1U0LA

Crystal structure of yjeq from thermotoga maritima
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
291
structure length
278
Chain Sequence
LRRRGIVVSFHSNMVTVEDEETGERILCKLRGKFRLQNLKIYVGDRVEYTPDETGSGVIENVLHRKNLLTKPHVANVDQVILVVTVKMPETSTYIIDKFLVLAEKNELETVMVINKMDLYDEDDLRKVRELEEIYSGLYPIVKTSAKTGMGIEELKEYLKGKISTMAGLSGVGKSSLLNAINPGLKLRTTTTAQLLKFDFGGYVVDTPGFANLEINDIEPEELKHYFKEFGDKQCFFSDCNHVDEPECGVKEAVENGEIAESRYENYVKMFYELLGRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable GTPase engC
publication title Crystal structure of YjeQ from Thermotoga maritima contains a circularly permuted GTPase domain
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 79
structure length 278
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 3.6.1.-:
pdb deposition date 2004-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03193 RsgA_GTPase RsgA GTPase
A PF16745 RsgA_N RsgA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.50 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Probable gtpase engc; domain 3 1u0lA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1u0lA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u0lA02
3J81i 1D9XA 3QBTA 4D6PA 3AF0A 3AKEA 2R93H 3H1TA 1D2NA 5DLQC 1T8TA 3RRNA 1AS0A 1TQ2A 2WICA 3KKPA 5TV2A 2Q2IA 3IO3A 1IBRA 1Q3HA 2QBYA 2B63G 4DWJA 1O3YA 1LB1B 2WWFA 4EPWA 3LW7A 3FKIG 1QHYA 1AGPA 3UWKA 1G41A 2JA6G 1M74A 2C9OA 4OYHA 4AG5A 4DR5L 3UPUA 1W36D 4CYMA 5G3ZA 3HJNA 3OEEA 1J2JA 1G7SA 1M6NA 4Y7NH 2WZQA 4L5RC 4L9SA 1QUQB 1UWVA 1P60A 4GI7A 1XTQA 4KVGA 4Z8YA 1VQOA 1TX4B 1XXHB 4ALPA 4A0FA 4UNNA 1HNWL 3KKNA 2H8KA 1D8LA 4HZIA 1OXSC 3K53A 4QGFA 4URXR 1JXOA 4BLQA 1XCPA 1GIAA 4TL6A 4D4LA 4JYBA 1H8EA 3U7FB 1CR2A 3EPJA 2QPAA 4ZDIA 2R62A 3KTAB 3L0SA 3LXXA 2VY3A 3P1JA 3AM1A 4XH9B 2BM0A 4DZZA 1E2HA 5FOVA 1P2UA 1YR8A 1RPZA 1ZM4A 4IOMA 3TBKA 5KNBA 1J70A 5DYGA 4NXNQ 1GILA 4RFSB 4XOIA 4FMBB 2IWRA 3OEHD 2A8VA 2V55B 3SBDA 4C0BA 2BDTA 4QNMA 3B82A 5HR5A 3Q85A 3WNDA 4EPRA 1JJ2A 4GLVB 3DKPA 2NTYC 3LV8A 1DOAA 1F2TB 4MZ9A 3HDTA 2OCYC 2HJGA 3H15A 4OL0A 1S9HA 3AP2A 4G0NA 1X3SA 3I92A 2KI5A 2IL1A 3KFUA 2E2HH 1WCMG 2CHVA 3BBPA 2LXJA 1SFOH 4Y0AA 4LJAA 4UPAA 4JMPA 5M5WH 4A9AA 2IYWA 3WRXC 3P4YA 4DDUA 2ZRAA 3GJ5A 1F60A 4YY3L 1TF2A 2AD1A 2OLKA 4M1OA 4M21A 3TKLA 2JLXA 4DUZL 5EXSA 3ZS8A 5JEAG 1KGDA 3F3YA 3NC1C 4TLBA 2BA0A 4W9MC 4A3LH 3UDFA 1XJ0A 3FTQA 2AWNA 621PA 1YHBA 4YCVA 1X1RA 4Q1EA 4O25A 3M3YH 3L0OA 3KXKA 3JC66 1FVIA 1VQ5A 2Z83A 1D8TA 1T0HB 3CRRA 4R4QA 2OFWA 3VR6A 2QSZA 4QG7A 4U00A 4DV7L 3S14H 1Q46A 1PA6A 2HT6A 4WZAE 2UXBL 4MKGA 5EUMA 2YZ2A 4YXWA 5ELNA 5C4XH 5J5CA 1GNPA 3CF0A 2UVQA 1ZYUA 2G0NA 2ATWA 1JE5A 1PLJA 3BOSA 4AYXA 4US1R 2HHHL 4UY8C 4WJ3M 3BFXA 3MXNB 4P0TA 1P16A 4Q66C 4X8MA 2NGRA 1W48A 2RGDA 1HY3A 2ZAOA 4HZUA 4IPGA 2UU9L 3I7FA 2FSIA 4LF6Q 3BD9A 4PO1A 3ADBA 2ORIA 1SR3A 4UP9A 2VL7A 3LX5A 3MWJA 3QF4A 1GAJA 5JSZB 4QRHA 3ZD6A 4JBJA 5GADC 4MGZR 2D0PA 1U8AA 1PH6A 3JZMA 4BLSA 1JALA 1Z22A 1IBKL 4QQBX 1A5TA 1PLLA 1ZM7A 2WWIA 2ZI6A 1PVOA 2GK6A 1UEJA 1UEBA 3U4VA 2IHYA 2R6DA 2ONJA 4YCWA 4DR5Q 2FDCA 2JA5G 3RZOH 1IAQA 1CLUA 1OFHA 2XX3A 5FTMA 2CL6X 2GF9A 1N5IA 5IYDG 5JRJA 2Y8EA 4DEYA 1OLOA 2GN5A 1X1SA 1OFUX 2CWAA 2P6UA 3PITA 2OTLA 3UMRA 1GITA 3CCJA 5FBRB 1W5SA 2RHQB 3B1ZA 3KQUA 3MSXA 3HPRA 4A3DG 1CJMA 2PNHA 2EFHB 2K5UA 4EFMA 3WHKA 5JEEA 1NJFA 1FTSA 3K9NA 3LBHA 5M3MH 1TL7C 2P2LA 1NVWQ 2O0KA 3KQKA 2FXQA 5C4JH 3CC7A 1KTVA 4BZPA 2VP6A 4GKJL 2GVBA 2J7KA 4PC3A 4MTNA 1ZUIA 2UUBL 4NCHA 1L4YA 2Z0MA 3THWB 4QM7A 4P4SA 4Q5IA 2GAOA 4YDSA 4QIWE 3TSZA 2BVNA 3MG9A 1TPZA 2VP5A 1R8QA 3WYGA 1VG1A 4KFRA 1KIMA 3FMPB 4HDOB 3HYTA 3HKSA 1D6JA 5E4FA 3GJ0A 1DAMA 3FMIA 2ZSBA 2AK3A 2QM8A 4N1AA 1YJWA 1JJGA 1NN3A 3BFKA 1I5FA 4BLPA 1P9RA 1YZKA 2ZROA 3CF2A 4ESHA 1X6OA 5C0XJ 1PYSB 4M53A 3M0EA 3TVTA 3KJGA 4DUZQ 1W2GA 1YZGA 1YR6A 4GN5A 4ZCLA 5JI2E 1OH8A 2OAP1 1LUZA 3M4QA 2PMKA 3CNOA 1TXYA 2IY5B 1RKBA 2GJ8A 4NCKA 1Z63A 3KDFB 4FCWA 1P2TA 3UE1A 2REOA 3W8RA 3SQXA 3H0GH 3LH5A 4PPGA 1RJ9B 2GHIA 1KI9A 4GNKA 4TLDA 4HUTA 4DV7Q 1E0SA 1H8ED 1LFDB 2JASA 4PMWA 3L43A 2O0HA 2ZXUA 1GD7A 3S15H 3FHCB 2UXBQ 2ZS9A 4FMDB 3RNLA 1OPXA 3K7AH 4BFWA 2GRJA 3W6OA 1VQGA 1KSHA 2VNUD 5C44H 2HHHQ 1XD9A 2NG1A 4BLOA 4JYAL 4N3NA 1ZW6A 4Q9JA 2ZS7A 4OWXB 2UU9Q 3GJ8A 5H70A 1N34L 4FWTA 8OHMA 1TQDA 3W34A 1KMHB 1GWNA 1NL3A 2C8VA 4D2IA 5CLQA 3HR8A 4R71A 1R10A 2CBZA 4IFDG 1ANKA 2HYIC 2WWWA 3CWQA 3NBFA 4BGDA 5J4VA 1T0JB 3U4QA 1VQHA 1IBKQ 3H0KA 4R2HA 4F4JA 2EU8A 1FPMA 2IF2A 3HOUG 4LDJA 2JJ8A 3TQCA 1B23P 4X64L 3EASA 5AWFC 1UKEA 4F4CA 2GZDA 2J0SA 4UXHA 1COWA 1B7YB 5AJ3L 1SVOA 4IDOA 2HV8A 2JA7G 4X65L 3HOZG 4POFA 1S9DA 4JLVA 1XRJA 2PLFA 5M3FG 2RKOA 4KYIB 3BJUA 1CEEA 2ZI5A 1FQJA 3B6YA 4P72A 1G8GA 2B29A 3IQXA 4M1SA 2IUUA 4DIEA 1YRAA 2JLUA 3EG5A 4DV5L 1DEKA 1G7TA 5H8WA 3LAWA 2ZR9A 2RAPA 1LYLA 3KXLA 1E0AA 1NLFA 3CRW1 5FR2A 3I56A 4YXWD 5JHGB 2J0QA 1Z0JA 3HYRA 1NE3A 4A2QA 1NRJB 4GKJQ 5HTKA 1XMJA 1PLKA 1JMCA 3AEZA 1JB7A 4Q1FA 2O52A 4L9WA 1VQEA 2KBEA 2ZREA 3S16H 4OK5A 1XP8A 3GQBA 4CVNA 2D7DA 1W1WA 4A3FH 3CQZH 4AQYL 5H68A 5CB8A 2XZPA 1VKJA 3H3VI 5IE8A 2UZ3A 2IS2A 4GP6A 3S2DH 2ZTCA 4R1JA 5TARA 1T3HA 