A 4EKDA 2J3DA 1GG8A 3GPBA 4JU9A 4MQUA 4WLUA 4MP6A 5KTOA 2XMRA 4KR9A 1ZIOA 3N2KB 1KAHA 1FDRA 2EX1A 2WK1A 2CXTA 4PQYA 1JKJB 5AICA 3OO1A 3L4KA 2Q1SA 5SICE 1KTIA 1NHWA 1EFRA 4RHCA 2YRXA 3PNSA 4TVOA 1ODKA 4NQRA 1NXTA 3NHWA 2BP7A 1LBSA 3HY4A 1PZEA 3OAAA 4S1NA 2QMOA 4TXHA 4ZAVA 1PG5A 3N0RA 2PWYA 2BBWA 3EG5A 2YXNA 3I37X 5ALGA 5B55A 1SQFA 1RXWA 3OCJA 4JBWA 3M3HA 4PONA 3EEIA 1PR1A 1PT5A 5ALFA 4W5HA 4BNDA 1NXOA 4CCWA 1XLVA 4U2FA 1KH1A 3WLRA 1BZYA 1NPTO 1WCXA 1K75A 1XYVA 3D4OA 4HMOA 4WNYA 1Y1TA 2LBPA 5A3JA 4XZ3A 2OBFA 2PCLA 2XMPA 2ZITA 3BIWA 2P2SA 2Q0QA 2ZYAA 3CX6A 3B12A 1XZDA 3QVUA 1QHEA 3LC7O 4LHXA 4OYRA 4E3WA 2VQFB 3ND5A 4LC0A 2PUDA 1IXZA 2QGAB 1SVSA 3GJ5A 5I9MA 5KNBD 1NW6A 3KJFA 3E9NA 5J2TA 1AO3A 1H8ED 1CDDA 1I4OA 3LHKA 4C3ZA 4NJMA 4ZGBA 3N0WA 5IWCA 3QVGA 1I4EB 4TN5A 3RRYA 3I53A 1JJBA 4J3FA 4QU0A 3ZWDA 5DYNA 1T8UA 2AMJA 4D96A 4DV0B 2XVMA 3ICVA 4NLEA 4MW5A 1L3CA 1XCOA 3U13A 4G5RA 5A05A 3UG7A 2G4LA 4D99A 5FV4A 5A4KA 3L0YA 4PG6A 3DLTA 3BHMA 4OI4A 2ZYVX 3SKVA 5IM4F 2FAXA 1JFTA 4GBED 4CMGA 3GOHA 2NU7B 4W7SA 3BWMA 5AUOB 3EIFA 4TS4A 3HKBA 2Y4NA 3A4VA 1AKMA 2JCXA 3C74A 4RELA 4XX0B 2GLTA 1LLDA 5FLYA 4YUYA 2V7UA 3BEOA 3EW9A 4NHEA 2IFTA 4AWXA 1QR6A 1XTJA 1GR1A 1DDGA 1Z36A 2JHCA 3DBHA 3GWGA 4MVWA 4RK7A 3UJ3X 3WBKA 1X7WA 3HZOA 1Z5NA 1BH2A 1JG6A 2FZWA 4L0DA 1UKCA 2AC2A 2PUBA 3E9QA 2OOKA 4DV5B 3U6KA 3WMWA 4K9DA 1P6QA 2Q1WA 4LISA 4YK7A 1IJEA 3HE3A 3WMRA 5BVGB 4UARA 5I48A 1EVLA 2AH5A 2KE5A 3CZMA 4TM8A 4U00A 3USES 3A4IA 4MPJA 1VLQA 2WLTA 2OZEA 1ST3A 1YQEA 4I1SA 2BCGY 3AR9A 3FF1A 3G8CA 5GM1A 2XNSA 5C1IA 3GIWA 3NVMB 3TLCA 2ZSUA 1N0HA 1DCKA 1RE5A 1Q7GA 1N75A 1WDMA 3B78A 4UBNA 3SHTA 4BNUA 3JQBA 3F0TA 3OMWA 1N2IA 3L6BA 3OOJA 3QVVA 1I7NA 4FZVA 4J4BA 3ZI0A 4RULA 2AQ8A 4AF7A 4EY3A 4FIZA 5E4YA 2W2NA 5CK5A 1SOUA 2E48A 4JMLA 4A8HA 2VCYA 2Q3FA 2IBSA 2P9CA 4GBMA 