1U0LA

Crystal structure of yjeq from thermotoga maritima
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
291
structure length
278
Chain Sequence
LRRRGIVVSFHSNMVTVEDEETGERILCKLRGKFRLQNLKIYVGDRVEYTPDETGSGVIENVLHRKNLLTKPHVANVDQVILVVTVKMPETSTYIIDKFLVLAEKNELETVMVINKMDLYDEDDLRKVRELEEIYSGLYPIVKTSAKTGMGIEELKEYLKGKISTMAGLSGVGKSSLLNAINPGLKLRTTTTAQLLKFDFGGYVVDTPGFANLEINDIEPEELKHYFKEFGDKQCFFSDCNHVDEPECGVKEAVENGEIAESRYENYVKMFYELLGRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of YjeQ from Thermotoga maritima contains a circularly permuted GTPase domain
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Probable GTPase engC
total genus 79
structure length 278
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 3.6.1.-:
pdb deposition date 2004-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03193 RsgA_GTPase RsgA GTPase
A PF16745 RsgA_N RsgA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.50 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Probable gtpase engc; domain 3 1u0lA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1u0lA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u0lA02
2MNAA 1S40A 1KI7A 2CNWA 2WWWA 1E2LA 3NIBA 4P3YA 3OIUA 4PHGA 1KXLA 1M34E 2GDJA 4ARZB 3VAAA 1SXJD 3O8RA 1ETUA 1XEFA 3FHOA 5K8LA 1P3JA 3G6EA 3LQRA 1FW6A 4DJTA 1XFAA 4A3BG 1IONA 2ZRHA 1WMSA 5C4JH 3VR5A 5J3BA 3K70C 1G8YA 4DDTA 5J4LA 3Q8DA 2IS1A 4X66L 1NBMD 2BEKA 2DY1A 3BBPA 4QGUA 1DOAA 4C0QC 4PZZA 4ESVA 3I73A 1E1TA 4CDGA 1D7QA 3VR4A 3NEYA 3K0FA 1PH7A 1G41A 2OXRA 3ZZUA 1E98A 4OHYA 2HXSA 1MIUA 2Z6KC 3MLEA 4PPFA 1UADA 1G7SA 1XEXB 5AUQA 1I4DD 1SHZA 1TL7C 1GTVA 1PYBA 1UE5A 1X8JA 3B1VA 4WA7A 5TDHA 2AWNA 3K0CC 5KNCA 1N25A 3HPQA 3THXB 3GJ7A 4L8GA 1X65A 1CTQA 1F60A 1FPMA 3P27A 4M1MA 1PFSA 4LUVA 4LBWA 4X8OA 1HNXL 5K8UA 3RC3A 4YMWA 3CCUA 3BS4A 2J0UA 2HJGA 3CONA 3WNDA 4UJ3A 2QPOA 1K6MA 1NNEA 2N49A 3KYHC 3ZJYA 3I56A 1A2KC 1GFIA 1PH6A 4GKJL 3I8XA 4Q48A 1JT8A 4FCVA 4PPGA 1CSQA 3GJ4A 4P73A 1E9FA 1Z3IX 2I4IA 4IW3B 3KQUA 2ZUBA 1SHKA 1DADA 3DKPA 3U58A 1XDBA 1B8AA 1MH1A 2C9OA 4Q9KA 3STBC 3W5IA 4BPBA 5DO9A 3AVTA 1NY5A 4A2QA 1UBCA 4B35A 2C99A 4A75A 2DWQA 1N5LA 2ZREA 3KJIA 3TRFA 2GHIA 3PF4A 2FMXA 2NOAA 4MYTA 3U6KA 5FBRB 2HCJB 1TUIA 2HUPA 4WJ3M 1U8AA 1HZAA 2WWIA 3E2IA 2XTZA 3J81k 1W48A 3QBVA 1TMKA 1JR6A 4BY1H 4JKIA 1AE2A 2MSCB 1EOVA 3RS3A 4LF8L 3CB4A 4WZAE 5BYKA 1G64A 2ZRBA 5ANRB 4D4MA 4UNNA 3WYAA 1E69A 2WB1E 3GTJH 1HYQA 1YQTA 3B5JA 4JVLA 2NO9A 1VIYA 4O0MA 3CM0A 1R2QA 2OAQ1 1DG1G 3REFA 4Q7MB 4A2WA 1J5EL 2N46A 4YMUA 2KBEA 2VP4A 4DLZA 1DO2A 1ZNXA 4UNSA 5KHOC 2WSSD 4OQFA 3T34A 5JEEA 2Q3HA 1KK3A 2Q3FA 5FL3A 1COWD 2GXQA 4LNQA 2RAPA 3H0GG 1TWCH 1I5FA 2Q2IA 1JJVA 3PGZA 1E1RA 2OBNA 4PZ7A 1SRUA 1R0WA 5BW8A 4QRHA 3SYKA 1TEVA 1JPNA 3BD9A 3KJEA 4URXR 1OHHA 1UKYA 5K8IA 2I0QA 1L7VC 5C44G 2QT1A 3EPHA 3O47A 4LYFA 3PV0A 1P2TA 4QGAA 3VFDA 2JJ2A 5IYDG 1GKUB 3FDIA 4JLKA 4Q01A 5JFGA 3CRMA 1G17A 1TQDA 3HP1A 1KMHA 1E2FA 3CUEF 3SFVA 3J81j 4DV3L 2VP6A 4C0SA 4GI7A 3RZOH 2OV2A 3X2SA 4IEIA 4WIAA 4DCTA 4OK6A 3I4MH 3GO5A 2QA4A 1HNZL 3FFBA 5EP3A 4GNXB 8OHMA 1WF3A 5D3MA 5JEAJ 1AIPA 3W1BA 3T61A 3BC1A 2O8BB 2BDTA 3CCSA 1NMXA 1ZAKA 3HKSA 4LF5Q 5ELXA 4S2EA 4DV2Q 3QY0A 3WRXC 5BXQC 2VP5A 2RGEA 1OPXA 4GOJA 1XWIA 2OLKA 1P2VA 5C46F 3SQXA 3GLFE 4YONB 4DR4Q 4D80A 5M3FH 2H1LA 2VYFA 1E6CA 4YC7A 4OO1G 1QHHB 2GJSA 4MRRA 2YC4C 1R9TH 3TQYA 3ASZA 1E2MA 2Q2UA 1EXMA 1K8RA 3UPUA 3OFND 4RFSA 4B3MQ 2G0NA 2ZANA 3NH9A 1Q1EA 1KI6A 5FOVA 4L5BA 2Z6KA 1N36L 3KFUA 2VF8A 4AYTA 4BLOA 1XF9A 4A2PA 4N0EA 4OHZA 4W5HA 4DSUA 2WIBA 3GFTA 4LJYA 2FN4A 2F52A 2N42A 4DK6C 3NEJA 4POAA 4TMWA 4MTNA 3EWSA 4JI7L 4I1VA 5CK5A 3WMGA 4A8JC 1QRAA 4MYUA 1SXJC 4TZ6A 3B1XA 1NVVR 4NXMQ 2VL6A 4DV1L 1XJ0A 1XMSA 1Z22A 1HZBA 1WI5A 2NVXH 2YV5A 2BVNA 4YMSA 2EFHB 2FSGA 4WAUA 2QP3A 1FX0B 2LCFA 3QXCA 2ODEA 5E3HA 4KAXA 2F9LA 1Q20A 3NHBA 2HDNB 2P65A 2E8GA 3OE7D 5KDOA 4EPYA 4BFZA 5JJIA 1IAQA 1Y3AA 3AF4A 2FE4A 2FEOA 4A3DG 1P62B 1AE3A 2ZJBA 1EGAA 3T1TA 2JA6G 4JLJA 2QMEA 5FJ8H 5FL7D 3AP3A 2CCGA 1EFRD 2H7VA 4Z51A 3T06B 1UDWA 4ZIRA 4L9SA 2K5VA 4OQNA 5FUVA 2BH2A 2X1VA 1J99A 5E7MA 3HYTA 4LX0A 3KUDA 4H1UA 4DR2Q 5KPDA 2WKQA 4JBJA 2E2JH 3S17H 1DG3A 1ESMA 1OT3A 3KDFB 5IYDH 1UJ2A 1XCMA 3FB4A 1OYYA 3K0CA 3LBHA 3GLHB 5GAEC 4EJSC 2R93G 3O8DA 4KXFB 1KAOA 3ULLA 4CF7A 2JLYA 4BFSA 4RKEA 4Q47A 5BR8L 1FTSA 1NN5A 4L9WA 5J47A 1TF2A 2OCBA 1N33Q 1HY3A 1N6RA 4GN3B 2G6BA 2RGDA 3W9YA 2ANBA 1UEJA 1VQEA 2IHYA 2XNDA 3IPXA 1MRNA 1XD9A 4KJZA 4F4CA 1YEZA 3AQQA 2VPPA 2ZVPX 3GMTA 2J0QA 3U44A 1KI1A 2PQAA 1I50H 1KRTA 2B8WA 3A4MA 3EZ6A 1LNZA 4DAMA 2R2AA 5FBQB 3D31A 5JSZB 2KBFA 4UP9A 1Z0JA 2OCAA 4JL6A 1R8SA 4XWAA 5JMTA 2PMZE 4DV7L 2E87A 1LM0A 2PCJA 4GKKQ 4JI1L 2VQFL 2DUDA 3CNNA 5EXTA 1Z0DA 2QQ0A 3K0AA 4HUQA 3I72A 5TB5A 1EWRA 3Q8XB 1NVWQ 1YZKA 2ZSAA 1US8B 3L0SA 3GFOA 1VQCA 4O2DA 2IT1A 2OTLA 2G0TA 2GXAA 3IILA 4GPTA 2YKGA 1Z6YA 3TVTA 4LF7L 3QEOA 1OH8A 1HURA 3K9NA 3R7WA 4C0LA 4K8OA 2PCLA 3CF5A 4H9GA 1JJCB 2BBTA 4PO1A 2ZRAA 1Q1BA 2GN5A 5EXPA 3GJ3A 2WKPA 4TLDA 1Z2CA 2MMGA 3BH7A 1K5DA 1IBMQ 3NTUA 2GCOA 1CJVC 4BXXH 4UXIA 4LHVA 1YHAA 2ZITA 4HB2A 3Q7QA 1PH4A 3FPAA 