2JARA

Crystal structure of d12n variant of mouse cytosolic 5'(3')- deoxyribonucleotidase (cdn) in complex with deoxyuridine 5'- monophosphate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
196
structure length
196
Chain Sequence
KRPVRVLVNMDGVLADFESGLLQGFRRRFPEEPHVPLEQRRGFLANEQYGALRPDLAEKVASVYESPGFFLNLEPIPGALDALREMNDMKDTEVFICTTPLLKYDHCVGEKYRWVEQNLGPEFVERIILTRDKTVVMGDLLIDDKDNIQGLEETPSWEHILFTCCHNQHLALPPTRRRLLSWSDNWRGIIESKRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-DEOXYRIBONUCLEOTIDASE
publication title Crystal Structures of Human and Murine Deoxyribonucleotidases: Insights Into Recognition of Substrates and Nucleotide Analogues.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 72
structure length 196
sequence length 196
ec nomenclature ec 3.1.3.-:
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 2jarA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2jarA01
3MC1A 1J8DA 1JUDA 2Q4TA 3QUQA 5AM3A 3OCWA 3ZWKA 2Q5EA 3OCUA 3EF1A 5ALPA 4KX3A 1RLMA 1O03A 2BY4A 4DW8A 2HO4A 3R9KA 4ZEVA 2EATA 1RQNA 1YDFA 3ESRA 5ALTA 4DWOA 2G08A 4UU1A 3AR6A 4BNDA 5AI9A 2W4MA 1XP5A 5AI8A 3ZW7A 3FM9A 4Y2UA 5AW6A 5AM2A 1S2OA 2WF7A 5AKXA 4EX6A 4GXTA 3UMBA 4J03A 3ZVLA 3ZX4A 1ZD2P 3I1YA 3IB6A 4XE5A 3L1VA 3WKBA 5A3RA 4PNHA 1Y8AA 4BBJA 4OHFA 5AI5A 5ALXA 1RMQA 2PR7A 3W5CA 3HYCA 3BWVA 1RLOA 1LVHA 3B9RA 3DNPA 1RLTA 3U7HB 3W5BA 2ZXEA 1TJ5A 5AK6A 3WKCA 3PCTA 2CFRA 4CNQA 2HF7A 2RB5A 3A1DA 5ALNA 5ALSA 5AM1A 1O08A 2P27A 2OA0A 2D2VA 2FUEA 3EF0A 4BKMA 4UMDA 2O9JA 4QQFA 1K1EA 4BEVA 4Y2VA 4C4SA 5AVRA 4QJBA 1RRCA 2HCFA 5AW5A 1L8LA 1SU4A 2OBBA 2B30A 3P96A 2WHEA 3IRUA 1T5TA 3NALA 3W5DA 3B9BA 5AKKA 3KDPA 3E81A 2NYVA 5ALEA 3RF6A 2B0CA 5AK3A 2MSNA 4YCLA 4UMFA 1RDFA 5ALFA 3M1YA 1YV9A 4ZEWA 4FFDA 2EAUA 3L0CA 3B8EA 3WKEA 5AW1A 4JB3A 1L7NA 1RPZA 5IT4A 3L5KA 1ZS9A 3FPBA 2YJ5A 2W11A 1EK1A 1Z4OA 2G06A 2IOFA 4G9BA 3KD3A 3QUBA 3F9RA 4YCNA 3I76A 3ZWDA 4G63A 3MMZA 2YBDA 4DCCA 2NO5A 5AVZA 1Z5GA 2ZBGA 2B8EA 3I28A 2B1RA 4DFDA 3W5AA 3FZQA 3WGUA 3QGMA 4UATA 3QX7A 2I33A 1ZJJA 3PGVA 2I54A 1WVIA 2ZBFA 4C4RA 3L8HA 2P11A 3FVVA 1T5SA 2AUTA 4UMVA 2YMLA 2AH5A 3PDWA 3L8FA 1EK2A 2ODAA 2BDUA 4E88A 4B6JA 2G0AA 3ESQA 3N28A 2OYCA 4CF5A 5ALWA 4O8CA 2WF9A 2JAUA 2JAWA 2YMQA 3OTQA 3QU4A 1ZD4A 4EENA 3FPSA 2IOFK 5AKLA 4C4TA 5AVTA 2FPRA 2CN1A 2C8KA 2OM6A 5ALVA 5A3SA 1WZCA 2YJ3A 1QQ7A 4XPZA 4EZEA 1YMQA 3SKXA 3M9LA 1CR6A 3QUCA 3ZI4A 1CQZA 1L8OA 1RKQA 2R8YA 3NANA 3PGLA 2C88A 3SD7A 3QU2A 5ALKA 1IWOA 5AW9A 4J2TA 5ALRA 4HYTA 4L6AA 3ZX5A 3QNMA 5AVUA 1L7OA 2GFHA 3U26A 1ZRNA 2G1AA 2IYEA 5FP0A 3SF0A 4EEKA 4F72A 3KZXA 4EELA 2I7DA 1NNLA 3MPOA 1N8NA 4HGOA 2HEGA 3BA6A 3NRJA 3QYPA 1TJ3A 5ALIA 3E8MA 3WK5A 5AW2A 2R8XA 2P69A 4KYTA 1XVIA 3AR5A 1XPJA 2YMMA 3QLEA 4AS2A 4AS3A 1TJ4A 4EX7A 3ZTWA 4UU0A 3ZTYA 1QYIA 3KOOA 1Q91A 2BDEA 3DDHA 4JDPA 1QQ6A 1Z4JA 1AQ6A 2IOHA 1L7PA 2PKEA 3D6JA 4FYPA 2JGAA 5AKHA 3L8EA 4BEWA 4FE3A 4OD0A 3SMVA 2CFTA 3WK6A 5AW7A 4HAIA 4Y2SA 3A3YA 3QXGA 5ALUA 2C8LA 5ALQA 1YNSA 3EWIA 2R8ZA 1PW5A 1Z4PX 4I9GA 2FPUA 4Y2TA 1U2TA 3QUTA 4NAVA 2YMPA 2B8JA 3WK4A 1RQLA 2WFAA 1FEZA 5AKZA 2FDRA 3AR8A 3L0BA 5AHXA 2FI1A 4Y2PA 5ALMA 3GYGA 2G80A 4NABA 2R8EA 4UAUA 1L7MA 1QH9A 2HI0A 3ZVMA 4BYGA 3U7EB 5AW3A 4YGYA 2HOQA 3KBBA 3TLMA 2JAOA 4BX0A 3WK9A 3U13A 1YJ5A 2I34A 2I6XA 4YIHA 1RKVA 2GMWA 3WGVA 3WKAA 2ZBEA 1T9ZA 2WM8A 3WKDA 3UMCA 5AIAA 3ET5A 2B1QA 2FUCA 5ALJA 4IG4A 4RESA 3ED5A 4MWOA 4KNWA 2P9JA 2ZOSA 5AICA 5ALGA 3SHQA 2DQSA 4NFLA 5JJBA 1N9KA 4NWIA 5AKGA 1Z4KA 4CE6A 2G09A 5T41A 3SLRA 2C4NA 2ZG6A 4HGPA 5AVSA 3NIWA 5AK5A 5AVVA 1U02A 2FEAA 2PQ0A 1Z5UA 3R09A 4OFZA 3UMGA 5AVYA 1LTQA 2YFYA 5AKEA 3KC2A 3NAMA 5AVXA 5IT0A 3L7YA 1ZOLA 2IA5A 1X42A 3AR4A 1U7OA 2ZBDA 3AR9A 3NUQA 5AM0A 4BX3A 5AVQA 5AW8A 3DV9A 5AM4A 3L1UA 3QU7A 1F5SA 2C9MA 2HDOA 5ALHA 3S6JA 3N5KA 2RARA 5AVWA 3DAOA 3WK8A 3N07A 4H1WA 1Z4QA 1RKUA 2YY6A 5AK4A 4OCZA 4UARA 3HLTA 5AI0A 5AW4A 4Y3UA 2FPWA 3IJ5A 3I6BA 4CF3A 2FPXA 1ZRMA 1NF2A 2NO4A 3N1UA 4HGNA 3ZU6A 4XQ0A 1ZD3A 3VAYA 4Y2RA 4L6CA 1RC8A 2G07A 5AIBA 3R4CA 1SWVA 4GIBA 1KYTA 3A1CA 3ET4A 1RMTA 1TA0A 3NASA 4Y2JA 2WF8A 2YJ6A 1J97A 1Z4MA 3A1EA 4HGRA 1TE2A 3OCYA 3J7TA 4UM5A 3ONNA 2Q4RA 5AI4A 3K1ZA 2O2XA 5ALLA 1Q92A 1MH9A 5E0OA 3AR2A 1VFPA 1U2SA 4AP9A 2YN4A 4Y2YA 3WK7A 2I55A 4NV0A 4UAVA 4CF4A 4IFTA 3OCZA 1NRWA 5AI6A 3ZUPA 3CZ4A 3AR7A 5AKJA 2AGVA 3U7GA 5AKIA 3OPXA 1S8OA 5AKYA 5IS2A 5ALYA 4HGQA 5ALOA 1WR8A 1ZD5A 2AMYA 2HSZA 2RBKA 3AR3A 5A3QA 3E58A 1YS9A 4BNDB 3ZVNA 3MN1A 4RETA 2WF6A 5ALZA 1QQ5A 5ALDA 4F71A 2X4DA 2B82A 4I9FA 2VKQA 4UW9A 1Z4NA 4Y2QA 4Y2XA 2GO7A 2FPSA 1WPGA 1L6RA 4YCMA 3U7FB 1VJRA 2EARA 4MUMA 1VJ5A 3FGOA 4BX2A 4UASA 3L0YA 3RFUA 2W43A 1Z4LA 2WF5A 4UMEA 2QYHA 1U7PA 4YH1A 2JARA 3QU5A 2HHLA 1SWWA 4KNVA 3U19A 2MU1A 5AM5A 4KN8A 2GHTA 3OCXA 2HX1A 2YJ4A 4YIKA 5AESA 5AW0A 4L57A 4UM7A 2GHQA 2HF2A 2RAVA 4XOUA 4ZEXA 3E84A 3EPRA 3SKYA 3UM9A 3L8GA 3CNHA 1Z88A 2QLTA 3QU9A 4KX5A 3OCVA 1Z4IA 3N8GA 1RMYA 2CFSA
chains in the Genus database with same CATH superfamily