4IQFA 3EDRA 4I1UA 3OJ0A 2HJHA 4IIGA 4XH9B 2VJQA 4IQ8A 3OCYA 1S02A 5K0NA 3RIYA 5IDWA 1EQ2A 2WKRA 3KPYA 1LNSA 1P7VA 3SEQA 5AFSA 5HDBB 4ND7A 2CUNA 3CH6A 3O4RA 2WMOB 2QLJA 3KXIA 2B1QA 4MROA 1DKOA 1BHQ1 1W52X 1ZXXA 2VDNB 3A1CA 3DB1A 5G1PA 4D74A 1GCAA 1XZGA 1JP7A 1DC7A 1HO3A 2NO6A 3BHNA 4RDCA 4BRUA 4XYMA 1YBFA 4R1PA 1QE3A 3JW8A 4DR1B 3WISA 1VSBA 1ADYA 2COUA 3ICCA 3F47A 1L4HA 1P44A 5T4EA 3MT7A 3PZBA 2CHFA 3GMIA 1ZN2A 1EE9A 4F5YA 1EESA 4JJGA 3KQSA 2BDTA 1AHNA 1DUSA 1BJRE 2XV1A 3EFOB 2I4IA 3L7OA 2V54A 2FMUA 1C1XA 4JH0A 3WV4A 3ZIDA 1X38A 4MMZB 4WXEA 2WQ7A 1OGYA 2X41A 2KI5A 3QKRA 4RESA 1FQJA 2IV2X 2F4NA 4XFJA 3I64A 1Y6RA 4JFAA 1VYUA 1THTA 4EG6A 4DIKA 3GVHA 4KDEA 2BZGA 1IB0A 1A9QA 2P6OA 4G5FA 2EBHX 4RK6A 3AM4A 3CCFA 3D31A 5CT8A 2P3SA 1ZL0A 4HBZA 3WWZA 4HN4B 2EU8A 2AG8A 3E7XA 3V4RA 4IHJF 3CZ4A 1U6JA 3H9EO 1G20B 3RS7A 5CHYA 2Z1MA 3UVEA 3WNQA 4OV6B 6AT1A 3JZIA 1ZSVA 3WLAA 1Z7WA 2RAVA 4MI1A 4PW0A 1YZLA 2MOKA 2C2YA 2FRDA 4D9JA 1YKSA 1CE8A 1UJ4A 3H5IA 5CM2Z 4GZ6A 4IZ6A 2GKOA 1KYVA 3F3SA 3JD0A 3BCSA 3K73O 4IMIB 4JYPA 4ENQA 3EVAA 1FA9A 4TKUA 2ZS9A 2OT3B 4LVOA 3THYA 4XCQA 1MO3A 2AJLI 2QG9A 5D51S 4DJEC 3FWKA 1SHTX 3I1FA 2QDXA 1NNLA 4G97A 2PV0A 5EL0A 4N0DA 4YJHB 4D0RA 2JVKA 3PXBA 4DMUB 8AT1A 3KXDA 4YI5A 4IJ5A 4A8JB 1I3CA 3I9V6 3C3CA 4HRYA 4O25A 4KFTA 5LP6B 3MWGA 1UZAA 4AG5A 4CKWA 1F60A 2DHRA 3PA8A 2DFNA 5CVVA 4YBZA 2BGLA 3A31A 1G291 5IK2A 3U4DA 3GCZA 3O0DA 1UUFA 3A4YA 3T9CA 1O2DA 3H18A 2HUNA 3MLAA 2GEBA 1FYEA 2EFYA 3AESB 3GFSA 2GZ2A 3RTAA 2QV7A 1KE1A 3AEQA 1XJCA 2OBYA 1E2EA 2X1VA 3PIDA 3L4BC 5B7GA 4ZCIA 2H31A 5EIBD 3TM4A 3WE7A 1UBEA 3Q7PA 3CLUD 4Z1MA 5C2JB 2FW7A 1L7AA 1TQ6A 2JGDA 2JVJA 4GQIA 1E5DA 1CKEA 3DO8A 1D1SA 1NVWQ 1XMJA 2ERXA 2JBWA 4MVXA 5FFNA 3ZTWA 5I3CA 1TK9A 3BRSA 3WMFA 3P4UA 3KJQA 5HCIA 1EK6A 2PGIA 3M81A 1BFKA 1E4VA 4AO7A 3N2NA 3DJFA 4HLDA 