2P6RA 3DHWC 1CUKA 1U0HC 1YJWA 1XTDA 2N78A 1W47A 4DUYL 2NQ2C 1L1OA 2GAOA 1SVSA 2ZRPA 3BK7A 1TADA 1U94A 2E5LQ 3NBHB 4FMCF 4M4SA 4PC6A 4IVRA 5E7IA 1Z07A 4LUOA 4JI6L 3NVAA 2NN6I 2ZXUA 1PYSB 1X9NA 4X8MA 3L8ZA 4PO9A 3F2BA 2A9KA 2C9CA 1SN8A 3BAFA 3IIMA 1LY1A 4NP6A 4UKDA 1T3HA 4B34A 3SE0A 3R8FA 5E7JA 4C0KA 3T5GA 2HHHL 3CKLA 1SXJB 2J7PA 2WSSA 5KOYA 4A8JB 2GBLC 2PMKA 4IDQA 4Q02A 3NBZC 1Q0UA 1G7RA 2VHQA 1E3MA 4A9AA 5JJKA 2YWHA 1G1MA 2WWFA 1KO7A 3KL4A 1N0VC 1FQKA 5AJ3L 2QL6A 1NLYA 2H5EA 2XOKA 3A1VA 4OJQA 3S14H 3FKSD 4PAMA 1J90A 2JA7H 2GESA 4XSHA 1FTNA 1BBUA 4B47A 3G4SA 4WOPA 4YY3Q 1R0YA 2A8VA 3FE2A 4LK2A 4D0NA 2JA6H 3JZMA 4ZI3A 1XU4A 2WKRA 2MFIA 1XCGB 5KSPA 1X6OA 1G3IA 1NN3A 2PBRA 1ASYA 1LVGA 5LMNQ 1G3RA 3BFVA 1U2RA 2GF9A 4GMXA 4O25A 2CJWB 1G3UA 1YJ9A 2MSEB 5A4JA 5LMNW 2XB2A 1W0KD 2CK3A 4TTPA 2R6FA 3PEVA 2ZM6Q 4JIMA 1J8YF 4M9ZA 1K3RA 4R9UC 4IKEA 5HE9A 2YOGA 3A0JA 4CEJB 1RE0A 1W2GA 3KTAA 3MRSA 1D9XA 3T1QA 3HPRA 2MMCA 4PAQA 3HU1A 2ZJ8A 1QHIA 1Q1ZA 1VQJA 2FPMA 5DN6D 3B60A 2W6IA 2G9NA 4UNRA 3LX8A 1NE3A 4DCSA 3CC7A 2ASBA 1E2KA 1PVOA 2OESA 3H86A 4BA1I 2QENA 3SEAA 3I4LA 1MO6A 1GNPA 5FR1A 1MT0A 1XD8A 2CCJA 5HCIA 3Q5EA 4Q18A 2ZU6A 2E2HH 3SC3A 3UIEA 4RD4A 4BLTA 1XXHB 1PUIA 1ZMXA 3I32A 3JVVA 4OQLA 3U44B 4AKIA 3EIEA 4US0R 5DYIA 2JEOA 3NBXX 4LPKA 2PEZA 1XJCA 2BKEA 2ZE6A 1AZTA 2BBSA 3RRZA 5JZVA 2TMKA 6Q21A 1OH6A 4LF4Q 2UXDQ 1G5TA 1W0JD 1CJMA 2CLCX 4PZ6A 4AKGA 1WXQA 2FSHA 1PZNA 4DB2A 2BMEA 3MJRA 5UKDA 3OAAA 3KF6A 2YU9H 3OEHA 3UG6A 4NE2A 221PA 3AEVA 3OEED 2EYQA 5FPHA 5EJEA 3NEMA 3I2ZA 3TSZA 4BFTA 1K8AC 4B3TQ 1F2TA 4YLGA 621PA 2QROA 4TMKA 4UP7A 1C1YA 2CFMA 5DIFA 2GCNA 3RNLA 4MRPA 2WJYA 1A8VA 3PFIA 4Q9LA 4FMDB 2BMDA 1A82A 1HNZQ 2FPLA 4R4QA 5BR8Q 1BIFA 4QFMA 4TQ9A 5B30A 2B63H 1KI4A 2OEPA 1CEEA 1B23P 1J70A 1QBKC 1CKNB 3HWSA 4MRSA 5FFMA 3FHCB 3QBTA 4NH0A 1KSJA 5BN4A 2AX4A 4JT2A 4Q7KA 2JLWA 5FL7A 2REBA 1NVXQ 1KK0A 2ZJZA 4B74A 4DR4L 4N0DA 5GJVC 4B6EA 2QAGC 4E09A 1R4AA 1NG1A 4R7ZA 1UPTA 5KSZA 2F3RA 2R62A 1NMFA 4MKGA 4AG6A 2CHVA 4AG5A 2QPTA 4BZQA 1YKSA 1E9DA 4MGKR 5B64A 4JS0A 4POGA 2QN6A 1E0SA 3SBDA 2X19A 1VCMA 2WB1G 1QVCA 4BXXG 3SHFA 4EPWA 5FOTA 1NKTA 1YVCA 2QUZA 3AVQA 4TLBA 1Q12A 4DB4A 1G291 1IL2A 3GEHA 4J0QA 3I1FA 4LF9L 3QEJA 3IHLA 3AFQA 4X8HA 3ETLA 4ZKEA 4HSEA 3KOJA 4BASA 3C14C 2OILA 1JR3D 4A3JH 1SKYE 2H92A 2ZR7A 4JOIC 2ZE8A 2OQ0A 4QNMA 5G41A 1CIPA 4WXRA 3J80i 4CEHA 1SKYB 4EFLA 3WYGA 1NMZA 4HAWA 3A5UA 2NGRA 1FMLA 2OFWA 3GD7A 1E4YA 2KBNA 2Z43A 5LD2C 5D3MB 4KLZA 3HOWG 4GNXA 1XNRQ 4YDHB 1A62A 3WXMA 4Q21A 1E2QA 2UXCQ 1KJZA 1XZQA 3T12A 1YZUA 4M9XA 1IOZA 5KNBA 4AKEA 4ZKDA 3RZDH 2R7ZH 3A4LA 4LF6L 2A7QA 4LJ5A 1N32Q 3S16H 3CNLA 5LB4A 3C5HA 4HJ9A 3SJBA 5A5GA 3W8NA 2GTPA 5JJLA 2WSMA 3ASYA 3KKOA 2FH5B 2XSZD 4FXPA 3T5DA 1VMAA 4IDPA 1P2SA 4NBSA 3K09C 3N70A 1IN6A 2VP0A 3I62A 1H65A 1SVLA 4B71A 5JBQA 1FL9A 2GEVA 3EX7C 1VQ8A 3K1JA 1C4OA 2XJ9A 3THYA 1F5NA 2WWYA 2DFLA 4DAYB 4B33A 4FMBB 3I92A 1ZIOA 3SS8A 5JEDA 2WTUA 2O8FB 1I94L 1DAKA 4GRAA 2ZJOA 1P4SA 1IJEA 1T3LA 4Q4AB 1QHXA 2BWJA 4IJLA 2RCNA 2GAAA 4P0TA 2Z83A 4FW9A 3AQ4A 3T15A 1G8PA 3UDIA 5K36G 1N3BA 4Y7NH 1T8UA 2BKUA 3KFXA 4JLDA 4TT3D 5CYOA 5DNYB 2DFNA 5HZHA 3DM5A 3ZVMA 1JALA 1S1CA 3HU2A 4B32A 3EW9A 3ZIAA 4IOLA 1KZ7B 5IK2A 1VYVA 1DGSA 1KAWA 4I4LA 2JLSA 4KLKA 4JKYA 2VUMG 2ODWA 2GZDA 3K0EA 4JLMA 3U7FB 4LW1A 4KO8A 5AJVB 4OHWA 3IEVA 2IHFA 2F7SA 4UNQA 3CAMA 5AJ3Q 1E0JA 1MOZA 2ZUCA 4XOIA 1N5KA 2VRWA 5C4XG 1JNYA 2IXFA 1KQSA 3C5CA 1ELOA 3V00A 4A4IA 5JCZA 1Z0IA 5SZKB 2HCBA 1E7ZA 3MUFA 2JLZA 3QKSA 4DRZA 2OO7A 1XMQL 1S9HA 4JLBA 2X77A 1XTKA 3L7ZC 3CCLA 2ASEA 1RRPA 3H1TA 3S2HH 1SVMA 1XJQA 1YZQA 1FL0A 4MKIA 5H70A 3HOYH 3PR1A 1O3YA 4DSOA 1KC8C 5BN3A 4A3MG 1K8GA 5FPTA 3AM1A 2ERYA 1A2BA 2PNHA 1CR0A 2KE5A 3UK6A 2JATA 4URVR 3T1HQ 3BB1A 3M85A 2GWHA 4AI6A 4A93G 1B70B 4UJ5A 5KPJA 1E4VA 1T0JB 4LBZA 4C7OB 3VR2A 4DZZA 5FBVB 2WMOB 1RIFA 3LVQE 4V0NA 2PH1A 4O2LA 5IYBH 1JB7A 1HNWQ 3G5UA 2JJ8A 1KI6B 5BYJA 2PX3A 2VQSA 1U9IC 3AVOA 3FKSA 4APVA 2EXDA 3K8AA 2YHSA 1FFHA 1N34L 3U3JA 3PVSA 1X1SA 2HF9A 1E99A 4LWCA 3QOFA 5TMPA 1YNXA 1R6BX 1YR7A 5GJBA 4DCUA 3X1ZA 4KI0A 4R4OA 3U4QB 1KYIA 4HIKA 2ZI7A 5IYBG 3EASA 1L2FA 1ZM7A 2PLRA 4OI2A 5IT5A 4MDEA 1E22A 1E1QD 4AWXA 2F1IA 4NCHA 3AVYA 4RZ2A 1E79D 1AS2A 5J4KA 4HEJA 1GILA 5J4VA 5SZHB 4GSYA 3GJ0A 1KD1C 3U6BA 2R93H 2F4VL 1PH5A 3LV8A 1G7CA 1Z6XA 4IOJA 1YHQA 3U7GA 2OBLA 4PANA 2UUCL 4D0GA 3D0FA 2AKWB 5HE8A 1KMHB 4A3EG 4HI0E 1K83H 1PH2A 4R1JA 4MGIR 2EFCB 3DZDA 4WW0A 5AJYA 1ZUHA 4KFRA 1JAIA 3PIOA 2CCZA 5SZIA 2CQOA 4C4PA 1QG2A 4LJ6A 3HOZH 4LY6A 3I55A 2WJVA 3FMIA 5IK2D 4CGZA 2JE6I 1XTRA 4M1KA 4PHFA 4FCTA 4DV2L 1OKKD 4AYBG 4QGHA 4M8NE 4BRWA 1IBRA 5E7NA 4A3EH 1Z29A 2JDID 3HDTA 1KAGA 2ZJ2A 3M4YA 3S1QH 3Q85A 1UF9A 4DR6Q 2HLDD 4A92A 1KRSA 2C98A 2CBZA 4RD2A 5JRZA 4FWIB 5JRJA 2CWPA 3S2DH 1HE8B 4HZUB 4OL0A 4B48A 1SXJA 4HJAA 1RL2A 4A3GG 1TU3A 2ZRLA 1E94E 4DVGA 3VHLB 3VKWA 1YHNA 1NRJB 1Q86C 3AKEA 1XJVA 3OIVA 4M2LA 1KO8A 1CRPA 4B3ML 2A5YB 3SOPA 1MO3A 5CLLA 4M22A 4EFNA 1ASZA 4TMTA 1T9HA 4AYBE 3KXKA 4DR7Q 4PO8A 3TBKA 4ME3A 1HZ9A 1L2TA 4EKDA 2VHCA 3REGA 4O3MA 1OB5A 3RN2A 3CMAA 3GLIA 1OW3B 2QRZA 3NG1A 1RC8A 4JI4Q 