4RMGA 5FXMA 1E1KA 4LJYA 5BORA 1DG3A 2MSKA 1GD1O 2VPPA 4KLNA 4D8XA 3WLIA 4HNVA 5T4BA 5BWOA 3BRCA 3M6LA 4TTSA 1YULA 2AMVA 3QZUA 4M83A 1RLMA 3B52X 1NVTA 2C2OA 3ZNNA 4F3NA 5BVGA 3V6LA 4ARZB 3M34A 3IERA 1DIAA 2EATA 1C4WA 5DH9A 4C6TB 5ALTA 4UZFA 2VP9A 2BVNA 4GVLA 3TPCA 2PUJA 1PSWA 1EAMA 1OHHD 4X92A 2Z9BA 2B7LA 3B89A 1MOPA 2W4MA 1A4XA 3EGCA 1IRXA 4JLSA 1MNAA 4V0RA 3TRDA 3FI9A 3VR4A 3BDAA 3UK1A 2I6GA 3GFSA 3PLNA 3LX5A 4DA6A 2PT5A 5AM2A 4MQ5A 2E4AA 2WF7A 4MV0A 2ZETA 4OA8A 4CLEA 2JLYA 1FDIA 3KQLA 4KO4S 1VE1A 2QOEA 2REQA 4G4GA 4Y67A 1D1PA 4BMDA 2VXCA 2PPVA 4BJ6A 3TINA 4PNHA 3FDIA 3R6DA 2XX3A 1P2BA 4FHZA 4UC0A 4OHFA 4YUWA 1T2CA 4IGFA 4BLSA 4HGYA 3GXOA 2V4UA 4M54A 3AF5A 5A6SA 2XT6A 3KT3A 5CA0B 2OFWA 2CFOA 4EPVA 1GIAA 4QBTA 2PL1A 2PR7A 3W06A 1RJDA 3R5XA 4DZTA 821PA 1L4KA 4MSUA 2ENUA 3AVOA 1XQ1A 1KQGA 5BQOA 3KB2A 2R65A 2JEYA 2O8VA 2D1TA 1KY2A 4IS2A 2W2PA 3PSAA 1ISGA 2P9CA 4F21A 3QY0A 4TKLA 1E60A 4CL3A 5L4SA 3GZNA 2YH2A 1SBIA 1CJCA 2AJDA 3AC0A 1O6BA 2GILA 3PE4A 2CSUA 1TM5E 4IX9A 3K5WA 4ZIRA 2IYRA 2VXYA 4A8JB 2D2VA 3ZS8A 5JT1A 3I6MA 3OKAA 1B43A 3S2UA 3FMPB 4WZAE 1U3DA 4J0HA 1EFLA 2IHZA 2R9VA 3LFTA 3FCYA 3Q0EA 2TMGA 4S1WA 4WVLA 3ZDDA 1A0OA 2QTTA 3FYTA 2HCFA 4XPIB 4DL9A 2VYVD 3BREA 4N7BA 1W2HA 2WZQA 5BN1A 1E3EA 2NZXA 2UV8A 3UA4A 1PJBA 3ZK8A 2PL5A 5DM4A 2PYDA 3L7CA 3WZLA 1EWYA 1WHTB 3NTQA 4DIUA 1A97A 4DLAA 2ADMA 1GTL1 2AG6A 2QX7A 2UYYA 2ZYWX 2ODWA 3A6ZA 2VSFA 3DMFA 4OXNA 2ACKA 5C1DA 2HJHA 2OEPA 1CRQA 1IM2A 3AXSA 5FBHA 1A8HA 2F8LA 2JLQA 1VMDA 1LJLA 4FFOA 1OTXA 2NW6A 4TMWA 4YJ2A 4DABA 3PJGA 1JSCA 3SWWA 1XKQA 4G5XA 3RUIA 3WKEA 4QJ4A 1LF0A 4HX2A 4FX2A 1SKQA 3D8UA 4UHCA 1GTVA 5EIHA 1R7RA 1VYTA 3U81A 3OZCA 3HA7A 4EW6A 4II7A 1ZBDA 5A7FA 4I66A 2PANA 3I5AA 4OK5A 5GJWC 3BJZA 4LW8A 4DOMA 4LMAA 4W1RA 2PL3A 2PZFA 3OO0A 3KZKA 1CUBA 1U2GC 2B5WA 2IEAA 2D7JA 3UK2A 1W9HA 4L4RA 2SNIE 2AHRA 4GKVA 3VRHA 3AVTA 3ROXA 5GOZA 1EDEA 2O3JA 1P17A 2FMIA 1LV7A 1II0A 4KUHA 3IUJA 4AZ0B 2O0HA 1JBQA 4DEVA 4QGGA 3JQRA 3LJKA 5HE8A 1S7GA 4GOKA 3GFPA 1M6VB 4MS1B 1CFZA 1C3OA 4DV1B 3ER8A 3GVPA 4IDQA 3N0WA 1E62A 1OF1A 1OSNA 1ZLYA 1X1SA 4GQIA 2AUTA 1RCUA 5F5NA 1HQDA 1X8KA 3PX2A 1V16B 4GPTA 4HFRA 2Q41A 4WXYB 2JJYA 2VYVA 3L8FA 4KFCA 4OQFA 1S3IA 5E9QA 3I2IA 3OX3A 1FTNA 2FXIA 2Q3JA 3ESXA 1AKNA 1T1IA 2ACEA 4B45A 3E1KA 5TS2A 3KAPA 1B16A 2G0AA 4P8RA 3TAHA 3ADCA 2Q6VA 1U98A 4OQ4A 2QRVB 2F43A 3G7SA 4XGIA 4CIDA 1KDTA 1DCNA 1O3YA 2WJJA 3A7EA 3JQAD 2GXAA 3DOJA 2JAWA 3OTQA 5KWIA 4FBGA 4EI9A 3VO8A 2G4VA 1KFCB 3A28A 2YN2A 3QEJA 3TQRA 1A77A 1P1FA 2OENG 4I4CA 5DU2A 2X8JA 4E31A 3PWZA 4HAZA 4OX9Y 4BNXA 2JI8A 5DLEA 3WGTA 4L75A 1T8RA 2I1WA 1ZN9A 2QD4A 2WQ7A 1A8PA 1HE8B 1K2WA 3DL0A 3JWEA 2DVMA 3UATA 2VPXA 2ZSHA 5CD1A 5BMVA 2Y93A 2CUKA 3LCRA 4FMBB 1WXEA 4YMVA 5KNBH 1Q7CA 1RAAA 4F96A 1CB7A 1E2UA 3CZAA 3FFAA 4GVXA 4IKEA 1GPWB 2J3QA 4RWEA 4M88A 1HMYA 2AL7A 2FW1A 2G70A 3O92A 4JB0A 3DTNA 2L0XA 4FCTA 4W1QA 1R9NA 4LGMA 4I3HA 4AD8A 5LBTA 3CVYA 2PZAA 1QZ3A 5KOIA 3EOBI 4OGWA 2X86A 1Z83A 4TWBA 4LVNA 4LXIA 3JRXA 4LSZA 4FTWA 5LN1A 2FEWB 2C96A 2EKQA 4JBIA 2Q99A 1UP4A 4PVCA 4B40A 4UBIA 4OQDA 1JHPA 5HGXA 5HJEA 1GGHA 1SFRA 2OMEA 1IOVA 3DQPA 4RH0A 2H5LA 1M0WA 1IN1A 4KQ1A 3QBPA 4IFEA 1DC6A 1QONA 4LZJA 3WYGA 2K5UA 1TI7A 3NWEA 3CVVA 5GPBA 3QPCA 2G1PA 3BA6A 2YUIA 1WSWA 3TCKA 1YIOA 3FSRA 3UJ9A 3ZXSA 2R3SA 3H99A 1CUYA 1NVKA 4IM7A 3CW8X 1KDZA 1E2BA 4ADLA 2DTEA 3GT4A 3QFFA 3QLVC 5REQB 2ZRJA 5K0TA 2O7SA 5KYXA 1ZAKA 2XUZA 5LKRA 3LPMA 1G0OA 2JH8A 1KDYA 5AVJA 5BQ5A 4M9SA 3LYUA 3GFQA 3I1FA 1YB4A 3PRKE 5TQ0A 3RFVA 1QXSA 5ERGB 4R2KA 4G0XA 1CR2A 3B6EA 1I5RA 2V59A 4GLOA 4R8RA 4GI2A 4RK1A 3O8NA 1L7PA 3HKDB 4Q9HA 3WLKX 4BB9A 3FJ1A 4BJHB 4JH0A 3CYFA 4CQNA 1P61B 1I9GA 2JD1A 3D7MA 3FCAA 3NIFB 3X2FA 2EDAA 2JBHA 4JUCA 3FH0A 4QUBA 1JIXA 3T3DA 2V6JA 2ZUCA 4ARZA 1TK9A 2I4LA 2GLTA 3EYWA 1ZA1A 3I2HA 4CMIB 4C6TA 3FTPA 1CERA 3HSYA 1KJZA 3K09C 4BLRA 1GPBA 3UHFA 3QMVA 4WKOA 3HUDA 1HQKA 2QGZA 1E0JA 1OYWA 3KVNA 5IXJA 2QVLA 4UXHA 2R4UA 3CJRA 3F8TA 2ZFUA 3K0AB 4INJA 1N9ZA 2HRQA 3OIUA 5IBCA 2GPAA 4OQEA 2BOVA 2FPUA 2JFHA 1LZKA 3IEXA 2J5QA 1MB4A 1XVUA 2ZJFA 1I2ZA 4MQ6A 4OQQA 4QGHA 4YRBA 1PWZA 5IH7A 1P0FA 1T9GR 1ODTC 4F4IA 3UC9A 1MX1A 4G0UA 1JG6A 1QJCA 1W4AA 1O94C 1XLWA 4KXMA 2NSLA 3KPWA 4L4ZA 5D3ZA 3ZE6A 1BHSA 1K98A 1HFJA 3SBDA 2IFTA 1LDYA 1BKDR 1JS1X 4KXWA 5CA0A 2XOXA 1XJ5A 1UWCA 3WDMA 5HJ2A 3KJIA 3ZGXA 3TJRA 1HWYA 1NNSA 2B4YA 3L1KA 5IVHA 5KNCH 3GHYA 2HI0A 1CUXA 3CPEA 1QF6A 4UQLA 2H07A 3O8RA 1TTQB 3WDSA 1SCJA 3H5WA 3IKVA 1MOZA 3RSZA 3X1MA 1A4RA 4C6SA 1K86A 4NCXA 4N3CA 1L8QA 1DKQA 4L4SA 4XRRA 4LKOA 2JAOA 3ENNA 4XVUA 1LU9A 3TZ6A 1JI3A 3KB6A 5KNLA 4CEHB 1RD4A 4E3ZA 3T1HB 2I6XA 3AF1A 4FE7A 4EHJA 2XKAA 1TT5B 1AN9A 4R31A 2NP6A 3MK31 2BBOA 3L04A 3GBPA 1P31A 3A9VA 1FU8A 1HE2A 2HRDA 2IX3A 4F3RA 3SN6A 1JU4A 4GXQA 1RXWA 4XPIA 5C3UA 2PM8A 4QODA 2AJ8A 3CG0A 1L5FA 5K3AA 5LDGA 3WL7A 3VVLA 3DZFA 3HCWA 3QVXA 2R5NA 4PFSA 5B1EA 4E0BA 1ZISA 1J56A 1WHTA 2Q4EA 4NARA 2RJOA 1HOXA 1NQWA 4EEIA 4NE7A 2P1DA 4O2AB 5JBNA 3T41A 2EW1A 3OTOB 4JVNA 3P0EA 4OV6B 1NT2A 2ZROA 5A4IS 3OHPA 1Z2AA 4HAWA 1W73A 2NO0A 3H2IA 2VTEA 3UC5A 3MTBA 2OCLA 3HR7A 1JX6A 3KKZA 4HWRA 5C0OE 2AEMA 4D57A 2JJQA 3QLTA 3UV7A 1ZN8A 1X7HA 1UJMA 3GB9A 2GYWA 3NWPA 4A8TA 3UAOA 