1U0LA

Crystal structure of yjeq from thermotoga maritima
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
291
structure length
278
Chain Sequence
LRRRGIVVSFHSNMVTVEDEETGERILCKLRGKFRLQNLKIYVGDRVEYTPDETGSGVIENVLHRKNLLTKPHVANVDQVILVVTVKMPETSTYIIDKFLVLAEKNELETVMVINKMDLYDEDDLRKVRELEEIYSGLYPIVKTSAKTGMGIEELKEYLKGKISTMAGLSGVGKSSLLNAINPGLKLRTTTTAQLLKFDFGGYVVDTPGFANLEINDIEPEELKHYFKEFGDKQCFFSDCNHVDEPECGVKEAVENGEIAESRYENYVKMFYELLGRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of YjeQ from Thermotoga maritima contains a circularly permuted GTPase domain
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Probable GTPase engC
total genus 79
structure length 278
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 3.6.1.-:
pdb deposition date 2004-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03193 RsgA_GTPase RsgA GTPase
A PF16745 RsgA_N RsgA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.50 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Probable gtpase engc; domain 3 1u0lA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1u0lA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u0lA02
2QI9C 1Z47A 1P2SA 1UKZA 5GJBA 2VUMH 1ZCBA 1MV5A 1RJ9A 2O8FB 4IPCA 3KJGA 4EPTA 4BLPA 1K5GA 3RRMA 2HJGA 1DO2A 2IYYA 3IPYA 4FXPA 4Q9JA 3K0AB 2WB1E 2VPPA 4DHEA 3CAMA 3UXMA 2Q2IA 4KV9A 5JBQA 2HYDA 3EXAA 1NBWA 3QPVA 1NY5A 4GP6A 5B58C 2FOLA 4ZDIA 4F93B 1FOEB 3EPHA 1VQMA 3LQRA 2HF8A 4FWIB 4LDJA 2NZJA 1GP2A 4DIDA 4Z1MA 5B64A 3V4RA 4QJ4A 3JC66 2IYVA 2R7FA 3CZQA 3R9WA 3PR1A 1A62A 4HLCA 4LYJA 4Q9IA 3PCRB 3U61B 4ESHA 4BBRH 2ZANA 3P4XA 1XJCA 1Q12A 4MYCA 4LJAA 2G83A 3R7WB 1RL2A 2XOKD 5DGXA 4BFWA 2ZYTX 1R8SA 4LV6A 1HH4A 1SULA 3PITA 3REFA 2V54A 2DCUA 3HP1A 4G5QA 4DV5Q 1YZNA 5AUPB 3R9IA 4JLDA 4LOAA 5JCPA 4AQYQ 2V3CC 1Q3HA 2WPDD 2RGNA 3T1YQ 1SZPA 2ZS8A 4BGDA 1VQ8A 2RGBA 1R0YA 2QTHA 4EFMA 4B73A 4ARZA 5HR5A 4HAUA 1E9AA 1G41A 3AVWA 3BFXA 3IBGA 1D6JA 3PEYA 1KHTA 1K8RA 4DCNA 2UUBQ 1HE1C 3RVBA 2YWHA 3THXA 1V1QA 5D3MA 1Z0KA 3B9QA 4X64L 4IDPA 4D2IA 4R4TA 5TMPA 1Q1EA 1E24A 1K5DA 3PIRA 4H9GA 2R7DA 3IPXA 3CCVA 4KYUA 4MA4A 2ZETA 4URZR 5BQ5A 1NN1A 3F1ZA 1PJRA 4FMBB 4C2TA 2GVBA 1U8ZA 2IC5A 4UJ3A 3AQ4A 2MNAA 3BZKA 3AVOA 1CJTC 1G17A 4HDQB 5IRCD 2V6JA 5M3FG 3FP9A 2LWIA 4EPRA 4MTNA 1R8QA 4MNOA 2CVHA 2Z0SA 3FKSD 4A9AA 1X1SA 1M8PA 5EAYA 2IF2A 1MO4A 3PO3H 3K9LA 4HZUB 3QUSA 3TVDA 2N46A 2GXAA 4A93H 3S2DH 1EIYB 1E2KA 4JBXA 3I8XA 4BEBA 4OI1A 4FDBA 2FXQA 4Q48A 1UBEA 4EX5A 4A3EH 5CITA 5DN6D 1XB2A 4JI2Q 1Z06A 2AR7A 3ONWA 1DTSA 4CT5A 4A3MG 4OHVA 2AFIE 3T5GA 1Q82C 1WP9A 3PUYA 3HFZB 1X9NA 5JECA 3VKHA 1AKYA 2OFOA 1HUQA 5HKKA 3VKGA 5ELOA 4JBKA 4R4QA 4GRAA 5FOTA 4C2MH 4KVAA 2JK8A 2BBSA 3CIOA 3REGA 3SQWA 1WCV1 4Q7KA 1VYTA 3LNCA 3I56A 2OCEA 4LX0A 4R9UC 4CDGA 1JR3A 2JA1A 2WAXA 2B8TA 3S1NH 1XJ0A 1DS6A 1U0JA 2XSZD 4Q1FA 2PCLA 4KLZA 2FDCA 3A4LA 3SNHA 4UP9A 4AH6A 4DR1L 2BWJA 1L4UA 2C9CA 1Y14B 1SN8A 3KF6A 1L2TA 121PA 2KBEA 4F92B 2PT7A 2O8DB 5FOVA 1FUKA 1X8LA 2GJ9A 3UE1A 1F6BA 1DOAA 1IAQA 1LM0A 2MFIA 1M34E 3RHFA 4C9BA 1JXOA 4IFEA 5M5YH 1X3SA 2CNWD 2PZGA 5HPYB 4JYAQ 4DEXA 2N3SA 1UM8A 3I62A 4DV6Q 1Q3TA 4YY3L 3BD9A 4GBMA 3ZVNA 4YMTA 4BASA 2O8DA 4X6AH 5HE9A 4A75A 2FWRA 2QAGA 2R62A 1CF4A 4IVQA 1VG8A 2ZUDA 1P6XA 4DV4L 2WWHA 4IXNA 4V0ME 5FLMG 3IEUA 5FTMA 5BR8L 2NZHA 2Z4RA 3HR7A 2Y0SG 2RCNA 2GVZC 2KSQA 1IBKL 5KPJA 2WOOA 1P9RA 2GJSA 4BFYA 4LPSA 4P0TA 3EBEA 1G64A 2EQSA 3E1SA 3DEFA 3Q85A 4TLCA 3RLNA 5LBIA 3VHXA 5JJLA 3CQZH 4DR6Q 2QNRA 4DUZQ 3FYHA 2ZRDA 4G0NA 4URYR 1ASZA 1P60A 4CEJB 1AGRA 3LX8A 3X2SA 4DC9A 3EPKA 2YOFA 2Z6KA 2IYSA 2VNUD 3TR0A 1SROA 3MJHA 2JLYA 3BK7A 4LCBA 4JI4Q 1PZNA 3RS5A 2BM0A 5FJ8H 2JA7G 2GBLC 4LHYA 2MSEB 1SRUA 4JL8A 2VQEQ 4A3LG 5L3QA 4HUTA 2W6IA 4QBHA 1CXZA 4N0DA 4HIMA 5C1BA 2ZRFA 3SU8A 3H3VH 1YZGA 3M4OH 4N0EA 4PC3A 4TT3A 4EAQA 1KI1A 4BFUA 3KDFA 3H2YA 3LA6A 3NELA 4NONA 3J7ZC 4LF5L 4DSOA 4TL8A 4QNMA 1KO7A 4JI8Q 4UNPA 4TMVA 3VAAA 4PQYA 5LDDC 1Y1WG 4XWAA 4DUYL 1T5LA 3EWAA 1MJCA 3TSOA 5BYKA 5M3FH 5CYOA 2VQEL 2OQKA 1A2KC 5L3SA 3L43A 3KF8B 1BYUA 3ER0A 4Q5IA 3VKWA 2WWFA 5H68A 4V0LA 2LSSA 4JLPA 1XEWX 3AEVA 3GTPH 2NVXH 1QBKC 4CEIA 4UXJA 2OM2A 3W5IA 1E2PA 3UIEA 4L5SA 4JI3Q 1AN0A 1NLZA 3L0IB 5TY0A 1CKEA 1CU1A 1OXVA 4C30A 4YCWA 1Z22A 1RRCA 2AK3A 2PCJA 4CEHB 2FZ4A 1P8LA 2IYWA 2QG6A 4D4KA 