4BQSA 4C3HH 2QT0A 2QG6A 3MGCA 3QPVA 4JV5L 2JJQA 1O87A 4Q4AA 3EBEA 1TEXA 1OSNA 1WQ1R 2HEIA 2LKDA 1YR8A 1U0LA 1Z28A 3RDPA 4JLVA 2VNUD 2W0MA 4A1FA 1GVPA 1IBLL 1N5IA 1GL6A 2ONKA 3M1IA 3ZJYC 3J81c 1W4BA 5M5WH 1P6XA 2B21A 3CH4B 3P4XA 5JECA 3KKMA 2XZLA 4QOSA 1SVIA 3M4PA 2HT1A 2D62A 4AH6A 2QGNA 4A3KG 4JYAL 2X2FA 1XD2B 4OKSA 2D74A 4A4DA 3QUSA 3OHMA 4F93B 4ACBA 3LNCA 1WB9A 5M5YH 1JR3A 2PEYA 2JK8A 4GNXC 4ASUA 2AK2A 2V1CC 1OE0A 2VUMH 4HYYA 4AYXA 4WVFA 4B44A 1IJFA 4DR2L 1FMJA 5IT9c 2V9PA 2ZTSA 4HDQB 2IS6A 4LHYA 2P5TB 4IVPA 2D06A 1ANKA 1H8ED 3CWZA 3KF8B 2JA5H 3CCQA 2DR3A 4JZKA 4KITB 2A19A 4Y0VA 2QM7A 5KNDA 1S3OA 2L15A 4EX5A 3K0FB 1L4UA 3WBJA 1QVGA 3VU9A 1QVAA 5AR1A 1SVKA 4RY2A 3RN5A 2Z0MA 5DHAA 2D2FA 3FKIG 3S1RH 2ZUDA 3PENA 3HOVH 4M1OA 4B2PA 4EPTA 3GCGA 4F4JA 3FMOB 2K75A 3EZ2A 5F9FA 2RH5A 1X55A 4X65Q 4EFMA 2UUBL 1AS0A 2NO6A 3R8CA 1XPUA 3ND8A 2O8DB 2WAXA 3TJZA 5IE8A 5IRCD 1AQYA 3B82A 3PEWA 1HH2P 3AV0B 2V6JA 1UEBA 2V54A 5FUYA 4C30A 3WNBA 2JLQA 2BA0A 2YWGA 3PIRA 2KI5A 2OAP1 4GOXA 4HB0A 2NZJA 5HGQA 1G3QA 1G8HA 3KLWA 4NXNL 1Z83A 3CR7A 4EUNA 1D8LA 1VS0A 1XMQQ 2VHJA 821PA 1EX6A 1G4UR 1CR2A 3RR5A 2F1HA 3RLNA 2AHOB 1P9RA 2GBLA 3R9WA 521PA 3CR8A 3ZZ0A 3TAHA 2JJ2D 4PG3A 4OWWB 5HY6A 1QG4A 2PL3A 4TL9A 2Q0HA 4MQBA 3Q9LA 4LJAA 3ZYCA 3BZKA 3IIJA 1GRQA 3E9IA 4JI2L 2IYTA 1IN4A 4H1VA 3TKLA 4CZ2A 4HUTA 3GTKH 4DV5L 3DMNA 4DDUA 3SGIA 3K9HA 5JSZA 5FBLB 1GNQA 3VR1A 2KJQA 4PC7A 1D2NA 5C18A 1Y63A 2QSZA 1T91A 1EWIA 4TL6A 3A1SA 4OHXA 2CJWA 2XXAB 1SULA 3N2EA 2PJZA 3PEUA 4JT4A 2K5NA 4BY7G 1H8HD 3ZVRA 3AVUA 3I4NH 3KZ1E 1RJ9A 2CHQA 1E24A 2JJ1D 3ER0A 1Q21A 1S8FA 4A76A 3TSWA 3CC4A 3IGFA 3MWLA 2QA5A 4A3KH 5JHGB 4MKFA 1WCMH 2XTIA 3PG5A 3GTLH 2IUTA 2RHMA 1KTVA 2VLIA 3W90A 2JLVA 3HYRA 3STBD 3UE0A 2F43B 1KKLA 3FMFA 1DTSA 3PO2G 2GEDA 4M21A 2ZRDA 1QZGA 2KHIA 1ZVQA 1NTGA 4LF6Q 1G18A 1YE8A 4B3SL 2EQBA 2BH8A 2D7DA 4ALPA 3TE6A 4GOPB 4A8JA 1XRJA 1VDZA 4BA2I 1VYTA 2C2HA 1JEDA 3BGWA 4LFAL 2BV3A 1OIXA 1SFOH 4ZCLA 3ZD7A 3I7FA 2FOLA 1L8QA 3K70B 2PI2A 2I1QA 4QKQA 3PO2H 2GRJA 3DOFA 3LLMA 3AVWA 2FNAA 2XTMA 1EFUA 2PI2E 4HAVA 5CM9C 1Z6TA 3ERSX 4QBHA 4GOPA 2CL6X 1D6JA 3RSLA 3FHTA 2C8VA 2GKSA 5EQTA 4NCIA 2NO0A 2WPDA 4TLAA 4EQ5A 1FX0A 2ZYTX 3R9IA 4V0LA 4R71A 1QHSA 3B8HA 2RF4A 3QPWA 4Z8YA 1S96A 1JJ2A 5FBWB 2IXEA 4P33A 3H0KA 5M3MG 4ILEA 3ADKA 2VA8A 4HB3A 3BJUA 1GWNA 4BRUA 1NBME 1QVRA 3CC2A 5LMNL 3LXXA 4BEJA 3NDBB 2BM1A 4YMVA 1XNRL 2EQSA 3KTAB 1XEWY 3W5JA 2UUAQ 4HDOB 2DB3A 2ZI3A 4TSFD 1JPJA 4DV4Q 2K5UA 1ZCAA 4Q4HB 3TW8B 2QE7D 5HKKA 2AD1A 1ONBA 2P6NA 1S4QA 4LF4L 1X56A 5JI2E 2ZTCA 4HDCA 4KSBA 4D82A 5IP7H 4D2IA 4LDJA 3CX6A 2IUUA 1RIPA 1MO5A 2WJGA 5KDDA 4LWZA 2AK3A 2X8AA 4LV6A 2Z4RA 1MKHA 4JL8A 1EFWA 1S0UA 1N8RC 2GK7A 1TQ6A 1UE6A 5ELNA 3F2CA 1N6NA 2IYLD 4IOAA 4V0MA 4QGFA 3K0AB 2GJAA 4WJ4A 4ZV4A 3I5YA 3JVUA 5FR2A 3MCAA 1XXHA 2YOHA 1ZJ6A 4Q1FA 4LFCQ 1M8PA 4MYHA 4XD7A 1XMOQ 3UANA 3MWJA 4K81B 4QJ4A 4G5SA 2OFOA 4QXAA 5EE5B 4E03A 3IQWA 3AGQA 4OJKA 5FI1B 2IYSA 3LD9A 2B3GA 2CNWD 2WWGA 1FP7A 4DLSA 1V43A 2ZRFA 2VSFA 2B7BA 1KI9A 3RANA 4NB3A 2C77A 3AUXA 3EIQA 1EK0A 2IYUA 1NY4A 3TW4A 1KY2A 1QZXA 3IBYA 2ZSBA 2RGXA 1R0XA 2BMFA 3G71A 1J7KA 4DV0L 4QNRA 4A6XA 4TL8A 2GVDC 3CCRA 1KJWA 2IYVA 2P0EA 2C78A 3AUYA 1GUAA 2FFQA 5FI0B 4IO9A 4R2HA 3SYLA 3J7A5 4RD1A 1VQ9A 2V55B 4JCVE 3I4MG 1VG9B 2BJVA 2GETA 2CMKA 2H17A 3GLHA 4TWZA 1OXUA 4LYAA 2FDCA 2XX3A 5FPYA 3ZH9B 1NSTA 2RGCA 2BM0A 3GTQH 4B6FA 3CNOA 3TS0A 1CKNA 3IEUA 2JA9A 4BLPA 1E9CA 1CR4A 3U7EB 4LBYA 1FNNA 4Q03A 5BWMA 4BBRG 4NCKA 4PC2A 1FNMA 4QM6A 1E2DA 3MMPA 2Q2TA 3RHFA 1A4RA 4OK5A 1P2UA 5HR5A 3A6PC 2UZIR 5EUMA 4DXAA 1IY2A 2ZRMA 4BEBA 2PJRA 2XZPA 4DUZQ 1M1YE 5FTJA 2WICA 1OFIA 1ZM3A 2AKAB 1D8TA 3CCEA 3EIHA 2ZYVX 5LMUL 2RGGA 1ZC3A 2P3SA 2WOOA 3D3QA 4JL5A 1EQRA 3CMEA 2FSIA 4TMVA 3R7WB 1COWA 4GN4B 2O5VA 3GJ8A 4R4TA 5GROA 2BMJA 1ZBDA 2FU5C 4DBLC 2O0HA 4PMWA 1KIXA 4QHYA 4DEXA 4YHHL 4PXAA 2CL7X 4HATA 3W5OA 2ZSEA 2WJIA 5D3QA 1X8KA 3SNHA 1E9BA 3KDFA 4LI0A 3QKRA 5KU1A 1OHHD 5CDFE 2JLXA 1PJRA 2A78A 1KL9A 4NYMQ 2BEJA 5AJXA 5DLQC 5KDLA 4KVAA 4BFXA 1NL3A 4DUGD 3A37A 4XWOA 1NG9A 1JJGA 1ESNA 2FWRA 3BXZA 2G3YA 4LF9Q 4L15A 5AUNB 1I94Q 4NU0A 3C41J 1G5PA 2W6JA 4OX9Q 3GLIB 1W5TA 1KIMA 3GFPA 4A0RA 2XOKD 4Z8XA 1NI3A 1ZM2A 2JEBI 4KBGA 3ULPA 1U8YA 2P2LA 4Q4HA 5JI3E 3KQHA 2PMDA 2O8DA 1NLFA 2OBMA 3GEIA 4JLNA 3KJPA 3TH5A 3NXSA 2PQAB 5L3RA 1GITA 1NJIC 3H3VH 5LBIA 3TS2A 2JASA 2QGQA 3NBYC 3RAPR 2XB4A 5GADl 3L82B 4PPNA 2AXNA 3A1TA 3ADDA 4RFVA 4JI7Q 2HF8A 5BN5A 1LTLA 2KCTA 2UXCL 2ZRCA 4GNKA 4KBFA 4YXWA 4DR6L 3GDEA 3AP1A 3SJCA 2MO0A 3F1ZA 1QZHA 1NN1A 1TQ2A 4KV9A 5AWFC 4DLWA 2QP4A 4IDHA 1R5OA 4BFVA 2EW1A 4HLCA 3UATA 1V9PA 4ZDJA 1GNRA 4JLPA 2J5XA 2IYRA 3AF1A 2B92A 4QBGB 4URUR 5B57C 2HQLA 4PX9A 2JJ1A 3A36A 4F91B 2UUBQ 3S24A 1IY1A 2RKOA 5GQOA 1U98A 2ID0A 4P31A 5IDVA 5F3WB 1GKHA 1NKSA 4EQ6A 1MKYA 1GZSA 4DNIA 1Q57A 4MDFA 1LS6A 2IL1A 1K5GA 3O8BA 4Q4LA 3LXRA 4IFEA 1VYUA 3B1YA 4OBEA 3OEHD 2R8RA 2K4KA 4HIMA 1JAHA 1ZUIA 1AK2A 3OEEA 3TEHB 2MO1A 4URWR 3RS7A 1HZCA 1N6PA 4B3XA 3OFNA 4LHZA 4IXNA 1XMIA 1VPLA 4PZYA 1C0AA 4US2R 1TNDA 1X86B 3FMPB 2OWOA 3Q3JB 2A30A 2FGJA 1Q81C 1JQJC 4MKHA 1DVRA 1EFRA 