4RGYA 3NIWA 3JQBA 4ZTUB 4E2FA 1T91A 3H1AA 2BE7A 2I8AA 3GPIA 2QXYA 3MMNA 4QFDA 1WP9A 4TXJA 4IGKA 3QI7A 3GLHE 1YZKA 3FKSD 3KUKA 5FI5A 3DL7A 3QHQA 2BR4A 2QR3A 4JLJA 1Q1EA 3O38A 5LCXA 1RI1A 4INAA 4AUNA 3MTIA 4O4JF 3VTAA 4FFMA 1K6XA 3I52A 1DDOA 1O6FA 4ND5A 3D1LA 3A1NA 3GUHA 3X1KA 1F60A 1TKCA 2POCA 4GOMD 5EE0A 2J0VA 3FUXA 5H5JA 4BAUA 2NNLD 1UXJA 4WCDA 4CM3A 4RF2A 4D41A 4D8UA 3HDVA 1CU1A 1F5SA 1N5DA 1PJ3A 3BG5A 4QBFA 1XPRA 3REGA 3EZGA 3FTDA 3L8CA 1R6AA 2HBRA 4B2YA 4LJ6A 4AZ0A 1AUXA 3QFTA 3AB8A 4ZVLA 4EJ2A 1VQ1A 5D5PA 2XQIA 5CITA 1U0NA 1ZNZA 2CBZA 1PJ2A 2IZ7A 1M6VA 4MS1A 4RE6A 4BKQA 2FMXA 4XD2A 4UEQA 5AK4A 1UK7A 2DXIA 3GDOA 4LFAB 2JGMA 2H2WA 2CBXA 3HLTA 2MYTA 5DNEA 1HLFA 4Y3UA 2OCIA 2X9GA 1M2EA 1KO5A 1NPDA 1V16A 2CD7A 1DAIA 1U3TA 2E21A 2N3ZA 2OXCA 2ZT5A 1Q1BA 3GEDA 3HB5X 3RE1A 3AJDA 3ZIAD 4DIBA 1FIUA 1TZJA 3L7JA 5J4LA 2RKBA 3KALA 1XCGB 1N2EA 4Z99A 3FYUC 4U63A 3U3MA 1NJ2A 1O0SA 3WGNA 4A0RA 1NN0A 1ZM2A 4EVSA 1K7SN 5G0VA 3LW8A 2QRVA 1HYEA 2D4HA 3QMWA 3VKUA 3ZCVA 1IH8A 2PX3A 3BD9A 3HRKA 3PUHA 2Q8PA 4G0NA 1VFNA 3OPMA 1LQTA 3I8SA 1E2IA 3R24A 4H7DA 3TZEA 3AUUA 2D4AA 3H9QA 3WB2A 1I4DD 4QM6A 1DIGA 4J0JA 2WF8A 4JP2A 1ORHA 1J97A 3H1TA 4IFIA 3OO1A 3OJWA 3QG5A 4TLAA 1C0KA 1P4JA 1OTHA 2IHUA 3H2BA 3FY4A 5KYVA 5FH9A 2GAFA 4HZUB 4GYWA 4RPCA 1AKMA 2K6GA 2R8OA 4QELA 1G1MA 1NE2A 3A10A 1F2UB 2BFDB 4MYDA 4PLHA 4WY8A 2BKUA 4LOJA 4EYQA 5JRJA 1PNRA 3R9XB 3FKSA 3NR2A 3SOZA 3TI7A 1YE5A 4Q3BA 1CJSA 1HV8A 3OA0A 3C39A 4MW1A 4ZCPA 4BCCA 3OUTA 2A3RA 4YRIA 2ZDQA 1DZIA 4AY3A 3NIBA 3WQRA 2HGSA 3D59A 4BNTA 4NHEA 3AL0C 2H9AA 3AI2A 1WPRA 3OQNA 2BV3A 1P4AA 1UQRA 3UKJA 5EIXA 1AGPA 1N57A 4YT8A 1XHEA 1YJ8A 3FNRA 2E85A 2WJPA 2LPMA 2IOQA 4UJ3A 2AGVA 1E2GA 1KEPA 2LV8A 2NUTB 3KOMA 1ECGA 5E6UB 1S8OA 2OGWA 4TXMA 4PLYA 3LDAA 1DJLA 3OM8A 3TCXB 3ETEA 3B2NA 2JIQA 4JJ6A 4URFA 3IBYA 2FZEA 1TA4A 1ISIA 1PKXA 3PS9A 4IIDA 2VSNA 3QBJA 3GUYA 1E4VA 4NH4A 3PRYA 4OEHA 2HF8A 5EKUA 1Z5ZA 5IAGA 1M54A 3H3JA 4EY3A 1SKMA 3VU1A 2X4DA 1UJ6A 3BS4A 4RQBA 3RAPR 5REQA 2A4KA 1PHPA 1WW3A 1PFUA 2NSHA 3ULKA 2R2GA 1DAGA 4CIBA 1EM6A 1LI5A 2H4WA 3NDRA 4H4EA 4BCDA 3HRHA 5LZ5A 3ASYA 3VDNB 2UUBB 3GGOA 3MW8A 1WPGA 3P5BA 1NXWA 1AA6A 1EJ6A 1M9NA 1GCUA 2XCIA 1Q6ZA 3G1WA 4TTRA 4J0FA 2QT9A 3HKDA 2DPLA 6REQB 3O1HB 5KQMA 5F3WB 1BCRB 2GN6A 1JQ5A 2OECA 3KKMA 1B8VA 4FYVA 1KPGA 2K2WA 1VGRA 4DIFA 1U0TA 3EAGA 5DWDA 2MU1A 2VBIA 3DLPX 3DOIA 4FYXA 1F4VA 1NC3A 2JH9A 4LJAA 2WI8A 5A2GA 5CEFA 2VPWA 4HKTA 2XXJA 1FYDA 1Q0PA 1Z06A 2REBA 3OCXA 2X7HA 2IYUA 5F33A 4CMIA 2BCEA 5CG1A 2G7MC 4O25A 2ZIGA 3Q1LA 4EOGA 4X90A 2O7QA 4UM7A 1GA6A 2GUWA 4ZEXA 4NMWA 3K0AA 3B9QA 5DCLA 1O8CA 1BXKA 4U7JA 4UREA 5CIQA 4KO1S 4BFZA 3BFXA 5FORA 3JQFC 1T2FA 1O1YA 3A32A 4OFXA 2VZ8A 4KWIA 1D6SA 1FYXA 3N6VA 1ZONA 1Y80A 4KX5A 4Q3DA 4UUBA 5FL7A 1JV2B 2X40A 1KBOA 3COZA 5KOJB 3CEJA 2UZ0A 3LM8A 4R83A 1Y8CA 4UZSA 4YAJA 3WMEA 5AM3A 5I01A 3R0JA 1QKKA 4N3NA 3GAAA 4M99A 1IQUA 1R12A 4FZRA 1E0KA 4KX3A 2QEQA 5DSZA 4B4UA 3BPSA 4TVSA 2VAVA 3ICCA 4I8DA 1OWLA 2Q27A 2QQEA 3TE7A 3PKZA 5IX8A 1RQ7A 1QVAA 3QPAA 2OCYC 2OCBA 3OWHA 1Y7PA 2XT0A 5LMZA 1AHNA 1Z0FA 3SAJA 1W1UA 2PQ6A 1CUCA 2ZRIA 3QE3A 1I1NA 4I81A 4CTOA 1ZC4A 5FPQA 3GPLA 4MPDA 4CEHA 1E69A 3CEHA 3T5CA 3WB0A 3H2GA 3LUCA 4JHLA 1F2VA 1E99A 3E2PA 2H2IA 1VOTA 3F7MA 3WA7A 2PV0A 1LDMA 1TT5A 4TXLA 4ZOLF 3I1YA 3RT7A 1CDEA 1SUBA 1ZFNA 4YT4A 3U5TA 1OXSC 4PV7A 3RVDA 4LNHA 5CNJA 2G40A 1BX3A 2HZBA 2EVWX 1NP3A 3PV0A 2IPLA 3KZCA 3GWGA 1FDWA 3HDYA 4UJ5A 3NM6B 3OQMA 5ERXA 1T0BA 4GM4A 3UHOA 1XQ6A 4DILA 2V97A 2I3ZA 4D9IA 1RHQA 5LBUA 3TSCA 2V5AA 3GLGE 3N8IA 4AK9A 5D84A 2P6UA 3IESA 4RVSA 3LY9A 4I5GA 3N2GB 4O2AA 3PCTA 3WWYA 1I5OA 3CCCA 5J59A 1VJDA 4JFRA 3VZRA 4TS1A 1EZ1A 1YZQA 1Z6QA 3EMKA 5J63A 5JI2E 1OXTA 2FKAA 2H11A 4P0QB 2PXCA 4BFWA 5JAHA 2XUPA 4NCAA 4DBZA 4BRWA 4P0TA 1VDKA 2I1LA 3NX4A 3O4RA 4PX5A 2HW8A 2F1IA 2YYAA 5L51A 2HV8A 1RRMA 1TYZA 1K4YA 3SSNA 4ERNA 2QGAB 1LTKA 1NIPA 3F2IA 3LOPA 1J0AA 3GR6A 3QW4B 1IUPA 1T3SA 1UMBB 3AK4A 4G0QA 1V41E 3K5PA 2QB5A 5LUBA 1TUBB 2DOKA 3L7BA 2HIMA 4S0ZA 1WB5A 4I5DA 3M82A 2WTAA 1MJHA 1TC2A 2O5RA 2RK6A 4TQGA 4C0KA 2G77B 2VHWA 5LWHA 5ITSA 1D07A 3OWOA 3ZWMA 1Z15A 2JCVA 3Q2IA 3COWA 3QX3A 1BN7A 5KMGA 2BN4A 5K3BA 2PSSA 3ESBA 4FB4A 4APBA 1TQHA 1Z36A 2X9LA 2BH2A 3B8EA 1E9BA 4NG4A 2YHUA 3A0UA 5DBIA 3TB4A 3RQIA 1KNQA 4NYMR 1JU3A 4L07A 1RPZA 7MHTA 1K7XB 1I14A 2SCUB 4B9EA 5AJXA 4CT0A 4YMIA 1JDBC 1HDGO 1O5IA 3CUSA 3DXZA 3H5AA 1QNFA 2QTLA 4B2PA 4UBNA 1W85B 5CM2Z 1A9SA 4ZA2A 4AL4A 4YCNA 2HMWA 1E2NA 2AFHE 2P9GA 2QVYX 2Z1NA 5DX0A 3QSYA 1H6CA 1BJRE 3IAUA 1X13A 2MIIA 2B99A 3LY8A 4PNZA 3KPVA 5JBQA 4URVR 5EGSA 5EJ6A 4PCAA 3T7DA 1H05A 1RXUA 2QE7D 5DT9A 1N32B 2B1RA 2HUNA 2J6HA 3CI0K 2CFCA 2FSIA 3FZQA 1H0SA 5EPEA 3UICA 4HNRA 3VR5D 2NO1A 1EXMA 1G8HA 4L50A 4M1OA 1T9AA 3O73A 2G6TA 1U7DA 3MT9A 4OYRA 1A1SA 2YIDA 3D4IA 4PGMA 3WRYA 2AE1A 4AO8A 1L5LA 4I6JA 1E5VA 3AZPA 1KAEA 1UXGA 3Q3IA 3WBJA 3TQCA 2C4TA 2QMUA 3G9ZA 2Q49A 2WJIA 4HZUA 4L78A 4DT1B 1K7CA 1ZUIA 1F2UA 2BFDA 2QYSA 5JAIA 3SJBA 4BO5A 1OLUB 2RAPA 1CJBA 4P38A 4TKMA 2VOJA 4KPUB 1ICIA 4ND1A 1IATA 2JFYA 4D79A 1UK8A 4E14A 4QHSA 3N28A 5LD2B 2COUA 