1OH8A 1IOZA 1GL6A 4PC2A 4QBFA 1I4LD 4Q4AB 4B3TL 1C0AA 2KE5A 5EXXA 4ESVA 2CLDX 2BH2A 1CJMA 2ZS9A 1XD2A 3F8TA 1BIFA 1KSFX 4LY6A 4EDHA 4V02A 5DN6A 4Z8XA 4DV4Q 3BH0A 4J15A 1KY3A 1JMCA 1RYFA 1W0JD 2Q3FA 4LV5B 4M9QA 4A2WA 2ZRLA 4WXPA 1HZCA 1XMOQ 1VQLA 4PHTA 1LS6A 1XRJA 3K0CC 2UZIR 1VECA 3STBD 2PT5A 4M9XA 2VL7A 3U3JA 2PQAB 3HOVH 3Q8DA 3NENA 5KHOC 5IP7H 2R2AA 2VTKA 1W36B 1R5NA 1P4SA 2XTMA 4LC1A 2PLRA 4HDOB 2KHJA 1OFIA 3K9GA 3MWKA 3QQ5A 4KFSA 5JSZB 2LXJA 4GKJL 2F9LA 3I4NG 2PQAA 4NHOA 4B3SQ 1L1OC 3LV8A 2HQLA 1R0XA 4B3TQ 2B7CA 1GL9B 3I55A 1NKTA 1WA5A 3EN2A 4GLVB 4KHZA 1YU9A 3VU9B 5IT5A 1AA9A 2QBYB 2GCOB 4URUR 2FU5C 1TX4B 2C03A 2R8RA 2P0EA 5DE3A 4YONB 1SVMA 1IXZA 2K4KA 3ADDA 1K6MA 2VA8A 1KI6B 4GN3B 2OESA 3PENA 3UG7A 4Q66C 3CMEA 2OCAA 3VHLB 4YWLA 1E4VA 3OTOL 4TLDA 3VFDA 3WBJA 4JL6A 3A58B 4XWKA 4C3JH 3NBHB 1E9SA 1F60A 2VYFA 1Y63A 3P20A 1W2HA 5DH9A 1L7VC 3I4MG 1R5BA 1BBUA 4DV0L 1XP8A 1J90A 2ODBA 1ZU4A 2WVJA 4DB2A 1US8B 1KMHB 1ZINA 2GK7A 3DOFA 4TLAA 2UVQA 4EPVA 1A63A 1SXJA 3KUCA 3QKUA 1ELOA 5GADC 4L4UA 4GN5A 4OQMA 3BFKA 2VY3A 1EUJA 1YHQA 1IJFA 1RRFA 2ZU0C 1PH5A 3CX6A 4BLQA 4DLSA 2A7QA 3OZXA 4Q1EA 2AD5A 3D3QA 3RS0A 4WXRA 4Q9HA 2GJKA 3E9IA 4GLAC 2F1RA 1EQRA 1DAIA 2A8VA 1E2MA 2DGYA 2DFKB 4HJ9A 4LF6L 2GF9A 5KSYA 1LW7A 3N5CA 1T0HB 3W34A 4O0AA 4GNXC 1Z3IX 5GQOA 1NMYA 1OW3B 1UEIA 2QENA 3F5FA 3NEJA 4JLOA 2E87A 3LVRE 3OF5A 4L9WA 3U7EB 3GLHA 1KI2A 3OW2A 1YR7A 1PH3A 3TRZA 3QKTA 4B3FX 2ZI6A 1KJYA 1L1OB 5IWAQ 2VP4A 3L2OB 4DLRA 2EIFA 3CBQA 3SHFA 1A5TA 1UE1A 2EYQA 3QENA 4H1VA 3W6PA 2GJAA 2GK6A 1HY3A 4GNKA 4KLNA 5J4LA 1JB7A 4APVA 2ONJA 1VYUA 1ESMA 2D2FA 5LMUQ 2CHQA 3KX2A 2ZRAA 4LF9Q 1ZVQA 1G3MA 1NN0A 1SLJA 4N3NA 2OBLA 1JJ7A 4DT1B 1E79D 2FFHA 4MGZR 1NVWQ 4XD7A 5C0XG 5JFGA 3CXCA 3H15A 1G7RA 2JEAI 1SVLA 2UXBL 1J5EL 2GESA 2VO1A 2JJ1D 2WOJA 1X54A 3UDGA 1IBML 2ZRNA 2PL3A 1VQHA 4K46A 4IEIA 5DIFA 5LD2C 1G18A 3QKSA 4LF4Q 4JI0L 1DO0A 3GJ8A 3AGPA 3J81c 4AY2A 4QY7A 1D9XA 3EZFA 4RZ3A 4NXNQ 2CBZA 1YJ5A 2OSBA 2IUTA 3GLHE 3FKQA 3TEHB 1TTTA 3ERSX 2WPDA 1CKNB 3GJ3A 5FOUA 4DR5L 1SXJD 1KMQA 3CNOA 4XIGS 3GLFB 3SI7A 4A4IA 3CWQA 4EPWA 4NYJQ 2ZSBA 5GAEC 4MGKR 3I32A 2K50A 4BE7B 3ADBA 1TF2A 3CF6R 3KXKA 4V0KA 1UKEA 2F3RA 2QP3A 4MKGA 3Q3JB 1ZCAA 3AM1A 2AFHE 4KBFA 3I8SA 3W1GA 1P72A 5EP2A 3C16C 3QOFA 1N2CE 1OKKD 2OZEA 4DXAA 1J6QA 1TWGH 4HIOA 1XMJA 2R6GA 1EWQA 1RW4A 2X77A 1E0JA 2F55A 5CB6A 3MWLA 3W8RA 3QKRB 2ZI3A 4HLUA 2Q3HA 2ZTSA 4JYBA 3TUIC 2E9SA 3QXJA 4Q02A 2AD1A 3CCMA 3IHWA 3KXLA 1J99A 4JT2A 3ZZUA 1ZC3A 2JA5G 1S72A 5FR1A 2V1UA 3GEIA 4DSUA 3OTOQ 2ANBA 2H92A 2IXGA 4RSGA 2XX3A 2R7ZH 2VEDA 4B35A 1ZRHA 4M22A 4K0KQ 2DWPA 2R65A 2YOGA 4NCHA 1N6HA 2REOA 2R92G 3HOYG 4JIMA 1ANKA 4IKEA 3V4FA 2BDTA 1YZTA 2EWVA 2RHDA 3AEZA 1EK0A 1Q57A 1W1WA 3W3AA 4HAZA 3A5ZB 2QGQA 2J41A 2BCJQ 2JDIA 1R0ZA 3H0KA 1KSGA 3RNLA 1HQCA 1XEXB 2JCSA 1PV4A 2J87A 4Q9KA 3D31A 2JLQA 3QE0A 3R8FA 4DUGA 3AVTA 2QTFA 4YDSA 1UDXA 4FMDB 3ICQB 2UUBL 2XJ9A 1E9CA 1SMXA 1AS2A 4KVGA 3KL4A 3SJAA 3WMGA 5JHGB 1FQJA 3A1SA 4LJ5A 1YBYA 1T91A 1UBCA 4X64Q 4F4JA 1KI4A 2FFQA 4PAOA 5G3ZA 1XMQQ 1KDPA 2REBA 5FUVA 3LBIA 1JE5A 4W5HA 4DDTA 1CJVC 1KZGB 2ZTDA 4GI7A 2KHIA 1N6OA 1S0UA 4Q47A 2ECKA 4CIDA 1G8HA 1IXRC 2ZJZA 2GA8A 3W6OA 3K0XA 4DLWA 5C18A 2YU9H 4A3IH 1C4OA 1QF9A 4UP7A 3EIQA 3BU2A 1P9NA 2EYUA 4DR3Q 2ZR0A 3WHKA 4F4IA 1KK0A 2Q2UA 2C8VA 2HYIC 4GOPA 4X66Q 3TQFA 2R93H 1YHNA 3BAFA 4DV1L 1QVFA 5A0FA 5GJWC 1WJJA 3R20A 1L1OA 3PF4A 1N6PA 2GEDA 4BWYA 3G6EA 2VP5A 2QPAA 3Q7QA 2B29A 2GXQA 3Q8XB 1W49A 5F3WB 4LJYA 1GUAA 1WCMG 1A8VA 1FGUA 4DR5Q 1W5SA 4YMVA 4DIEA 3NBZC 4JI3L 1LTQA 1R2QA 3K70C 4XTCS 1FFHA 2CE7A 2GETA 3CRRA 3GJXC 3NHAA 4NDZA 4C0KA 2JQOA 3DZ8A 3RS4A 1Q1QA 4X65L 1FPMA 1SKYE 1TUIA 2BKUA 3QPUA 2EW1A 4LYFA 5FBQB 1G4UR 2AWNA 5G53C 3ZJYC 1Z08A 1PH8A 4YLGA 3U7FB 4IOAA 1RRPA 3GPLA 1ZUNB 2EFDB 4DR7Q 4LF9L 1E1RA 1M7GA 3CRVA 3M1IA 4DPGA 1FVIA 2QMEA 1VQKA 2NO7A 3HPRA 1S3OA 3FKIG 3Q7PA 1YI2A 1A2BA 4DLXA 4JOIA 1E69A 1RJ9B 5L8VA 2V4ZA 5CK5A 1X3GA 5FUWA 2P5SA 521PA 5IK2A 4AI6A 3HKZE 2ZE6A 4TT3D 3AF2A 4E09A 3THWB 2GZDA 2Q9CA 2HHHQ 4YY3Q 1N8RC 4XH9B 4DV6L 1PFSA 1G9XA 1FZQA 3AH8A 4L5QA 1SXJE 4HI0E 5EE3A 1KJWA 2MSDB 2JJQA 2A5YB 1K3RA 3ZVRA 1E0AA 1W48A 1EG7A 4KCGA 4Q03A 5EJEA 1E2EA 2ZI7A 3IIMA 4A0RA 5A4JA 5P21A 2UUAQ 2MO0A 1M74A 2E8GA 4QNRA 5FTNA 2MO1A 2ZROA 4DR1Q 2DB3A 