3CBQA 1AJEA 5M5XH 2VQEQ 4ZDKA 2V1XA 1CP2A 1M90C 2ZS8A 3CPFA 3VMFA 4D6PA 3M9BA 4L4UA 2VW9A 4ON9A 5DI9A 2IHBA 4MA4A 5GADC 4JOIA 1OFUX 2MSDB 1PHJA 3B78A 2RHSB 4TYNA 4BLRA 3BB4A 2Y8EA 1VQMA 2ZI6A 3AGPA 4DHEA 4DLYA 2DFTA 2CLSA 4OONA 2A5GA 3WNCA 3T1YQ 2UUCQ 4MRNA 4EPVA 4CYMA 1VCIA 2RGNA 3HU3A 4EIWA 1OLOA 3CQZH 3RWOA 2ORIA 4PHTA 1CJKC 3U4QA 4HAUA 1XNQL 1G6HA 2K5HA 2QI9C 3UDGA 4HLQB 4PFSA 4B75A 1E0KA 1CBUA 2QMHA 2RMKA 5B2ZA 3T1OA 4B76A 4TSFA 1UE7A 4LJ8A 2NO7A 4P72A 1JEEA 1AH9A 2PZGA 4EPXA 1LFDB 2C35B 3D7MA 1J8MF 3QE0A 4LZZA 4TZ0A 1N34Q 5HTKA 2UU9L 3OIYA 4X65L 1BMFD 3ADBA 4TYQA 3ADCA 1E2PA 4DV3Q 1GRNA 3D6TB 3KF6B 5LB2A 1UKEA 2ZI5A 1KK2A 4AK9A 4DR5Q 1T8TA 3GP8A 4I99A 2V1UA 2NMVA 4QJ3A 1SVWA 3JAMc 2J3EA 2G77B 1JB1A 3ZS8A 4NPHA 1CRQA 1BOFA 2IYXA 4EDHA 1YZNA 4EJSA 5TXGA 5AUOB 3EZ7A 3BH0A 4HIOA 3CF0A 4EQ6B 4HZUA 1OF1A 2QAJA 3B6EA 5EXXA 3I4NG 2ZJAA 4G5OA 2VS1A 1WE2A 3PITA 2ZR0A 2IWRA 2WZQA 2IHEA 2AKYA 5EP2A 2QM8A 4L5TA 1F2UA 1R5NA 1VHTA 2QPAA 1RRCA 4FN5A 2OCEA 2WIAA 3X1XA 2AWOA 2VY3A 4JI0L 1G8FA 3LBNA 3GJ6A 2UXBQ 3CD6A 1YZTA 1Q82C 1WRBA 3CCMA 2DYKA 4HB4A 4B3CA 1CXZA 1Q22A 3CWQA 1IYJB 1YITA 4LHXA 2FA9A 4NYIQ 3WP0A 3DL0A 4DUZL 4HJ5A 1RYFA 1BBWA 2VZAA 1XEWX 4POFA 2YVUA 1ZD8A 3WHKA 2W83A 4OQMA 3W34A 1GOTA 4IOCA 5CB6A 2VBCA 4XH9B 2J0SA 5JS7A 2IX3A 1XD2A 3VX3A 4DV4L 3QQ5A 1G19A 4PR0A 1CLUA 3QF4A 3F0TA 1GD7A 2FEMA 3CO5A 3F3YA 4CEHB 5EP1A 3MJHA 4U00A 4QJ5A 2J87A 5F9HA 4I1UA 1TPZA 3EN2A 1N36Q 2PT5A 1W46A 3H84A 5EZ5A 3AYHB 1EFHA 5EAYA 1L0WA 2V7QA 2KWIA 1CKOA 5J4HA 1YIJA 1R0ZA 3EIVA 3K81C 1EG7A 1TWGH 2FPKA 5FOWA 2ZYUX 3RRYA 3VU9B 3GTGH 3QG1A 2V3CC 1YVDA 1W4CA 4RJLA 2G83A 4MH0R 2D4HA 4OQXA 2IC5A 2G1JA 4BLQA 2CLDX 4MYCA 5FOSA 2JQOA 1A63A 3G0HA 5L3SA 1R7RA 1V5WA 2BHRA 3ZQJA 3B1WA 3TQFA 3CRQA 4C7OA 1IBKL 3C15C 3MAAC 4X6AH 4BUJA 1BYUA 1EFTA 4A3IH 1NLZA 4IPGA 2IYQA 4URZR 4FCWA 1E32A 3RRNA 5FH9A 4JYBA 3PJRA 4GP7A 2IX0A 4IFDJ 5AK0A 3EXAA 1I3QH 3GTPH 1RYHA 1Z0FA 3W1GA 3BZCA 4TTRA 1W2BA 5G40A 4YMTA 4D4KA 5IF9A 2GJKA 3O8CA 4TYWA 5IP7G 4A0HA 4A3DH 1EESA 4DUGA 1M74A 3LW7A 1TXYA 1KMQA 3QENA 4X8LA 1Q3TA 3B2EA 2O8FA 1W36B 1UDXA 3QKSB 2W6JD 4JSTA 1DELA 1TX4B 1VTKA 1QHYA 4A3FG 2R6DA 3UE1A 4BGDA 3AKCA 4CEJA 5C1BA 2K14A 4BY1G 4GOPC 1F48A 1YJNA 2ZM6L 2EFEB 1GP2A 4LUCA 2KHJA 5FOXA 2MQHA 2ZSFA 1ZU5A 2QGZA 2K52A 1ZU4A 3SYNA 2HT6A 4N3NA 5CIQA 1HT2E 2AN9A 5BQ5A 4D25A 5C4MA 1JI0A 4JI1Q 2VQFQ 1ZYUA 3FTQA 1G51A 3F8TA 3E5HA 3VDYA 3IDQA 2VF7A 3TQCA 3HOUH 4A3LH 1I6HH 1LB1B 3N5CA 3PUYA 4LV8B 1IXSB 1P72A 3OW2A 2R7DA 3T1VA 2JCSA 2NZHA 4P74A 2C04A 2B29A 4PSAA 3P26A 2WMNB 1DAMA 1KO1A 3THYB 1HE1C 4TVAB 4RMFA 2A5JA 3L0PA 1JBKA 5FTKA 3GLFA 1NVVQ 1VECA 2QBYB 1KOFA 4JJZA 4MUAA 4ZO4A 4RZUA 2O0JA 3R20A 5GJWC 3QSYA 4C3JH 2A5FA 2DCUA 3QXJA 4LC1A 3C4JA 4RZXA 5JHHB 1TTTA 4JBXA 4B3TL 1YBYA 4A3MH 1EUJA 4JBWA 4BE7B 5JWHA 4XVRA 1W36D 3T1YL 4L5RC 3AKDA 3LRPA 1UE1A 2QMOA 2GK6A 5LDDC 1WP9A 1ZM9A 2ZYWX 4WZBE 1ODFA 2JA8H 4V0ME 3HR8A 4LFAQ 1HUQA 1KSFX 3ND9A 5JS8A 2R44A 3TUIC 2XNSA 3CX8A 4L5SA 5DSZA 4W9MC 4PQRA 1WBBA 1TAGA 1XPRA 3KX2A 1FJGQ 4KU4A 1SROA 3I4OA 2BIFA 5IHPA 3EA5A 2A5DA 3LA6A 5G53C 1PUJA 2WWXA 2UZ3A 3LFUA 4DLTA 2JA8G 3VHXA 1HQYE 2Z4SA 2ATXA 4LCBA 3JC66 5IYCH 1DARA 1N6IA 2QAGB 3CW2A 5FPSA 4ERNA 721PA 3PUXA 2HHHQ 2YOFA 4JBKA 1NSFA 4Z54A 2AD5A 3TIFA 4PC3A 2F3IA 3HOWH 4BBSG 1D2EA 4R98A 1A0IA 1LS1A 1NBMA 4A3CH 3EC2A 1PLLA 2FFHA 2R7FA 2XZOA 2NVTH 1RRGA 3AKYA 5IYCG 2I1VB 1YI2A 1WCV1 2ZROA 3MD0A 4HAXA 2UUAL 4TTQA 2N3SA 4W5WA 1AS3A 5FOUA 4OX9L 4F7WA 4JLAA 3THXA 4DCVA 3FFAA 3MXNB 4E07A 2EVWX 4FIDA 1X3EA 5CYPA 5P21A 2J7KA 1HR0Q 2B8TA 2ZEJA 4TMZA 2ZI9A 2OSBA 4TYYA 3THWA 4PSVA 1FUKA 1MABB 2Y0SE 2KSQA 3OZXA 1E2GA 1I2DA 1W4AA 3VQTA 1Y1WH 2OG2A 2QP9X 4Y52H 2ZRGA 1S72A 4IJMA 3CZQA 4IOKA 1LF5A 4I81A 4M0LA 4DLRA 4YCWA 3EPJA 4RG1A 3G82C 3HKZG 4RKFA 1X54A 3W3AA 5GAGC 3AVPA 4QQBX 5KO2A 3DLLA 4DIDA 1H8EA 3R9XA 1SGWA 5AUPB 2J45A 2JAQA 1YZGA 5HPYB 3CF6R 1P73A 5G3YA 3RC8A 3VKHA 2I3BA 1PH1A 4DSNA 4QC2A 2XSZA 4OI0A 2KCMA 3UG7A 2GXUA 1BKDR 4DDWA 2Y0SG 2H16A 5EUQB 1LW7A 2G1KA 5DI3A 4IPDA 1VIAA 2JIZD 4Q66C 3U50C 2R92H 2F43A 4D4JA 1LV7A 1E9AA 2AXPA 2ODNA 3Q72A 3SHWA 4A15A 5C4XH 2JA1A 3AH8A 1N6LA 2A1AA 2OXCA 1II9A 4HLDA 3PCOB 2HJVA 1XNJA 2AR7A 4UPAA 5GVSA 2J1LA 2GVZC 4LFCL 2AMCB 1VKJA 5SZJA 3A1UA 1O7IA 4MUBA 3QXSA 4TT3A 3SU8A 3U5ZB 1FGUA 3B7GA 4NYJQ 4NL4H 4GN5A 1GVNB 4Z1MD 3ZIAD 4NYMR 3V9PA 4LC0A 2FF7A 3QKUA 2AFIE 4ZCIA 4K0KL 1CF4A 1D2MA 1T6NA 4LHWA 3RRMA 3RS5A 3B1ZA 3GEEA 4PQFA 4J15A 2FZ4A 1K9MC 3KFVA 3QKTA 5C0XI 4RCZA 1OFHA 1II8A 1Z8FA 1YR6A 2F9MA 3B9PA 4DR5L 3K8YA 4KLNA 1Q8KA 2QZ4A 3LY5A 4OI1A 4DLXA 2V8OA 4DWJA 5FLXc 2DBYA 4CEIB 4C0AC 2VQEL 1DPFA 2R6AA 1VG8A 1U8ZA 2EU8A 3S15H 3K0SA 2ALYB 1HJPA 1OXVA 3G48A 2RHQB 5H1SE 3DM3A 1WFQA 1J5EQ 4RVCA 1AM4D 3LQQA 121PA 1PLJA 1QF9A 3H3VI 1P9NA 3KJGA 2AFHE 3QVUA 4QHTA 3DO6A 2YZ2A 3RYTC 4JI5Q 2FX3A 3H4MA 3LGJA 1AQUA 2G88A 4G5QA 2CDNA 1E2IA 1Q1QA 2ZS7A 5TV2A 3VNVA 1Z5ZA 1OIVA 4IFDG 1WA5A 2FJUA 3IBGA 4OHVA 5KUTA 4LYHA 1C9OA 4DV7Q 3CCJA 1M7BA 2K50A 2F3TA 1CULC 1R8QA 1PH9A 3CH5A 4LYJA 3HR7A 3TNFA 2NN6G 2BOVA 4ZIRB 1SE8A 3BWDD 3ICQB 4AYWA 1Q7YC 3CRVA 4FMDF 