2V1UA 4WIAA 1W0JA 1Z0AA 3V4RA 1ASZA 4PQRA 2AL7A 3OFNA 3PR1A 1A0IA 2OILA 2KBNA 2GXQA 4AYWA 4HAXA 3PJRA 3L7ZC 2ZAMA 1YZLA 4KSCA 1G6HA 4DLZA 3AFPA 3OIYA 3RLOA 1CBUA 4B6FA 4A93G 1NBMA 2D06A 1A1VA 2WHXA 1FP7A 2NN6G 2PCLA 1KZ7B 3U61B 4JV5L 4HAYA 5M5XH 2CE2X 2VA8A 1KK0A 1FW6A 3ZYCA 3CRVA 4IEEA 1S3SA 2EIFA 3RDPA 5CM8B 3IEUA 4HYYA 3AKYA 4TTPA 3TE6A 3W6PA 2VUMG 3HOYG 1UEIA 2MSCB 3NBZC 3NWJA 5FBVB 2NVQH 4LFBL 4FCVA 3NHAA 2K75A 3E2IA 4B3ML 5HE9A 2XITA 4J0QA 2HDNB 1HA3A 2L15A 1K8AC 2G3YA 1XTRA 2HXSA 2VSXA 2FOLA 3QVVA 3GLFB 4B35A 4JYAQ 2CKZB 3M7NA 3PO3H 2CCGA 4MRVA 3TLXA 1N8RC 1N34Q 4BBSH 1F5NA 1UDXA 1CRQA 3PUWA 4ILEA 4YONB 4A0RA 2WAQG 4PHTA 3ICEA 3M4OH 1XMQL 3IQWA 5TMPA 3J81c 1NTGA 4G5SA 4CEHA 1CJTC 1JAHA 2IYLD 3B60A 4URYR 1XNQL 1PFSA 2ZRCA 5FTLA 4HUQB 2DCUA 1LTQA 1JQLB 1I4LD 2Q2UA 1XZQA 4KITB 4X64Q 3GTOH 3G4SA 5SZIA 1R0YA 4TVAB 5AJ3Q 2WJJA 3D8BA 4A75A 3HP1A 4X65Q 2QA5A 2PT5A 2AKYA 3CZPA 2J87A 3QG1A 4DSTA 2WTUA 1HURA 4Q4HA 4C3HH 1NI3A 1X55A 5KSPA 3L8YA 4WZBE 1WQ1R 3NKVA 5FOSA 2REXB 4Z51A 1VG0B 1RC8A 4DV5Q 1ZNXA 3B8HA 4DSOA 4JI3L 1E7ZA 3RZDH 1G17A 1NMZA 1QZXA 2DFLA 4FIDA 4RKFA 4Y52H 4LJ8A 2FSHA 3DM3A 5CDFA 2AFHE 1N5JA 3BB1A 3I61A 1FUUA 5GAGC 3SYNA 4LHVA 2NO7A 3BB3A 1KDPA 3LXRA 2ZUCA 3TR0A 2YNMA 2BBSA 5FLMH 1PV4A 1DO2A 3R8CA 2QMUA 3A1SA 3RSLA 1TUEA 3TAHA 5EP1A 1QHIA 4NPHA 4QHSA 2H16A 1N36L 2J59A 1WP9A 4AQYQ 4MDFA 4PAOA 4OI4A 2XXAB 2AKWB 3RN5A 3EWAA 2CDNA 3RAPR 3TQFA 3SS8A 3B7GA 4O0MA 1RL2A 2CE7A 5IP7H 2I1VB 4AI6A 4P31A 1EG7A 4G5OA 4L5SA 4UNRA 3ZH9B 2GKSA 4TN1A 1S0UA 1A62A 1E2PA 1P3JA 1R0XA 4LPSA 3MMPA 1P9NA 2X2EA 4CEJB 2IC5A 3SJBA 4DIDA 1H65A 2FGKA 1TU3A 1L1OA 2FFHA 4JV5Q 1ZVQA 4Q4AA 1WOCA 4A0GA 1KI4A 1YHQA 3SHFA 1HE1C 5JCZA 2IEZA 4TSFA 2ZTSA 3RYTC 3UMSA 2AHOB 3MGCA 2NMVA 2OT3B 2H92A 2EYQA 3IPYA 4EPYA 4A3KH 3TS0A 5ELOA 3GTQH 3HOVG 3DMDA 3KZ1E 4M9XA 4AG6A 4PZYA 4LFBQ 2ZTEA 2A7QA 1HH4A 4C0AC 2GZHA 2O8BB 4B3MQ 2CHGA 3KOJA 1G3MA 1NN1A 1YKSA 4ZIRA 4AIMA 1EESA 1XB2A 3QY0A 5C46F 1LV7A 1AN0A 2G77B 1KHIA 3BRWD 1GNRA 3WBKA 3RNUA 3CX7A 4BY7H 2C98A 4EX5A 1E2GA 1M1YE 3GO5A 1NN0A 2Q6TA 3C7KA 3I32A 3DLLA 2A30A 3KUDA 5IHPA 3GEHA 1H8HA 2A5FA 2D0OA 1PH8A 2W83A 1EK0A 1X8KA 3D6TB 4QNRA 1XMQQ 5DI3B 3CNLA 1Z2AA 3VNUA 1N6IA 3CC2A 1OHHA 2V54A 1KZGB 4LJ7A 2K4KA 4IW3B 4A3JH 1XNQQ 4R7ZA 1W0JD 1AA9A 2VHTA 4QJFA 4JI6L 3OFND 1N5LA 4URVR 4QFMA 4HJ9A 1PYBA 3TJZA 2OCAA 3KJHA 1IJFA 1Y1WH 1JJ7A 3GLGA 3ZJYC 1Y1VG 2CCKA 4M9ZA 1AZSC 1NBMD 3HU3A 4F38A 2WWGA 3NBXX 3QKSA 3RS4A 5B30A 4KLKA 5IYCH 4JI7L 1KI3A 1MO5A 3O8CA 2F55A 2IXEA 2JLWA 3B6EA 3QBVA 1A82A 3SN6A 3UG6A 2GBLA 3MCAA 4NH0A 4EQ6A 1KI8A 5LMUL 3UDXA 1PH9A 3GTLH 3CCVA 1ZCBA 3QEJA 4DLUA 4HLDA 4JI3Q 1QHHA 2YHSA 3K9HA 3GLIA 3KLWA 1UBGA 1E98A 5CM9C 2BEJA 4Q47A 4ACBA 2WM9B 5GJCA 3RWOA 4X8LA 3ZD7A 1IY2A 1EX6A 2A78A 4A3BH 2MO0A 4KV9A 4AH6A 3K0SA 4C2TA 2ERXA 4LPKA 3OZXA 4LYFA 2CFMA 5KDLA 2QT1A 2VHCA 4JLBA 5C18A 2N78A 1AKYA 3SHWA 4BXXH 3WMGA 4W5HA 3CRMA 2VRWA 2IYUA 2QEQA 2PLRA 3FPAA 1W44A 1E94E 4PPNA 1N6HA 5SZJA 2MSDB 3K7UC 2O8EA 5KTYA 1N36Q 3DHWC 3JZAA 4C2MH 2W2TA 3L8ZA 2Z6KC 3O8BA 4LV6A 4PC7A 5HCIA 2QM7A 2V6JA 3REGA 3RRZA 3SJCA 4DLSA 2ZM6L 4XWKA 4LYAA 2HIVA 1NN5A 3QPUA 1KY3A 2OQKA 1YJ5A 4HLUC 1JQJC 4JLJA 4Q4LA 3W1BA 1BBWA 1EFUA 2WSSD 1KQSA 3MD0A 5L3QB 5AUPB 3THXB 3QQ5A 4PZZA 3FOZA 2JCSA 2GZAA 2BMDA 3A58B 5KUTA 3KQLA 1TWAH 3PUVA 1PH3A 2JJQA 1UBCA 4CT4B 2FH5B 2J5XA 4IFBA 5K8TA 2F9MA 4DK6C 2VQEL 3ERSX 2IYXA 3CH4B 1V5WA 4DC9A 4XSHA 4KODA 4C3JH 3GTJH 5E7NA 1R7RA 1ZCAA 2IHBA 2NO0A 4Q1DA 4U5XA 1GVPA 1KO1A 4KYUA 4EJSA 4R4OA 2JJ1A 2ZJOA 2ZR0A 4QBGB 4OKSA 4DV0L 1QG2A 2GK7A 4GLXA 1XTSA 4FMDF 3M9BA 4I1UA 4TLAA 4O0AA 3E1SA 1VQJA 2WB1E 4GOPC 4JBKA 1U0HC 3H84A 4NXML 3AGPA 3B2EA 3KXIA 4KHZA 3AF3A 4Q9KA 3G0HA 1S8FA 3I62A 1Z9FA 2NZJA 4PZLA 4QHTA 5BYJA 3TR5A 4IDQA 1NBWA 2HF8A 4L15A 2J0VA 1E1QA 4BZXA 2W0MA 2PQAA 4U02A 3QPVA 3EZ6A 3KF6B 2YV5A 3PIOA 4KAXA 4A8JC 3OEHA 3L2PA 4MYCA 4GL2A 5IYBG 4IDNA 4JLPA 5FBLB 5CDFE 1HYQA 4NU0A 1SXJB 1E9CA 3KKOA 3EPHA 2IK8A 3JAMc 2IX3A 2YTXA 3CB4A 4X62L 3CCSA 5C3EG 4A3EH 1X54A 4MRSA 4XD7D 5EXXA 3B5JA 1E3PA 2RF4A 4JI6Q 2ZRLA 2G1KA 1ZM9A 5CLLA 4TQ9A 3GTMH 4LHYA 3VR4A 4KLZA 5AR1A 2A5DA 3C41J 5IY0A 5GROA 1NVUQ 5C2JB 2O5VA 1FX0A 1W46A 2WV9A 4M9SA 3ADKA 3MWKA 4BE7B 1Q22A 3U58A 4CT5A 4JI7Q 2QPTA 4M2LA 4B3RL 1ZC3A 4JJKA 4YMVA 3AKDA 2AMCB 1U9IA 5KSYA 5F9HA 5LMNL 4P73A 2OBMA 1Z0IA 2RGEA 3PUYA 5F2EA 3A4NA 4NCJA 3I4MH 3AVPA 3N5CA 3W8NA 5LMUQ 3U3MA 3B85A 3AUXA 4TYWA 4AKGA 3SYKA 4EKDA 3BU2A 1P4SA 2DPXA 4MRRA 4A3IG 6Q21A 4ARZB 4KFUA 3K70B 4DT1B 3EZFA 1EXMA 4B34A 4IJHA 1MT0A 3GJ3A 1LW7A 1ZUHA 4QBIA 1SVLA 4H1VA 3TUZC 2V1CC 1Z6TA 2DFKB 3MWYW 5GADl 2F1JA 4IHQA 4MUBA 4UNPA 4C3IH 1RRFA 2E9SA 3CH5A 4ITRC 1UBEA 3I2ZA 1GL9B 2ZTDA 4LJYA 2YWGA 4GNXB 4MKIA 3THYB 1XNRL 4F91B 3FMOB 4TZ0A 1WBDA 5FTJA 4MA4A 5EE3A 4KHPL 4ASUD 2D74A 1G291 2IT1A 1OF1A 2ORWA 5JHHB 2ZM6Q 1OHHD 2EVWX 2ZRKA 3U44B 4EDHA 5C1BA 2UUCL 1E2JA 4G3XA 2GVDC 1QUQA 2ZUBA 3ZQ6A 4FW9A 2R9VA 4DKXA 4DDVA 4OO1I 4UJ5A 1QVRA 2ZRFA 2R92G 2XB4A 1Z28A 3CX8A 5CK4A 5KSOA 3QSYA 1T5LA 4GKKL 1JXMA 2QQEA 4M1YA 2I5LX 4LF8L 3TUIC 1QZGA 1DARA 1G9XA 2VTKA 1IN6A 2VQEQ 1DGSA 