4KHPL 2DFLA 3IDQA 3IBYA 2CEAA 4MUBA 1DBSA 1AIPA 4DV3L 4OO1G 3GLFA 221PA 2O5VA 3D0FA 2P6NA 4WJ4A 3GDEA 1LVGA 3MMPA 3BE4A 2P6RA 1M6NA 5TV2A 3M4PA 1R0WA 5JSZA 3KKOA 1W46A 4C0HA 3WHLA 4DCUA 5JMTA 1FTNA 4YWKA 3AP3A 1FJGQ 5JRJA 1IN5A 4M1KA 3ADKA 3SJCA 4RD2A 3O47A 4BLSA 2D62A 4Q1AA 3JZMA 1EOVA 2YTYA 5ANRB 4U5XA 1KD1C 5CM9C 1GO3E 4P75A 4X62L 3TNFA 4BFSA 2VS1A 3FPAA 4AIIA 1MO6A 3OYYA 1R10A 1ZM4A 4L5BA 2IXEA 2D74A 3CCEA 4BXXG 3SZRA 2WJYA 2C77A 5AJYA 4F38A 4KFUA 3AVVA 3RZOH 4FINA 1MABA 4J0QA 3MJRA 5SZHB 3DKVA 2N8NA 3TUZC 1CEEA 4CT4B 4WZ6A 3I61A 2RHMA 3CF0A 3D7MA 5C2JB 5J47A 3U5ZB 5BWMA 1XMVA 1WDTA 2F6RA 2ZI9A 4LF7L 1GRNA 4C3HH 4HUQB 1J2JA 2J9RA 5J4HA 1EXMA 1ZW6A 3QF7A 4KJZA 4TMTA 5HKKD 1KNQA 2B7BA 4NL4H 4PHFA 4Q4AA 3EPLA 3I2ZA 4PHGA 4O2RA 1K83H 5KNBA 2NZOA 4UY8C 4A36A 3CB4A 4NYMQ 4JBJA 4PZLA 2ASEA 2OTLA 2QAGC 4DSTA 4QHSA 4ZIRA 2J0VA 1XTJA 4LWCA 3B1VA 4M21A 4MRVA 3EASA 1QZGA 3OIUA 3RRYA 3WNCA 1YVCA 1CS4C 1E32A 1P9WA 3WY9A 4A3CG 5DNYB 3C8UA 4Z54A 1PH6A 3RSLA 2JGNA 2NTYC 4FI3C 3GLIA 1X1RA 4PXAA 5KDOA 2I1QA 3LW7A 1QHNA 4LF4L 4JI6L 3MRSA 1FMJA 1KMHA 4R2IA 2BMEA 5BW8A 4G3XA 4R2HA 1I94Q 2VHUA 2ZJ5A 4BUJA 4OHWA 1OV4A 1IBMQ 1VHLA 1WE2A 2OO7A 2HEIA 4HJ7A 2UXBQ 3ETLA 2O8EB 3I4MH 4B3GA 1FUUA 1NSTA 1GILA 1E1OA 2WJHA 1R7RA 5G41A 1VQDA 3GD7A 1XNRL 4JCVE 1S1CA 4DLZA 5J4YA 2YWEA 4UKDA 4BLTA 3Q9LA 3CRW1 2JJ2A 4C3ZA 2FSGA 3ULLA 1Q0UA 1OB2A 1YHBA 3HKSA 4US2R 1Z0IA 2QBYA 4BY7G 2ALYB 1KSJA 1MKYA 3JVVA 3S2HH 4DV3Q 1E9RA 1XCGB 1SGWA 3TREA 4B34A 4QGUA 2C9OA 3QEOA 2I5LX 1YITA 1G3QA 3ZIAA 4JI5Q 2PX3A 3B5JA 1M90C 2ONKA 3CPHA 4AG5A 5BN5A 3T1OA 3PFIA 1NMFA 1YE8A 3T12A 3P27A 2OCBA 2YV5A 2CKZB 1DARA 1X3FA 2G1KA 3OFNA 4IOMA 1B7YB 3VDYA 1AE2A 5EE1A 3UK6A 4XWOA 4BPBA 4BA2I 1KKMA 3CZPA 3I4NH 4OQLA 2VIIA 5BYJA 2ZYWX 1DGSA 1EFWA 2J7PA 1VTKA 3RN5A 3UATA 1ZJ6A 3J81k 1GVNB 2ORVA 1E2NA 5FBVB 1KTVA 3T1TA 2UUCL 2PX0A 1D8LA 4LK2A 5H8WA 3LH5A 2IYZA 4DR7L 1MOZA 1P2UA 2K5HA 1G21E 3KOJA 1T8TA 3MEFA 3K0SA 2A9KA 5IYDG 1VG0B 1IJEA 3FDIA 1K8GA 1X3EA 3IHLA 2C78A 1PH9A 4LUVA 4IPHA 4NZYA 4OJKA 4ZO4A 1TMKA 3VTKA 6Q21A 3GEEA 3T15A 4QKQA 1GOTA 1WRBA 1R4AA 3Q5EA 1E9FA 1P61B 4KSBA 2WWIA 2BH8A 3WBKA 3LWNA 4AIMA 2Z0MA 4CEHA 1CKMA 3SJBA 2UU9Q 4L9SA 2RGXA 1KI3A 4RY2A 1SVOA 2E2JH 4NYJR 4LBVA 3CCRA 5JS7A 3B6YA 3FE2A 5JCZA 1FNMA 2ES2A 4MRNA 4KBGA 4R4CA 2NO0A 5AUOB 2X2EA 3K81C 3I5YA 3UMRA 1L8QA 1FTSA 5FTJA 4OQXA 3W1BA 4HAWA 2D0PA 2OE2A 2QL6A 4M1YA 4HAYA 5IDVA 5JWOA 1OH7A 3E2IA 1P3JA 4BBRG 3X1XA 2BJWA 2N78A 1Q22A 1OKKA 2P65A 3MCAA 2D4HA 4PZ7A 2GHIA 3EZ2A 4JV5L 2ZM6Q 4XVUA 3DL0A 3LFUA 3B82A 2IF0A 1UDWA 5C0XI 4YWMA 1ASYA 1JXMA 1U9IC 2WMNB 1QVCA 3HPQA 4D4LA 4DLTA 3BGWA 2OCPA 2O0KA 4O0MA 2HT6A 2O0JA 1E1QA 2IWRA 3GJ4A 4QGHA 3FWYA 2FNAA 3BZCA 5KTYA 2UXCL 1GKIA 4QIWE 3ZQJA 1CLUA 2J0UB 2W2XA 5FPTA 2HCBA 2KJQA 3D8BA 4JVSB 3IRBA 4RZ2A 4I4LA 2F4VQ 2OAQ1 4LJ7A 2F7SA 1VQJA 3M4QA 1COWA 3RAPR 1DADA 2F1IA 4O25A 4PZ6A 4CEJA 4Q19A 1IM2A 2OXCA 2D2EA 1UEBA 1ODFA 3NC1C 1NVXQ 4QOSA 3OE7D 5HZHA 4R4IA 2IX3A 2WKPA 1JPNA 2G1JA 5FI0B 1TWAH 1Q44A 1COWD 2L15A 4I1UA 2D0OA 3GTQH 1H65A 2GKSA 4RZXA 1FL0A 3F2BA 2B63G 2IL1A 4LFAQ 3FHOA 4OWXB 4Q1BA 3IILA 2BM1A 1OIWA 2W83A 2A5FA 3BORA 2I1VB 2ZYUX 1X8JA 4TMZA 3LLUA 2VQFQ 3C41J 1HT2E 4OHXA 2BHRA 1U5KA 4QJFA 4DR2Q 1JAIA 4KHPQ 3GJ7A 2IWHA 5CIWA 5FOXA 3G4SA 4M53A 4ZI2A 2B21A 3GLFE 5ELXA 4PO9A 2JJ1A 2K5UA 4RD6A 4DDUA 2WFWA 1QRAA 1PHJA 2XGTA 3L0PA 4II7A 1YZUA 3L0OA 2G3YA 2J45A 3DM5A 2OLJA 5DI3B 3NEMA 1EWRA 2QEQA 1VKJA 2FG5A 2JA9A 3BH6A 5CB8A 4HB2A 2A5DA 1OB5A 2GF0A 4IOCA 1HZAA 1I3QH 2KBFA 4V0OA 4B3BA 4RD4A 3Q72A 2BMFA 5E4FA 3VX4A 4E03A 5LMNQ 1II0A 1OTCA 1X6VA 2V9PA 3JZAA 2OWOA 3CX7A 2V6IA 2IEZA 3OEHA 2B6HA 4Q7LA 4A3EG 4A82A 2QY9A 1U2RA 3ZQ6A 1Y1VG 1VYVA 1OLOA 4PFSA 1U94A 4A0HA 3GTLH 1R6BX 2X2FA 4DV0Q 4TTPA 4TYQA 3AF3A 3HOVG 4DV5L 3BJIC 3IUYA 2ZPTX 1UBGA 4DUZL 3GQBA 4OJQA 4KSCA 1P16A 5CJ2A 4CRWB 4A3MH 1GITA 1LUZA 2ATVA 1WI5A 1VIYA 1AJEA 1DAHA 5JEEA 2FF7A 4BZQA 4EPYA 4LHVA 4ME3A 3EIEA 4GSYA 4TN1A 1PA6A 5FTKA 4IPDA 3TW8B 1Q81C 2YOHA 3PEVA 5C4MA 4ON9A 2NN6G 2DFNA 2NPIA 2ZE8A 2V1CC 4DV7Q 5C4XG 1JR3D 2CXXA 3CPEA 3FMIA 3I73A 4ZCLA 4JI6Q 2REXB 1JNYA 4B33A 4EJSA 2GCPA 2BEKA 2XITA 4QBGB 5SZJA 3AVUA 4A3KH 2IYTA 5SZIA 3GTOH 1E96A 5IYDH 2ZRMA 1GSIA 1ZP6A 2P67A 5DHAA 2FEOA 4IVRA 3EWSA 3M85A 3RWMB 2QQEA 4C0BA 1QUQB 