3OZFA 1DV1A 4PO1A 2FQ1A 3M70A 3VKWA 3L7LA 1USVA 3LQ4A 4IW3B 3QU4A 4F4JA 3SQWA 4O4HA 4G07A 4BNNA 3TL3A 2NUTA 4MW0A 2KM1A 1NMZA 1PBNA 4IH4A 5E6UA 4C3ZA 1JEEA 2BE9A 2GJAA 5EVJA 3OQ1A 1EQ2A 4KGDA 1QH8B 5EZSA 2Y0PA 3TLZA 2X13A 4I19A 4L51A 4PPQA 2NLOA 2WKSA 3TSAA 1IVYA 4FM9A 3VKGA 1I4TD 3V4RA 2Z6VA 3NBFA 1H1TA 4RYDA 4RMNA 5AJTA 2DR3A 2NXCA 2FR0A 3M3HA 4DV0B 1QCCA 1UPCA 3OY7A 1NBWB 1KDVA 2R0QC 2NNWB 1AIPA 2JAPA 3O8QB 1DE0A 4LVCA 3GELA 3O6VA 1M6HA 4IOJA 3TKAA 3AW9A 4TMYA 2C88A 5EVCA 2FV8A 3GJZA 1THGA 2G1JA 3PITA 3CY6A 3A6EA 3MOGA 1XAHA 1KE1A 3MJCA 3V7UA 3IKJA 4HRXA 4YV7A 2QE7A 1QUEA 1Y82A 3HL4A 4PIPA 6REQA 3KSZO 1IK6A 3VR5A 1ZHHA 1BCRA 2BMJA 5HIIA 2FE1A 3Q9UA 1S2IA 3BC1A 5CW1A 3CISA 2G1AA 3HB9A 4RPGA 3F7NA 2RIPA 4XVRA 1UXIA 3MPOA 1N8NA 4XIIA 4AECA 1QIKA 2V7WA 2VAXA 4LA4A 4MX8A 5JSKA 5LQCA 1Z5NA 3HTXA 3WK5A 4ZODA 4B79A 2ZI5A 2GBGA 1IRIA 2WM3A 3IAHA 5KHOC 1Z0KA 2FWIA 2E9SA 3JYPA 3LECA 3G1UA 4DARA 1RYBA 3JY6A 2NTNA 3C5CA 2B4RO 2C3MA 4QG3A 4UU0A 3D7LA 2G5PA 1XTIA 3OJLA 3TQFA 1G9TA 2XNKA 5JYBA 4Z2YA 4G4IA 4Q1AA 5KOJA 5BOVA 1J24A 1WHSA 3D6JA 3GZJA 3L7AA 3RUHA 2D1SA 3Q15C 5DTEA 5L3RA 5JATA 4HQKA 4F5YA 3C6KA 5C5CA 5CAEB 4J29A 4EAQA 2BUCA 3FPJA 1G8SA 3BK2A 3QVLA 2R00A 2Q9BA 3IVGA 4XWGA 5KEIA 1OFIA 4JWTA 3UJ7A 1E3SA 3O3CA 4MVJA 3GEHA 3WZMA 4ZFNA 2GEJA 3H2ZA 1ECLA 1RYZA 1TDJA 1PEYA 3GA7A 5FOVA 3EXG1 1Z6YA 2DY1A 3H6KA 1QZXA 1TLFA 1XUOA 1KOLA 2ZBRA 3G85A 3I9NA 3OWXA 3DKRA 1NA5A 4RELA 5CFPA 1NNEA 2F3RA 3FPKA 2COKA 3PE6A 2XR1A 1ZJ4A 1WBBA 2WU0A 1P0PA 2C5HA 4NAVA 3KBOA 4CMAA 1BWSA 1Y37A 5JW6A 3GJ7A 4RIHA 3D6VA 2R85A 2QQGA 2JCGA 3EVEA 4YT5A 4JU8A 2X0FA 2R47A 3UXEA 2JGLA 4ZGBA 3AOEA 3B1FA 2QRQA 3C3WA 4L85A 2FDRA 4KOAA 5IJWA 2AZMA 2O23A 4HDMB 5ES3A 1WPQA 1GZ4A 4AZSA 1PYDA 3IPYA 4D9NA 1V4VA 3HCCA 1KKUA 1OH6A 3D9QX 4ZVMA 1A95A 2LDXA 3AFIA 1P4HA 2IW1A 3DEIA 3FRHA 1LDEA 4XYBA 3HJHA 1A9YA 3IELA 3KJGA 4QU8A 3VKVA 4BYGA 3N2GA 4NYMQ 4RFVA 1G1AA 2GZ2A 2KB0A 4F4UA 3EVZA 1FTSA 3ICWA 5G2OA 1JIJA 3G2LA 2ODBA 4X6YA 2J31A 2Q7XA 4RIEA 4DLZA 1YJ5A 2IYLD 3E9QA 3TGPA 2H5EA 3O7MA 3FWNA 1U0LA 4IILA 1UJNA 4OU4A 5I9LA 4NZ9A 4NECA 4MRRA 3P0RA 1AKEA 5EPOA 5JJIA 3H8JA 1L5OA 3EA0A 1QNLA 3W7BA 2DFPA 4FXOA 4TROA 1USIA 5GGXA 5I9MA 5DIFA 4U7DA 1VDMA 1GPAA 2A0FA 3ZQJA 3C87A 1UMBA 3ET5A 1VKNA 2Q6IA 5CDHA 4E4YA 5CXSA 3JYQA 1TUBA 4N0MA 3L4BC 4IEEA 1DDGA 1HT0A 1EFRD 3PRJA 2Y2VA 2JIZD 3ENWA 2Z58A 3LCVB 3C3PA 3PQ6A 2F3QA 2QUJA 3MRTA 2WVAA 2RGYA 4HAYA 4JV5B 1NU8A 1QK4A 1UM9B 5D87A 5A2QA 3KTOA 1RQ2A 1EDZA 3ENQA 3G9XA 4LTNA 1E6MA 1T9GS 1KOFA 1N9KA 3HJCA 1ZM7A 2DH6A 2JLZA 3BCRA 4RF3A 4L4XA 1CQPA 1OWNA 1YR1A 3HY6A 3Q11A 1CDDA 2CLMB 4KTVE 5DHSA 5K99A 2OTCA 1YH3A 4UEWA 4CG1A 5CDFA 3GGGA 3SLRA 4PYRA 2D6FA 1UFOA 2C95A 3GY0A 4JUIA 3SK0A 3HVKA 1I3MA 3EIEA 1NYQA 1XZEA 3V00A 4OI2A 1U02A 4WLNA 3HJNA 2PQ0A 1KI2A 1Z5UA 2VA9A 2SCUA 2YWFA 3G8DA 2AR0A 4B3DA 5B3JA 3HE3A 3EGDA 3KC2A 3IBFA 1S02A 3E61A 3LBAA 1SEPA 3TF5A 3U09A 1JMKC 1W85A 1NVEA 4AJHA 4XQGA 5JMPA 4OGFA 4NLEA 1PLKA 2J45A 3AR9A 2WUWE 3NEAA 1D9ZA 4GH5A 4LOHA 3UOAB 4BVFA 1ZGCA 2DQYA 1U90A 4HQ0A 4NQZA 4P34A 1VG0B 4XGNA 4TS3A 1M6EX 2ZI9A 3ICVA 1O6GA 1XMVA 3KKLA 2C4KA 3BD7A 1PLLA 4L3OA 3SE0A 1AJEA 3JRNA 1SK9A 4EKDA 1GZ6A 5JNVA 3CJTA 2ZRDA 4EUKA 3O90A 2IUUA 5EMHA 1OX4B 1XHLA 2RGWA 2VDJA 1SQ5A 3NATA 3Q4GA 4FDLA 1JLKA 4MQEB 4MX2A 3FPFA 3I09A 3L8DA 2FQWA 4NSNA 4QTUB 2XWJI 5JZVA 4JLOA 3EFBA 4ZT3A 4I9HA 3BMCB 3BL6A 3EGEA 3I53A 4DT1A 1AKTA 2KI5A 1GPUA 3IJ5A 2A9JA 2QM3A 3DLIA 3GUCA 4FUQA 4V0QA 1OLUA 1UC8A 3CB2A 1ZD3A 3IQXA 1GFZA 5THQA 3WTCA 4KPUA 3C6XA 3O2NA 2XOEA 1RBZA 1Y6ZA 1MTZA 1U3FA 1YZLA 2EQBA 1QM5A 2H1WA 2JIZA 3QVWA 4FJ2A 3BHGA 4M0CA 4UD2A 4XR4A 5I47A 3I9MA 1U2EA 3FHOA 2QL7A 4F92B 4OK6A 1IG0A 1Z35A 4KLRA 5E0KB 1U0SY 3OIWA 3G5AA 3QVTA 1KMNA 2OBXA 4GXRA 4YAUA 4B3IA 2HK9A 2WRZA 4J8PA 1E5QA 2YV4A 1PFYA 3RKSA 2FRDC 3VR5H 1J2TA 3VOBA 3UXHA 1RPAA 2C31A 1E0DA 2PUWA 3L7IA 3LPCA 3H9GA 1DJMA 4DLSA 4MUHA 5A05A 1PL8A 2VDVE 3WLEA 4BUCA 4X6UA 4U39A 3QY9A 5IH3A 4HDOB 1YBFA 3C1AA 1PD0A 1QRUA 1RP1A 2XUGA 4WN3A 2LTAA 3O8QA 3S4YA 5CP8A 3S2YA 3IJPA 4NYJR 5MFZA 2HA4A 3MWEB 3QK7A 5LB4A 4EIWA 1VFPA 2X58A 4V0KA 4ZHQF 5LQNA 4EKGA 1YFZA 3DBHB 3GJQA 3PR3A 2J30A 4WGFA 1IBCA 1GVNB 3G0BA 4HZIA 2Y1GA 4G1UC 4JR1A 3B1JA 2IF0A 5DI9A 3ZHRA 1CPYA 4TQ9A 2EGUA 1WOMA 3F71A 5EHIA 1NPTO 4KN6A 3K71B 4M6WB 4D4HA 2NUPB 1W0JA 3O4HA 1SVKA 1YA8A 5LDHA 1SU8A 3U56A 3DDNA 4J4BA 1AUWA 3SPXA 2WSLA 1XMOB 4XUGB 2ZRGA 2OWEA 4M89A 3ZQKA 4BP8A 1H2AS 3OM0A 4OHUA 4MVJH 4PZ0A 1JSRA 3LWZA 3RARA 4RORA 3LQYA 5C8ZA 1PR2A 4K86A 3TQQA 4ZZ1A 2VOEA 4D5EA 1U0EA 1A27A 1Z4NA 2ZUBA 1IG3A 1KAGA 3LVQE 3P9RA 4GMXA 3IIJA 3UJDA 2IDKA 2HT6A 2PX5A 1RLIA 3BICA 3BRWD 3BXHA 1Y89A 4IMRA 4JC4A 4JJZA 1VJ5A 1Z28A 1Z5VA 2AN9A 4BX2A 3L0YA 3ACBA 2PJUA 3BXFA 2WF5A 2JHCA 4IYJA 5E9WA 3GFBA 1GKIA 1XF1A 1FMJA 2PRIA 3EOZA 4KMRA 4J0DA 4KO2S 4OMFG 5A4MS 1E32A 2QN2A 3DE1X 2YN0A 4PGGA 4AJ1A 3WIVA 5CAEA 3CWZA 5C7LO 5JS7A 1I2BA 3RHZA 3DWGA 5GGYA 1PS8A 3N58A 4RACA 4P98A 4Q9KA 2B4QA 3IMCA 5EJEA 1IPEA 2X3UA 3B1WA 2JJMA 4CT4B 4XM0A 1R0WA 2JIBA 4C2UA 2Q5FA 3TAXA 4DVGA 2J0SA 2OR3A 2FHPA 4CUKA 2JG3A 3H2YA 