3AEVA 1M34E 1YBYA 3K09A 4EPXA 1MKYA 3KTAA 4Q7KA 3RHFA 1S3OA 4V02A 1N0VC 3CXCA 2WPDD 2EWWA 1Y63A 2Z5FA 1YR9A 3ZVMA 1P72A 2V8OA 3GLGE 4DV0Q 3ASZA 2PI2A 4A76A 3X1DA 4RFSA 4LBWA 4ZO4A 1XMIA 1N9WA 4NXMQ 3X1WA 2VLIA 1R4AA 4GN4B 1CU1A 4D4JA 3VX4A 5JJLA 4CEIB 3CNNA 4E22A 5H1SE 1F2TA 3ADDA 1N2CE 3GLIE 4QKQA 2MFIA 2EQBA 2FV8A 4PHHA 3KB2A 4Q18A 4TLCA 4EPVA 3AF2A 2D4HA 2PT7A 3JVUA 5EE0A 1ELOA 4TMZA 3GCGA 5FPHA 4GT1A 4PSKA 4A3GG 2ZI3A 3IO5A 2PEZA 4DPGA 2C2HA 4IFEA 2WWXA 1ZIOA 1OB5A 4X62Q 2BCGY 2JA6H 4ESVA 2B92A 1M7BA 1TMKA 2BJVA 2KCTA 2ZJ2A 2G9NA 2RHSB 2WJIA 3X1XA 1AZTA 2MQHA 2QMHA 2VH5R 3A5ZB 5B2ZA 1HT2E 3K0CC 1N6OA 2ONKA 5DH9A 2JA9A 1NVVR 3GTPH 2QE7A 4DCNA 4MYHA 4B3RQ 4WOPA 3ZZ0A 4LZZA 2HQLA 3E9HA 5LMNQ 1JJCB 3BAFA 1SVMA 5G41A 2F4VL 1N0UA 3NH6A 4DJTA 3SFVA 4B44A 4H1UA 2JJ1D 1DTSA 2QP9X 1TF7A 2DWQA 2O8CB 1ASYA 4ERNA 1XCGB 1JBKA 1II0A 2BV3A 5SZKB 3EPKA 1XEWY 1KI6B 2NO1A 4URZR 2REBA 4WJ4A 4QGUA 2R93G 1C9KA 2P6NA 4GP7A 4O2RA 3VMFA 4B47A 5IP9H 4KVAA 4GBMA 1S2MA 2BOVA 2E1RA 1W0KD 4LY6A 1KAOA 2DGYA 4M1MA 2L0XA 1VDZA 1E1QD 2EFEB 4L5TA 5JSZA 2CJWB 1XNRQ 3UE0A 1DE0A 1KO5A 4KHPQ 3RRYA 4CW7A 1A7JA 2IYYA 1QHSA 4NBSA 3LGJA 3FKQA 1I4DD 4QOSA 4G1UC 1IBML 1MIUA 1GL7A 4XTCS 2VQFL 4LUZA 2BEKA 2BKUA 2UUCQ 2YC2C 3LQQA 3DO6A 2G6BA 4A2PA 1O7IA 1E99A 4Q9HA 1T4GA 2B3GA 1R5OA 1E9EA 2FJUA 2IA5A 3DOFA 1ZC4A 4WAUA 1SVSA 2J9RA 2ZJ8A 2AD5A 2QAGA 4ZCMA 1GDDA 3REFA 4BRWA 2MNAA 1J90A 3TAUA 4HIMA 1P9WA 1C7YA 4GKKQ 4X6AH 1YR7A 2CLCX 3DZDA 3X2SA 1ZM2A 3EZ2A 4LF8Q 3AVTA 4J15A 1WA5A 1AIPA 2ZSEA 3AKCA 1VCIA 1BKBA 2ZSAA 1KI2A 4DKAC 1R0ZA 4TMVA 2ZRPA 3OHMA 1KYIA 3FKSD 4DUYL 1PUJA 1FQKA 1K83H 4JI4L 3GD7A 4MRNA 4RCYA 4JI1Q 5FI0B 1WJJA 2H5XA 1RZ3A 2RGCA 2EXDA 3LW8A 3THWA 2O8FB 4DK3C 1P75A 1XD8A 3CM0A 3L0IB 2ZRIA 4S2EA 4LRWA 4Q9LA 4BWYA 4V0KA 4D25A 1NJIC 4DLXA 3T34A 2EWVA 2AX4A 2YOFA 3QKRB 2JLYA 3PO2G 3U2QA 2C04A 2MMGA 3E70C 4LV5B 3TREA 2JA8H 3C16C 3QI2A 2BCJQ 1IN4A 3AFQA 4LJ6A 4PTLA 1DVRA 3PIPA 3E5HA 3LX8A 1KOFA 3D0FA 5JFGA 2AKAB 3KJIA 5AJVB 521PA 4A3LG 4OQLA 4B3GA 1GZSA 3N70A 3PEUA 3I4NH 2G83A 5UKDA 1M2OB 2WOJA 4HIKA 2B6HA 4MITA 2VF8A 2LCFA 1JJVA 2YTVA 1ZD8A 2LKCA 1ZD9A 1ESMA 3ZS9A 4EFNA 1OH7A 1MJEA 1Z08A 3KDFA 2QMOA 3ULLA 4TTQA 5FOWA 1JEEA 2UXCL 4RKEA 1Z07A 2C9CA 2WMNB 4D80A 2WOOA 1RJ9A 1KDOA 2QI9C 3CC4A 121PA 3WXMA 3WP1B 2O8DA 2YWEA 5AUOB 3EW9A 2A19A 3I72A 2PEYA 1YHNA 2F4VQ 3SFZA 1VS0A 1KKMA 3BC1A 3CO5A 2XGJA 4A1FA 1HNWQ 3GMTA 1Z83A 2K50A 4QJ4A 3BGWA 2EFGA 5FUVA 2KBFA 2AWOA 5EE9A 4P4UA 3NEJA 4UXIA 2P0EA 3C8UA 3RS7A 3V9PA 2JIZD 1E2QA 1SKYB 1TEXA 1T8UA 2OBNA 3L82B 5A4JA 5AUQA 5BXQC 3FHTA 1KMHA 3KB1A 5FBQB 3K9GA 3SJAA 1IYJB 3S1NH 1XEXA 3A1UA 3B1YA 4M1WA 2IWHA 5JWOA 1E9RA 1VQLA 3U3JA 2QZ4A 3CD6A 1NMFA 3A37A 1KD1C 3SE0A 1M90C 2PI2E 1JB1A 4LWZA 4M0LA 1J5EL 2GEVA 3SBEA 2ERYA 2GVZC 5JLJA 5EAYA 3QVUA 4RD2A 1IBMQ 1ZU4A 2VQFQ 5L3VA 1IONA 5K8LA 2ZITA 1II9A 1CKNB 2KENA 1G7CA 3FDIA 3KKQA 4XJXA 4LJ9A 3Q7PA 4D0LB 2CK3D 1YEZA 2ZYTX 1PZNA 5EP2A 3B1XA 3PSIA 4POAA 1FJGL 1E1TA 1G3IA 4FMCB 2D62A 5M3MG 4IOCA 3RANA 4YY3Q 1XF9A 2QE7D 4JLMA 2UXDL 3A0JA 1Q1ZA 2J41A 1XJQA 4OHVA 3W90A 5IK2D 2VP2A 1Z5ZA 1GUAA 1G18A 1YHAA 4HIDA 2OBLA 1UKVY 3VFDA 2BHRA 4DUYQ 4HAWA 4LUCA 1P2VA 2GXAA 4JI4Q 2B7CA 4DLTA 2GJSA 3LVRE 2K5HA 1U8ZA 4UXJA 4DLVA 2ALYB 5KHOC 1W2HA 2R7FA 3BH0A 3D3QA 3SC3A 2I5MX 4GMDA 3SOPA 3TK1A 3U3OA 1MOZA 2IEYA 3GFOA 2IX0A 4HLCA 2X1VA 1MRSA 4DDWA 3R8FA 4DR3L 1IQPA 4JLAA 5FUXA 2IYTA 1G8FA 1W4BA 1W3SA 1MABB 3CX6A 1DELA 821PA 2KCMA 4DV2L 3JAMi 2NQ2C 1Q1EA 1VCNA 2B7BA 3W3AA 2A2ZA 2V6IA 5DSZA 2OUKA 3BK7A 3HFZB 3ER0A 2GA8A 1GKYA 4BASA 5DISB 1XTJA 4KBFA 3K0XA 4S35A 4B2PA 2DWOA 2H18A 4HAVA 1WRBA 1TF5A 2QSYA 4IVPA 4BFYA 1VQ9A 4MQBA 1OXXK 1Z8FA 4I1VA 4PO9A 4RZXA 3T06B 5IRCD 3H0GG 3IEVA 3PUZA 3R20A 3MRSA 3W9YA 3KKMA 1OKKD 4Q03A 1EFTA 2QN6A 2UXCQ 2YKGA 1AM4D 3QG5A 4GOJA 4JOIA 1X6VA 4A6PA 3RWMB 2V9PA 3PEVA 5E7JA 5C44G 4DV6L 3C5CA 4LHWA 4BFXA 1F2UB 1AH9A 5JJIA 4OHXA 4PSVA 1Q57A 3SDZA 1I4TD 2ZR7A 4B3SL 4KCGA 5EQTA 3FHOA 2HUPA 4KJZA 3GLFA 3TSWA 1E2MA 4TMWA 1NVVQ 2VZAA 3B1WA 1VPLA 3T61A 1KC8C 1SQ5A 2XTNA 5FUYA 3KQNA 1AGRA 3S1MH 3EX7C 4GS3A 1F6BA 4GOXA 1D9ZA 1Q0UA 1Z06A 3BE4A 4DCVA 5AUNB 3IRBA 1DG3A 2ZPTX 2IHFA 1X3EA 1U94A 5FOTA 2JEAI 1L2TA 2ZRNA 1KL9A 1VQNA 2E5LL 1FNNA 1WXQA 2UUBQ 3NIBA 1J5EQ 4HUQA 4JVMA 3SZRA 1KJWA 1UBFA 2ATXA 4PG3A 3PENA 4JSYA 2R44A 4HSEA 1IBLL 5J4KA 2F7SA 1GO3E 4JZKA 2VP9A 3QKUA 1VMAA 4PPFA 4WVFA 4DHEA 1DPFA 1UM8A 2KSQA 1X8LA 1IZ6A 4NZYA 4DR6L 2ODWA 4OHWA 1WMSA 4OONA 2D2EA 2F9LA 4IFDJ 1NKTA 2FU5C 2C35B 2XJ9A 3Q3JB 4KU4A 5BR8L 1Q81C 2FFQA 4TL9A 1ZBDA 2ZRHA 4NDZA 4WW0A 3T35A 4P3YA 4W7SA 1FJGQ 4DUGA 2R7ZH 2GWHA 3DM9B 2UXDQ 2RGGA 1EFWA 2BMJA 1XU4A 2ZU0C 3CBQA 1DG1G 1U0JA 2CCZA 1IHUA 3CCEA 2VUMH 2R6AA 4JT2A 4JLKA 1AJEA 1WF3A 1II8B 2WJHA 3ASYA 4TMXA 1DAEA 1OW3B 2RGNA 2KHIA 4XIGS 1T3SA 3CF5A 1RVDA 2PX3A 2SHKA 2LXKA 4AKIA 4GOKA 2ZRJA 2WIBA 1TWHH 1NP6A 2D7CA 1SKQA 3PF4A 3IILA 3AVQA 3WYAA 4EUNA 1KDRA 1WDTA 4DR3Q 3I3SR 3M85A 4ZKEA 2R7DA 1R9TH 1NMYA 2OCPA 2ZVQX 2R6CA 1VQDA 3I1FA 2R6GA 1KIXA 3EC1A 4JG2A 1QVGA 1XTDA 4QM6A 4DV2Q 4A3CH 1P62B 5FLXc 1CKEA 4TYNA 3AYHB 1Z0DA 2XEXA 1S40A 