1UBFA 5UKDA 1NJGA 3KB2A 2IEYA 1ZAKA 3UMFA 5JLJA 2YTVA 4PQRA 4D81A 4NTZA 4QJ3A 4DWJA 3IQWA 5E7IA 1EFUA 2JJ8A 5M5XH 4JSTA 1EFCA 4H1UA 1CR2A 1P75A 3J7A5 3B78A 5CIQA 2JA6G 5CM8B 3ND9A 2A5JA 4PPFA 2J0SA 5F9FA 1SVSA 1BKBA 2XB2A 4EFLA 5JEAJ 3X1ZA 2AL7A 4LFCL 2O8CB 3BFVA 2JLXA 1VQ6A 3QXXA 1FL9A 2WIAA 2H7VA 4OO1I 2RHSB 4QC2A 3BB3A 4URWR 1XWIA 3A36A 1N0UA 4HAXA 2O52A 1FP6A 2RGEA 4YMSA 1CRQA 1CKOA 4P4SA 4JI1Q 1I94L 1FMLA 2ZRJA 4TYNA 2ZI4A 1U81A 2YWFA 4JI1L 2ODNA 5FPKA 1XJVA 1N6NA 5KSZA 2QRZA 3D6TB 5DI9A 3HOZG 2A78A 3OEED 4LUCA 4EFNA 5IP9G 4P74A 2NO6A 5LB2A 4E07A 2YVUA 4GKKL 3X1DA 2FE4A 2F52A 3NDPA 1TNDA 4GMDA 2F43B 3UKDA 1T3LA 2RHQB 1PLJA 1SVKA 4GOJA 3KFVA 4YC7A 4OI0A 4KLKA 4A3FH 4B3SL 1FJGL 1J70A 1YQTA 2NOAA 4Z1MD 2V7QD 2WHXA 2XXAA 2ZXUA 4RD1A 2ZE7A 5AWFC 2EFCB 2IHEA 4L15A 4ASUD 4F7WA 2RH5A 1N33L 1VQ7A 2PI2A 1V5WA 1PUJA 3PVSA 3L7ZC 3NVAA 2Q0HA 2Q9AA 4C2UA 1BO6A 1GNQA 2WWXA 3K1JA 4GZLA 1O7IA 1QHXA 4LC0A 2H16A 5IYBH 2X1VA 3S17H 2QGNA 2WJJA 3M7NA 2KCTA 2UUAL 4HSEA 1XMOL 1T6NA 2EFGA 4RJLA 3SFVA 2D7DA 2O8EA 2CJWB 1IN6A 4QRHA 4DVGA 3SYLA 1QHIA 1GKHA 4AYBE 2CDNA 4F4CA 3A5UA 1ZIOA 1LV7A 721PA 4KI0A 3SYNA 3U7GA 4GT1A 2ZJYA 3FHWA 5FUXA 3KJHA 2IT1A 3UE0A 1DAMA 1H8ED 2LKDA 3TQCA 3EZ7A 5JJKA 4BQSA 3WWVA 1KKLA 4DAMA 3U4ZA 3N2EA 3DMDA 2H5EA 4JLKA 3B1YA 1VIAA 4IDHA 4Q4JB 1S3SA 1SHZA 4HB4A 5D3QA 4D80A 2DBYA 2B92A 2HV8A 4D25A 4YQFA 1JJCB 2AXNA 3K9NA 2YC4C 1C7YA 3QXCA 1IBKQ 1OFTA 4W5WA 2VP6A 1B8AA 5EE0A 4NE2A 4NB3A 4OKSA 2UU9L 4B2LA 2WWWA 2ZJ8A 3QIAA 3AP1A 3KJEA 1W0KD 1XXHB 2A30A 2JASA 3AF0A 4FN5A 3I5XA 2JLWA 4HEJA 1EYGA 5HTKA 1Z6AA 4KAXA 1IY2A 2XNDD 3KDSE 2LCFA 4Y52H 1E2JA 3FKSA 2C95A 1E2DA 4EJSC 1G6PA 4IFDI 3QF4A 4UP8A 1B23P 2BA1A 1XXHA 2NG1A 3QG5A 4OK6A 2JAQA 1PH7A 2JEBI 4W7SA 1FNNA 2QU8A 2V1XA 2XOKA 1E2FA 3HOUH 4Q00A 5B2ZA 4TQAA 4PTLA 4US1R 5BXQC 3EPJA 4IJHA 4Y7NH 2W6ID 3CF2A 3E0EA 1CP2A 4DV1Q 1G19A 1MT0A 3RDPA 4X66L 1NMXA 2J3EA 1P2TA 2ZRHA 4JI7L 1TAGA 1RIPA 1N32L 3O8DA 4MYHA 2XEXA 3C5CA 3DPUA 4MZ9A 2GZHA 5M3MH 1SXJB 2QP9X 5KSPA 2XB4A 4OHYA 1XXHE 3FTQA 3I4LA 5AJWA 4PC6A 2CHGA 5C4XH 3BB4A 3CM0A 4I99A 3ULJA 3AB3A 1ZM7A 1D9ZA 2CLCX 3CCJA 3I92A 3RS3A 3TMKA 2H17A 2ZVQX 4TL9A 2Z4SA 4A3DG 4ILEA 4UPAA 3WMFA 4M4SA 3PUVA 2IY5B 2AX4A 4D82A 4CW7A 1KO8A 4LFAL 4MKIA 2Z5FA 4ZPXA 1NNEA 1UF9A 3PUWA 2QSYA 1G5PA 1NVUQ 2ZUBA 2ZU6A 3ZJYA 3LDAA 2NVTH 1M1KC 2NGRA 4POFA 2W6JD 3J81j 2NO1A 4Q21A 3RABA 3IO5A 3I1FA 3QXSA 2CFMA 1D8TA 3AVPA 3C4JA 3LQQA 4MKHA 4B6FA 3K09C 3SHWA 4DLYA 4PSKA 2WTUA 2K5NA 4D4JA 1N6RA 1W0JA 1UWVA 1KO4A 3AGQA 3JAMc 3KFXA 1NJIC 3VR2A 2PJRA 1AM4D 1KI9A 4JKYA 2OUKA 1IN4A 4OI4A 3RC3A 4YHHQ 3VR5A 1YJWA 1TWFH 3P32A 1U0LA 1Q1ZA 2FV8A 4DV2Q 3FFBA 3UDFA 1KIXA 3PF5A 1NI3A 1I5FA 2GJ8A 2CE2X 2R6DA 3MWYW 1EFHA 2YJTD 3NH9A 4IDQA 2QE7A 2OV2A 1IY0A 2YNMA 1VQBA 1EFRA 5J40A 3T1YL 4PC1A 4DSNA 4TQUS 2CK3D 3KB1A 4Y0AA 1MRSA 4DDWA 2EXDA 4GLXA 2VHCA 1JBKA 3HYRA 2HXYA 3DMNA 2CHVA 2E1RA 2QORA 3PUXA 5DHFA 3TIFA 3ZIAD 4QJ5A 2ZM5A 1E0SA 4MYTA 1VPLA 4IOLA 4BLRA 4JLNA 2QEXA 2ZJQA 4P4SB 4AKHA 1S9DA 5DI3A 2WP8J 1RKBA 4Q1DA 2W00A 1UPTA 1YKSA 1OXUA 3MFYA 1A82A 5B57C 1KAWA 1VQFA 3L82B 4LRWA 1EWIA 1VQGA 1CKNA 3VR6A 1QZXA 1JB1A 4JI4L 3PO2H 1ZUIA 2ODEA 3CRQA 3T34A 3VQTA 2BOVA 4HZIA 3A6PC 2VRWA 5IYCH 2WICA 1QUQA 2QQ0A 2NZ8A 5CLLA 3MGCA 3S1AB 2YZ2A 1Q7YC 2E2IH 1IN8A 5GAHC 2KI5A 2QSZA 3B85A 3U4VA 4B48A 3ULPA 1SR3A 2CCJA 2FSFA 3TLXA 2B3GA 2HT1A 1BMFA 1NVVQ 2GEVA 2RGNC 3TKLA 2IX0A 3Q5DA 4OI2A 2YWGA 2QMHA 4Q01A 3WRXC 4X65Q 2WKRA 5L3SB 4GOPC 1KIMA 3GP8A 4LZZA 2HLDD 1OF1A 2WIBA 2WWGA 4EJSB 4CYMA 1XTQA 3J80i 4LJ4A 2IYXA 3DM3A 2R7ZG 4MYUA 3HYTA 3S14H 1AQUA 4UXHA 3HU2A 3LLMA 4B3ML 4BBSG 4AG6A 4JKIA 2HXSA 1OFHA 4B47A 2JLUA 1E22A 1QG4A 1G7TA 2CCGA 2RGCA 4HAVA 2ZUCA 4JZKA 2G9NA 3UWKA 1M1YE 2XJ4A 2QT0A 5EE5B 1W7AA 3CLVA 2I5MX 3VR1A 4P32A 4NP6A 1BBWA 1XEXA 2FPMA 2MQHA 1HNZQ 5CLQA 2GZAA 5HGQA 5EXPA 2BBOA 2JIZA 3PEUA 4HB0A 4DZZA 3WRYC 3GLGE 1F2UA 5C44H 3KJIA 1HNZL 1T5IA 4DT1A 1BVSA 2JA8G 4A3CH 5IYCG 1LNZA 4KU4A 4ZV4A 3FMOB 1KK1A 4EPXA 1EIFA 4NCNA 4WZBE 3KQKA 2WJVA 3U60B 1IBRA 2JIZD 2ZSDA 4NBSA 4QHTA 1FW6A 2CMKA 1VS0A 1B0UA 3CPWA 3HOYH 5KNCA 4FCVA 8OHMA 2NPFA 4YXWA 3CMAA 1OXTA 4OWWB 1H8HA 3LBHA 3ZLJA 3EZ6A 4LFBL 3HKZG 1W36C 2CWAA 4HLUC 5KO2A 2NMVA 3T06B 2KB0A 1KK3A 3QBVA 4R71A 4F91B 3EC2A 4JBMA 3GCGA 3MAAC 2YKGA 