5CITA 1RRFA 1TWAH 3EC1A 1S9DA 1IM2A 3UDFA 1B7YB 1H95A 2ZJPA 3RABA 5FTLA 2NPIA 2IYWA 4IVQA 4EPRA 3U61B 3TUJC 3FGNA 1NP6A 3B9QA 1CJTC 1VQ4A 3H2YA 4JJKA 4XTRA 3TSOA 5L3VA 5C3EH 1G5RA 4PZ8A 3P32A 4GOKA 3KQLA 2W2TA 3FVQA 1Z08A 4M1WA 1BKBA 1OB2A 4V02A 3RLOA 4UXJA 3U3OA 2GZAA 2L0XA 1HEIA 1VQOA 4A3BH 2I5MX 1E79A 5H8WA 1Z6GA 4KSCA 2W0SA 2D7CA 2JGNA 2J41A 3FWYA 3RS2A 1M6NA 1KDTA 1M7HA 3PUWA 3H0GH 1KI3A 1TF7A 4AIMA 3NHAA 3BU2A 2IX1A 1OTCA 4DSTA 1CS4C 1KDOA 1E0AA 5AJWA 1T5IA 4KFSA 2JEAI 2Z0SA 5IY0A 3CPJB 3KJHA 2PT7A 4DV1Q 2AHOA 1JMCA 4JI3Q 1QHHA 1Z06A 2GCOB 4JI6Q 2VTKA 4HAZA 4QGGA 2QRNA 2XITA 1DAIA 2FSFA 1ZM4A 2QMUA 5M3MH 4L16A 1WOCA 4UY8C 4RFSB 3S1AB 3CP0A 1DO0A 1BYIA 4QBFA 4N1AA 5EE9A 3QNUA 2D0OA 3VR6A 1KHIA 4PTLA 1V1QA 1ZP6A 2RGAA 4BFWA 1DAGA 4C9BA 3UWOA 2NG1A 1CKMA 1AKEA 3RSOA 1RKBA 4LUZA 4JI4L 2D2EA 3NC0C 3FHWA 1MV5A 2BBWA 2OHFA 3T35A 4MNOA 3TGPA 3BFXA 4M9SA 5CLQA 2IWHA 1KDRA 1SMXA 4JI0Q 1E9RA 1Z6AA 4A36A 4NHOA 4AY2A 1HR0W 2WP8J 1QHNA 4IXMA 1DAFA 4V0KA 4XIGS 3GTMH 4QL5A 4Q4JA 5DHFA 1KZGB 4D81A 4Q9HA 4DKXA 3GQBA 3GTOH 1J2JA 2R6CA 2GVAA 3NELA 2HYDA 3DEFA 1VQDA 4A0GA 4XJXA 1FZQA 2I5HA 1XP8A 1IXRA 1VHLA 4JBYA 3M7NA 5C0XJ 3E70C 4DC9A 4ZDIA 1IY0A 1VQPA 2WV9A 3K9LA 1GIAA 1E3PA 1EX7A 4RD3A 3CPWA 2JLRA 2E1RA 2IK8A 3JAMi 4YWKA 1RW4A 2BJWA 4IPCA 5FJ8G 1EFCA 1U99A 4PQYA 4GP6A 1KHTA 3A74A 1N33L 1G16A 1X1RA 1N6HA 3KUCA 4DEYA 4MZ9A 2GVBA 4TLEA 2XNDD 3GLGE 2JA5G 3AF2A 2DWOA 4UP8A 3V4FA 4G5GA 4BWYA 5A0FA 1UKVY 4O0AA 1VQ6A 4YQFA 2ZAMA 1N9WA 2P6UA 2XJ4A 3UDXA 2QTHA 5LD2B 1XTIA 2ONJA 1I2MA 2ZS9A 3GPLA 1OXXK 1EIYB 3P1JA 1YRBA 2H8KA 1GAJA 1E1OA 3CPHA 4PZLA 4Q1BA 5L3QA 4NYIR 2XGJA 1XNQQ 4Q19A 2C9YA 1HNXQ 2HXYA 2V4ZA 4URYR 2YWEA 1BO6A 1N6OA 4DLVA 1FUUA 3GLHE 4LPSA 2BCGY 2Q9CA 4US1R 5CB8A 1VQIA 1JJ7A 2OCPA 2WM9B 1VQKA 2GA8A 2ERXA 2OUKA 4BECA 1LTQA 2P5SA 2ATVA 3BB3A 2WWHA 1ZW6A 3K7UC 4E22A 1NJGA 3I3SR 1KKMA 3DVLA 3IO5A 3MG9A 2ATWA 2VO1A 3KQKA 2CKZB 1P75A 2F6RA 4NONA 5L8VA 4A93H 4HZIA 4XWKA 3HOZG 2OTJA 2Q9BA 3QJYA 4Q1EA 1JXOA 1UBGA 4B3DA 5L3SB 4K0KQ 3JZAA 4UQOA 2PZFA 4HUQB 3L0IB 2QQEA 3QVVA 4JI5L 2F55A 2CWAA 1WJJA 3CRW1 1PV4A 1W49A 3PIPA 2BBOA 2XAUA 3QXHA 5M3FG 4ASUD 5IWAL 2E5LL 4OO1I 1GM5A 1P16A 2N8NA 4BFUA 1P8LA 4NDZA 1EYGA 2W00A 2REXB 3CPEA 4KYUA 2J0UB 3E0EA 5FLMH 2WAYA 2RHDA 3EG5A 1XEXA 1T3SA 2QTFA 3IRBA 2REOA 2ZRNA 3AP2A 4A3FH 1ZCBA 3MSXA 3RLFA 1DEKA 1G21E 1W1WA 2RGBA 2VIIA 3DM9B 4P4UA 2KB0A 2IUSA 2ZE5A 4YCVA 1ZINA 4FD2A 1VG0B 5IP9H 3K7AH 2QEQA 3KB2A 1AKYA 3WP1B 3BIFA 3LW8A 3P20A 4D26A 1KNQA 3J7ZC 1NJFA 2P67A 2WJHA 4Q7LA 4CT5A 2FXQA 2O52A 4R2IA 1M7GA 2BA1A 5CDFA 3FKQA 1GSIA 3L8YA 2IW3A 1XTJA 4EAQA 4FDBA 3E9HA 2CK3D 4HJ8A 2WBLC 3RWMB 2O8BA 2ZU0C 4A3LG 3ZVNA 5C44H 4NYJR 1R10A 3GLIE 3A1WA 3QF4B 1VQBA 4OXPA 2J0VA 4P4TA 3GLFB 4R4CA 3LO5A 1OH5A 5DLQE 2ZJYA 2F4VQ 4V0OA 3S1NH 1DS6A 1H8HA 1IHUA 4B3SQ 2Q3MA 1UAAA 4QM7A 3U2QA 3U4ZA 1E2JA 1Q46A 4IFDI 1YJ5A 4JV5Q 1F3OA 1GL9B 2GEUA 2WOJA 4ABYA 3WHLA 3EPKA 4GZLA 1B0UA 5C2JB 3H15A 4IJHA 3TRZA 1L1OC 3A58B 4XTCS 4JBMA 1IN5A 1X6VA 3GJ5A 4IHQA 3U3RA 1P7CA 4KYIB 2WVJA 2RB4A 2GJ9A 1LYLA 1VQGA 1QDEA 3MFYA 5DH9A 4C0HA 4MGYR 4LFBL 1RPZA 4L5QA 4C2MH 3L2OB 1W0KA 3NWJA 3QKRB 1IQPA 5G3ZA 1JQLB 1N32L 4X62L 4GL2A 2CHGA 3DPUA 1UEIA 1P61B 5H1YA 3ZQ6A 3SN6A 1Y14B 4Q9IA 5JWOA 2W6ID 4LJ9A 4II7A 3DMDA 1I4LD 4QG7A 2R6GA 1Z0KA 1ZNYA 2HYIC 4Q1DA 1OXSC 1VQFA 4IEEA 3HOVG 3K9GA 2WPDD 4LV5B 1XZPA 2C5LA 2CE7A 3PUZA 1IN8A 2NVYH 2ORVA 4IOMA 4NMMA 2GCPA 1D9ZA 1KO4A 3F5FA 3EARA 1SLJA 3HJNA 2O8EB 3LDAA 1IXRC 2B7CA 4C2UA 3OAAD 4Q7JB 1N0UA 1GRRA 1W44A 1II0A 1X8LA 2ZAOA 1W4RA 3EZFA 3HOUG 1C7YA 4GKJQ 2OT3B 3OIWA 4ZPXA 1TU4A 5IP9G 4M1SA 4TMXA 4A3IG 1DAHA 2CEAA 4PSKA 5TVKA 3K70D 3A4NA 3TMKA 2EWVA 2ZJ5A 1P60A 2VSOA 3FOZA 4GS3A 3T1HL 2W2XA 2ZRJA 1RZ3A 3VX4A 4DR3Q 1KO5A 4C0JA 4DK3C 1F2UB 4JI8Q 1Y1WG 3IKJA 3CW2C 4KHPL 3SQWA 5FUWA 4CT4B 1TWFH 1NN0A 2E2IH 1Z2AA 4DLUA 4UXHA 4I1OA 5J40A 1TUEA 1R5BA 3SI7A 2XGTA 4Q1AA 4BZXA 4IPHA 3WYFA 1E9SA 3U60B 4A82A 2CXXA 4RZ3A 2ZTEA 3LWNA 2Z6VA 4LOAA 4F38A 4MITA 4TQAA 3CCVA 2D0PA 4ZCMA 3THOA 2IYZA 1AA9A 2ODBA 4BLSA 4B2IA 4BY7H 3K80C 1HTWA 1XMOL 4A3JG 2Z5FA 5DN6A 1S3SA 3X1WA 3X1DA 2IS2A 4K46A 421PA 5CJ2A 2DGYA 1KSHA 3KKPA 1M2OB 3TK1A 3KB1A 1AGRA 1CKEA 2YC2C 2YNMA 2DPXA 3ECCA 3DKVA 2OE2A 4Q4JB 3HOYG 1DE0A 2PX0A 1T4GA 2FG5A 1TQ4A 4I1SA 4KODA 4OK3A 5GJCA 1VG1A 3PQCA 4BZPA 1U9IA 4ITRC 1WYDA 4ARZA 3LH5A 2ES2A 1QVFA 1XB2A 4HIDA 1ZIPA 3K09A 2ZRKA 2F1JA 2KENA 3KXIA 1C9KA 4RCYA 2ZM5A 3NENA 3N2IA 4LF8Q 3QG5A 3F2DA 4BFYA 5J5CA 4AQYQ 1SQ5A 2A3RA 3SJZA 5CIWA 1XMJA 2GF0A 3QIAA 1W36C 3S1AA 1YR9A 1W3SA 1W7AA 5KYKA 1KJYA 1NF3A 2ZR9A 1A5TA 4W5JA 5GAHC 1VCNA 5E4FA 3RVBA 4OI4A 1CU1A 1ZUNB 1HV8A 1X3SA 4XD7D 3KDSE 1E96A 4DCNA 3GJXC 3M0EA 1F6BA 2D3WA 2IXGA 3THWB 5HCNA 2NVQH 3IHWA 1NIJA 4CVNA 1PH3A 1PA6A 4M9QA 4TLCA 5AJZA 1VQNA 4Y0AA 3KJOA 4JVNA 2Q2HA 4DV6Q 4M1YA 3UWKA 5LPNA 4GDFA 3AVVA 2ZJRA 4TYPA 5M04A 3WMEA 1BH2A 3OYYA 4R4IA 3J81i 1VQ7A 4QHSA 2O8CB 1AZSC 4KVGA 2ORWA 3W6OA 3AB3A 3QI2A 2F1RA 3A8TA 3UMRA 2GNOA 3NC1C 2IYYA 4D4LA 1T5LA 4GLXA 1MO4A 1XCPA 4JLOA 4FI3C 2EWWA 4GFDA 5DI3B 1N2CE 1NY6A 1SXJE 1EWQA 2H5XA 3CF2A 1F2TB 