2ZIUB 1K3UB 2PMWB 1SUCA 4H6XA 2VT6A 2O4CA 1U04A 4PHGA 4RZIA 3L8GA 4QD3A 4GMHA 2HJSA 4EYSA 3PNKA 2J3KA 3NM5A 5A03A 5B2FA 3IDSA 3M6XA 3TQSA 5D1NA 2CFSA 3MC1A 5DN6D 1M0EA 3AEZA 5BV1A 2PSFA 3LCMA 3RCBA 1EFVA 4HDMA 2PIDA 3ZWKA 1TNDA 4BBZA 1BC5A 3L0ZA 3GNSA 5ARDA 3BL8A 221PA 3JQ7B 2DWUA 3LQQA 2A86A 4OI4A 4B4VA 1WV0A 3D7KA 4KP7A 2Z5GA 4GPIB 4UU1A 3EVDA 3BHMA 4DWOA 1X1BA 3CW2A 3Q7RA 4BN0A 1XP5A 2C03A 1J2YA 3M4ZA 1MXFA 5ICEA 3D3WB 1KJNA 4I55F 5AW6A 1QG6A 2NOAA 5E4FA 2YYYA 3SSMA 3ZVLA 1OMOA 2QNRA 3BSYA 3JR7A 2R6DA 5DTJA 1XZIA 1EYZA 2PZLA 2VH2A 3BRWA 4PBRA 5G0SA 2VDWB 4XDGA 4R0MA 5A3RA 2BCGY 2IHVA 2CYAA 3L8YA 4G5RA 4NZNA 4YUXA 3KU1A 1TAUA 5TPZD 1AQLA 3DJFA 4LJ4A 1GCAA 2V7PA 3EQZA 4RK7A 5D6OA 2Z0MA 1BRTA 4ZQHA 3WGMA 4CM9A 1PJZA 1YSCA 2QTHA 1E4EA 3R3ZA 3K6KA 4WUTA 3D4BA 3FR7A 4I7EA 1YL6A 4NDNE 3KP1A 4BX9A 2PD3A 5AQEA 2PTSA 3ESDA 2WU3A 2Y6UA 5JO9A 3R75A 4FE4A 1UM9A 9LDBA 2BGTA 5TPWB 1H0RA 3E3OA 3NGLA 5EWMB 3QOYA 1JDSA 1XYYA 3JYLA 1Z6ZA 4KQMA 1KU0A 3TMAA 4TL6A 1U3GA 3GFOA 4BCBA 5C4MA 4RF4A 3HVIA 1XNGA 3MOIA 3A05A 3TZHA 2BLNA 3B1XA 3RGGA 3GLIA 5DM0A 2VWQA 1TVEA 1WIWA 4X94A 1DXQA 4F06A 1EA7A 2GEFA 2XWSA 4BEVA 4YP6A 5FNVB 4C06A 4YROA 2P77A 2DETA 4DSOA 1E5DA 5DN6A 4FQ5A 1TJYA 1MVNA 2QE6A 4O2BB 2IUFA 2W83A 4PPGA 1XZKA 1PUJA 1ODFA 1XU4A 4BAGA 1ZR4A 2L42A 2FUNB 2YTZA 3RM3A 1NQXA 2VWGA 1WW8A 4N6NA 4RVUA 5BO5A 3NALA 4ARCA 4BO4A 2AC4A 1DUVG 4PBSA 4PZ9A 2VZ0A 3N8NA 4HVTA 1Z22A 1ZH8A 4TN1A 4XFKA 2HK7A 2HCRA 2XNSA 2BGUA 2EW8A 4Z3DA 1N7JA 5J2UA 3FPGA 4GGMX 1G59A 3BTSA 4RJLA 1XNRB 2PUEA 5K0BA 16PKA 4GZ3A 4GP9A 4EGSA 2JVKA 5DSTA 3AB7A 3C8DA 3KJNA 3W6ZA 1LLDA 2LIPA 1EUCB 1OX4A 1BIFA 1OILA 4M38A 3GCWA 4MQEA 5AHKA 2O2GA 2VQSA 4LV6A 4UBJA 2ASVA 4P2BA 3O74A 1KY5A 4NYJQ 3OEYA 4U2BA 2F4NA 1HDYA 2JJ1A 3X3HA 3BMCA 4F6CA 1JEDA 1M5RA 3EIOA 5TPZA 3SIWA 2X3YA 1YRWA 1UZAA 1P2FA 3CSSA 3AUKA 3B1ZA 4GYYA 4QULA 4UNRA 1E3DA 5CNIA 5HIKA 3GAFA 2CDNA 1PR5A 4XI9A 3DPUA 4KVFA 2OM2A 1YCDA 2R11A 3QV1A 4ZAGA 3CKKA 1PSZA 2DX7A 2E4ZA 3UJ3X 3W2IA 2NV2B 3COPA 5HKLA 3U16A 1IBSA 4TL7A 3RC8A 4W5WA 1MX5A 4HLCA 1DHTA 2A7QA 3L6RA 3C8TA 3C1TA 3T1OA 1GNPA 3JD0A 2ZCJA 2C92A 1PT9A 5BN3B 5F1KA 3O4FA 3RTAA 4BWVA 1B0PA 1N8KA 4M8IA 3URKA 4G1CA 4A73A 1EX7A 1PLJA 2R44A 2V7UA 3CIFA 3MSCA 1TAGA 1TO6A 4I99A 1DQZA 2PMDA 2W6ZA 4DCTA 1X8LA 5AXDA 3QPWA 1K3FA 4MHTA 3WYBA 5FBKA 3AOGA 3ECCA 1WG8A 1FUQA 2DWOA 3GRUA 4GM0A 3KXPA 1R0KA 4PYNA 2QVXX 3LUJA 4W7SA 1C8VB 4Y8VA 3DCJA 1YI0A 3GEBA 1R6BX 1G8GA 1S8NA 3JALB 3WIDA 1SZPA 3DMRA 3F0TA 3MWEA 1DCMA 2C0PA 4CF5A 2VZ9A 1H6DA 1W48A 1W5EA 4MQFB 2NZ8A 2PJRA 1DVRA 1RQGA 3LNCA 1Z16A 2WF9A 3EDOA 4PGFA 3DBHA 4WZBB 5B30A 3ZCUA 5B3LA 4U0JA 4QUAA 3HYNA 4H2DA 1M34E 2ZUDA 1YZYA 1TUIA 2HPVA 2OBFA 3IP3A 2C4WA 4ZO9A 2VSXA 3IXLA 2J09A 3HADA 4M6WA 2NUPA 1YZ3A 1ZSVA 3MMSA 1SCDA 1X8JA 3F3SA 2GASA 2W9XA 3QTBA 4NE2A 4Q3EA 3HXOA 1XTVA 3F4SA 3GAZA 2Y1LA 4RK5A 3T9AA 3K16A 5K3OA 1K2VN 4IVNA 4C7XA 3RC2A 3T4XA 1P33A 4X8HA 4K9SA 3SKXA 4F9GA 1UBJS 1GRVA 1QGOA 2WILA 1AKYA 4HPJB 3COJA 1KJQA 2H5IA 2ZLBA 1FS6A 3C5VA 4CM8B 1YRHA 4RD3A 5CLIA 1U1EA 3KYIB 2YW2A 3ZK9A 5IDQA 2L18A 3WR5A 3V4SA 5H70A 5FV4A 1Z26A 5JRDS 1TM1E 4YDSA 2AX4A 2R1VB 4RYLA 2GLUA 3DXFA 3U9LA 2IBTA 1C4OA 4J6FA 3PIDA 1A76A 1N6KA 1MORA 4BO0A 2K7FA 3HHPA 3UWKA 3ROMA 3VNAA 1D2AA 1CS4C 4OYLA 2O05A 1YZGA 1K6IA 2XMZA 4OAQA 4UFNA 4URWR 5EE1A 3ZH2A 1Q0HA 1ODCA 1L9KA 1NOJA 3NDPA 4GBJA 2Q6OA 3HRIA 1N6PA 5K05A 1B8PA 3M49A 4LC1A 5F1OA 4IIXA 3BF8A 3S81A 1QGAA 4GNKA 2BMEA 1E3MA 3L92A 1KHHA 4NENB 1WUHS 4HGOA 4XWYA 3EVAA 7ADHA 2XYGA 5KOYA 3F1LA 1UPTA 2CZGA 3C8MA 4WD3A 4LK3A 1TYBE 1WV1A 3HVUA 4G5OA 4TYMA 4A2PA 3NHLA 1XVIA 1C8KA 4YHHB 1E8MA 3BORA 2HSEA 1LJUA 1BVUA 5TNXA 4AS2A 2HO5A 4IDPA 4RXUA 5HKOA 1E9SA 4F45A 4C6RA 4RQUA 1TD9A 2Q6KA 4DDWA 4H59A 3SE7A 3OOWA 1DAPA 2HTFA 2A59A 3DZDA 5ILOA 1O6CA 2QTFA 1CZUA 3GDFA 2BYTA 1ZU4A 4QEDA 2B9VA 1YMUA 3GJ5A 4X3CA 1ZVVA 3OICA 5HW2A 2J08A 2ZT7A 4N7MA 5JS6A 2X76A 3T7RA 1B1AA 1OBCA 1TCVA 5DWVA 1NKVA 3JQ7A 3R76A 1T0PA 3A4LA 3W2GA 1I36A 5FPKA 2FK8A 3BRSA 3KEQA 4FLEA 4ZVPA 3KXLA 5AW7A 1GPH1 1ZGHA 4BMYA 3S55A 4F4FA 3ZWOA 3DDZX 1ETUA 4MHSA 4OHZA 4W8HA 2VF2A 1I6MA 5IFKA 3ZLJA 1SQGA 3BERA 4CIVA 2PTGA 1NXSA 5LQSA 3D3WA 2EX0A 3ZVRA 5CFRA 5BXYA 3JU3A 1ULBA 1DFGA 1U2TA 1XA4A 3F6BX 1KARA 1AGNA 3ZWVA 1XAJA 1GZUA 3CLRD 1NX9A 1EDOA 4Q00A 2BFPA 3ANMA 2VDWA 1FEZA 1Z0AA 2QW8A 4MV4A 1GVHA 4E70A 4KQHA 4YCDA 2E1PA 1GGVA 3WNVA 2ZS7A 3UTCA 4TMFA 4TSRA 3GCXA 5ALMA 4NK5A 4Z9XA 4PPFA 2QTGA 3K7EA 4S1PA 2ZSAA 5FWYB 1OWPA 1FF9A 5CLHA 1JIUA 4WINA 3RROA 3PFKA 1XFDA 3REQB 4QVIA 4M1ZA 5TQ2B 1P1BA 3DWIA 5TPWA 4Y1RB 4MVCA 5EWMA 2XMCA 1MKYA 3TLXA 3DDWA 4XUEA 5JSZB 3HXQA 3EIUA 2ZUVA 3NOXA 3OFKA 4BX0A 4M9ZA 4FMPA 2HF9A 3U13A 4CCSA 3JPWA 4OHPA 1GILA 1GNLA 3DHYA 3OF3A 1XA0A 3VX4A 4BEBA 1Y4AE 3BD8A 2F17A 2JGNA 3HSKA 4TZTA 1U3UA 2V1UA 1VIDA 4NEHB 2IU4A 1MOQA 5AVOA 3PHHA 5FNVA 4IJQA 3SMQA 5CYFA 2FW6A 4HNSA 1Z7BA 4O2BA 5TVKA 1EHCA 4I4LA 3I83A 3GDGA 1A5BB 1N33B 4IUCS 3PWTA 1DIOB 1MQ8B 4KYIB 1RIFA 1E92A 4RS3A 2G71A 2IEYA 2NU9B 1PJ4A 2OL4A 3HDGA 2OORA 1K7YA 1QH1B 2W2TA 4DC0A 4ZV7A 2WK1A 4AN0A 4MWDA 3Q7QA 1AK2A 