2WKQA 4XOIA 3WP0A 1NF3A 3UDIA 4TYPA 4HDCA 2BKEA 1E2QA 4LW1A 4QL5A 1KNXA 1RZ3A 5K36G 4HJ5A 2FJUA 4JBYA 2FSHA 4U7DA 2XAUA 4LI0A 1MO5A 2IYUA 5SZKB 3HWSA 3UANA 1TF7A 2ATWA 2P2LA 3IIKA 1VQEA 1F2TA 3S1MH 1F2TB 1XCMA 1TXYA 2NO9A 3KZ1E 3NG1A 4BFXA 4PSAA 3H4MA 2WAQE 2UKDA 4XSGA 4RMFA 2PZFA 1IHUA 4JC0A 3KKPA 3W8NA 3PJRA 3BERA 1JR3E 1XU4A 2A2ZA 2QM8A 1IYJB 4NXML 1JAHA 2ZAOA 1KY2A 3AUYA 3BRWD 1WBDA 2ZRGA 1JEDA 3NH6A 3OIYA 5LB4A 3K8AA 4ZDKA 1KK2A 2P6UA 4LUZA 4MGYR 4IXMA 3K0FA 4OX9L 4A3GH 3TS2A 4EIWA 1HEIA 4V0MA 4XSHA 1T3HA 2CK3A 1WB9A 3BIFA 4YMUA 4JLJA 3MSXA 2UXDQ 4JT4A 3LXRA 1U99A 4AYXA 1U98A 3LBNA 3AVYA 2RF4A 3HOWG 4RVCA 2FSIA 3S16H 4ZCIA 2QROA 5AUNB 2PJZA 1LTLA 3U50C 3EIHA 1NLFA 4AQYL 1F2UB 2CWPA 1E1QD 1HE8B 4P72A 4UJ5A 5FPSA 4MRPA 4C3IH 1OJLA 4AKIA 4OHZA 3WMEA 2XNSA 4IDOA 2ZSFA 1JJVA 2YTXA 2W58A 2JDID 4L8GA 1CSQA 2GBLA 2K52A 3RZDH 3GFTA 3U3MA 5A5GA 5JS8A 1G3UA 1Z8FA 4WOPA 1W3SA 3T1HQ 4LFCQ 1SKQA 3M3YH 3LX5A 2J46A 1ZNWA 3LRPA 4P71A 4K8OA 1RFLA 1HJPA 2L0XA 1F3OA 1TPZA 3PCOB 4BY1H 1E1RD 4MH0R 1ZM9A 2ODWA 2PEYA 1WXQA 2BBWA 1Z2CA 4A76A 5D3MB 4QGGA 3THYA 1XTIA 3S1RH 3SFZA 4DK6C 4A3JH 1X8KA 4Q7JB 5E7MA 2H18A 5IK2D 4CZ2A 1K0RA 2PMZE 4A3FG 1CJUC 3DO6A 5KYKA 4RCYA 2I4IA 1JI0A 5KDLA 1Z0AA 1G8PA 1LB1B 2CNWA 3BC1A 4G1UC 2RGAA 4NYIR 1VQ4A 2HIVA 4HJ8A 1NMGA 4ZCMA 4ZI3A 1KC8C 4L5RC 2PZEA 2YC2C 1HNWQ 2GVAA 5EUQB 2GAAA 4IPGA 4LF6Q 4XVQA 2A19A 3EZ9A 2GXUA 4FMCB 4GPTA 3QF4B 3U3KA 4ZKDA 1KQSA 5BN4A 1W5TA 2Q9BA 3P4YA 1HNXQ 4HUQA 3ND8A 1GIAA 4BXXH 4RKFA 2PI2E 3T1VA 2ZQ5A 4A6XA 2NN6I 1Z9FA 4Z51A 4A15A 5AUQA 1Z83A 4UXIA 5E7JA 4LYAA 2VSXA 4R4OA 2OFWA 4B3CA 4TYWA 2O8BA 2EFHB 5KU1A 1QZHA 4Q1CA 2BMDA 5FOSA 4A2PA 1MABB 2DHRA 5J4KA 1H8HD 1S40A 1W4BA 1RRGA 1VCIA 5CK4A 1ZNZA 4LHZA 3DVLA 4Q4LA 3IIJA 4KO8A 3RLOA 4A3JG 4Z8YA 3K7AH 2QPOA 2ZITA 3FFAA 5DLQC 4IJLA 2O0HA 4HYYA 2ORWA 3KTAA 2ZIAA 2D06A 1ZD8A 3L8ZA 2J7KA 2RMKA 3K0FB 1RYHA 3K70D 1LS1A 3CW2C 1RPZA 5EUMA 1XDBA 5G40A 2OHFA 1CR1A 2QAJA 1XTKA 1GKUB 4CF7A 5FI1B 1ZNXA 5LMNL 2OT3B 3CKLA 2OEPA 3GTKH 2EVWX 5TB5A 4D0NA 621PA 3O8RA 1G5RA 1E2HA 1HV8A 3QXHA 2D3WA 3L8YA 4YMWA 2ZI5A 2XGJA 4DNIA 2Q6TA 5FR2A 4TQ9A 1Y3AA 1IONA 4M8NE 4MDFA 4RD3A 3CF5A 2IUSA 1AQYA 3WYGA 1N0VC 3K53A 4PAQA 2XTZA 4GKJQ 5K8TA 2XSZA 1IL2A 3CD6A 1FQKA 3CR8A 4EKDA 2HUPA 1NJFA 1S1MA 3PQCA 4HATA 4MUAA 1UE6A 4B3RL 2JA8H 1G20E 2AN9A 1NN5A 4NPSA 4WJ3M 2CQOA 4BLOA 5H1SE 4GS3A 4H02A 4M1OA 4N1AA 4P31A 4AKEA 5L3VA 3DOEA 3L2PA 5CDFE 3KJOA 1ZNYA 3HU1A 3U2QA 2EFEB 3ZZ0A 4KITB 3QSYA 1DG3A 2JLSA 4QHYA 1GFIA 4URXR 2DYKA 2AKAB 5DLQE 1G7CA 4I1VA 5FBWB 1YRAA 1ZBDA 3HOUG 3G48A 2ZSAA 2ZS7A 4JJZA 2V8OA 3EG5A 3KKMA 3WYAA 1XX6A 3RR5A 1XFAA 3AKYA 3F0TA 1Z2AA 4OWTB 1Y1WH 1TL7C 3C14C 2LKCA 2IYLD 4K0KL 3A1WA 1JEEA 1RIFA 4BFTA 1E2IA 1G3IA 4BEJA 2WAYA 5DO9A 5K8IA 1P2VA 2YYZA 3GTGH 2ZTCA 1RVDA 4M1TA 2ZJAA 3FHTA 3B7GA 1I50H 4BZXA 2ZJ2A 1JJ2A 3KFUA 2ORIA 4LWZA 2F1JA 5FLMH 4WBSA 3CC7A 1QHGA 5L3QB 1HT1E 2XZOA 4ASUA 4B32A 4TMXA 1P73A 2OLKA 4UNQA 5C0XJ 3ZYCA 1ZC4A 1CR0A 3SGIA 1VQOA 2ZM6L 3JAMi 4NYIQ 5JRZA 4JI7Q 4NMMA 3SC3A 2IW3A 1ZIPA 2PLFA 3BJUA 3THOA 4C4PA 5AJ3L 4LSGA 2IHYA 2QUZA 3QY0A 2HF9A 4M0LA 3LGJA 3KKNA 3EC1A 3TW4A 1QHYA 3B2EA 3IQXA 1H95A 4TMWA 4OK3A 4G01B 5JWHA 2AXPA 1XJQA 3RRZA 4W9MC 1N6IA 1NMZA 2GN5A 3I4OA 2QMUA 4X8OA 3VX3A 5TDHA 1GZSA 1NBMA 2ZR7A 3GJ6A 4AURA 5ELNA 2BA0A 2ZJRA 1NG9A 3HU3A 4TTRA 1XTSA 2C04A 3O8CA 4IW3B 2VUMG 5F2EA 1OH6A 3RS2A 2FPLA 1NBMD 1A1VA 4RG1A 4FWTA 1F5NA 1NVVR 1ESNA 2VH5R 4QGAA 2AHOA 4LUOA 1GAJA 4NPHA 3TAUA 2ZYVX 4U02A 5EP1A 4TZ6A 2ZJBA 3OIVA 4L16A 3OESA 3C7KA 3R7WA 3U3RA 2VP0A 4LF8Q 4TZ0A 5JWRA 4E22A 1G6OA 1YJNA 1XF9A 1K9MC 2D7CA 3JVUA 5EP4A 1WF3A 5AK0A 2JJ2D 1XTRA 2CL0X 2WSMA 3CONA 4JLAA 1WOCA 3I72A 5IYBG 2ZRBA 3B9PA 2KENA 1LFDB 3NXSA 4FIDA 1U0HC 3CH5A 3A1UA 2GXSA 4JYAL 4JLBA 5M5WH 3N70A 1GVPA 3QBTA 5EE9A 5KOYA 2J1LA 1OIVA 1W0KA 2W6JA 2SHKA 3QKRA 3RWOA 2IS4A 2IUUA 2QZ4A 2BC9A 4RFSB 4Q18A 2QA4A 1K73C 1OYYA 3PG5A 4RFSA 1WFQA 1TUEA 1CJKC 1YNXA 3AFQA 1Z28A 3SDZA 2O8FA 2JA5H 4PC7A 2AMCB 3BH7A 3DLLA 3FMFA 5IF9A 4JI8L 3ZS9A 5FL7D 4AYBG 1XMQL 2QT1A 4IRUB 1C9KA 4LBZA 3K7UC 2WAQG 1Z6GA 1TQ6A 821PA 5GAGC 1I4TD 4ITRC 1NP6A 1WYDA 1E9BA 3GTJH 2PBRA 3ZVLA 3A1VA 1I2MA 4JLMA 2F3IA 3S1QH 1CSPA 2IX1A 1PUIA 2RAPA 1X55A 4BA1I 2WZQA 4MRRA 2OFXA 1JQLB 1NKSA 2FGJA 1NIPA 4D4MA 