2XTZA 1KHTA 4HAUA 4IPDA 1EQQA 3OYYA 5GQOA 1HTWA 4HDCA 3TMKA 5FI1B 4CEJA 1VQ8A 3SNHA 5KDOA 1TQ6A 2JATA 1E2EA 2NPFA 3ADCA 2GETA 3F2DA 4PQFA 2WSSA 2FFBA 3S1QH 1QHXA 2FFAA 1VQ4A 2XNDA 3TW8B 1E32A 2AHOA 4KO8A 1NG9A 1DAKA 1NSFA 1EWRA 1HZCA 3NELA 4LC1A 5EXTA 2BWJA 3Q5EA 4Q02A 4JL8A 5L3SB 4AKHA 3A6PC 4DV6Q 2FPKA 4US0R 4IJMA 3GDEA 3KFVA 2O8BA 4KLNA 3F2CA 3RC3A 1K5GA 4B3SQ 1VHTA 1ZRHA 2W00A 3P20A 3PO3G 4A3MH 2F3RA 3BORA 4A82A 4AKEA 4BUJA 2J46A 4PZ7A 4BBSG 2WAQE 1L8QA 1QRAA 2FG5A 4NYIR 2VSFA 3IKJA 1EFCA 2R2AA 3W5IA 1QVFA 4JI8L 5HGQA 3CCLA 2PBRA 1LY1A 2QP3A 4M1TA 3WMFA 4B48A 4OO1G 4Z8XA 5DI3A 3AVWA 2AR7A 1G4AE 1J99A 4LHZA 2MO1A 3SQWA 2W6ID 1HR0W 5DN6D 3Q8DA 2ZYWX 2E5LQ 4IKEA 1W7AA 1KK1A 2OFOA 4GZLA 4B6EA 2N46A 1EYGA 3QXXA 4B75A 4Z1MA 1ZJ6A 5KO2A 2XAUA 4NMMA 5KYKA 4OJQA 3TGPA 3K1JA 5J4YA 4DR6Q 1EGAA 5KDDA 4XD7A 2QU8A 1HV8A 3G5UA 5BR8Q 2WVJA 1XD2B 2VBCA 3QXJA 5C0XI 4QJ3A 3GLHA 4FD2A 2C96A 3AH8A 3EXAA 4QBHA 1XEFA 1Z6GA 1IY0A 4F7WA 4XSGA 3FMFA 5SZHB 2EFCB 1FMJA 1IOZA 4TYQA 5JCPA 4Q7LA 1I3QH 4TMKA 4DSUA 4AYBG 3HOVH 1X9NA 4B2LA 3LRPA 3QKTA 5FLMG 2QNRA 2ZANA 5A5GA 1J8MF 1SVWA 1ONBA 1CXZA 1OJLA 1Z29A 2ODNA 4AY2A 4YQFA 1UE6A 3M4YA 2NZ8A 1E96A 2W2XA 2NIPA 2Z43A 4AD8A 2K5NA 1QVCA 2E2JH 4E07A 3T1OA 1PHJA 4LJ5A 5IP7G 1HR0L 1U5KA 1G5RA 2G88A 1HNZL 2NOAA 3CW2A 2B8TA 4Q1BA 1CJUC 5D3MB 2A5GA 5EE5B 4YMSA 4CEHB 5DNYB 1CSQA 3K80C 2VO1A 3GLFE 2GJKA 1K73C 2N8NA 3AB3A 4W5WA 3VDYA 1KAWA 3MEFA 4RZ3A 4ASUA 2QPOA 5L3QA 1LVGA 3S1AB 4DLWA 5P21A 2VHUA 4L8GA 3IUYA 5CITA 1ZNYA 3TS2A 4P32A 2BMFA 5BN4A 1U81A 3K8AA 2DHRA 4R2IA 3BERA 4C7OB 1PJRA 4K0KL 2LSSA 4A3KG 3QNUA 3SI7A 4DUGD 1G19A 3LVQE 5JMTA 3VR2A 3AVVA 1L1OC 1NKSA 4PANA 2AN9A 2DWPA 2V3CC 4DB2A 2QUZA 1VCOA 3EAQA 3A36A 3V4FA 2WKPA 4EAQA 4GLAC 2BMEA 5JWRA 3BS4A 2WPDA 2PMDA 1KMQA 1J8YF 1TAGA 3WNBA 1SLJA 1NBME 4JI8Q 2X77A 1JR3D 3KF6A 4HJ7A 1OYYA 1T6NA 2F6RA 2V7QD 2WJGA 4K46A 3IPXA 1NMGA 4QC2A 4BZQA 4C0SA 4OK3A 4E09A 5LDDC 1OB2A 1SXJA 4UNQA 4H9GA 4A3JG 4M22A 2Q2HA 5A0FA 3NXSA 4UP8A 1DO0A 1GRRA 4JL5A 3C5HA 4ZV4A 3VNVA 1M1KC 1HQCA 1Y1WG 2ZSFA 5JS8A 4EFLA 4DAYB 5K36G 1KI7A 1OIVA 2FEMA 2Q9AA 3NTUA 4MKFA 4TTRA 4C0JA 5IYCG 1E2NA 4JL6A 4P33A 1E6CA 1OFIA 4WZ6A 5EXPA 2BJWA 2VIIA 3WY9A 4ACAA 4R4IA 1XMVA 3ZIAD 4Q4AB 4ZI3A 4JI5L 3CPEA 1IM2A 1VQPA 5FJ8G 4LF9L 2F43B 3R7WB 4IOLA 2NO6A 1YNXA 1CR0A 2GAAA 4IDPA 4PPQA 4FMCF 5FL7A 2XNDD 1EX7A 3W1GA 5M04A 3WHLA 5K8UA 2XZLA 4NYMR 4DV1L 4DEXA 2BA1A 1YIJA 4BY1H 2NVTH 4A3BG 2KHJA 2EYUA 3JVVA 4CF7A 3NBHB 3ULJA 3W5OA 1CULC 2GBLC 2GEUA 2ZI4A 4BXXG 2DB3A 1B8AA 3KX2A 3CPFA 3TVDA 1MJCA 4RD0A 3QENA 3I4LA 5LMNW 4BA2I 3S2HH 3IBGA 3HOXH 5BW8A 3B9QA 3QEOA 2LWIA 2IW3A 4D0NA 4GNXA 1GKUB 2IYQA 1GKIA 4JBXA 5FBWB 3AF4A 3PG5A 2J0UB 3KYHC 3CZQA 1QHNA 1C9OA 1R0WA 1E9SA 2DY1A 1IXSB 4O2LA 1HR0Q 1I2MA 3B78A 1HNZQ 2X2FA 2HCBA 5IYBH 1W0KA 2ZRDA 3U44A 1XJVA 4Q1CA 1UKYA 3DKVA 4OQMA 5HKKD 4RG1A 1PH4A 1ZD1A 2XZOA 5CIQA 2N3SA 4GN3B 5TB5A 4AYTA 4EPTA 4Z1MD 4LF5L 2WFWA 4KXFB 1X3GA 1FZQA 2TMKA 3NVAA 1Q21A 3OIWA 3EN2A 3VTKA 1S4QA 2PCJA 1G8HA 2QGQA 3RS5A 3U7EB 2ASEA 2FN4A 1HUQA 5TVKA 3CONA 1Q1BA 3CCUA 2QGNA 1AKEA 2W0SA 4II7A 4Q4JB 3TSOA 2OFXA 1EFRD 1KO7A 1L2FA 4K0KQ 3BB4A 5G53C 3RS2A 3PIRA 3GJXC 3W5JA 4IXMA 4YWKA 1W36C 4KSBA 4N0DA 3GLIB 1XPUA 2C77A 3N2IA 4A36A 3VHXA 1GG2A 1AE3A 3I73A 4DLYA 4C9BA 3VKGA 4EJSC 4GOPB 2J7PD 1YJ9A 4QY7A 1JI0A 2FA9A 3FKSA 4CEIA 1IN8A 1DAIA 3EC2A 4LF7L 3RABA 3GLHE 3AP1A 4IDHA 1E9AA 3UKDA 2IF0A 1CKMA 2E87A 2ZJBA 2WKQA 2XNSA 2JDID 1FNMA 1YQTA 1C0AA 1E9DA 2C78A 2GXSA 1A8VA 5ANRB 4A8JB 4A3EG 2WJVA 4BBRH 1ZIPA 3F5FA 3RRMA 4PQYA 2BM1A 1QBKC 2B21A 2BKEA 4LBVA 4NL4H 4B32A 3G6EA 2GJ9A 1XCMA 3K0AB 3KUCA 1N33L 5EP4A 3UATA 4I1OA 1IXRA 1OSNA 1US8B 2PZEA 2WAXA 3GJ7A 3LFUA 1RW4A 4NE2A 3TW4A 2VP0A 4R4CA 5B64A 3PFIA 1XMSA 1FL0A 3KJOA 3QJYA 2OWOA 3HPQA 1Z6AA 3DVLA 3MJRA 2P67A 4JI5Q 3EPLA 3ZDQA 4BFSA 3OTOL 4LF9Q 2OE2A 4A92A 5BYKA 5M5YH 1J7KA 2GCOB 3CPJB 1NJGA 3QXCA 1XPOA 3EIHA 4DDTA 1WBBA 4BFZA 1XXHA 2JLVA 3AP3A 5FUWA 4V0MA 4B73A 4FWIB 4DV1Q 4MGYR 2ZSDA 1LM0A 4PR0A 2XTMA 5G40A 2GTPA 5HE8A 2O8CA 2C95A 3TEHB 2B8WA 1U9IC 1G5PA 4V0LA 1E2IA 1KI6A 3HOWH 2P3SA 3J7A5 1N6LA 1R5BA 1SULA 3A1TA 3AGQA 4A15A 1HZ9A 4D4MA 4PHGA 3FHWA 1XMOL 1T9HA 1BMFA 2ZUDA 4BFUA 5KPJA 5IF9A 3STBD 2QTHA 1KK3A 4PAQA 1KO4A 1UPTA 2Q9CA 5HY6A 4JVLA 2F1HA 1NG1A 1FTNA 2CJWA 2D2FA 1Q20A 4NYJR 2JIZA 3G82C 4QJ5A 1RFLA 3PQCA 4NHOA 1G8YA 1SXJD 4TQAA 1D2MA 1DAHA 4G5GA 1PUIA 1T3LA 2W2VA 4F92B 1GM5A 3QXSA 2IS4A 2UUAL 3WWVA 4JI2L 4PFSA 2ZU6A 3UANA 5JECA 4B3FX 2KB0A 3L2OB 2ZIAA 1CR4A 1ZNWA 3RN2A 1E2DA 1I50H 2PZGA 3DZ8A 1OXTA 4MYUA 4LF5Q 1UFQA 5KU1A 1YZNA 3R9XA 3ZVLA 1EQRA 4DB4A 3L0PA 2O8DB 3CP0A 2B63H 4MRPA 1XEWX 4YMUA 2YTYA 5KPDA 3FKIH 2E8GA 4FDBA 3TUJC 4A2WA 2WSMA 3Q8XB 2JLRA 2ORVA 4P74A 1TU4A 1LF5A 4F93B 4B3BA 3AF1A 1NF3A 4TWZA 1YRBA 2CK3A 5FL7D 2A9KA 3EBEA 4OQXA 1W5TA 2IUSA 2KJQA 1E79A 4IOJA 4JVSB 4CZ2A 2C5LA 1G7RA 3DMNA 4RVCA 1K8GA 3ECCA 1VG8A 3K70D 4FINA 4QGAA 5KNCA 1SVKA 3K09C 1UE7A 3E9IA 4LWCA 2GVAA 1MO3A 2JAQA 4C0HA 1TNDA 5IK2A 3LQRA 2KWIA 5LB2A 2O8FA 2CL0X 3G48A 4LCBA 2CL7X 3SGIA 1P6XA 4LF7Q 3QUSA 1AS2A 4BLRA 4XVUA 2GCNA 2RMKA 