4KWIA 1PWXA 3AL3A 4RFSA 4PPQA 1G9TA 3SJBA 3GR6A 1L6RA 4TSFD 1IL0A 5T5QA 4DDHA 4J43A 3AIOA 4JZKA 2B8TA 2NN3C 1EWRA 4I4TB 1G19A 2Q9CA 4YRAA 2HH9A 2QT1A 3HXTA 4II3A 1HQCA 4ROTA 5E95A 1I13A 4WLOA 1TOAA 4DUYB 1XEWX 2IWHA 4BLQA 2ILTA 3DTVB 1I2CA 4Y9UA 4CZ2A 4NABA 5IEJA 2PSHA 4UZEA 2Q0XA 3S44A 2R3SA 2COKA 3DF7A 3NRCA 2FPSA 2Y05A 3WWEA 3KAPA 1QUFA 4ITUA 6REQA 3L0DA 1KPHA 1ND5A 4HB4A 1E8DA 2DBRA 1NR1A 2X6TA 2NU8A 4BMNA 2ZJ2A 2BJWA 4QUEA 1Y3AA 1RQRA 3EXG2 4CQMA 1FUYB 1X0VA 2GCOB 1HE3A 2XTAA 3KQVA 2O06A 3TD9A 5IULC 4ETIA 2ZJZA 1BE8A 2PSEA 1OA1A 3QOFA 4B84A 1GKYA 1C9MA 1I2AA 2H17A 4QQ8A 4HNHA 2RAUA 3MSXA 5ITWA 4ZTUB 4US0R 1GM5A 4RLQA 2P7HA 4I6GA 1QP4A 1RI5A 4L9SA 3STTA 4DV3B 1P39A 1QFYA 2CKMA 1QGUA 3OQVA 4AJ4A 3DLBA 1LRKA 3C15C 2Q3BA 3ZE2B 4X62B 1X8KA 3DMDA 3IQZA 4HEQA 4LBYA 2PWZA 4QECA 4FLMA 5B1IA 5B12A 4MKRA 4H15A 1R4AA 2PYIA 1ISRA 3KT6A 2C5GA 3HDGA 1PS8A 2HLDD 1J42A 4M0DA 3T99A 4ILKA 5IS2A 3HACA 1XVAA 4HQFA 5GJWC 3PRKE 2NOAA 3FYUB 3N86A 3RTDA 1MR3F 4B6GA 3SKYA 5KSYA 2XUKA 4OBBA 1XZHA 5AVJA 4GHWA 2R44A 3O2JA 4MKXA 3V34A 3DTNA 5HQ3B 4BL5A 5IUKC 2YJ5A 2KBEA 3A0UA 4GPAA 2AFIE 3PGLA 4PHTA 3ZZNA 2GLXA 1WW2A 3CIOA 4MS3B 3PNBA 1LSJA 3SHQA 1M8FA 4O4IA 1N0UA 1Z6YA 4WCFA 4YFVA 3QJ5A 1XBTA 3L05A 3O2QB 2C2GA 3L8GA 2BAGA 2FMHA 3ENKA 3KKNA 1T3ZA 4DBLC 2ZJFA 2XUPA 4C9BA 5EMLA 2WAMA 4ZAXA 3O82A 4B17A 3MD0A 5CW1A 1S2LA 3NHFA 3AI7A 3MTBA 4O4HF 4HDKA 1XMIA 2CDNA 2X40A 5CCXA 1HXHA 4LE0A 2F4VB 1WQ3A 2X5XA 3ES9A 5A4MS 3HRHA 3UAGA 2AJTA 2ZJ1A 4G1CA 3UT5B 3DKIA 4OMUA 1XV5A 1QPBA 1KQOA 4IDCA 1W8DA 4KI7A 4MPDA 1ISIA 4CXMA 2XEDA 1NRWA 421PA 4F04A 3AUUA 2G4VA 2AJ8A 3TNYA 9ABPA 2CUKA 3UKJA 5AUQA 3HCPA 2GTPA 3CX7A 1A2KC 4YFYA 3ND9A 2IVZA 4MAAA 4YCBA 3IKLA 1YH3A 1WXDA 1DIOB 1W44A 5AVYA 4PO8A 1I3LA 1TM4E 2VZEA 1P2GA 3ILHA 5SZHB 1RVDA 1PEDA 2ZU6A 1VC2A 4CGZA 4GI2A 4K9QA