2W0MA 3HOXH 5AR1A 4AD8A 1S96A 1WMSA 2BBTA 4ZDWA 5LD2B 1VG1A 4RZUA 1M7BA 3GLGA 5L3RA 4GL2A 1DPFA 5GADl 4DB4A 1JT8A 4A3DH 2K75A 2OBNA 3H0GH 4IOJA 3TS0A 1YZQA 1X65A 1A4RA 1NIJA 3OE7A 4OQFA 5HE8A 1TWHH 1D7QA 1TQ4A 4DR6L 1XZPA 2OCYC 1Q86C 3TE6A 3TVTA 4JBWA 2R6CA 4DCSA 1OYWA 3ASZA 2NVQH 1G16A 3DZDA 4QFMA 1G4AE 4MQBA 3X1YA 3SR0A 1E9DA 1MRNA 1JQJC 1VCOA 1XCPA 3CCLA 2QN6A 5GJCA 1IY1A 1OXXK 4A8JB 4OQNA 3U58A 5FOWA 2BVNA 3FHCB 3E70C 2X8AA 3CPFA 3W6NA 3W90A 1XTDA 5AJXA 3V9PA 3KXIA 4LJ6A 2F4VL 3MXNB 2R6AA 1N9WA 1FX0B 4PPQA 4X8LA 4LBYA 1S8FA 3I7FA 1ZMXA 1Z0JA 1AS3A 1X86B 3BB1A 1II8B 5C44G 1GRQA 2RGGA 3ZVMA 5KDDA 2IS2A 1G7SA 1IBLL 1P7CA 1YZKA 3GLHB 3H1TA 1A7JA 4XVRA 4S35A 4IJMA 2OILA 3QVUA 2ZVPX 5FL7A 3TSWA 4ALPA 1AKEA 4DV2L 2OTJA 3CPJB 1KYIA 4KXFB 1W44A 4LV8B 1KSHA 3K9HA 3T5DA 4KFTA 2GCNA 1T0JB 4GMXA 1OHHD 2Q3MA 4ABYA 2F1HA 5EZ5A 4MDEA 2XTNA 4IFDJ 5LPNA 3T35A 3BOSA 4G5GA 4UQOA 2N42A 5KPDA 4DR4L 1FP7A 1L0WA 3ZZTA 4NU0A 4C0LA 3RLFA 5J4VA 2CCKA 3RANA 3PGZA 1U8AA 1HR0Q 3P26A 3NBXX 1ETUA 3UPUA 2G77B 4EQ5A 5CYPA 5J3BA 2Q2TA 1OFUX 2HDNB 3ASYA 3CP0A 1GNRA 2GDJA 2IXFA 1NL3A 2BMJA 2QA5A 2G0NA 4IVPA 4LPKA 4A6PA 2CJWA 4OL0A 1NRJB 2HLDA 4U00A 5IP9H 3A74A 421PA 1S3GA 1G3RA 3F3YA 4ZIRB 2UXDL 2GCOA 4M1SA 5EZ6B 3MUFA 1DELA 2VHQA 3M6AA 2VF8A 2GRJA 3SYKA 5DISB 2WMOB 3B6EA 2AHOB 4KODA 2J5XA 1HR0W 1QVRA 3SN6A 2V55B 1XPOA 2HHHL 1I6HH 1SVWA 5FBLB 3ZGXA 4PAMA 2EWWA 4TTQA 3J81i 3RRNA 3T61A 4A0FA 4G5RA 2IS6A 2KWIA 2ASBA 5C3EG 3AUXA 3G5UA 1L2FA 4UNSA 4WAUA 4A4DA 3THWA 5EP3A 1ZD1A 4C7OB 4B74A 4DLUA 4TYYA 1E99A 3QKSB 5FUYA 2E2HH 2K5VA 1Z6YA 2DWOA 4TLEA 3SOPA 3WXMA 2W0SA 2CL7X 2JEOA 1SHKA 1YIJA 4JS0A 1YRBA 2JATA 3GFOA 3R8CA 2GNOA 4FMCF 3KTAB 2GVDC 3K0EA 3RYTC 3G82C 3FGNA 4DLVA 3LW8A 2FGKA 4A8JC 3OEHD 4B3DA 2LXKA 5TVKA 4A1FA 4BECA 2Z6KC 2VP9A 2B63H 4QGFA 2NVYH 2CL6X 1Q8KA 1E2GA 3FB4A 4KYIB 1YZ6A 4B3XA 2IYQA 3CW2A 4WW0A 3TAHA 2P5TB 1LF5A 3SEAA 2I3BA 3W3ZB 1ZU5A 1QHHA 3I3SR 4I1SA 2Z6VA 1X56A 1E79A 3KLWA 1XD2B 2H57A 4B3MQ 3O8BA 3QJYA 1MJEA 3U44A 2ID0A 1DAKA 4TLBA 1EQQA 1HQYE 3B1WA 3A8TA 5DSZA 4O3MA 4LFBQ 5JEAG 3T1HL 1VQNA 2Y0SE 1CR4A 1NG1A 2C5LA 3EA5A 4HLQB 3KQHA 1X6OA 3R9XA 3HOXG 1Z0FA 2YINC 2BV3A 4XJXA 3CR7A 5E3HA 1HURA 1JR6A 3DKPA 1U90A 3THYB 2C2HA 3DM9B 4PR0A 2OBMA 1UADA 3EW9A 4C0SA 4DR3L 1II9A 2UXCQ 4B2PA 3DHWC 4DCTA 1Z0DA 2AK2A 3M0EA 2FH5B 1EX6A 1MIUA 1NE3A 3VNVA 1JJGA 3WNDA 3ZD7A 4M1WA 4DBLC 3HR8A 1YZLA 1OE0A 1AS0A 3CNNA 3PO3G 1V9PA 1MH1A 3NDBB 1PH1A 4PHHA 4OYHA 1E3PA 1BH2A 3BWDD 1UKYA 2F9MA 1VQ5A 4M9ZA 5EXSA 4JL5A 1Q1BA 2J59A 5FLXc 1JPJA 1HNXL 1N33Q 3PIOA 3U44B 3PXGA 3GEHA 2W2VA 2ZAMA 3IO3A 2GWHA 4URVR 1E4YA 1TEXA 2A1AA 1VQPA 2ZRIA 3M9BA 3CWZA 1U9IA 2CVFA 1PH4A 4D26A 1AH9A 4MGIR 3TRFA 1UEJA 1O87A 3M4YA 3IEVA 1LF0A 1XZQA 5GVSA 5C46F 1G8GA 1AZSC 1XEFA 1OIXA 4GP7A 2ZSEA 1BYIA 4WZAE 5AJ3Q 4DDVA 4YDHB 5GJVC 4GKKQ 2OXRA 5FL3A 4DEYA 4YHHL 5EXTA 4JYCA 1SFOH 2DR3A 5FJ8G 2JA7H 2ERXA 2F43A 3B13B 4AYWA 1RC8A 3RC8A 1D2EA 4PO1A 2H8KA 3OEEA 2R6FA 5G3YA 4GOKA 4C7OA 4AYTA 3QVVA 4GNXA 2C98A 4JI0Q 2NQ2C 1D5CA 3DDCA 1MR3F 1CUKA 4X8HA 2C96A 4D0GA 3K8YA 5K8LA 1XNQL 1F48A 2G6BA 1MO3A 4S2EA 4X62Q 2ZRPA 2ZRKA 4ACBA 1S2MA 2ANCA 4DCVA 3U6KA 2Q2HA 2MMGA 1AK2A 2QPTA 2GILA 3SQXA 2DPXA 4PMWA 4A3BH 1TWCH 4PQFA 4W5JA 2O8BB 5F9HA 3MLEA 2UUCQ 4GOXA 4DR4Q 2CCZA 1S4QA 2V7QA 4BY1G 3FVQA 1I2DA 1WCMH 1N5KA 3ECCA 1PLKA 4I81A 3V00A 3AVXA 4HB3A 1KAGA 1S9HA 4LJ9A 1VCMA 1KRTA 2WSSA 4UNRA 5IE8A 4OXPA 1D2MA 1GL7A 2C99A 5IWAL 3K0CA 4B3RQ 1HZ9A 2PMDA 3LAWA 3C15C 5C4GB 1B70B 1W47A 4TWZA 4ACAA 2ZREA 3AP2A 4NKRA 4RD0A 2IHBA 1J8MF 1UE7A 5TARA 1G291 1KXLA 2P3SA 4A3IG 4JV5Q 1IQPA 3NEYA 1XMIA 2DY1A 1E6CA 2FX3A 2RKOA 3NBYC 3AQQA 3CC2A 2R92H 3EARA 3NHBA 5M04A 1WBBA 3EIVA 4O2DA 4YCVA 3F2CA 1E7ZA 1ONBA 3LY5A 4M2LA 5JZVA 2OG2A 3QNUA 1EESA 4DV7L 3QI2A 5IHPA 3HDTA 4QL3A 3PV0A 4JJKA 1N36Q 1J7KA 1IZ6A 3NBFA 3SJZA 1GM5A 2IHFA 4FCWA 2BCGY 2DWQA 3RSOA 2I0QA 2Q21A 4PPGA 5IY0A 1VCNA 4L5TA 1VHTA 3AKEA 4Q4HA 3QPWA 1E94E 3KDFB 3TGPA 1OPXA 1W4CA 3TH5A 1CBUA 1IN7A 2E5LQ 2FFBA 4DRZA 3K09A 4B75A 1Q21A 1KGDA 2WB1G 2E5LL 1O3YA 1WQ1R 2ERYA 3KQUA 3UMSA 3VNUA 1EGAA 4Q4HB 3SS8A 2VQSA 4JVNA 4DUGD 3AF4A 3BBPA 2XNDA 1E3MA 1N36L 2JA6H 5E7NA 2VBCA 2ZEJA 1P62B 4GOPB 2FEMA 3L0SA 3U3OA 3A0JA 5DYGA 1XD8A 3NC0C 2H1LA 4QXAA 3FKIH 2DFTA 1BS1A 2GTPA 4IEEA 1K8AC 