1UFQA 4OWTB 4JMPA 1VQLA 2QAGA 2I5LX 1AN0A 1JE5A 4DIEA 1Q3HA 1YHBA 4ZDWA 3UMSA 1ZRHA 1XPOA 1GO3E 2DFKB 1KI2A 1Z47A 1VQHA 3ZD6A 2EYUA 4LJ4A 4YCUA 3OTOQ 4A3CG 5C3EG 2CVFA 3CLVA 1NBWA 4HLUC 2QORA 3ZDQA 1UM8A 1M1KC 2W2VA 5C4GB 2LXJA 1QUQB 4B3RL 1XMVA 1PLKA 1XX6A 2SHKA 2VP9A 2ZQ5A 3OESA 5L3QB 2NZOA 5DGXA 2J7PD 1HR0L 1MR3F 2OZEA 2YTVA 4JYAQ 2ZTDA 1Z9FA 2E9SA 4GLVB 2ECKA 4IDOA 3SJAA 3VR3A 1VQ5A 1NVUQ 2LSSA 1XTQA 4GZMA 3C8UA 2HV8A 4QY7A 3TREA 1CR1A 1XTSA 3L43A 5K8TA 4LFBQ 4KHZA 1AGPA 1E1QA 3MEFA 2HIVA 1SZPA 2O0KA 1IBLQ 1KDPA 2C96A 1DBSA 4G0NA 4YXWD 4F92B 1G20E 4CRWB 2VEDA 2IBMA 2X2EA 3WWVA 4TL7A 5EZ6B 4CIDA 3GLGA 1OXTA 4P4SA 3AEZA 3EPLA 1N5JA 2VHUA 1DAEA 3QPUA 3L0OA 1S1MA 1XXHE 4LSGA 5CK4A 2FFBA 5KSYA 4E5UA 2IY5B 4C2TA 2LKCA 4PHHA 4H02A 1KNXA 3TAUA 1A1VA 5GVRA 3V4RA 2NTYC 1HNWL 2FGKA 4G5RA 1K0RA 2J46A 1TF5A 2C03A 2H18A 3SBEA 1S3GA 4P4SB 1OV4A 2ZVQX 2IA5A 2B6HA 2J9RA 2EIFA 2UVQA 4IDNA 2PLFA 2Q9AA 4BBRH 4IFBA 1HH4A 3MWYW 3EZ9A 4G01B 3WY9A 4GKKL 4JI8L 1NIPA 3ZVLA 4DT1B 2HLDA 1N0WA 1IZ6A 3B6YA 4P75A 2AL7A 1HQCA 2CVHA 2IEZA 1MRSA 3AF3A 1ZNWA 3HOXG 3TLXA 5EE0A 3ZGXA 1XBTA 4QL3A 2V6IA 4A6PA 3NBFA 3NH6A 2CL0X 4GT1A 3DOEA 1IN7A 1KY3A 1YZLA 2H57A 4LF7Q 3BORA 2GILA 3LVRE 1G9XA 3J80c 1OJLA 1IXZA 1W0JA 5FTMA 2UXDL 3PXGA 1Y1VH 4JI2Q 2QBYA 3BOSA 1KSGA 1OIWA 3E1SA 3UKDA 2YWFA 4NXNQ 4C3ZA 4MGZR 3PO3G 1G6PA 2QY9A 1G6OA 4U02A 4TN1A 1FJGL 3SFZA 4O2RA 5KTYA 3KQNA 4DDVA 2NO1A 1OKKA 1NMYA 2OCYC 4JVMA 4KCGA 3W3ZB 2WAQG 1N6KA 4JG2A 1E9EA 2JDIA 5EXSA 3Q5DA 1Y1VG 3IUYA 1VQAA 4DV0Q 4TQUS 4KFTA 1GKYA 2R65A 3I5XA 3GLGB 3U3MA 3U7HB 4AQYL 3AVXA 2IF0A 2B63G 1SKQA 3CRRA 5E95A 2FZLA 4QBIA 4NPSA 4JVSB 1RVDA 4PPQA 4QIWE 1LUZA 4M53A 3BJIC 1TWHH 3BH6A 1GL7A 1L1OB 4DPGA 1LF0A 1K73C 1BMFA 3KXLA 4M1TA 1QUQA 3SZRA 4A0FA 1W5SA 4B3BA 5EP4A 3M4QA 4U5XA 3EAQA 1S2MA 3Q7PA 2DWPA 3M3YH 4X62Q 3WRYC 4D0LB 2WAQE 5ELOA 3QXXA 4GLAC 1UKZA 1Z63A 3X1YA 4B3GA 2LWIA 1VCOA 2OQKA 3M6AA 1U0JA 1GKIA 2EFGA 3UMFA 4LF5L 3SDZA 3LBIA 1I4TD 1P5ZB 1G7TA 4DR7L 1UBEA 1U90A 2JA7G 1A7JA 4QJFA 4DR1L 4WXPA 5JLJA 1RJ9B 4Q1CA 5DISB 3VTKA 2ZE7A 4JYCA 2QNRA 3U4VA 5JCPA 1US8A 2R7ZG 1G4AE 3W6PA 3VNUA 3U3KA 2IEYA 2UXBL 2BCJQ 4XVQA 3A5ZB 3WBKA 4Q9JA 3PEYA 1SVOA 1II8B 1OH7A 4RD0A 3WMFA 4G3XA 3IO3A 4F4IA 4X66Q 1ZC4A 3ONWA 3LAWA 3OF5A 2JIZA 4XVUA 2ZRIA 3HOXH 3NKVA 5F98A 3HFZB 2R92G 1HT1E 1KI8A 2QTVB 1OFTA 4DR1Q 3FKIH 1EQQA 4PAOA 2XXAA 4FWTA 5DYGA 4B3RQ 2Q21A 4GBMA 5JWRA 4C3IH 4NCNA 4AIIA 1EIFA 2YTYA 1MJCA 4B43A 3ZZTA 1YRAA 2YYZA 3D8BA 1KGDA 1FVIA 3RS0A 3IQXA 1L4YA 4Z1MA 1U5KA 4AD8A 1IBKQ 2LXKA 4DT1A 4HJ7A 3PO3H 3RNUA 3I61A 1E1RD 1ZD9A 4HAYA 3BRWD 4CEIA 3B85A 4JSYA 1WDTA 2V7QD 4IRUB 2QEXA 2UKDA 3CZPA 2ZSDA 4ZI2A 4LGMA 4JC0A 1NMGA 5C0XG 3EWAA 4P32A 1G3MA 3K53A 2GZHA 1X3FA 3W8RA 4B3FX 2JLUA 4LJ7A 3RS4A 4YWMA 3BE4A 3CIOA 4YY3L 4P71A 2C95A 1T0HB 2VP2A 4GMDA 3TVDA 1RFLA 2NIPA 3ULJA 3IPYA 3ZLJA 4RD6A 3LLUA 2VSXA 4U7DA 3MWKA 3LX5A 1BVSA 2VHTA 3B13B 4LRWA 3K0XA 4YDSA 2NPFA 4MRVA 1MABA 3C7KA 4FMCB 3FYHA 5JEAG 2PZEA 2XEXA 5IWAQ 3IIKA 2ZJQA 1FP6A 4C0BA 4RSGA 4YWLA 2YINC 3PF5A 1CSPA 3DZ8A 3AFPA 4NZYA 1PH8A 2VH5R 1YZ6A 2VL7A 5DE3A 4V03A 1W2HA 4DKAC 1WCMG 5LMUQ 1JR3E 4Q5IA 5HZKA 5KSOA 3C16C 4XSGA 4ESHA 2W58A 4B2LA 3TR0A 2OLJA 2DHRA 4DUYQ 3BERA 1J6QA 3FP9A 1JXMA 1SR3A 2Q6TA 5H68A 2ANCA 4OWXB 2QU8A 1WBDA 3I8SA 2GJ8A 2XTNA 5TARA 3ICEA 1MJEA 4A3GH 2RGNC 1E2EA 4DR3L 4X64Q 2CCKA 4LBVA 4Q00A 4FINA 4DV5Q 4ACAA 1Q44A 1X3GA 4KFUA 1U81A 2OFXA 3NDPA 4KHPQ 3HKZE 5CM8B 2O8EA 3SR0A 2OM2A 4PC1A 4AC9A 3W6NA 5TY0A 2WHXA 1GDDA 4HLUA 5FPKA 1E2NA 2HIXA 1ZNZA 3VKGA 2EFDB 2YJTD 4W7SA 2CE2X 1G8GA 5EE1A 3OE7A 3PSIA 3CX7A 4YHHQ 3KKNA 4X64L 3CXCA 1OYWA 4B73A 2ZPTX 3PCRB 4JI3L 3P4YA 2IS4A 1GG2A 2O8CA 4WZ6A 2IF2A 5CJPA 1KK1A 3KKQA 5EE3A 3S1MH 4AURA 2YTXA 1IBML 4AKHA 1FOEB 1HA3A 5FLMG 2QE7A 5B58C 5HKKD 3AF0A 2ZI4A 4OYHA 3QF7A 1JECA 3L2PA 3EA0A 1P9WA 3ZS9A 4NCJA 2UU9Q 1D5CA 1E2HA 3TR5A 3M4OH 4G1UC 2N1BA 1BS1A 4NTZA 4CW7A 3UXMA 4BBSH 5FTNA 4WBSA 4NXML 2WJJA 2ZETA 2R9VA 3DDCA 1ZD1A 2A2ZA 3TUZC 4DV6L 2GXSA 2NZ8A 4UNPA 2BC9A 1UWVA 2WFWA 5F2EA 1FQJA 2ZIAA 4EJSB 1UBFA 2J59A 4NKRA 3PUVA 1YU9A 4S35A 1Z0AA 5FUXA 1QHGA 1CJUC 5J4YA 2FV8A 2QSYA 2FFAA 3BFKA 3OTOL
chains in the Genus database with same CATH superfamily
1KI7A 3WGQA 3FDZA 4CKZA 3NIBA 3GQBB 4LVNA 3B1KA 3SXPA 3DTTA 1DCMA 3VAAA 1VSVA 3HCFA 3THSA 3HEBA 1ETUA 1Z7GA 3FHOA 3LCCA 5K8LA 5F7OA 3BF7A 3LQRA 3QU5A 2X0KA 2JIRA 4HLNA 4OEMB 3CZAA 3M4XA 1V3VA 3UZUA 1JLMA 2XBMA 5J4LA 5CFQA 3AM4A 3CHBD 1ORVA 3G5LA 5CA0B 4PAWA 5ES4B 2BEKA 2ZIFA 1O5TA 1L0BA 4C0QC 3I52A 4ESVA 3I73A 4MS3A 3VR4A 1PH7A 1G41A 1E98A 1QR2A 1JR2A 2HXSA 3NTHA 1DZ1A 1V45E 2Z6KC 1F0PA 3MLEA 4L50A 4F0JA 3ZVKA 3ZWOA 3HO1A 4C3IG 1C30B 4I55F 2O06A 4RORA 2I8AA 1L1EA 1JHAA 1UMCB 3JWHA 5L6MB 5H02A 1GTVA 2FVXA 2Q2VA 4MUEA 4RPKA 4ROSA 5SICE 2Y77A 4ZJYA 4KSYA 4MIOA 1B8NA 1F60A 1FPMA 3P27A 4M1MA 1PFSA 3CXUA 4X8OA 1E8DA 4S1TA 2O20A 2X0DA 3CCUA 3BS4A 1Z25A 3CONA 3F9IA 5CLJA 2QPOA 3ELUA 1EY6A 1NNEA 2N49A 1FLDA 4UASA 3KYHC 3FNGA 3I56A 4NC9A 1A2KC 2W6NA 1RBQA 3A3YA 4WCFB 4HDRA 3I8XA 1NPYA 3D6MA 4CCWA 4YAKA 3PO2B 1H42A 2DTXA 1D4AA 1M2VA 2XBUA 