2J45A 3PVSA 1KKLA 4FXPA 1KSGA 4F4IA 3NG1A 3QKRA 3SYLA 5BN3A 4C30A 1R8SA 2YWHA 5FL3A 4LNQA 3A8TA 3DEFA 3QXHA 4KFTA 2XSZD 3K0FB 3CLVA 1VQAA 4KI0A 4ZPXA 5GJVC 4TZ6A 1UKZA 4A0HA 2NZHA 1KSJA 1S72A 2QG6A 2A5YB 1U90A 3KF8B 5ELXA 3IBYA 2RCNA 4HEJA 2ZJRA 1DAGA 2LKDA 3A1VA 4PC6A 1N33Q 2ZE8A 3FGNA 1OYWA 4LYHA 3VHLB 1I6HH 2V4ZA 4RFVA 2XB2A 4HJAA 1PH5A 2H5EA 1M7HA 4XWOA 3RLNA 2OTJA 1LTLA 2HJVA 2HXYA 1I94L 2GESA 3NC0C 4B3CA 5L8VA 1WCMH 1GKHA 3IIJA 4M9QA 4L5QA 4B71A 2CNWA 2F52A 1VYVA 3OTOQ 2ZE5A 4I99A 3A4MA 2CVFA 4ZI2A 1N5KA 4D0GA 1E9FA 2GNOA 2RGBA 1LS1A 4YCUA 1BH2A 5DE3A 1OKKA 5J47A 3T1HL 1Q12A 1FMLA 2AXPA 1KI1A 3ZLJA 1OXUA 4QL3A 5AJYA 3VR5A 5IP9G 1GTVA 3LDAA 4IVRA 2WWYA 5FPYA 1UAAA 5AJZA 2ATVA 4IJLA 3B1VA 1XMOQ 1Z6YA 3VU9B 1CSPA 5CJ2A 1N6KA 4NYMQ 4QBFA 5B58C 4LSGA 3NEYA 1FUKA 4FI3C 4LOAA 1CRPA 1BYUA 3X1YA 3OW2A 2J3EA 1GP2A 421PA 1SRUA 1BS1A 4Y0VA 1CS4C 3J80i 1YZ6A 2CLDX 3ONWA 2YOGA 1NVXQ 3PO2H 2X8AA 2D3WA 3VQTA 2ZI7A 2UUAQ 3FE2A 2IX1A 2HLDD 4JI2Q 1NLZA 4TMTA 2C9YA 4JLDA 1CKNA 1K0RA 4QL5A 1W49A 1QZHA 1ZNZA 2BBWA 4O3MA 3AVXA 4EQ5A 5TXGA 1E4YA 3GEIA 2JQOA 5HZKA 2QBYB 5CK5A 4UP7A 1UF9A 4WA7A 2WAYA 3T1VA 3CKLA 5JS7A 2AFIE 1IJEA 2H7VA 2VYFA 5FPKA 3WNCA 2ODBA 2JGNA 3P4XA 1E1RA 2OV2A 4MH0R 3NEMA 4B43A 2QAGC 2JA5H 3DOEA 4LUOA 2RGAA 3QIAA 5JEDA 3CCMA 1TADA 3MAAC 5AJXA 5DHFA 4GRAA 2QTVB 3GJ4A 2PJZA 3BJIC 4MDEA 2QENA 1V43A 5IYDH 5EJEA 2JJ2D 4TYPA 1YVDA 4OQFA 5F9FA 1EIYB 4FN5A 2YU9H 3GEEA 3X1ZA 3WRYC 1YZTA 3RR5A 3Q5DA 5C4XG 3MLEA 4A3DH 3P26A 1TWFH 2ZJZA 5LBIA 4ZDJA 2CMKA 2XTIA 5JEAJ 1W4RA 3BZCA 1BMFD 1NY6A 4LC0A 4UJ3A 1G20E 2QRNA 4C0KA 1XXHE 3PCOB 4KFSA 2JLSA 4V0ME 2OM2A 1GVNB 5J3BA 2JA8G 3AUYA 3EA5A 5DIFA 3FFAA 1MABA 3N2EA 3FVQA 4OQNA 4HLQB 3OF5A 1E0JA 2NPIA 5DO9A 1P61B 3RS0A 1G8PA 1OXVA 5C0XG 2IYZA 2OXCA 3PEWA 3I4NG 3D7MA 3OE7D 5J4LA 1RRGA 1S1CA 1W4AA 4MKHA 4XTRA 3M1IA 4ZCIA 4OBEA 5DLQE 4BFVA 2QAGB 4LBYA 5DYIA 2DUDA 2F1RA 4DAMA 2E2IH 1YU9A 4DCTA 4BQSA 3KFXA 3K0EA 5G3YA 1I94Q 1Q44A 4A6XA 2EQSA 4OK6A 1GRQA 4G5QA 1WI5A 1YI2A 3CR7A 5KOYA 4MNOA 1ESNA 4PO8A 2P5TB 3RLFA 2ES2A 4JLNA 1DAFA 1F2UA 3LA6A 4HDQB 1WCV1 1KDTA 4RZ2A 1IN5A 1GL6A 1E79D 2CLSA 3C14C 5TDHA 2ZETA 3U6KA 3T1HQ 3WBJA 1S3GA 4I4LA 4D81A 2XJ4A 4US2R 2EFDB 2G0TA 1KK2A 1XTIA 5B57C 2PJRA 1K9MC 4JBMA 3T15A 1E2FA 2ZYVX 4RD1A 4RSGA 4M1KA 2QORA 3WP0A 1EIFA 3P32A 3K9LA 2IXGA 3LD9A 1LS6A 5K8IA 2ANBA 3GPLA 1E9BA 4NCNA 4MYTA 1H95A 3PV0A 1G3QA 1MO6A 2A3RA 3ZQJA 4HZUB 5E7MA 3MJHA 4GSYA 4C0LA 4X8HA 1IXZA 4JIMA 4BA1I 1VQ7A 1MKHA 1JEDA 3QF4B 1QVAA 4ABYA 2FE4A 3BFVA 1X65A 3OEED 1UADA 2W6IA 4PSAA 2QY9A 3AQ4A 1U8YA 3QF7A 5DN6A 2FMXA 2OHFA 1WFQA 4LFCL 5FFMA 4NYJQ 1YITA 1M8PA 1NY5A 4QHYA 1ZINA 5EP3A 2PX0A 4IOAA 3HOUH 2GJAA 1Z6XA 4NP6A 5C4MA 4D26A 1XTKA 1Z2CA 2CNWD 3G71A 3IHWA 1NIJA 3GJ6A 1P8LA 4Q1AA 1XDBA 2JA7H 1Z47A 3HOZH 2IBMA 4AK9A 4OI0A 3CAMA 1LF0A 1VECA 5M3FH 2I4IA 4OI2A 3EZ9A 1II8A 3V00A 2C99A 2Q21A 4RD3A 1SHKA 3W3ZB 4JSTA 4P75A 2JA1A 5GJWC 2VP4A 1EOVA 2Y0SG 1V1QA 1OFTA 2G1JA 2QGZA 2QMEA 4C0QC 1VCMA 2P5SA 3ICQB 2FX3A 1GRNA 2OCBA 1P73A 4IOKA 4KBGA 2ECKA 4ZDKA 1XEXB 5CB6A 3CCQA 1TWGH 1EUJA 1TQ4A 2WKRA 1VHLA 3J81k 4HB4A 1L0WA 1SN8A 4APVA 1YZUA 2ZEJA 1MRNA 2ODEA 2WMOB 4IXNA 1GOTA 1RRCA 2BH2A 4HB2A 3T1TA 2IS1A 1W47A 1XZPA 1CR1A 3FWYA 3PGZA 1KJZA 4P4SB 1SKYE 1ZP6A 1N0WA 3SEAA 4JVNA 1QF9A 2QP4A 1CUKA 3TQYA 2IYSA 1SVIA 3GFTA 2UZIR 4RD6A 1NY4A 3U7HB 2RHDA 4LYJA 3I55A 4PHFA 5BWMA 4HIOA 4YWLA 4EIWA 2OQ0A 2CXXA 3RVBA 4B33A 3THOA 1Q86C 4ON9A 2GILA 2Z4SA 1ZUNB 4YWMA 2Y0SE 1MH1A 4TT3A 2W6JA 4U7DA 2CQOA 2GF0A 4DCUA 5LD2C 2F3TA 1CJKC 1E1RD 2RHMA 5FPTA 4BFTA 1QG4A 3TRZA 1GFIA 5L3SA 2CHQA 3U7GA 1NSTA 1IY1A 5IWAL 2OG2A 2WWHA 4A93H 1UE1A 1JPNA 2EW1A 1S1MA 2KE5A 4IO9A 2Q9BA 3FFBA 3AVOA 4XWAA 4CIDA 4DBLC 1N32L 1Q3TA 2C03A 3MWLA 4L5BA 2HEIA 1AK2A 1L7VC 4UQOA 3TNFA 4B3DA 1SROA 3J7ZC 4JOIC 1XX6A 2ANCA 3BIFA 2QA4A 1DBSA 5GAEC 1XJCA 3NHBA 4K8OA 3WMEA 3ZZTA 4Q00A 1P2SA 1VQFA 2HYDA 3ZZUA 3KQHA 3ULPA 3VAAA 3LBNA 4C3ZA 4D4KA 2XGTA 3HOYH 3EA0A 2JK8A 3A74A 3TRFA 1WB9A 2I1QA 4JBYA 1X8JA 3NDPA 2VHQA 3K8YA 1VQCA 4A3FG 3U3RA 3BZKA 1YJNA 4PZ8A 1HNXL 4JKYA 1K6MA 5FTKA 5FTNA 2HIXA 1JR3A 1R6BX 4I1SA 1XFAA 2V7QA 2NZOA 4R9UC 2IYRA 3U50C 2XXAA 1D5CA 4DSNA 2MMCA 1TTTA 5LD2B 4E5UA 4QXAA 3U4ZA 5FOUA 4IPHA 3U4QB 2YVUA 1UJ2A 4TL8A 4LFCQ 1T5IA 2QTFA 2YWFA 1G51A 4HJ5A 1G16A 2R7ZG 2HF9A 1XD2A 5LB4A 2ID0A 5L3RA 3M6AA 1KRSA 3SU8A 3I5YA 5FH9A 4JCVE 4P71A 4OWWB 4OX9L 1D7QA 2DBYA 3T12A 2Z4RA 3CPHA 3BH7A 3ZIAA 4ME3A 4R4TA 1F48A 3ETLA 1KSFX 1VYUA 5J40A 4B2IA 5GVSA 1B0UA 3LNCA 2CCJA 4L4UA 2XOKA 3KJPA 2GXUA 3CR8A 4FCTA 5CYPA 4RD4A 1N3BA 1F3OA 3CUEF 4MGIR 1M7GA 2P65A 4YMWA 5EZ6B 4NKRA 3CRQA 3DM5A 1PH2A 2WIAA 4DV4L 1OIWA 2FPMA 4XVQA 3BXZA 2RGNC 2J1LA 2VF7A 1EFHA 4JI0L 5JWHA 5D3MA 4DVGA 1KO8A 2ZS8A 4A3CG 3DDCA 4DNIA 4OI1A 4DR7L 2RB4A 3U3KA 1K5DA 4IVQA 1XWIA 4A4DA 2K5VA 3A4LA 2ZM5A 2NO9A 3S1AA 3I4OA 5GVRA 4Q7MB 4RMFA 3EIQA 1NIPA 2DFNA 2VQSA 3SR0A 4XVRA 4ZDWA 3KJEA 2DYKA 1J6QA 4HB3A 1CJVC 2NVXH 2OZEA 5HKKA 4N0EA 4C2UA 3TH5A 4C7OA 4LFAL 3I5XA 4RJLA 2FEOA 1VTKA 1IBLQ 1JAIA 5IDVA 2GEDA 2ZVPX 3QOFA 1EWIA 3A5UA 3K81C 5JI3E 4POGA 4DR4L 3VR1A 3NH9A 