5ALGA 1NJSA 1QQTA 1THTA 3R6WA 1J5PA 1HDOA 1M72A 1SIOA 4AY2A 4PVDA 5HRUA 1S2GA 3KT8A 4H77A 3MB8A 9ABPA 4WWHA 3N2EA 4ZANA 4ZYVA 1Z4KA 2VF4X 5HIAA 1OXBB 4KK4A 1YFLA 1WO8A 5DEIA 2RGXA 5C2JB 5FPYA 1PQYA 1G4HA 5LKAA 3FPEA 1V5FA 5I7FA 2IV7A 2XCSB 1EUCA 3DTYA 3FCOA 5BYKA 4OLAA 1K92A 2IV3A 5CDTA 1GPJA 2ZTVA 3MS2A 4PZLA 3N59A 4YT2A 3TXYA 3T0IA 3KSAC 1HLDA 1Q84A 4BQOA 4WA7A 3W8DA 4ZU6X 3VHQA 1V6SA 1A5ZA 1I5EA 2HRCA 3DVSX 4FIDA 4YVFA 3JQBC 4AMUA 4EJSB 5JAOA 4LDPA 2IA5A 2OZPA 4U9HS 3NHSA 3AR4A 4X93A 3MGBA 3P2OA 3G6WA 1U0RA 4LYFA 1L1QA 4ADSG 4DCJA 1PDWA 3WICA 5SY6A 2CWDA 1ZNWA 1JDVA 3QU7A 3V2HA 4Z7JA 1VSBA 5LM3A 4IQ8A 5BW6B 4TVKA 2RG1A 1QHEA 1A1VA 2B35A 4EHBA 5GAJA 4NATA 3W4JA 3V2GA 1MGOA 4K1XA 1EFUA 3SXUB 4O4IB 2WPDD 1ISSA 5BN3A 4IIFA 1OZGA 4QDKA 4KG7A 3PTZA 3DBRB 5TSDA 1XCBA 2IDZA 1A69A 1RKUA 2X8AA 3BH0A 2WVJA 3ZHOA 2WD9A 3ETCA 3ADOA 2XMDA 1QE3A 1VP3A 1KR5A 2WVHA 4BMNA 4ZI7B 2R4TA 5T4FA 3JZAA 1GP2A 4CDGA 2YHIB 2EERA 5B1IA 4KXLA 4CM4A 3H7AA 1UH5A 4Z4QA 4MW5A 4NAHA 2C2BA 4X65B 3JALA 4ETNA 5JO0A 3HVHA 3D43A 7AT1A 4BKOA 2EYQA 4MQFA 3ZBTA 2EEZA 3NT4A 4QOJA 1JEAA 4EUFA 4XJXA 4WZBA 3AHCA 1Y7TA 3IGFA 1KYTA 2PU5A 1DRUA 2DR0A 3M4XA 4C01A 2HQ1A 2V0NA 4EGJA 1FK8A 3MT8A 3ZN2A 4ZYTA 3Q72A 2QROA 4UM5A 2HHJA 3HGQA 4J0KA 1FUKA 3ZV6A 1KRWA 4Q19A 4OQNA 3T3HA 2OO3A 3JD1A 4ZU3A 2A84A 2H1CA 3K0CA 3EVGA 3LT1A 3ELDA 4FLFA 3F4KA 5FJIA 3WGJA 3OMXA 3B85A 1A82A 1MU0A 2GNOA 3OLYA 5ALLA 4OLFA 2BGNA 4D74A 1Q92A 1VRCA 2BIFA 4CM8A 5TGTA 4OFBA 1TQ6A 4II2A 2V6GA 1H3FA 4QOSA 3AIMA 1P1HA 4GMGA 1NJGA 2R1VA 2BZSA 3MS7A 3DE4X 4Q03A 1NBMD 3D3KA 4Y2YA 1JDNA 2G76A 3EOAI 4TZ6A 5DM2A 1MXHA 2R7KA 3CZPA 2ZS8A 3IOMA 3MJ4A 2XQFA 4C08A 5AKJA 1WU7A 3AHHA 2I7CA 2IPMA 2H31A 4YJHB 4DNFA 5TLSA 2A4MA 4RLFA 4X45A 4QDTA 3W5JA 3HQ4O 4FYYA 4I4IA 3BULA 4FKZA 1B3RA 4N5IX 1SN7A 3AVVA 2YDXA 4QFMA 4NENA 3TH5A 1JSXA 1Y1RA 3AP1A 3A9TA 3GJRA 4G25A 4QWMA 4RL6A 1KTVA 5AHRA 3T35A 3P2MA 1V45E 4KODA 2ZRFA 1FP4A 2OAP1 2ZP1A 4Q12A 3FSJX 4D99A 5F2NA 4TYWA 1JPVA 3PE3A 4IMIB 3ORRA 2H63A 2O3SA 2V5UA 4LXTA 4WBSA 2FEPA 4BFYA 2WFZA 4ETWA 2PS1A 4MMYB 5DMXA 1R18A 3NC4A 4N8DA 2I2DA 5J2TF 3AJ9A 3BAZA 1M83A 1G9SA 1NGSA 4ID3A 3O95A 2ZYHA 2YXLA 2O14A 2Z9CA 3TTUA 1Y8ZA 2XGOA 4MJXA 1K8QA 4TKZA 1Z0UA 4EM6A 2VSYA 1R1DA 3PD7A 2J5RA 4BNIA 4RH3A 2CFIA 1V47A 3EW7A 5HRCA 2CNBA 1VMKA 4KDFA 5EIBC 1KF0A 2ZZNA 5FHRA 1QRDA 1BDBA 4IFBA 4IH1A 5BP7A 1N2BA 4MINA 3V4OA 3WWCA 4AZWA 2AWOA 2AYYA 3SXJA 3I4CA 1OFVA 5BR8B 3C3YA 1C3EA 2Q3DA 1OW3B 1X86B 1Z88A 3ELWA 1P9OA 3ICOA 4H1VA 5JAUA 4WLUA 1B26A 3K9FC 3CT4A 1JUDA 3AM1A 3QUQA 4RVNA 1A7JA 3L07A 4S35A 3FVWA 4MLPA 1AO3A 3OU6A 2ZYDA 3T1TA 1JFVA 2I87A 1CUHA 4FDUA 4GMDA 1YVUA 4Q4AB 4TWAA 3S44A 4N5MA 3U7JA 5CK5A 1HLGA 2WIGA 1BE1A 3M6MD 3Q12A 3CVOA 3P5SA 5CA1F 5IXYA 4RTOA 4C0BA 1XVVA 3U1BA 1NU6A 1HRKA 2DFNA 5B6JA 3O0TA 5L7YA 2FR1A 3REQA 5TQ2A 1OKKD 2C82A 1EEXB 4Y1RA 5E6RB 3FF4A 2CNKA 3OY2A 3MTJA 2XJ4A 3WDKA 5JSZA 2AF3C 1TJWA 2LP4Y 1NV9A 3RWBA 2WUEA 5KOHB 3Q7TA 4EX6A 2PA3A 3UMBA 1KAOA 2EZ9A 2XE6A 3RS3A 1U7UA 2B69A 1HE1C 2F6RA 2MT9A 3ZX4A 5L53A 4TUYA 1V11B 5C34B 5FPTA 1SG0A 2XITA 3I2JA 2ZRMA 3TQIA 3EULA 4QC2A 4D4KA 1UAAA 1F48A 3SVZA 3G82C 3JTMA 3OZWA 4JOSA 4BO2A 3ZCRA 4DNOA 2ZTLA 3E7WA 5JISA 3FW1A 1JLMA 3F8SA 1VPWA 2NU9A 1IXZA 3HYCA 4ZT4A 3OCJA 4IP0A 1QH1A 1ECJA 3EY4A 4EJMA 3U7HB 2JL1A 3RI3A 2WPNA 4HHEA 3HPQA 3E5HA 2C2GA 4QNMA 5JZBA 4REQB 2QUBA 4YWJA 3RH0A 4FSXA 3A1TA 4B74A 3KLPX 3KV1A 2NWQA 1NPYA 3O84A 4R84A 4EMSA 3ASUA 3K9CA 2H4JA 3ZDQA 3U4CA 5A4DA 4HMQA 4RM3A 5BSVA 4FXPA 1LRJA 4NJEA 3NHPA 3S5JA 4XWOA 1AKUA 3AHFA 1LW6E 4HYYA 5JCPA 3MBIA 1TW3A 4L9RA 1E4YA 5GVRA 1X15A 2FG6C 3PKIA 3UNXA 4BQFA 1XTUA 3OZTA 2VCHA 3SOPA 5KYTA 4RKYA 2Z5FA 5EQJB 1S01A 4Z3OA 1PYOA 4PFQA 3FB4A 3ZHUA 3WL6A 3DT8A 4EJSA 1H8HA 3ONDA 1NIJA 5LA6F 4HI0E 4BIMA 5DYNA 5H0IA 2Q9AA 4D4LA 4MW4A 1QE5A 2BBTA 5ALEA 4DM7A 4ZD6A 1V25A 3CX8A 3UY4A 5FTJA 1RQPA 1YQDA 2QG4A 4JI5B 3WL5A 1BGWA 1SB8A 1OKKA 3HDQA 3DYVA 1COWA 2DR2A 4OF4A 3DFUA 1Y7IA 4POOA 4IDHA 2OCXA 4B6SA 1KI8A 4JUDX 5L3QB 4CCWA 1YF3A 4YJDA 3SXUA 2CVOA 3EDRA 3IE2A 3ER6A 4O4IA 3UAXA 1ZVKA 2ERYA 1HKHA 3DBRA 4HX5A 3IE1A 1SVOA 3ZLTA 1MR3F 1YJQA 1DIHA 3TIVA 3ZW9A 2NSDA 1U11A 4ZI7A 3LT4A 3SC4A 2Z8XA 1PJCA 4GZ5A 4DYHA 1VMIA 2DY0A 1SD1A 1KVUA 4F12A 1QV6A 3SQLA 1UXKA 1DOAA 1TQ4A 5AFSA 3LO5A 4G63A 1UCFA 3VMFA 3WWPA 4R1UA 1MBZA 1RYYA 2ZYSA 2C3OA 4D8TA 4KV7A 4D1YA 2YXPX 4KLCA 3T1VA 3KYCB 3RS9A 2GZHA 5B37A 3ZXYA 1PP4A 4XW2A 1NYLA 4LOIA 1AS2A 3GL9A 3OZEA 2BTEA 4M7WA 1PJQA 2X0RA 3LGSA 3MQ4A 1X94A 1XZAA 2I29A 1B8OA 1BQ3A 1NRXA 2V1XA 3F4BA 4P3OA 1OXKB 3R8CA 3W6NA 4BKUA 3PGVA 4PSKA 4AB1A 3WGZA 3KJFA 1A9TA 1GUZA 3JVEA 2DPHA 2EFCB 1KI6B 1CD5A 2AXQA 2RJ3A 5A4JA 4DXAA 4BRSA 1ECPA 1K8ZB 2ACVA 4FGLA 3EPKA 2OKGA 4F9FA 3ZK7A 2O3RA 2CYBA 2QJFA 4NOMA 1G6OA 4U7PB 5K0CA 5BQFA 2QR2A 1DMRA 5L7TA 1ETHA 4DA7A 4B7ZA 1B41A 4RVGA 1DUSA 4B6JA 2XIQA 4MW6A 1IN6A 3AVPA 2X4IA 2IX9A 3HXLA 3R7BA 2HSDA 2KX7A 2G72A 5FF9A 4BO1A 3PEUA 1KO7A 3ZDXB 4YMUA 3DVRX 3HU1A 1MF7A 3C74A 3HEAA 3QXHA 3U0VA 1QYWA 3JVIA 3VSBA 3CX7A 4TLCA 3ILHA 4DSTA 2JGRA 2YXNA 1AUPA 1ZUWA 4EG5A 1GT6A 1NQTA 1IBMB 