3S1AA 3BS4A 2KBNA 1GKYA 2QE7D 4DKXA 3FMPB 4ARZB 1TU4A 2VL6A 4NH0A 4US0R 1ZD9A 2ZJOA 4YCUA 1DE0A 3U6BA 2QAGB 1KDOA 4DR2L 3GFPA 1XMSA 3UG6A 5IP7G 5FPHA 3CCUA 1T9HA 4IFBA 1LY1A 3WNBA 3A37A 1BOFA 4CVNA 4AC9A 4G5OA 3ADCA 4JI5L 4O2LA 4GN4B 4OK5A 5AJVB 2IBMA 1N34Q 2IA5A 3SBDA 5GROA 4DAYB 2VQFL 4DKAC 1W2GA 2VF7A 3EAQA 1CULC 1ZYUA 2JLVA 1CRPA 3KF6B 1KAOA 4JOIC 3VR4A 1G51A 1IXSB 1TF5A 4B44A 1A0IA 4JG2A 3KQLA 1HR0L 4P4TA 3T1QA 5CJPA 2HIXA 3CO5A 4C0AC 2N49A 5CDFA 1KHIA 5BR8Q 3NIBA 1R5OA 4JSYA 1PH2A 2JLRA 3G0HA 4QM6A 3GO5A 1NN3A 1Z6TA 1YR9A 2KCMA 1BKDR 1G1MA 4BRUA 4BY7H 4GNXB 1L4YA 3E9HA 4G5SA 1XNQQ 1PVOA 1PYBA 1N5LA 4A3KG 2VHJA 3AFPA 4NYMR 2IYRA 3KKQA 3CUEF 3EA0A 3LD9A 2OAP1 4QBIA 2VP2A 1C1YA 1E9EA 1M2OB 4LNQA 1N6KA 3CX8A 4PANA 1HZBA 4PZYA 5J5CA 4CGZA 1Q46A 1VMAA 1E0KA 4I1OA 3MG9A 5HCNA 2IK8A 1ZM2A 4PO8A 4BRWA 4OONA 2J0UA 2WJIA 1QG2A 4JMPA 2ZRCA 1V43A 2R93G 1N5IA 1SQ5A 1W4AA 1YHAA 1YR8A 2MSCB 1XPUA 4HZUA 5BN3A 5FH9A 1II8A 4ZDJA 4YXWD 1NSFA 1W4RA 4IO9A 3KUDA 2WSSD 3STBC 1EFRD 4P3YA 2NIPA 3SBEA 4C0QC 4D6PA 5C4JH 4IOKA 4JLVA 1DAGA 1GTVA 4NCKA 5JI2E 4NXMQ 5C3EH 1YR6A 3U7HB 4OX9Q 3H3VI 1G6HA 4TSFD 1JALA 3U4QA 1ZUHA 1DG1G 4LF7Q 3N2IA 1OXSC 2BEJA 1YEZA 2PNHA 3GJ0A 3MWJA 3RNUA 4CEIB 1SE8A 1M7HA 3GLIB 1NBME 2PMKA 1JECA 4FCTA 3PO2G 3CCQA 4NXNL 1KDTA 3F2DA 1OT3A 1Z29A 1E1TA 3CH4B 4IDNA 3S24A 3WP1B 3TSZA 1J8YF 5B30A 1KL9A 1R9TH 3THXB 2IS1A 1Z5ZA 1AE3A 2C35B 1XEWY 2VLIA 4JVMA 4MITA 5FTLA 3NKVA 2DUDA 3UWOA 3ZD6A 2AWOA 1GRRA 3W9YA 2EQBA 2G0TA 2YHSA 4FMDF 3OAAD 5JHHB 1G8FA 1J5EQ 4LF5Q 3PEWA 4TVAB 3ZDQA 1NY6A 2Z83A 2Y8EA 3IKJA 3K70B 3OHMA 2EU8A 1RE0A 4PZ8A 3GTMH 3NTUA 1UE5A 3OAAA 4P73A 1D2NA 4A3GG 4XTRA 2TMKA 3RS7A 4BZPA 1VQCA 2B8WA 2HJVA 4RCZA 4QM7A 3AYHB 2OQ0A 3A4NA 3TBKA 4K81B 4MRSA 3UDXA 3GLIE 2VHTA 1XBTA 4HJAA 2ZJPA 2W2TA 5KUTA 2WM9B 4A93G 3W5OA 2G88A 1NY4A 4Q7MB 4KFRA 2VSOA 1N32Q 4POAA 1GWNA 3OFND 1G8YA 1KI8A 4M9SA 1NLYA 5IT9c 2H5XA 1EX7A 4GDFA 2FA9A 2JLZA 2WJGA 1W2BA 1U8YA 1IXRA 2R44A 3HOZH 1E2LA 4V03A 2J7PD 3VR3A 4B6EA 3FOZA 3AVQA 4HIDA 3H86A 4PSVA 2QM7A 1DAFA 3AV0B 4B71A 3CC4A 4Q9LA 3K0AA 3SE0A 1US8A 4A0GA 2VW9A 4IFDG 4IHQA 4R98A 2JE6I 3S15H 3KYHC 4LF8L 2PEZA 4BFZA 1Z63A 1EFTA 2BJVA 4TL7A 4B76A 4EQ6A 1XNRQ 4BFVA 1VQ9A 1GD7A 1CIPA 1HYQA 3TUJC 3B1ZA 4ZKEA 2I5HA 3VU9A 2VZAA 3B1XA 1OSNA 1QDEA 4R7ZA 3J80c 1DEKA 1HH2P 5HY6A 1N3BA 1KRSA 1T4GA 3PUZA 1KDRA 2AKYA 4JVLA 2XTIA 4LYHA 4PPNA 4A92A 1N0WA 3VMFA 4B43A 1XD9A 3HOWH 4GZMA 4PZZA 3H0GG 3GJ5A 4LBWA 1C9OA 5DYIA 4DJTA 3A1TA 3CNLA 1MKHA 1P5ZB 3G71A 3X1WA 2ZE5A 2GAOA 1Z07A 2Z43A 2QP4A 3AKDA 1KO1A 5HZKA 1Z6XA 2PH1A 3LXXA 5K8UA 5KNDA 1UJ2A 3E5HA 1LYLA 4TL6A 5E95A 3CRMA 3KQNA 5KSOA 1VDZA 3TK1A 4PG3A 3TR5A 1TQDA 5EQTA 2QRNA 1VQAA 1T8UA 2CLSA 1OH5A 3OIWA 1G5TA 1SXJC 1TEVA 1Q20A 3WYFA 2WWYA 4AKGA 1TQ2A 2QTVB 2RB4A 4NCIA 4HIKA 2WBLC 1YVDA 4P4UA 3K80C 3GMTA 5M3MG 1HA3A 1N5JA 4AWXA 3MD0A 4RFVA 4WVFA 1GG2A 1DVRA 2AKWB 4D0LB 1W36D 3LVQE 2FN4A 2HCJB 3LO5A 4JI2L 3RN2A 1KJZA 1SKYB 2FMXA 4A2QA 5LMNW 3ZH9B 3PIPA 1KOFA 5FFMA 4LHXA 1QHHB 1VG9B 4TMKA 1KO5A 3W5JA 2K14A 5F98A 4XD7D 1FX0A 4TSFA 2O8CA 1TADA 3ICEA 1SVIA 2BIFA 3PSIA 3BXZA 1XPRA 4A3LH 3QEJA 4M1MA 2FPKA 5JEDA 3QG1A 1E98A 4POGA 1OHHA 3H84A 4NCJA 2ZR9A 2X19A 4A8JA 2F3TA 5GVRA 4QG7A 1QVAA 3P1JA 3A4MA 2FZLA 2FFAA 1I4DD 4P33A 3TJZA 3ZS8A 3NWJA 4BBSH 4A3BG 2ATXA 1UFQA 2GEUA 3IGFA 3TQYA 4OBEA 1QHSA 1Y1VH 5LMUL 2R9VA 4C0JA 2N1BA 4AK9A 4WIAA 1VQIA 1N25A 1AZTA 1HTWA 4GFDA 1QVGA 3C5HA 1AGPA 3B8HA 2VSFA 4WA7A 2MMCA 1KZ7B 1KI7A 4FD2A 5H70A 1N6LA 1PYSB 4B2IA 1UKVY 2RGDA 3AKCA 4MKFA 4PX9A 4Q4JA 4X8MA 4RKEA 4V0NA 4E5UA 2QMOA 4EUNA 1N34L 5HCIA 1NTGA 1BMFD 3GLGB 1UAAA 2UZ3A 4Y0VA 2WV9A 5FPYA 2QGZA 4HLDA 1IBLQ 1YJ9A 4DUYQ 4ERNA 2A5GA 1GDDA 4LHWA 1PLLA 1GNPA 2A3RA 4FW9A 5H1YA 1T3SA 5JJIA 3U4QB 2XZLA 3HJNA 2XZPA 3EX7C 1KI6A 4QQBX 1CTQA 3CCSA 1H8EA 4LGMA 5FBRB 5AJZA 1XNJA 2ZTEA 2C9YA 1DAEA 5TXGA 4EQ6B 4DK3C 1TU3A 1HNWL 2XXAB 2J0QA 4UNNA 3KJPA 4R1JA 1ZM3A 5JI3E 3B60A 3AF1A 4LJ8A
chains in the Genus database with same CATH superfamily