2VL6A 2IYVA 5IWAQ 3H2YA 3BWDD 2QAJA 4YMTA 1FL9A 4DR2L 4A3MG 1HZBA 1EFRA 1N32Q 2HT1A 3ZVRA 1KNQA 4LF4L 2JEBI 3DL0A 3OAAA 3MFYA 4YLGA 5J4HA 2F3IA 2Q0HA 5HPYB 3O8DA 4V0NA 2AK2A 5JZVA 1N6PA 4JKIA 2H1LA 2ZE7A 2QRZA 2VS1A 1G4UR 1BBUA 1RYHA 1HH2P 1UDWA 1P7CA 1VYTA 2FGJA 2MSEB 4GZMA 4PC1A 3T5GA 5JRZA 1DADA 2J7PA 1DS6A 1FP6A 3HR7A 4YDHB 4TL7A 5H1YA 5CJPA 1VIAA 3CF6R 3AQQA 3F1ZA 1HNXQ 1Z0KA 1SHZA 2ZQ5A 2BH8A 4QGGA 2ZJ5A 3CCRA 3UDIA 2JDIA 4HAZA 2ZI9A 5JBQA 5TY0A 1VQBA 4OHZA 1COWD 1QDEA 3H4MA 3J80c 1ZM3A 1P5ZB 3UDGA 1YE8A 3PCRB 3ZJYA 2BBTA 1VQ6A 3HWSA 2ZJPA 3A1WA 5EZ5A 3UIEA 4X66L 4DLRA 3ZGXA 3HKZG 2F43A 1BVSA 1AQUA 221PA 3R7WA 4RCZA 2VEDA 1TUIA 3UG7A 1Y14B 1PH7A 2YJTD 4RY2A 2W6JD 4TT3D 3THXA 4Q21A 2BC9A 4PX9A 1E69A 4AYBE 2DFTA 4OX9Q 1G1MA 3E0EA 2ZRBA 2IHEA 4Q4HB 1Y3AA 1Y1VH 5F3WB 1U0LA 4OHYA 4JC0A 4OWTB 1ETUA 1RE0A 4K81B 1ODFA 1OH5A 3IGFA 1KAGA 2R65A 4GMXA 1BIFA 4P4TA 3VKWA 4AURA 4B74A 2A5JA 3EIEA 5BN5A 4URUR 1AQYA 4DCSA 1TEVA 4NONA 2ZRMA 2J0UA 1S96A 1JECA 1U2RA 4DV4Q 1JR6A 1BYIA 4H02A 2VPPA 3LY5A 3RS3A 2WP8J 3HKZE 4JI0Q 4BY7G 3H86A 2Z6KA 1X86B 5E3HA 1KXLA 2PL3A 1E22A 4DR7Q 5IT5A 4O2DA 2P6RA 1Q82C 2VW9A 5EUQB 3GP8A 4TQUS 2OXRA 4HLUA 2N49A 4GFDA 3CW2C 3VR3A 4Z54A 1E2KA 1X56A 1U99A 4M4SA 3D31A 3T1QA 1SE8A 2PZFA 3T1YL 1AS3A 1G6PA 4BEBA 3EWSA 1K3RA 1X3FA 1QHGA 3KDSE 4Q4JA 1OE0A 1SZPA 1XPRA 1MR3F 4DR1L 4LFAQ 1G5TA 2IUTA 3IHLA 4CDGA 1G21E 4UKDA 4PAMA 1JR3E 3GLHB 3HU2A 5FJ8H 1Q7YC 2ZJQA 4BRUA 1WE2A 4D82A 4IFDI 4W5JA 4B3XA 2JLZA 1U98A 4DR4Q 4LK2A 3AVYA 1FOEB 1VG9B 3KL4A 1L1OB 2K52A 2OEPA 1FFHA 2V1XA 4DR2Q 5HZHA 2OCEA 2Z0SA 4YHHL 4B3TL 2QL6A 4QGHA 3UXMA 2AXNA 1V9PA 2CEAA 4GOPA 2XOKD 4PZ6A 4DRZA 4ZKDA 2FPLA 1NMXA 4LF4Q 1XNJA 3OESA 4G5RA 2ZRGA 4LBZA 5D3QA 4ARZA 4DT1A 1HE8B 2Q3HA 1L4UA 3FB4A 4G01B 2BIFA 3IIKA 2RH5A 4URWR 5FR1A 2H57A 3I8SA 1E3MA 2YOHA 2ZYUX 4Q7JB 4WXRA 1A4RA 1ZAKA 1TWCH 4I81A 1E2LA 2N1BA 3RSOA 3W6NA 4A8JA 1KNXA 3STBC 4ZIRB 3IDQA 3WYFA 4Q19A 3CMEA 4TYYA 1KRTA 2CVHA 3S24A 3DPUA 3M4PA 2W58A 2WB1G 3NDBB 3CPWA 2YYZA 3BH6A 2VSOA 3THYA 1AE2A 3K0AA 3O8RA 1SXJC 2R8RA 5AJWA 4LGMA 1W2BA 1SMXA 3UMFA 1WYDA 2XSZA 4OXPA 1US8A 3C4JA 5HCNA 3SJZA 2X19A 2FF7A 3IIMA 2QEXA 1IN7A 4L16A 5F98A 1HEIA 2FSFA 3J81j 3C15C 5C4GB 4X66Q 2GCOA 3F8TA 5C3EH 2FSGA 4BY1G 2WJYA 2ZJAA 2PMZE 2GDJA 1OT3A 3QE0A 1OV4A 3GLGB 3R9WA 1ZMXA 1N6NA 3LLUA 3QKSB 2YINC 4A4IA 3GTKH 1KY2A 1OH6A 5DI9A 2O0JA 1RIPA 1SGWA 4LHXA 4DXAA 5JJKA 3HOXG 2FZ4A 4EQ6B 4LUVA 2HCJB 3HU1A 3OAAD 1Q8KA 1OIXA 5DGXA 5AK0A 1N6RA 1QHHB 5CYOA 3K70C 1LNZA 2QROA 2I5HA 3AV0B 2NN6I 1OTCA 1RRPA 4BECA 3GTGH 1Z0FA 2JLQA 1JPJA 3EARA 3PF5A 4A3IH 2IS6A 4E03A 1G6OA 1CIPA 4DV3L 1HQYE 3EZ7A 1G64A 1FGUA 3QPWA 1D2EA 3LLMA 4PC2A 1R2QA 2PH1A 4B76A 3ND9A 1BOFA 4RZUA 2UKDA 2OESA 4IRUB 1MV5A 4LI0A 3U5ZB 3PEYA 4GNXC 3Q72A 1PH1A 2H17A 4WBSA 4CRWB 4GDFA 721PA 1B70B 1C1YA 4X8OA 2O8EB 5GJBA 3R9IA 3LWNA 3OIUA 1ZU5A 2OLJA 5KNDA 4GPTA 2JE6I 3VX3A 3S1RH 1YVCA 3T1YQ 2HLDA 4NYIQ 3T5DA 4LX0A 3O47A 2Q2TA 2R6FA 1NLYA 3LBIA 4DR1Q 4NTZA 4TSFD 4TLEA 3B13B 4LW1A 1VQMA 3UWOA 3F2BA 3P27A 2R92H 4IPCA 1R5NA 1W36B 4JBWA 4WXPA 1C4OA 3EIVA 3VKHA 3I4MG 2FZLA 3CMAA 4HJ8A 4BEJA 1VQKA 1E1OA 4YHHQ 4B3TQ 2A1AA 4NB3A 3Q9LA 3OIVA 2OO7A 3UK6A 4NPSA 1E24A 4EJSB 1N25A 2JJ2A 4JT4A 3ND8A 4Q9IA 1CP2A 2K14A 1YZQA 1CKOA 4NXNL 5KSZA 5E7IA 3FP9A 4MUAA 2FNAA 4BBRG 5DHAA 4V0OA 1KJYA 1HZAA 1H8HD 3FYHA 3K0FA 2QT0A 1E0KA 2ZE6A 3MUFA 4HI0E 1A63A 2ASBA 2Q3MA 4LV8B 4PXAA 3B9PA 1HJPA 5IT9c 3TIFA 2PQAB 5LPNA 1W4CA 4HATA 1BKDR 4HB0A 1IL2A 1G3UA 4JLOA 2DR3A 1JNYA 2GCPA 2Q3FA 4Q01A 3Q7QA 5FOXA 2OSBA 1JT8A 5GAHC 2RGXA 2ZJYA 1Z3IX 1RYFA 2OAQ1 1K8RA 2Z6VA 3NBYC 3OE7A 1BO6A 1UE5A 4A3GH 4BPBA 3K0CA 5FPSA 1XBTA 2F1IA 3CWZA 4C4PA 5E95A 1IXRC 1NNEA 2QQ0A 1CTQA 4JS0A 4LJ4A 3U6BA 2CWPA 3U60B 4CGZA 1CF4A 1O87A 1T91A 4MGKR 4Q48A 3RC8A 1FX0B 5EE1A 3LO5A 1SXJE 3HOWG 2I0QA 4JYCA 1E4VA 4UNSA 1A2KC 2N42A 4JI1L 1VIYA 3F0TA 2IXFA 1Q1QA 2JEOA 1I2DA 4V03A 3PUXA 3S17H 2WBLC 4IEIA 3GFPA 3PXGA 4AC9A 3I8XA 4YC7A 1HT1E 1GSIA 3CIOA 4JJZA 3VU9A 4NCIA 2YC4C 4OJKA 1MO4A 1GNQA 2FWRA 2VHJA 4R98A 4M8NE 1G3RA 1RIFA 3ZVNA 4BLTA 1A2BA 3NENA 4AIIA 1EWQA 3H3VH 2BBOA 5CIWA 4DV3Q 2NVYH 3AVUA 1VQIA 5BQ5A 4AWXA 4LF6L 2I3BA
chains in the Genus database with same CATH superfamily
3AEKA 3H1TA 4QASA 3RW9A 2D5LA 5TV2A 1U2ZA 1MMFB 3EVCA 4UUPA 5JUWA 2C9OA 4K9QA 5A3SA 3Q3VA 1TX4B 1JX6A 2QMQA 2XRZA 5EKXA 2A86A 2VOJA 1PEKE 3EXG1 3MJ4A 2JI4A 1BO0A 2R62A 5FOVA 1HBJA 2P2ZA 2MYTA 2YWDA 4BO6A 4RFSB 1GPWB 1PFGA 3JQ9A 3A7EA 3EOZA 1JJ2A 2B2XA 4P84A 2HB6A 5J9FA 4JP1A 4ZVOA 2DUUA 1JDJA 3SXUB 4RVGA 4QUFA 3SEFA 2AUTA 3HN6A 4YCVA 1FVIA 4R4QA 1MJFA 1I1QB 1P1FA 4BTVA 1Q46A 5ICEA 2L19A 1FP4B 2W6QA 3BFXA 3MXNB 3ZGNA 4PO1A 3O7MA 3LWEA 2XMBA 3ZD6A 1K27A 4JW0A 1RWWA 2XD9A 3U4VA 1GSAA 3FOBA 1OFHA 1DAPA 3J7AF 5CV4A 4PZAA 5TQ2A 3PITA 2OTLA 1VL8A 4KO4S 1QFXA 1L8OA 1NJFA 4OFBA 5B4UA 4Q6BA 4BZPA 1ULTA 1WSWA 2J7KA 1TKBA 1EK6A 4U673 1ZUIA 4JENA 4NCHA 4B6GA 5T7BA 3CRKC 1KDAA 2G70A 3HKSA 5IT9E 2IPOA 1P9RA 1X80B 1IUPA 4Y0NA 3OSZA 2QIPA 5JI2E 2GJ8A 3N2YA 3G9QA 1NQVA 4HUTA 4TLDA 2ZKLA 4C78A 1HLFA 1CQJA 1H0SA 1GD7A 3S15H 4CV3A 3H5WA 1XQYA 