2DCUA 4YJHA 5BSMA 3DBIA 4PF1A 4RTPA 1F8UA 4O4JB 3PGKA 3SYRA 1ODKA 4O02B 1NXVA 4QAJA 2O2IA 1R5BA 1W4LA 4RSRA 3WFJA 4JKYA 1S2MA 3N2YA 3RFTA 1WZCA 2KBEA 1YKGA 5IPFA 1GCIA 2ORVA 5C46F 2JLCA 3KQHA 4GZLA 2WWVD 1R10A 1PK8A 2WNIA 2C5AA 3G13A 3M1AA 1TRKA 1K0UA 1FTYA 4I8XA 3G5LA 2C4MA 4GX1A 4YB8A 4KQKA 1X7YB 5CLGA 3V4ZA 1FQJA 1MHTA 1GXSB 1DT3A 4RW0A 4FBLA 3AFHA 3NANA 3C5HA 1S1CA 1GKYA 1KU6A 2LD4A 1A5SB 1TYDE 3SZUA 1Z0JA 1J4AA 4RMHA 2X41A 2C29D 3IDOA 3NQ41 3QYFA 5AWFC 5CB8A 4JYPA 4QHTA 4D3YA 4NVRA 1YUMA 4RY9A 1LNZA 1UBRS 3NHUA 1EVYA 4WAUA 4Q9LA 4IQGA 1A04A 3I45A 4WW0A 4CDNA 2I9PA 4R9SA 2AEFA 1GPNA 1LS1A 4PWZA 4Q9JA 3CH4B 3S5UA 4JX8A 2C5BA 1QO9A 2YS7A 4MZXA 2M6SA 1U3WA 3IQEA 4WMLA 5I5GA 3OA2A 1JXOA 2H5JA 3ES9A 3NRJA 1I3OA 1JAYA 4YAIA 1XV5A 3CLUC 3GIDA 3W9BA 1LTHR 3V4VB 5CB4F 2FDCA 5YASA 1ZRHA 3PEWA 4Q82A 4D4JA 1PCXA 2YMMA 3EA4A 1TZ2A 5FBLB 3KHSA 5GY7A 1H4QA 2G8LA 3U3KA 2DSNA 4I2NA 5IJXA 2Y4OA 5CT5A 3UGTA 2C94A 1Q17A 4YP5A 1WRBA 3ZU3A 2PUBA 4RJKA 1EDBA 2W6CX 3H16A 5IUKC 5ABPA 3KQMA 4LXGA 2W93A 4AJIA 3EXHB 4KZPA 4ZQIA 3KQPA 4B8YA 3L8EA 3OT5A 1G4AE 3DH0A 4Q4AA 1VSQA 2QK4A 3DCYA 3RRFA 6PFKA 3AETB 3T4PA 1T2EA 1AZLA 1RKXA 5ALUA 1KDRA 2ZUWA 4MQLA 2GBLA 4A10A 3ZNPA 4X62B 3WQSB 2ALJA 2XTJA 2R00C 5JH7F 5E6RA 2C58A 3ITDA 1IJEA 1BH6A 2BT4A 4L6IA 3WDLA 1LZLA 1PW5A 3SVTA 2W6OA 3BB3A 1RI5A 3EISA 3VC1A 1XTZA 2GPYA 4Y2TA 3E48A 4CIYA 5KOHA 4OG2A 3LVBA 3VVCA 1PUXA 4NFSA 2Z1DA 4KFTA 3O2QB 4R4JA 3TGLA 2B8JA 2G7ZA 3WK4A 5JPCA 1V11A 5FAKA 2WFAA 4QEKA 3JYNA 1FPMA 3H9UA 3ZW8A 4R1NA 2A78A 1A5TA 3ZE9A 1XKLA 1O0CA 5AHXA 4ZCIA 1UDRA 1W5BA 4ENSA 1GL7A 1P8JA 5K0SA 5D8DA 1VCMA 2IE0A 1XNHA 1CVIA 1Q74A 3FETA 5FTKA 3AOEC 3SHOA 2BM9A 3U7IA 4F3CA 2EBUA 1GUFA 4PONA 4QU0A 3ZI7A 4BP9A 3F1KA 1PHRA 1QHIA 3ZVMA 5CJPA 2P3QA 3Q3CA 2CXOA 1SIUA 1SHUX 1ZUNB 2CDRA 4REQA 5AUQA 3QWFA 2B4KA 4ZI3A 2NTJA 1HOTA 2ZI6A 4IWNA 4L5BA 5EA2A 1W1IA 4CMEC 3KBBA 3TLAA 2ZR7A 3SYNA 3R5SA 1OFHA 4B7AA 4BNYA 5LFAA 1W5AA 4YRQA 4KUGA 2HHAA 5F77A 4QYTA 3PFGA 5C37A 1GFIA 1A7AA 1CJKC 2PX4A 4U1RA 2VQDA 3WGVA 4EF5A 2WJHA 3PC8A 2O8FB 3PVCA 3UF0A 1UC4B 1UC9A 1V2HE 4OJYA 3AIIA 3PQDA 4URZR 3A58B 3WKDA 2PT7A 4WCVA 4P81A 5JDCC 2X2EA 3PC7A 1SXHA 2Q1WA 1KEUA 1V71A 3MUNA 1J70A 4KNWA 4O0MA 1DC7A 2EIXA 3WIUA 5JPIA 1JEYB 5FLEX 1W59A 1LD3A 1R0YA 1KZHA 4DRZA 2H7XA 5DEOA 3OM1A 1G20B 5CH8A 2OG1A 2FEXA 2OD7A 2OY0A 4Y6LA 4KPFC 4XJTA 1SMKA 3LHIA 4L7QA 4B3SB 2X8LA 4O33A 3D8BA 1REQB 4BVHA 4B3GA 3P71T 5T41A 3EGOA 3CUUA 4NR0A 5KVVA 4M0DA 2CLSA 3KETA 5CNMA 1WM1A 2JFUA 2OZKA 4AG6A 1TQ2A 1SQ0A 4S05A 4F3TA 1RAFA 1C29B 4MUNA 3VJLA 4ZJZA 5C35A 1Y5MA 4MGYR 2N9UA 1XFAA 4LXUA 1SU6A 5CMLA 2ZBDA 5EHQA 5B3JC 2YVUA 3MWLA 4PYIA 1EG2A 5LQKA 1E6WA 1UDCA 4LCBA 3AT1A 1J99A 3FYCA 4RH1A 4S0XA 5BR7A 1UBOS 5DTIA 1G60A 1JKMA 1LDGA 2IUYA 2YICA 5ELMA 3VH1A 3MA0A 4H6WA 4R7ZA 3ZOZA 1ES9A 5T67A 1HT2E 2BTQB 3E05A 4F60A 1TK2A 4YI3A 5A1TA 1TYCA 2OUKA 4E51A 2W90A 3FLAA 5DK6A 4OHBA 5JC1A 5LIRA 1RYHA 3BGOS 4F04A 3CONA 3ZY6A 5CU7A 1S0UA 3PDUA 1Y6FA 4YLYA 3W79A 1WNTA 1KI6A 1H85A 4P2GA 4H08A 5DRYA 2Q1XA 3MYRA 2XYRA 2ZITA 2ID9A 3E1SA 2AN4A 2LKDA 2FW7A 1L7BA 2L19A 4MUEA 5BSRA 1SOVA 4P5DA 1EFPB 5KSPA 3V46A 1P7PA 3VR1A 1L4GA 3B3GA 2Q07A 5AIBA 3I30X 4R1TA 2X4LA 3QX8A 1W0CA 3Q8MA 1R00A 3EDMA 3IDFA 4AMVA 1P0MA 4FSHA 2PY6A 3EZXA 2DPGA 2A88A 1ISMA 1WZNA 4L15A 2WJVA 2P2CA 4ZQFA 4DC1A 4KWHA 2ST1A 2CXSA 1XRPA 3NASA 4UVDA 4UU7A 1IZ9A 3LV8A 5I7EA 2IITA 3KD2A 1Y5RA 4J49A 4O4JA 3BZBA 2Z43A 1DWPA 5FD8A 5F78A 2IHJA 2XWBF 4UTZA 5BUQA 1NN3A 3P45A 5HW0A 1T1EA 4HS9A 5SV2A 5C7YA 1N2JA 2L69A 2Q4RA 1EFDN 1OV6A 2UYGA 3RJ5A 2FK7A 4LGVA 2EFGA 3B1YA 3WLJA 2HPHA 2XI4A 1MN6A 3C4JA 3CKLA 1X7YA 5CBKA 2WU1A 4LC0A 1FLAA 2HA6A 1IN5A 1T29A 1DC4A 1GXSA 3H0EA 1S2LA 3PUYA 3GLFB 3L06A 4RY0A 2VYQA 5EFOA 3PR2B 1JN0A 4GYKA 3V55A 3L7NA 4P7JA 5B7QA 3PUXA 5EWLB 4ZVKA 1CEXA 1HKUA 3KEMA 5JIBA 2WWYA 2XZOA 3RABA 2WT9A 3TWOA 3CCFA 5JZMA 5H83A 2QRJA 3LXXA 3QP9A 1JEOA 1AB6A 4YRMA 1KI4A 1WE2A 5ALOA 3ZWAA 4FGUA 3FB1A 4FMDB 1S9DA 4EUNA 1KMCA 2FWBA 1V95A 2P40A 4HWSA 1POWA 4YAGA 2WUGA 3RAGA 1BVHA 2ECPA 1EE1A 1Z6XA 2Q3HA 3OZRA 1QQ5A 2NT3A 5KC8A 1J0CA 4JLKA 4E22A 3HI6A 4XEHA 3Q3VA 3X1DA 3ZEIA 1Q20A 3P9XA 3SIXA 4DIEA 4GT1A 1Q14A 5I51A 3HZRA 2AUMA 4Y2QA 2CF6A 2N75A 4Y2XA 1ST3A 1JILA 1GNVA 2EZTA 2XDAA 1EUYA 1D0VA 4W8OA 2RGAA 3CR3C 1ILEA 4MVJE 2EARA 1QYDA 2CUZA 2O6HA 3P2KA 3ZGLA 1NMXA 3B3QA 4OB8A 3EXHA 4TM7A 4BWGA 3P0IA 4KRYA 5D1HA 2CHVA 2WYOA 5IAEA 2OQIA 3PL1A 1JQAA 2PGOA 5BVHB 1YB5A 2RHGB 3JASB 3L79A 1RHJA 2RE8A 1C4KA 1H4SA 4GUDA 4ZOAA 1F9EA 2Q0SA 3AETA 2DBRA 4KN8A 4E5YA 4M0EA 5KYKA 4MWSA 5GP1A 3VUFA 4RUKA 1JR3D 4OX9B 1GRCA 1EX1A 1JSZA 3WO1A 1DAOA 1RBQA 4I4TB 4MUKA 2IPXA 4L57A 3SR4A 3EWAA 3M2PA 5CT8A 4JI2B 3CNBA 4JKIA 3KVRA 4RAOA 2P6OA 4JC5A 4CR6A 5HFAA 4LWPA 1VKRA 5FPHA 1P73A 3BMXA 3CNHA 4LGCA 1JLRA 1P9NA 2WWWA 1YS1X 2N0SA 3QU9A 1DLIA 4M49A 3N05A 4BRUA 1RMYA 3JVUA 4R71A 4YCAA 2AYZA 4RZQA 5BYAA 3IP1A 4BBPA 4E1AA 2Q0XA 4IDOA 4BVLA 4TTTS 1KH1A 5JC8A 1QP7A 1EFKA 3OCUA 3IBCA 2YYZA 1QKIA 1T6XA 2G0TA 4JSYA 5H1YA 2BM1A 1N2ZA 1JYEA 4DW8A 4DDVA 3NWBA 4AXBA 1KMQA 1COZA 1P7VA 1EQAA 3AZOA 