4PPGA 4R0VA 5JAZA 1R6TA 4IW3B 1E9FA 1MNAA 2I4IA 4I66A 4OP3A 1D8AA 3A9UA 3PPVA 1SHKA 4RNDB 1DADA 1IK6A 5I7VA 2XODA 3F9RA 4RVFA 3LHDA 3VPFA 4QIWB 2H00A 1CDZA 3V1TC 3VSDA 4DY6A 1D6EC 3STBC 2IY8A 3V2TA 3RFFA 1MJNA 1K7FB 2OV8A 1JICA 4XDZA 1P7WA 4EYQA 1UBCA 3DL2A 4RELA 4B35A 3A6GA 4A75A 2DWQA 1N5LA 2QN3A 4KPGA 1BGWA 1ENOA 2GHIA 4LS3A 3GJTA 3U6KA 4RWSC 2RGYA 2X9QA 2HCJB 4L7VA 3BRCA 2HUPA 1TWAB 1TJNA 2XTZA 1TMKA 3TW6A 4BY1H 1B14A 3N2YA 3NWOA 1EOVA 4HXYA 1U02A 4FFLA 5BYKA 1DEAA 1KYZA 3RVSA 4UNNA 5TSSA 5A4KA 4R8VA 1KABA 1DXOA 1QQ7A 3JD2A 1FTYA 1EK6A 1OUMA 4WLNA 1DG1G 2OHJA 5TPZD 3REFA 2WD9A 2QMZA 3TIXB 2HA3A 1C4XA 2J3QA 2YZKA 3PWZA 4YIJA 2KS6A 5JDIC 1K92A 1YAJA 2I99A 4OQFA 4CIAA 4H7KA 1UIRA 2Q62A 3JWPA 4EY8A 2Q3FA 4R3NA 2WR8A 4URFA 2WLTA 5FL3A 5AVYA 2QVLA 5HIJA 2GXQA 3ZEIA 1IPHA 1WW3A 3SZGA 2RAPA 3IDFA 4BNMA 4UPEA 2EEPA 5KC9A 1ZR4A 5E6SA 5AM3A 3FDTA 1I5FA 2PXCA 1GUTA 4ARAA 4ER3A 1AXGA 3E4DA 5FOQA 1Q95A 1ZWKA 4QDKA 1SRUA 1R0WA 5BW8A 2Q1WA 2OSVA 4QRHA 3TRDA 7YASA 4RBNA 3GV3A 1ORDA 1CVIA 1AE1A 2GJ4A 3G2PA 3B5IA 4CCAA 2I0QA 1RYDA 2QT1A 4I7AA 1G8JA 3GFFA 5AW1A 4IURA 1OZFA 4JLKA 1WNTA 3BT7A 1T0PA 1RAFA 3GLSA 3CUEF 2BFMA 2N55A 3VC1A 4DV3L 1L5YA 3R3JA 2QRVA 2GQ0A 2J0TD 2EHDA 4U2EA 3U61B 1UFOA 2ZDGA 1IY9A 3IP8A 4DCTA 4JT9A 3C7CB 2QA4A 1PTJC 1YDHA 4R2KA 3ZE1B 1X9HA 1WF3A 2HTFA 3K30A 4OBXA 5D3MA 4D7AA 1Z6HA 3LUCA 4RVHA 1EK2A 4DAPA 1YDGA 1WD5A 2E9FA 3DOCA 5AXAA 4RL6A 1ZAKA 3UMVA 4LF5Q 2VF4X 5DLYA 2WQ6A 4S2EA 4DV2Q 4WLEA 3H5NA 3WRXC 5EVJA 1OQAA 3F7MA 2B2CA 2RGEA 1OPXA 3BE8A 3H2KA 4TVBA 4BGEA 3SQXA 2X40A 3C3DA 1U7WA 4EUKA 3R3YA 4YONB 4GM1A 1TZCA 1GRCA 2QTCA 1E6CA 3H13A 4G85A 4QODA 3VM6A 4F3KA 1TM1E 3CNQS 3RROA 4HNTA 1JMKC 5GV7A 1IN1A 2Q2UA 1EIHA 2FW9A 5KJCA 1K27A 4RFSA 4IQJM 3MUNA 1F4PA 3BZUA 5FOVA 1AQJA 2Z6KA 3TCXB 1N36L 1PP4A 1V11A 4BP8A 5DM70 3ETNA 4FM9A 3MGKA 4ICIA 1GN9A 4A2PA 4B7CA 2F0GA 2ZWIA 1FRFS 2WIBA 5HZGA 2NN3C 3RYIA 1GPWB 2XCRB 4DMRA 1FIUA 4AKHA 4CCSA 5ESDA 2P2DA 5KWSA 4G9EA 1MGSA 1SXJC 2HDMA 1C8LA 3KLOA 3GCWA 4DMFA 5IJWA 4ARBA 1D2BA 4DR7B 1MFPA 4NXMQ 2ETVA 3FPCA 1U2ZA 4KQXA 4DV1L 1Z22A 5B7NA 2FCRA 3FMGA 3RUCA 2QN2A 1E5XA 1WI5A 2NVXH 2ES4A 1UBNA 1B16A 2BVNA 3A6KA 4HN4B 5DI3B 5KOJA 1V1JA 2QP3A 4F4DA 5D5QA 5JAQA 5IP5A 4RGMA 5FKAC 1PW5A 2FEWB 3F3MA 1G55A 5LLDA 2P65A 2E8GA 3G0OA 4G67A 1UAPA 2C1XA 3DHVA 3KNZA 1ET9A 4Y9TA 5CCDA 3HZOA 1IAQA 3LXUX 1Y3AA 2VT6A 2HBQA 4QLBA 3OJEA 2FEOA 4G1EB 3DLPX 3NYWA 2YQZA 4CLOA 3FCXA 3DMPA 3SK0A 1EFPB 1X80B 5JSHA 5HRCA 3I2HA 1R15A 4LRYA 5ALUA 1YRWA 2CCGA 2H7VA 2O4UX 4JQSA 1DC6A 4Z51A 4O1HA 4ZIRA 4L9SA 4CIBA 4RA8A 1JLHA 1TM2A 3OHSX 4WHMA 4BP9A 1SYFA 2C9MA 4BN4A 1J99A 5E7MA 4QTYA 3RPEA 1ND6A 1PJ2A 5KMGB 4Y9RA 4J76A 1H4VB 1INLA 3LO8A 4MWCA 4PVCA 1OT3A 4RPIA 1VI2A 4PCLA 3UHFA 3H0GB 2FSVA 3WBFA 4CMCA 4FYYA 4EJSC 2B4TO 5C53B 1JHUA 4M98A 4CF7A 1KAOA 4BKQA 4UBJA 5EJFA 5A9SA 3FRHA 3JV7A 4Q47A 5BR8L 1BCRA 4V190 1FTSA 1KR5A 3K8QA 4L9WA 3V4LA 2JFYA 5BWOA 1TF2A 1SA0A 2FX2A 1UEAB 4JI7B 3E22B 1N33Q 4MYRA 1N6RA 4GN3B 2RGDA 2ZUVA 3L04A 4Q15A 5DHUA 1VQEA 2IHYA 4J3FA 4MHOA 2YVLA 3HVHA 4KJZA 4RK5A 4UU0A 4GOLD 4F4CA 4KQCA 2E82A 2AG8A 4CL8A 4YJ3F 3BPSA 3KCNA 3U44A 3VKFA 4JMLA 3QU9A 4L0QA 1DFGA 2R8OA 1PZMA 3BK1A 2YUTA 3DBIA 3EZ6A 4LDPA 3ZK7A 5FBQB 4FGZA 2YN0A 3K2IA 4UP9A 2KLBA 4UQPA 1R8SA 4DV7L 1VBKA 1QV6A 2E87A 4MQ6A 3LUBA 5H3CA 1WU8A 1PRTF 4ML3A 4P2BA 1OI3A 3WGTA 2VQFL 1CSEE 2DUDA 4R3WA 5BQOA 1S7GA 1AQLA 5JVDA 2E4ZA 4Y1FA 5AHWA 4Q12A 4RSHA 2CHEA 1EWRA 5JMPA 1NVWQ 2ZSAA 4NU8X 3FY4A 2RD2A 2G0TA 1EUCB 2OTLA 4XQ9A 5CD9A 3HOWB 5DLPA 4C87A 4YRCA 3UNXA 2BMWA 2W22A 3EDMA 4HYTA 4D41A 4LF7L 3QEOA 1YB1A 1HURA 5F73A 2XI4A 3OPYI 1P7ZA 5LQJA 1ZITA 3R7WA 3BWBA 3HCCA 3LC2O 5FBHA 3T4PA 4H9GA 1TFRA 2R6ZA 2BBTA 2YASA 4X20B 4PO1A 3FNQA 1FTWA 2NVUA 3Q2OA 1QNLA 3GJ3A 1GZ7A 4MWTA 5CYFA 3OMGA 4MB2A 2G72A 4QEZA 3C3LA 3BH7A 4COOA 1USGA 2PGNA 3LQ4A 4MOWA 3O3NB 2GNPA 4BXXH 4EJ6A 1WPXA 4LHVA 3W1WA 4K9RA 2XH8A 1GUBA 1NDQA 3FPAA 4YUYA 2DBQA 3HP4A 1L4GA 1W25A 1W47A 2ZRPA 4DUYL 1TT5B 1L1OA 4KRXA 5ALZA 2Q6OA 5EPOA 4ENRA 2E5LQ 1Y82A 4UDXX 1SVNA 2JFWA 4UFPA 1M4VA 4MUNA 1Z07A 4OO1H 4LUOA 5FLKA 3K58A 1QX3A 4BQOA 1EG2A 4RPCA 4V2IA 3QJGA 4BE9A 1J1IA 3NVAA 3ELYA 3OZEA 5DHRA 1NAHA 5CD1A 1VLVA 3HWX1 3CRLC 2D1SA 2FEPA 1NFFA 3AC0A 5SY9A 2NADA 4TXLA 1OXBB 2AOUA 3ESDA 5D7NA 1FGBD 3TQIA 2OAGA 1Z2PX 3BAFA 3ENZA 4RCVA 4YV2A 4YBZA 2L0CA 2V6BA 5FWAA 3ANXA 3PD1A 1SEPA 4HWSA 4UKDA 5B2FA 3LK6A 3PB3A 2Q8RE 1FP4B 4LKRA 5E7JA 4C0KA 3OTQA 4AZ3A 5CA0F 2FP4B 3HV0A 4QTZA 1CY0A 1SXJB 3FLBA 3IUPA 5KTOA 2WSSA 2MPMA 4JZYA 2GBPA 1GCOA 4KQWA 2JLCA 1QWYA 4W82A 4EYKA 4MR9B 1G7RA 1E3MA 2BFDB 3QM1A 4X1YB 1U63A 4HXEB 5EIBC 4TUYA 2PS3A 5FEMA 3GA5A 3VR2D 2YWHA 1G1MA 2WWFA 4FEYA 4HEA6 5H7XA 5JJ5A 1HCZA 2ZW9A 3RT1A 3IOBA 2XOKA 3OE4A 4HX5A 5DYGA 4TKVA 4FU0A 2GESA 4MX2A 3T3EA 1FTNA 3C45A 4L27A 5KYLA 1L5NA 1PRTC 4LK2A 2A8VA 4D0NA 3QR8A 1XU4A 3T95A 5C8DA 5KSPA 1LNQA 3LUDA 4QUBA 2PUGA 1YQ9A 1G3IA 1MB9A 1NN3A 3JYHA 2PBRA 1LVGA 5LMNQ 5IAJA 2YVKA 3ZWNA 2CJWB 4IL5A 3RTBA 3SM9A 4BJ3A 5A4JA 3ZDXB 5D3ZA 4AS2A 5FO1A 1W0KD 4TTPA 2PX2A 2R6FA 2Z8YM 5T4EA 2FWJA 4C7XA 1O0BA 2QD1A 1UFRA 2QY6A 