4O02B 3TL2A 4BLOA 2PYDA 3DF9A 3T7TA 2FN8A 4PG5A 4DWOA 3HYNA 2R0QC 1T0JB 2WF5A 4R2HA 4TV9A 4Y2XA 4F04A 1SYGA 5K0BA 4EMSA 5AJ3L 5IAJA 2XCLA 3CO0S 5CLIA 4P72A 1G8GA 3CVJA 4G1VA 2WAQB 3N0RA 4JK3A 3C5WP 5HIIA 4I7AA 3SSNA 3AETA 5AM0A 4UTZA 1BHQ1 4ROSA 1BX0A 3LKBA 4OK5A 3G0BA 4AQYL 4RPKA 1O5OA 1CR6A 1SJHD 3OPYI 3RFUA 3V5NA 1ASZA 1TUBB 4DNPA 5C5IA 4DLZA 1G6HA 1ILQA 3RLOA 4J8PA 3R6WA 3G0OA 3E3OA 3S28A 3ITKA 3WGHA 2BTEA 1S3SA 5B7NA 2AI2A 1XN4A 4C56C 2ZXOA 2WJZB 4FYXA 1GQOA 3NBZC 1AO3A 3W5HA 2HC9A 2DKOA 1PP4A 2VSXA 1FYFA 5KJFA 2YX1A 4HTHA 3YASA 6GPBA 2H1VA 4PU0A 1CJTC 3OKAA 1LPMA 4FP5D 1T6YA 4QLOA 3BDLA 2PUGA 1CC1S 2REXB 3ETNA 4RKFA 1E7ZA 1NMZA 3CZCA 1A3UA 3WNVA 1G5QA 2E82A 4LJ8A 3DM3A 4FEYA 2CXOA 1QK5A 3LXRA 1CUZA 3UW3A 4I7ZC 3L7LA 4S04A 3SHTA 2LDBA 2CFCA 1RL2A 5F91A 5JTUA 4L5SA 3NOXA 1U9JA 3MMPA 3HZHA 3BTSA 4Q4AA 4GYJA 4OHBA 3S27A 3DUWA 5JCZA 1A7AA 4ETNA 4X71A 4CLOB 4C0AC 4B3MQ 4ZIRA 2F0NA 1IB6A 4BY7H 3KUDA 5IT0A 4XUGB 5IHPA 4Z4CA 2A5FA 4HGVA 2H1IA 3VNUA 3D8GA 4LJKA 3CC2A 3LQ4A 4ME5A 1RE1A 3BWCA 1A8HA 4ENSA 1K9SA 3VHQA 1TM5E 1KI3A 1JOQA 1A82A 1H5UA 3PT5A 3UDXA 3GLIA 2Z9BA 2WM9B 2V5VA 5BQXA 5IABA 1EX6A 1GN9A 3DM1A 3DAPA 4WZZA 3NTKA 3BVMA 4IQFA 5LZ2A 3S40A 3T95A 4YB8A 2IDJA 1FJXA 4R31A 3GTGB 4G9BA 4H27A 3W1BA 4W6QA 1FDOA 2WSSD 1EFUA 4D43A 1TIBA 1PW5A 3EWIA 5A9SB 2CLMB 3QQ5A 1GRVA 3ESYA 2GZAA 3WQSB 1AGXA 3T9BA 3MHBA 1UBCA 2FH5B 4DK6C 3UJ6A 1RXCA 3GTJH 4KYUA 4JLUA 3FD8A 2H2IA 5K0GA 2JGKA 3NANA 3M9BA 4O0AA 1LTHR 5F1PA 5F5LA 4Z9YA 4I0WB 3R6QA 1LDMA 2JK0A 2WHPB 1QF6A 3EGEA 5EKTA 1WDKA 5E9QA 4IGKA 1ZM9A 1KU0A 3D7KA 4N4AA 5IY0A 1NVUQ 1W46A 1POWA 4KTVE 4XM1A 1YS9A 4B3RL 2R11A 1DQRA 2AMCB 4IEFB 4XEHA 1WIWA 4Z4IA 3SYKA 4KFUA 2D9UA 1EXMA 1I24A 5A62A 1N2GA 4FFBB 2Z9DA 3FWHA 2ZTDA 4F91B 2SOBA 4Z7NB 1ZGBA 2ZUBA 5ALSA 5THKA 1O6BA 1AMOA 1JXMA 4ATNA 2RSLA 1DARA 1Q0LA 4HFRA 3IT1A 5A4DA 4DADA 3GTPB 4CKBA 1PJQA 2DMRA 2EJTA 4GN4B 2PVCA 3CNNA 2BGLA 2G7MC 4MKZA 4EY3A 3UF0A 3AF2A 2D4HA 4QIHA 5FPHA 1JUDA 3GCGA 2ZI3A 3AMUA 3JQEA 2Q5CA 4CIXA 1UKCA 1HY0A 5TQVA 4COOA 5B2EA 2QMHA 1MJ5A 2AOTB 1O6FA 4DS3A 1YV9A 3RUPA 3CZRA 3E9HA 2VUHB 2JFZA 4HFMA 1AHIA 1BKSB 4H1UA 5JE8A 4XX0B 1II0A 1T9BA 2EG5A 1KI6B 3DVAB 2L11A 2ETXA 3KQYA 3L40A 4M1MA 5KMGA 3OT1B 2YUTA 2GK3A 3RRYA 4QOSA 3LQQA 1MBZA 3UAVA 4QYTA 1ZONA 1EX9A 2NUTB 5JC1A 5THXA 1ZM2A 2BFCB 2X76A 1BKBA 3BUSA 4KE9A 3UV3A 2Q4EA 3W77A 4AJPA 4J16A 2CUKA 2O8FB 3EY9A 2ZIZA 3K2BA 1NJIC 1VLHA 5DX8A 2PMWB 3MFQA 3QBDA 2AX4A 2JH8A 4ZYLA 4CKEA 3VH1A 3PO2G 5M9OA 3DE6X 4GHWA 4LJ6A 3WWEA 4OQLA 2RFLA 4DE5A 5AW1A 3PUHA 1MJEA 5FNVF 1UZNA 2UXCL 2WOOA 2XB9A 5KNCH 5J2TF 1KE1A 3VTZA 1OO9B 3O21A 2K50A 1A8SA 3PQEA 1WXDA 1V96A 4Y6RA 1J8FA 4AF6A 2FJPA 4ZT2A 2GEVA 5HIJA 1XYIA 3DC7A 5K1ZA 1KTKA 3KBXA 3Q7PA 4KL8S 3KHUA 1JSWA 4OM8A 4E11A 4YJHB 1FJGL 5M3MG 4G4SO 3WKDA 2H5LA 2QX4A 4R83A 2J41A 4PCVA 1JPUA 2B7CA 2R96A 2GJSA 1U8ZA 4UXJA 2ALYB 3MWEB 1RKVA 1GCGA 1MC4A 1T5XD 4HMIA 1JHOA 1GV0A 1W3SA 4B3JA 4DV2L 2X6GA 2ZJFA 2A2ZA 2OUKA 1MVNA 3AJAA 4S35A 3TLJA 1EFDN 1E5LA 4L3VA 1H9AA 1TF5A 4A3FB 4ZICA 4GGOA 5AT1A 2XBUA 1N5OX 1K63A 3PD7A 3R3YA 4KE7A 2Q41A 3UV7A 3DZCA 5JJIA 1GUWA 4W4TA 3FHOA 3UCEA 2EFYA 4JWKA 1M1NB 2B1RA 1GZ7A 5DXJA 3QIVA 1Q14A 3FDJA 3DLPX 5AK5A 1DG3A 5FA6A 5FOTA 1GAQA 1GNTA 1TWHB 1L4GA 3Q3CA 4JT9A 1X2EA 4UE3S 5C51B 3EQLC 1ULUA 2P4QA 3DZFA 1IZ6A 3P2KA 4PXYA 3F3SA 1X42A 1Q81C 4TL9A 4WPGA 4JN6B 5E8RA 2R6AA 4F46A 1F06A 1II8B 1E4EB 3CUSA 3ZV6A 2FPGB 4RVFA 1QFJA 1OPRA 1WDTA 1PTOB 3RZDB 2H51A 3LY9A 4AW9A 1P91A 2ZVQX 3B38A 2QTBA 2JIOA 1NX6A 3RKSA 5AW4A 3DEHA 2ZCJA 2H48A 4ZT3A 5DDIP 4YRQA 1VQ4A 1BWPA 1Z3CA 3AF5A 1Q2XA 4HWSA 3GEPA 2O8BA 2WHEA 3PO3G 4KQMA 3IH5A 4YJ3A 4CNQA 3KBOA 1NZFA 2ATIA 2GYVA 3FBTA 3GPBA 2C83A 4LHZA 4E5VA 3O90A 4MS4B 4LRUA 2Q1WA 3TCXB 5KYKA 4LRXA 3TL6A 3HCRA 5TT1A 3DDSA 4KZKA 4ZOLB 3ND5A 1VJCA 2HFKA 1U5BB 1JEYB 1T36B 4G67A 1KH3A 1IY8A 1JBQA 5FLMG 2ZANA 3SM3A 1QVWA 1ISSA 1Z29A 4AD8A 4RHYA 1RZRD 1HKHA 4LJ5A 1SIWA 1GUNA 4FT2A 2C5GA 3GLFE 2B61A 2PMZB 4W5WA 3VDYA 2FQ1A 3S1AB 5P21A 3A6JA 5L53A 1TO1E 2D2VA 1LQ2A 1SRQA 2OQ2A 5B4VA 2XQIA 4KC0A 3TS1A 4F06A 2DWPA 1M4VA 4MIKA 2LZ0A 4KGVA 2D28C 5JWRA 1TWAB 3LPMA 4HCSA 1EGMB 1TA9A 1JR3D 1DKOA 4H9GA 4ED9A 4BB5A 3BBLA 1PBNA 3MJCA 2ZSFA 4HQ0A 4X1IB 4TTRA 5IYCG 2IZ7A 4P33A 5EXPA 4PYJA 3ZPXA 2PAAA 1YNXA 4IDPA 4FMCF 5FL7A 2ZJ0A 5HNKA 3IP7A 1GNLA 3IQDB 5COBA 3KX2A 2ZTMA 4A3SA 1LX6A 2DY1A 3NO4A 1LTTD 4EMBA 1VSQA 4OQMA 3ETEA 1EDDA 1JLLB 2N3SA 4AYTA 9GPBA 5EZQA 4C3JG 1EFRD 2WE8A 3W5JA 2TMGA 4YWKA 4N0DA 3ZHQA 5IZCC 3MS2A 3DZGA 1V2HE 4F1KA 4G0UA 1DCZA 2OGTA 4R81A 3GLHE 1XTUA 2WKQA 1YQTA 4J7CA 1AVTA 1WTPA 3AI3A 2ID8A 4BO9A 1T5OA 5CW2A 2VYND 3JAML 1XMSA 3USCS 1DKUA 1I50B 4LF9Q 1JF8A 4V0MA 4ESEA 2RAVA 4MV0A 4R3WA 3U3ZA 3CUYA 5CURA 3FIUA 3JQ8B 4DV3B 4A15A 2G4CA 2PFMA 1BMFA 5IF9A 1KO4A 3MMZA 4NULA 2D2XA 1G8YA 1GM5A 1CQFA 5BSVA 3SX0A 3F5SA 2KB0A 4TKUA 5DLEA 1N2JA 4MV4A 3WGQA 1WD0A 2WUEA 2E8GA 4A2WA 2ZWAA 4P74A 1TU4A 4GPBA 1OVGA 1TYBE 5D6OA 1ZN9A 4RVCA 1RI3A 1E2VA 3K70D 3FHLA 1AN9A 3GRYA 3NRJA 1MO3A 4KHPB 1PXUA 1P8AA 4IM7A 3F98A 3EBOA 4DPMA 1R8SA 3PF9A 1NYTA 1JAXA 2A5YB 5C3MA 2RCNA 2MPMA 