4G8JA 5DMHA 4A2CA 4AT1A 1A4UA 3TMYA 3IPAA 1HDCA 1HT3A 4E03A 2ZQ5A 2H2FA 4NFHA 1BWQA 1T8YA 2BFCB 2YIJA 3DBVO 2Y71A 3FZYA 3T9EA 1R9MA 4YV0A 1AKRA 1D7OA 1XZQA 4Q1CA 2O8BB 1FTQA 2ZUUA 5LXTF 2XZPA 3D6FA 3BK1A 2YIVX 2VP2A 2YVAA 1DUIA 3FIJA 4HQFA 1N7HA 4AMGA 1CY1A 5GV8A 2VRWA 2DMRA 2EHDA 5HUJA 1B93A 1S9HA 3BIOA 4ZQGA 2O8FA 3DO6A 1ZIOA 4EPWA 2D1YA 2W5UA 4MQ4A 5A62A 2WT8A 1P80A 2EZ8A 1MO5A 4Q93A 4WFJA 1EX6A 4PY2A 2OGSA 4HPWA 1O6ZA 4HAXA 3IIKA 4Q4JB 3PWSA 4JIMA 5CDFE 3KAKA 3VU8A 2GN2A 2M2IA 4NCHA 4R98A 4CG2A 3HNPA 5G41A 1JR3A 1JEYA 1PZGA 5LJIA 4D3XA 1KJWA 2J8ZA 4PX3A 3RTCA 4ARAA 4KIJA 2RB5A 1G20A 1ONOA 1ORTA 1HLPA 2CNDA 3LI2A 4M1QA 1KYWA 1REQA 2ZIXB 5H7XA 2GA8A 5C8YF 2QUKA 4GAEA 2DHDA 2DTDA 2ILVA 3KUDA 4XWKA 1VP9A 4H7JA 1NF8A 1W75A 5E7JA 1PAUA 2EJTA 3G0IA 2QF7A 4C4SA 4LF9B 1RRCA 5C1OA 1Y9JA 1DKNA 4WERA 5AUNB 2VJOA 3DCIA 2VHCA 5BRAA 4Y6SA 3IRUA 4YAEA 1MEJA 3JWHA 1V3TA 3H86A 4PO3X 3RIMA 3RVOA 3WGLA 2ZK7A 2IUSA 3W2TA 2IVFA 4HSGA 2F1HA 1P5RA 3EJWA 2MSNA 1ZD1A 1WVMA 4XKJA 3TW8B 1MO6A 3C45A 4F1JA 1NT4A 3EFOB 3CGGA 1CUWA 1YV9A 3GGPA 1OLSB 2IXEA 1H2YA 1KJYA 2BGRA 2I76A 2BTQA 2PKQO 2Q0HA 1U99A 1H3NA 1E20A 1JJIA 2NTYC 4BNKA 5ICSA 5EE5B 3RBAA 1T0UA 2NGRA 1E3WB 2GDJA 2GRAA 4KIUA 1DADA 2CMFA 2HADA 3IQFA 4AP6A 3KTFA 3FPBA 2HMTA 4LE1A 1N5LA 3E3LA 2WQZA 3NJ8A 4GLFA 4H3SA 1YA4A 4ZDKA 4LX0A 3ZHYA 3GC6A 4FCWA 1X38A 3L6OO 1TMGE 1JHVA 4CIWA 5A0TA 3GXBA 4MPRA 5IKPA 2H0RA 4MIKA 4CMGA 1GO2A 1Z38A 1QTIA 1T1JA 2BMWA 3SG0A 3I6IA 4PLZA 5D7NA 5F1PA 1EFPA 3VC2A 4Z8XA 1AY0A 4LY9A 3ZD6A 3ESCA 1YVEI 1FLVA 2ZAGA 2A35A 1KZGB 1AT1A 3I32A 4NESA 3SKVA 5EY5B 1L8XA 2ZRCA 3CVWA 3JV7A 4ENPA 1IEVA 4D9EA 4WVFA 1MQ9A 4UTNA 2E2WA 2E1RA 2Q3MA 2VCYA 1E0AA 2I33A 1U2QA 2IDMA 4CEIB 2R6ZA 2QW0X 5HNKA 1WXQA 2I54A 1BX0A 3ONEA 1QP0A 4M53A 4C4RA 1ODJA 4EW1A 2IGTA 3F5SA 2ZRNA 2IYWA 2FE4A 4KXUA 4BWFB 5BY2A 3PFBA 3FX2A 4BTEA 4PXAA 3G8YA 1A2KC 1XQYA 3AJEA 1U0GA 2YWCA 3DB2A 3D02A 1BEUB 5L3ZA 3TIFA 1VB5A 2YVKA 1E3IA 1UK6A 3RVQA 1QYRA 3AWDA 5F5LA 2PG3A 4G8DA 2C1ZA 3SLKA 4G0VA 5F51A 1QTQA 5LC1A 2RGDA 4B83A 4DSZA 1FXWF 1DNPA 1YU9A 3T99A 5K09A 1ZKMA 3AUSA 2DCMA 4ME6A 1CR4A 3F4LA 1H4TA 3G7NA 5EWLA 3RJZA 4CIAA 5I4CA 1DWQA 1SBHA 2W2XA 4MIYA 2YWDA 2ZE7A 5ICFA 5JMOA 4BMXA 1ABEA 1QRAA 3EH1A 4FGJA 2MDTA 3UK6A 4ABTA 1H66A 2AOWA 4YRTA 4EFLA 1R88A 1NI3A 3EASA 3T3PB 4ER3A 1AUQA 2VNJA 3H2JA 1LSSA 4I3GA 4AQDA 1W9MA 4EB3A 1CEEA 2OM6A 3TGWA 3OEED 5KMGB 2PVSA 1YXMA 1QTRA 2RKWA 4M46A 1RFGE 3D6HA 4ZP1A 4XPZA 1GAWA 2WWTA 4CYMA 2N42A 3GG2A 1C3CA 2O06A 2FPIB 1CR6A 2HQBA 2ZKIA 3CMMA 5KJEA 4ESEA 2WVGA 2A1TR 1Q1QA 2ZVDA 2Q21A 3D0KA 1T26A 3I8OA 4LDJA 4AURA 4JI6B 5KPJA 1U31A 2RHTA 3QKUA 2AKYA 4BO9A 3GLUA 4JP8A 1WULS 1GPYA 2PUTA 4WZAA 3K2QA 1SCNE 4IYRA 2PX2A 4ZQCB 1MVOA 2ZWIA 4C5AA 2DFVA 3R7DA 3KR1A 3QENA 3ZD7A 1OJ7A 1R6TA 5IW8A 5LR6A 1M1UA 3T5GA 1MG0A 4QQRA 4QYXA 1H4VB 2ZIEA 3BTUA 3CXUA 1L7OA 3PYLA 1LY1A 1X2EA 3JASA 4H0NA 1GU1A 4IO1A 3U26A 1G5IA 2Y1FA 1EQUA 2OO5C 2XD4A 5EZYF 3UZUA 2HCJB 2I7DA 3NW9A 4Q5IA 1LI4A 1Z74A 4R1SA 4YRJA 1EGAA 3RO7A 2PL9A 3BDIA 4ZO6A 4CM7A 4D9FA 5C4IA 5L40A 4FJ0A 2HQOA 1HA3A 1OC2A 1HDIA 2GN8A 2OE2A 4I4TA 3SNHA 1PV1A 1K27A 3F3YA 4PFJA 3KWMA 4UDNA 4WXPA 4R9VA 1M8FA 2AN3A 3WL8A 4F3YA 4K5QA 2PO7A 3QM1A 1JQJC 4IUDS 5B1DA 1YS2X 1SHKA 2CLHB 1DG9A 1ZXBA 3SSAA 2Q9CA 4E4TA 3NDIA 2RJNA 4MVJG 5HOEA 1RM3A 1SU7A 2PX8A 3HEMA 1L4NA 3FUWA 1YQWA 3IUPA 4LEIA 4RKEA 3PTLA 1JHUA 1QG0A 4Y7DA 3KJXA 3U61B 3HU2A 4QYSA 4DJ5X 4ONEA 3TNLA 4RD2A 3UGQA 2JW5A 2E5LB 2CXHA 2DBVO 4BMVA 1PQ4A 3JQGB 4E5KA 1F1JA 1SCBA 5D51S 1V1RB 2DKOA 3QEMB 3UMFA 4Q02A 1MO2A 5JTTA 4UOQA 3VJRA 3A4YA 4IXMA 5I3CA 1RP7A 2G3YA 1RADA 4L5CA 1GPDG 4EYOA 3RVJA 3OQVA 1X80B 3GA5A 3WVNA 1ZWLA 5IFLA 2R48A 2R8ZA 4ZCTA 4OREX 4G86A 1J39A 1M2NA 1FFAA 2BFCA 4U6QA 1O7JA 1H2WA 4JJGA 4MK4A 2QRKA 4DR3B 1XDSA 3C4VA 3C97A 2O8BA 2DLNA 4H60A 1OCEA 1R0BA 2GI4A 3PR1A 4EG8A 4AUKA 4KGVA 1WB6A 2F3PA 4GW3A 2COEA 3S29A 1GL3A 3DP7A 1Z2CA 2PXHA 3E7PA 1E63A 1E2MA 2B5OA 4XFDA 2FWPA 4G89A 1FUYB 4WBNF 1F2TB 5LNK1 4MULA 4OUDB 3GLIE 3DOOA 2PZJA 3NKFA 2WUDA 1E7WA 1M2HA 3ROGA 1ZGBA 2BKEA 2DUUA 2HHHB 3IO3A 3O4JA 3ON5A 3Q3EA 1U1FA 4RKQA 5EMKA 1RE1A 2HSWA 5BOSB 3AGPA 1OU0A 3P0FA 3EQ2A 1QLWA 1Y5IA 3PCRB 4G8BA 4C0QC 2EL7A 2C8VA 5KAMA 3DV2A 4HT3B 1VE7A 1WD5A 3FOZA 3SDBA 3TEMA 5JOQA 1CDZA 1U4SA 4KQFA 4X1KA 3ACCA 1SC3A 1JA9A 4K9RA 4KKVA 3Q85A 1TZBA 3L7KA 1Z25A 4C4AA 2GFQA 1JKXA 1S1MA 4IIYA 4F9TA 1QR6A 3AX6A 2J4FA 2WZDA 3DD5A 3DMYA 3IEUA 4BMCA 5K9ZA 1TAQA 1R0CA 2QRMA 3IOCA 5BSHA 2AD5A 2PHZA 1NQUA 2GM9A 3NTUA 2ILTA 1FS5A 4GYJA 2QPAA 4NCIA 2VJQA 4CQLB 3QIVA 3STWA 2GEKA 2HWUA 3OTIA 4NL4H 3T4EA 4OKNA 2JHAA 1OY1A 2ZRLA 4CJXA 2CJYA 1E0SA 1YHZA 1UK9A 1M1XB 2UYQA 3PHBE 5CYOA 3EFOA 5F12A 2YBEA 2B1IA 3RASA 1SQ6A 2OORC 4FWTA 1L7VC 1KGDA 3RRMA 5E7MA 1BDIA 4KHPB 2I78A 1E5TA 3FFTA 1OLSA 1ZIYA 2AHOA 3VO9A 2FSFA 4R3NA 4LWQA 1J2UA 1VTKA 4FSDA 1N34B 2X9NA 3CH7A 3B1VA 3NJRA 3IQDB 3Q0TA 4QSMA 3KQYA 5BYJA 1E3WA 2ZI7A 4LJ9A 3OPYB 2H1IA 3BZUA 2NSYA 2JCBA 3FF1A 4D46A 3R09A 1Y1KE 3UMGA 2FSPA 3T5BA 3NHYA 4B17A 1W36B 3RR2A 1XZLA 4Q16A 2V7EA 4I55B 3A4NA 4LQDA 3CLRC 4J0QA 1JJAA