1W2GA 2IYAA 1Z4LA 2G5DA 3I6QA 4MP3A 5DYIA 1AGNA 1X13A 4TSSA 3R7FA 1QHIA 2OK8A 5EJ2A 4BO8A 4KQJA 1J97A 1I7PA 3O26A 1M2WA 3CF4A 2YFQA 3G1UA 3NM5A 5K45A 1JA9A 1VLJA 1RWPA 2W2KA 3N8NA 2ASBA 5K4HA 4CW7A 1WS6A 4BA1I 3H86A 2HDWA 3I4LA 2VXCA 2ISCA 4RVGA 1QCYA 1V2GA 1MT0A 4X3KA 1XD8A 2CCJA 4CGYA 4EI8A 4L85A 2RG1A 3F9CA 4Q18A 1FJXA 2HK8A 3PYMA 5EAIA 1ZMXA 1PUIA 2XMBA 2L5TA 3HXKA 3A14A 4KAJA 4BNIA 5HW0A 3BJRA 3MTBA 3G0CA 4NJMB 4US0R 1FY2A 2IPMA 3N2GB 2PEZA 4N0QA 2BKEA 3RRZA 5JZVA 4HP8A 2VPWA 3TNYA 5COBA 4PZ6A 4R1MA 1WXQA 2I7VA 3ANNA 1PZNA 1C3UA 3H9GA 1XTPA 4TN5A 5UKDA 3KF6A 3WRVA 5JVH3 1DKRA 3K73O 1KGSA 4C20A 4MW7A 4NE2A 3MXOA 4GZYC 221PA 1QB7A 1A7UA 1Y7PA 2GVNA 4I50A 4PYNA 4BV3A 4GVXA 4IXTA 4B3TQ 5D65A 2XRFA 4YLGA 1U7XA 1GUNA 2QWXA 3GB9A 4UP7A 3LG2A 4BO3A 4A3DB 2CFMA 1LCIA 2O2DA 5GZ6A 4Q9LA 3K6JA 5BSHA 5ABPA 3W8FA 1P4JA 3Q3HA 3TP8A 4FMDB 1SYEA 1A82A 3EVCA 2C8LA 3GC6A 4W8HA 5BR8Q 1RXCA 2JZCA 2QU7A 1OAKA 1RVV1 1ZNQO 2FG6C 4L73A 3RRBA 4BO9A 1EVLA 5AVZA 2OEPA 4N03A 3V4OA 1J70A 1QBKC 1M2GA 1SD2A 3HWSA 3M4NA 5BY2A 2PX5A 4MJ3A 1SYBA 5LL6S 3ZCTA 3EDRA 1QTNA 4BLVA 2IIPA 5BN4A 4JT2A 2JLWA 5FL7A 3BD8A 3OFSA 3VR5H 3QBPA 2G5PA 4B74A 4E09A 3N2KB 3RBAA 1NG1A 4Z1OA 1E2ZA 5D87A 3AW9A 5CEJA 3D7RA 5KSZA 5C4HA 2WHPB 2F3RA 4RK1A 1NMFA 1E3WB 2BZ1A 2CHVA 3JR7A 1LJ8A 1F8YA 5FCDA 1E9DA 3CUUA 4RTQA 4L22A 5CA1A 5KREA 3HGQA 4JS0A 4ZO8A 1E0SA 1D1SA 1VL8A 1XRNA 3SBDA 5KYYB 3TLJA 1MEJA 4QUEA 1QVCA 4I9GA 4J6EA 1ZVJA 5K3FB 3AVQA 3JALA 4QHSA 4TLBA 1J0BA 1LK7A 3GEHA 1EB9A 2P27A 2V7VA 3K6RA 4NG5A 3AFQA 3JRXA 2CXOA 3W77A 4BO6A 4GKKB 2ST1A 3BMXA 2X9NA 1NBWB 2Q4BA 2C3OA 3BVPA 4JOIC 1K6IA 3DC7A 5CA0A 4FILA 4A16A 3LVBA 3J80i 2Q3BA 3CVOA 4WXRA 1N9GB 2GPJA 2G28A 1YGPA 3M9LA 4HAWA 5F7XA 3GLFA 2AC2A 4CF6A 1M33A 4UEOA 4NCBA 1FMLA 1M10A 4A8TA 1L7NA 1E4YA 3BWXA 1PNOA 3E1GA 3HA2A 5G4KA 4RMJA 3OUUA 2OC4A 2Z43A 5EJ6A 1RBZA 3MJVA 4GNXA 1XNRQ 1EJBA 1EVIA 1SC3A 3D1JA 3IVGA 4L78A 5JQGB 1BHO1 5K2MA 1XZQA 3TP6A 4M9XA 5FORA 1COZA 3RZDH 2C5EA 4YRKA 4LF6L 1MEOA 2A7QA 1N32Q 3DWAA 3S16H 3CNLA 3C5HA 1PZFA 3N07A 4KK3A 4OXRA 3CGWA 3KP1A 5DHPA 3SXJA 4AMYA 1E1LA 5IPFA 4LJKA 4G4KA 1Q74A 2XSZD 1VMAA 4IDPA 3T56B 1J25A 4N39A 1SB8A 1Z5GA 2VP0A 4IQFA 1H65A 4DAVA 1SVLA 1ZXTA 2EJGC 2DY0A 2O3QA 3M70A 1SSOA 4JSRA 4HGNA 3LFHA 1VQ8A 4A23A 2HWYA 1WJGA 1C4OA 3L8EA 3THYA 1F5NA 2HWUA 3GPIA 4X65B 2VZ0A 3SS8A 2PMBA 1RWKA 4P4LA 1CJSA 2WTAA 3L84A 5E2AA 3EPRA 4ZVMA 3UQYS 4BNVA 1KOGA 1T3LA 3NX4A 1NR1A 4FE4A 4O4LB 4Q4AB 4BTEA 5EPUA 5G3LF 5IT0A 5ELBA 2PGIA 3H9UA 2P4EA 2X0JA 1U2GA 5HUHA 3UDIA 3NT4A 1N3BA 5K5EA 2MJ8A 4IUNA 4AULA 3VJRA 1WEHA 3G1TA 3TMYA 3DM5A 3ZVMA 1JALA 1S1CA 1Q7TA 1ADGA 2QK4A 4M37A 4UDNA 4B32A 2G17A 3KZNA 4FO2A 5IK2A 1VYVA 3PGLA 2ERCA 3HB1A 4CM7A 4KLKA 3U7FB 1E6WA 5CV6A 2GZDA 2F9FA 4HO1X 5F2NA 5B1EA 4NZZA 4RUKA 1P0MA 5C3EB 5AJ3Q 1MOZA 4IHJA 2XSCA 1GHTA 1TAUA 1RI5A 4MI9A 3M7GA 3O5AA 4K6HA 4M86A 1X2EA 1RXIA 4TROA 3RJ9A 2GEJA 1KQSA 1C81A 2GM3A 5FB3A 2GUGA 4PFJA 1NXOA 1TD1A 1QJ4A 5JCZA 4CM8A 1RF2D 1JIIA 3LX6A 4FFPA 2JHPA 2OO7A 1V6AA 3UJ3X 4F6RB 2Q6KA 4XR4A 4ND5A 5H70A 3S2HH 4I5EA 1XJQA 1YZQA 3BTVA 4KN6A 4W9NA 1I4HA 3DOJA 2R8PA 4X91A 2PUFA 5BN3A 1K8GA 1T4CA 1A2BA 1I50B 2PNHA 2E7ZA 2GHRA 5EKTA 3T0GA 3IE2A 1HNNA 1BD3A 3UK6A 5K20A 1NBHA 4HFMA 3T1HQ 4NBKA 2GWHA 4NSNA 4AI6A 3FPUB 3OWEB 4RY9A 4LI3X 1U7PA 4FYWA 1T0JB 5J2UF 4OKIA 3GA0A 4F2HA 4DZZA 2ADFA 1M6EX 2HUNA 1JLLB 1V11B 5IYBH 3ID6C 1HNWQ 1S2NA 3G5UA 1E66A 1UUPA 2YXNA 2PX3A 3GXOA 3RG2A 1CT1D 1SUIA 1U9IC 1X2BA 3AVOA 3A6JA 2EXDA 3K8AA 3FKSA 4NAVA 4PYKA 2LTAA 4K6OA 5E4JA 3PVSA 3SJ7A 2HF9A 2XXJA 4B79A 2XY4A 2C00A 4ZQEA 2HHCA 1K4YA 4BRSA 5AHOA 2QW0X 5TMPA 2COUA 4DCMA 5GJBA 3MC1A 2E2DC 3IP6A 3BWYA 4BJ6A 3FDJA 4DG9A 3U4QB 4AN0A 3I05A 3ZBPA 5IT5A 3KU1A 1SJED 4NAUA 3HKEA 5T3UA 3AVYA 3IUSA 4RZ2A 2O9JA 1XALA 5K0GA 1C0IA 2P40A 4BNDA 1RJTA 5J4KA 4KHPB 1QFJA 2EEZA 5J4VA 5LNK1 4N7JA 1H94A 4DR3B 3AHDA 4GSYA 4BZZA 4IS3A 1NJSA 3WJ2A 2QX8A 3OHXC 5SV2A 1WW2A 2R93H 3SEZA 1PH5A 5EINA 3U7GA 2OBLA 2UUCL 1AUQA 2WJAA 4WLVA 1RJDA 1EP3B 1A95A 5HE8A 1K83H 1OMOA 5AQEA 4E2YA 3DZDA 2ESRA 2DF8A 4DIMA 3L8HA 2CCZA 2OGZA 3D7SA 5IZCA 4AF8A 3INNA 4A2CA 4ZKCB 4BCDA 3ISJA 3RD4A 4IO0A 4MK4A 1WXFA 3FVVA 2Z04A 3MPUA 1XTRA 4WBXC 3AONB 3LPMA 3Q3VA 3BQMB 2EZUA 1DL5A 2DUUA 4ZREA 3E7PA 3M4YA 4A3EH 1DUVG 1IBLB 2K28A 3VOAA 3ZWYA 3WLEA 3IDSA 4DR6Q 2IS2A 3NOVA 1KRSA 2QG9A 3CE9A 3MK31 4OATA 1CJCA 2DFVA 4RD2A 1JDTA 1A9XB 2CWPA 2WWVD 5JALA 4QPJC 5JNUA 2Q99A 1JIJA 4HJAA 1N2CA 1TU3A 2ZRLA 1ZJZA 1EX9A 3C87A 5YASA 2WFLA 3R3HA 3VHLB 1YHNA 3NTOA 4FHZA 3MTJA 5EGSA 2IHNA 4B3ML 2A5YB 5DTIA 3SOPA 4UPDA 4E32A 4R9SA 1Y1SA 3RYCA 2X0NA 2R7AA 4ZCKA 2E6UX 2EXXA 4FP9A 1X1CA 2N47A 5ALYA 2IV3A 2KA7A 4Y1RB 2QS9A 4F06A 2VHCA 2E76C 1KAHA 3L3OC 4LK1C 1Q3LA 1YDFA 3LT4A 2VTDA 3T4UA 4CKXA 1X39A 2QEJC 3BTSA 4FGUA 4OFXA 1GADO 1VB5A 1E3LA 2VCYA 2ZBRA 3G2QA 3NG1A 1DRWA 1A96A 2JI8A 5CLGA 3BGSA 3QPVA 2G67A 2AI1A 1O87A 1U8CB 5LMNB 3MTIA 5I8WA 3LIIA 1V1PB 3GT0A 3LA8A 3FTFA 1OSNA 1XRMA 1T2VA 2EDCA 2XV1A 4LZWA 1Y8PB 1JUDA 1YR8A 1ATIA 1EAYA 3C1OA 1FDSA 4L9RA 3WQQA 5JCJA 2VNUD 3ZKAA 4IQ0A 1RCUA 2LMCB 2W0MA 4A1FA 1GVPA 1WUJS