3TYXA 3KBGA 1YO6A 3A1VA 1N33Q 2NYAA 1YHZA 1I94L 4B3CA 4JI1B 4RTQA 2E5WA 3OTOQ 3MPUA 4R8RA 1E9FA 4TMFA 1JYSA 1M0WA 1DC6A 1FRFS 3LDAA 1YFJA 3F74A 3RASA 2O0MA 4PZEA 3KAJA 5A0TA 2VQ6A 1FUKA 5AW3A 3QR8A 4FF4A 2F0SA 3VQTA 2P4SA 4TMTA 4QL5A 3PJGA 1B8VA 2BDEA 1YB5A 3GG2A 2QUHA 1TE2A 1X0VA 3P4XA 2YVKA 1N3LA 3UGQA 2QENA 2JNWA 2FQWA 3WRYC 1V4BA 1QBGA 3Q5DA 2ZJZA 4ZKBB 2QXYA 3LPNA 5ALJA 1G20E 3PCOB 2JLSA 3DP7A 2PMFA 2D1QA 3Q11A 2BSAA 1OXVA 3WLMA 4MRMA 5FB3A 1XZGA 4RMJA 3FCUB 4RFLA 2I8AA 2BCOA 2FOXA 2I2WA 5FLYA 3T9EA 3MELA 5G3YA 1WI5A 3CR7A 1ESNA 4PO8A 1ZA1A 4F5WA 4RZ2A 1NBHA 3WB0A 2VJAA 2K33A 4B9XA 5M3FB 5DHSA 2IV3A 5LP6C 1EIFA 4Z86A 1LS6A 4DANA 1G3QA 5B1HA 1TO6A 1JORA 1BMTA 1HZJA 4X8HA 4BNUA 4F72A 1MKHA 3NXWA 2OBBA 3OKPA 1H9SA 1AMNA 3LS2A 3WBBA 4NYJQ 4MR9A 5AIBA 1NY5A 4OAQA 4MW9A 5DLYA 2WIDA 2ZTLA 3G71A 5IKEA 4Q1AA 5KVAA 3HA5A 1Q17A 2QRLA 2VHZA 1ML0D 1QC5A 2WIFA 2XDQA 1J06A 3FWNA 1KAAA 1LTKA 2DQZA 4P75A 1EOVA 2PFGA 2P5SA 3V6MA 1GRNA 3TOSA 3V1UA 4QULA 4GAEA 4DLAA 2A9OA 3RRBA 1L0WA 2PS9A 3NDIA 2B2TA 3HOYB 3T1TA 1SD1A 3RT9A 4WGGA 3QI7A 2FR8A 2IYSA 3K30A 4WBNA 4NOMA 3P1HA 4XFDA 3RVBA 3QX8A 1QIFA 2G1AA 4NP5A 3VPDA 1UOQA 1A15A 2W7TA 3O8NA 5B6PA 1XOIA 1Z5VA 5DNUA 4XQ0A 1DBSA 4WEQA 1KC1A 4B2YA 5IC5A 3BZWA 2W2PA 1OFGA 3GGDA 2XGTA 1VLLA 3RK1A 4DUPA 1DDOA 1SB9A 4D44A 2HIXA 3RVJA 3ZWMA 2BFPA 5JDCC 4HCEA 2MMCA 5LQRA 4N65A 1TTTA 5EZSA 4DV6B 1SHTX 2GD1O 4U3JB 2EKPA 2E1PA 1XFDA 2PGIA 1YRLA 2HR1A 1VYUA 1A9YA 5C3WA 3CR8A 4BNDB 3UWMA 3D3JA 3V1NA 2E5LB 2P65A 1CWUA 3JATA 5EZ6B 2IU4A 3EMVA 5DB4A 2P30A 2DERA 5I7RA 3C43A 1I3QB 3PDJA 4YRNA 2NO9A 3CGGA 1NXPA 4K26A 1J6QA 3MILA 3QPBA 5HKKA 4M8IA 4X90A 3I5XA 4RJLA 1SYCA 2GEDA 3LT5A 3CW8X 4PGAA 4DR4L 4RTPA 3Q15C 2JN4A 3PGVA 3P2YA 1FL9A 1DLJA 3M7GA 1ECPA 5KCMA 5JZVA 5IJWA 2I5PO 5JNLA 4G56A 4YVFA 1Z6QA 1DS6A 3CF6R 2W9XA 1U7OA 3R93A 3RMHA 1TCAA 3ZJYA 1GYQA 3UIEA 2ZJPA 5T4EA 4H15A 3NAGA 2A57A 4TT3D 1O80A 3ZBQA 3DTVD 1TK3A 5BN5A 1JIVA 1DQPA 4NONA 5TJHA 1PT6A 2PBLA 3DF7A 4ND8B 1KXLA 3L7AA 2PDAA 3QPCA 1ZEJA 2Q5LA 4F8MA 5A5DA 1QYWA 4O4HF 3D31A 2M1ZA 3IJPA 3AB7A 4UKDA 3GLHB 5FJ8H 1Q7YC 4KWEA 5LU8A 3OTQA 3KL4A 3QITA 4NENB 1EFID 4IV5A 3WIUA 3OESA 4O4LA 5FX2A 1VLMA 1RQXA 2Q3HA 1L1RA 2QN9A 1D6NA 5EPJA 2WD9A 3UYLA 5E38A 1E2LA 3RPEA 4BIMA 5A05A 3MT7A 4JC5A 1JFTA 2VSOA 5AVUA 4YIKA 2JFVA 4EI2A 5G0WA 1QZ3A 3RQIA 1YTLA 4RCVA 1UP7A 3OM1A 2CW0C 2YINC 2YNMD 3ZDRA 1OTCA 1KYQA 1HLGA 4A3IH 3KT3A 2PH1A 5DWQA 1I5EA 5K05A 4UUOA 1EXVA 4D9EA 3S8EA 4FM9A 2F0WA 3PWKA 1ST2A 2HADA 2AJTA 4C4YA 2HLDA 3DWIA 1WUKS 4LW1A 4DGQA 4DV0B 4JBWA 3EIVA 4KOAA 3TCKA 3CHBD 1PJAA 2OO7A 2JIPA 3ND8A 3E48A 5T4BA 2E21A 2CXHA 3BTVA 4HEHA 3ZX5A 1DFHA 1EY9A 1NBWB 3GVPA 4Q01A 1O95D 3Q7QA 4GOMD 1TT2A 1IK4A 4BQRA 1HO3A 2FUG1 4PRKA 3H5OA 1T91A 1Z17A 3TN7A 1GZ3A 1BSVA 3EOBI 2GO1A 1AQLA 4YC7A 3CIOA 1YE3A 4PG6A 3ZH2A 4AIIA 2OCLA 4L85A 4S1PA 2K5QA 1V8ZA 4FW8A 1HDXA 2RGRA 3MWFA 1C1XA 2WICA 1Q3HA 2V03A 5KTNA 3Q98A 2C7PA 4ZYTA 3MCWA 2BFMA 2PUDA 2WTAA 1FFCA 1G20B 2O4UX 2R47A 1GIAA 4FX2A 2Z4IA 3K2IA 2YIDA 4IOMA 4QG3A 2JA5B 5TIIA 4D79A 2R8OA 2VK1A 3AZOA 2A8VA 3BK1A 3UB4A 2ZQYA 5EJGA 1Y1RA 2OCYC 4YJKA 3CPSA 1FNVA 3WRXC 4R2XA 1M54A 2VF4X 4TLBA 4BQFA 3ZJ4A 5AOCA 1GKKA 2IIBA 5J3JA 2OCXA 3QVXA 1JG7A 1YBMA 3OCXA 2G0NA 1NRWA 3S7TA 2FSIA 3AR2A 1IH8A 2CFSA 3PF8A 3AG5A 1PYGA 5GADC 2D0PA 4CUKA 3R2TA 1A5TA 1Q83A 2WWIA 3T3IA 2IHYA 2BE5C 4RV4A 3T1HB 4ALNA 5FTMA 2NTNA 2WR8A 2P6UA 2ECPA 1KQ7A 1VMEA 1RM3A 3CCJA 4KR3A 4QU0A 4ND7A 1X7XA 2WMDA 2GVBA 3OIQA 2C1ZA 4UM8B 3WSWA 4ZQ3A 5ALVA 3ORHA 2BVNA 2UVPB 1BW9A 5AKJA 5BV0A 2G40A 1Y80A 2QM8A 2DPLA 4BLPA 4ZCPA 5C0XJ 2WKSA 2JP1A 4DUZQ 5H4GA 4WQMA 2SKCA 3AIKA 3I9MA 4NCKA 3V3KA 1E0SA 1MAHA 1AO0A 3FHCB 2IIPA 2QT9A 2VNUD 4TRRA 4J1TA 3BF8A 3ILXA 1H3NA 2P8JA 1Z36A 2IY9A 1KMHB 3PPIA 4D2IA 4MHEA 2HYIC 1QH9A 2DHDA 1VQHA 1N57A 4F4CA 2J0SA 3NHKA 1EI9A 4POFA 3GP3A 2B29A 3EG5A 1UEAB 3WKEA 3COYA 3CRW1 4K5QA 1GZ5A 1E7WA 4GW3A 3V80A 4GKJQ 1WEKA 1TK2A 2NXEA 1XMJA 2A9FA 4R1UA 1WULS 4OELB 2NVQB 1FP1D 2QV0A 3S16H 4KN7C 1MG0A 5DCYA 3F96A 1VKJA 3CT6A 2ZTCA 2EEPA 3ZWVA 2VUSA 3L7ZC 1CBUA 5F1KA 5ESWA 4BMDA 2X3UA 3MJDA 4ZAVA 4D3ZA 4UDNA 5ICFA 4JZYA 3UICA 4QRDA 3UT5B 2PKXA 4B3ML 4YO7A 1WTCA 3DUFA 3AERB 4PHTA 2R84A 3LM8A 1T1EA 1JLSA 3IQWA 4B7ZA 4HUQB 4H3HB 4KITB 8GPBA 4CDEC 1TD1A 2Q4RA 3SJAA 4DSTA 2AKYA 1HTPA 4XARA 3EGVA 3WLQA 4JJFA 3IAS6 5JISA 5EXEA 4QOIA 3JAWB 3HSKA 4CM4A 3H8JA 3LFHA 1LDYA 3TR0A 3KVRA 2APJA 3W3AD 2PNFA 2J59A 3ZIDA 4M7OA 4PBRA 4UNRA 2DF8A 4TN1A 1E2PA 2PUEA 5I4CA 3WFIA 2FMHA 1CFJA 3K35A 2CJPA 1ZXLA 4HVCA 2GD0A 2OT3B 1OVMA 4AG6A 1QO0A 5C46F 2YMMA 2JF0A 2DT5A 1E2GA 5AW0A 5EMNA 3DLLA 1B7GO 4X7PA 1OYOA 1R6DA 1SD2A 3A3YA 2IXBA 4J6FA 2V54A 2K4KA 1THTA 1TWCB 3OFND 2NWGA 4QFMA 1EUDB 1A95A 4R8VA 4LF4B 2XVSA 1QUEA 5F7OA 2FLWA 1NASA 3BGDA 4KN4C 4JI3Q 5GJCA 4MN3A 3ZD7A 4A3BH 4LYFA 4JMLA 3CRMA 4ZEOA 1L9KA 1IWOA 1FTQA 5HBRA 4LV6A 3REGA 1V11A 1X8XA 3H7AA 5KYWA 5REQB 4K0KB 4ZOAA 2GQ0A 5KUTA 1M2GA 3ZGVA 3GFVA 4XSHA 2IP1A 2JFFA 4L3WA 1WF6A 2GHQA 1AU9A 3LOUA 3MWGA 5BYJA 2C2YA 4O0LA 2W0MA 1A2QA 2HQSA 3L2PA 2QJRA 1E9CA 4JASB 4URFA 1VE1A 5EXXA 4TOIA 1TAQA 4F9GA