3JASB 2AFVA 2QI9C 1Z75A 1MBZA 1UKZA 2XMSA 4TUYB 4F84A 1MV5A 5B5SA 4IPCA 4DXGA 2OHHA 4EPTA 5YASA 3MB5A 5IKOA 4C5BA 1K62A 3IPYA 3PD0A 3ZY5A 5KQPA 3MHBA 3EXG2 5JBQA 4XQ0A 1EY6A 2CSUA 2HYDA 2JHGA 2QQFA 1NBWA 3K0HA 5CHYA 5IEJA 4I66A 5B58C 5JSQA 5JXWA 4ZDIA 3MGKA 1FOEB 1K92A 5M9OA 1I9GA 5B7GA 3VTZA 4GBJA 2HF8A 1H05A 1ADFA 2NZJA 3AONB 5HFJA 4JVZA 4DIDA 3V4RA 1F0KA 2WINI 3R9WA 1KJIA 3BXXA 5DBFA 3S8EA 2BDOA 4LYJA 4DABA 2P9CA 3QHPA 3SLRA 1XZDA 1Q12A 4PN7A 5I7EA 3DG9A 3MT8A 3WG9A 5AHWA 1Q16A 2XOKD 5K2MA 3FYSA 2WC1A 3K6KA 2PD4A 1DOHA 3IXLA 1R12A 4INOA 1C80A 1NUQA 2AHRA 3HP1A 4DV5Q 5AUPB 3A9TA 4CBVA 4DV7B 2AC7A 1REQB 4JLDA 1ESEA 1K97A 3QVKA 3U7IA 4EHAA 3TIXB 4EVIA 5BSKA 2L19A 4PSUA 1B26A 3U5TA 4BGDA 1VQ8A 1TWFB 3NWTA 2Z8XA 3L7LA 1Q19A 2XUJA 2GRAA 4HAUA 3PEYA 4QTXA 1KHTA 2VC2B 5HW0A 1BMQA 4QPCA 3BYYB 5E1OA 1G38A 4QG3A 1ABFA 2OOKA 4GL4A 2IH5A 1R6XA 3B9QA 4CM8B 1ZD5A 4D2IA 2IUEA 1EXDA 1STBA 4QREA 2BGMA 3PIRA 1N1DA 1AKRA 3CE6A 4H9GA 4XQNA 4G67A 5ABPA 2GKOA 2R7DA 4AJPA 4EYKA 4NEHB 3BVZA 4MA4A 2ZETA 3KZCA 1NN1A 3BD6A 4FMBB 2IBTA 2H2AA 1C1DB 2IC5A 4UJ3A 4AJJA 5DMXA 3AQ4A 2MNAA 3BZKA 2Q8TA 3P0FA 1SXTA 1GHKA 1J49A 1HO3A 3K9FC 4XT1B 4GYWA 5IRCD 3DZKA 1GOZA 3FP9A 1JVSA 3KEFA 3OMXA 4CM9A 5A5DA 1X9IA 2LUOA 2YMPA 3TOSA 3F3KA 4DREA 1TEZA 1X1SA 5AK3A 1M8PA 3NTVA 4QARA 3PO3H 3K9LA 3O5AA 3QUSA 4WXYB 2ZIXA 2O3TA 3A9CA 3LBAA 4A93H 3R3YA 3SDSA 3TVDA 4BOYA 1DO8A 3NQIA 1BH6A 1F1BA 3KLPX 1KC3A 3KS9A 3SHQA 3HXMA 4KX5A 4CEHB 3B20A 1UBEA 4MGEA 4EX5A 4A3EH 4JEMA 2PZKA 4ZOAA 2PMZB 5CITA 5JU6A 4JI2Q 2I9KA 1L0BA 3GFBA 1X7WB 4P53A 1QRSA 4A3MG 5DHSA 4BMCA 1L7DA 1DYQA 2Z9HA 1WP9A 2AFIE 1LPSA 3PUYA 1OYOA 3HFZB 3IKLA 4J3FA 3YASA 5KYTA 1HUNA 4GX2A 4AUMA 2OFOA 3B52X 1XVLA 3V42A 2C57A 3FF1A 5A05A 2RIRA 3DE0X 1USKA 2LDBA 2XRFA 4R4QA 1WDWB 2GLUA 2JBAA 2B1IA 2NT4A 2PHZA 5FOTA 5SYAA 4KVAA 2BBSA 3SIWA 3S70A 2DPGA 4XXHA 3JD0A 1V5GA 3X44A 5KWEA 4R9UC 1CCWA 1EEXB 3UJ9A 1JR3A 4RPJA 3KB8A 1Q2UA 2O4XA 1XRNA 2XIJA 3S1NH 3K6SB 3DZJA 4UP9A 4DR1L 2EDGA 1CE8B 2NNWB 2Z2IA 3LPMA 4MN3A 1L4UA 2C9CA 4GM4A 3F4TA 3ZI7A 3KF6A 5AKEA 1L2TA 1ML0D 1USGA 3CEAA 2O8DB 4RMHA 1F6BA 1DOAA 1IAQA 1LM0A 2MFIA 2WE8A 1GRCA 3AUUA 5ED0A 5C51B 3HJFA 3JXEA 2CNWD 5KAMA 2BI8A 2PZGA 3NYIA 4PAWA 3T5MA 3ZD9A 1YRYE 4DEXA 2QVXX 2IPKD 1JU4A 2FRVA 2XMQA 1E1LA 3E27A 2IDZA 3OTWA 3BJEA 3BD9A 3R7FA 2EGUA 4GDFA 3FLAA 1SCIA 4UEWA 4BASA 5HE9A 1LQUA 3URMA 4IVQA 2I2FA 1AO0A 1DT3A 4RV4A 5FTMA 4NCXA 4RKQA 2PUBA 4L02A 4B6GA 5J59A 2Y0SG 4JB8A 2GVZC 2F4NA 1IBKL 1D1SA 3BWMA 1RWWA 3L6OO 4GVPA 4WFIA 2GJSA 4MVJD 4P0TA 4ROSA 2EQSA 4ZMBA 1PBNA 1O94A 3BHIA 3Q85A 4LE0A 3R41A 4TLCA 2R8EA 4WCFB 5L6MB 1A9XB 4YFVA 2ZAYA 5JCOA 4DUZQ 2H4YA 1B93A 1WKCA 4DNQA 3GLQA 4QDOA 4F88A 2B35A 4XCQA 5JNWA 1UK6A 4P9NA 2YCBA 3WGJA 3OM8A 4ER6A 3ENKA 1SROA 3MJHA 1UPBA 3BK7A 2BD0A 2J3QA 4E4TA 5KEEA 2J48A 3OQVA 2XD4A 4E5YA 5HKBA 1A5AB 5FJ8H 4I3HA 2A73B 3TMEA 2D2XA 1IULA 1WZEA 1AHIA 2CB9A 2GK4A 3EXG1 4RA9B 4JL8A 4U6SA 2VQEQ 4A3LG 5TS2A 5AD1A 5L3QA 1QH9A 3CUUA 4HUTA 1UMCA 3D8GA 4FI3F 1CXZA 3IEIA 1WU8A 1I5EA 2J5RA 2YFYA 3QWFA 3SU8A 3M4OH 1GUYA 2BRUA 3PQ8A 4TT3A 2WU8A 4YRBA 3KDFA 2VJPA 4Y2QA 1JSCA 2VZLA 4DSOA 1V1RA 1FYVA 3L79A 1XZAA 1KO7A 2VJCA 3VAAA 5LDDC 4LMQD 1XNGA 5H83A 2B8GA 3EWAA 1MJCA 3JQ8A 4PF1A 4DUPA 5M3FH 4C56C 4K2KA 5CYOA 1GTRA 2EIXA 2G67A 3D3RA 4WCFC 1H9SB 3ER0A 1ZXXA 4MHTA 3IR7A 4P36A 3OOEA 1QAOA 3WGHA 1XRMA 2OM2A 1HYEA 3FROA 3UIEA 4K6DA 5CMLA 3I04M 3UWSA 1Z56C 2BFCA 4RLFA 3LT5A 3GRZA 2WIGA 3RYFA 1CU1A 1OXVA 2AVDA 5I3CA 5KIAA 3TQQA 1RRCA 4FOLA 5BNIA 4B40A 2E74C 2YDXA 3E48A 4U0KA 3NQTA 1FFDA 2PCJA 4F9TA 4D4KA 1P8LA 1Y8QB 2PUJA 2YXPX 3B3FA 1IOZA 2BFMA 3L4SO 4OUDB 4JI5B 3WWDA 4BJ3A 4DS3A 4U68A 5HURA 3V2GA 1I4LD 2D7JA 4B3TL 5E4WC 2KE5A 3OT1B 3RTAA 3IMGA 3EVTA 3E9ZA 3E5RA 1TKWB 2ZS9A 1XLUA 1N8KA 3F8TA 3FVVA 1QG7A 3S15B 2CMGA 4BQSA 3BG3A 4DV4Q 4J15A 1KY3A 3BH0A 1W0JD 2WU4A 5IZCA 1UZMA 2TMYA 5CV9A 4LZOA 3F2UA 3AXTA 3RG2A 3O91A 2QGAB 1BWPA 1KU6A 1VQLA 1YASA 1FNVA 3QE2A 1O97D 4MV5A 3WGZA 3AHGA 4J49A 5HQJA 4ZI7B 3O92A 3STBD 4M9XA 1RYNA 3EVZA 5ALGA 4JYZA 2PQAB 1B00A 4YJ3A 3ZW9A 4ETIA 3E9MA 3NENA 4QDJA 1KQGA 1Z37A 4MP3A 4ZRDA 2XTMA 3B3AA 4FYHA 1S5CD 2PLRA 5ALZA 3DNPA 4KFSA 4OAQA 4CKCB 1NJ2A 3RVLA 2E4UA 1DQYA 5HRCA 3QJGA 4EHDA 4ERXA 1BWSA 3I4NG 2F9LA 4B3SQ 2XEDA 3I53A 4RS3A 2PDAA 3UJAA 5BYAA 2HGSA 3D0QA 1HQRD 2WP0A 5L45A 4UTXA 8ADHA 1BUVT 2EZ4A 4PQXA 2NWQA 2XVZA 4UTNA 4W5OA 2QBYB 4URUR 2M6KA 2FU5C 1THGA 3MCVA 3EG9B 2CT8A 4YONB 4QTYA 1CUAA 3RTEA 2VA8A 2PLNA 4GN3B 5ERGB 5ALFA 4KC0A 3F9RA 2XUPA 4L1KA 2CMDA 3FZQA 1JLKA 1GSHA 3RZOB 3H9BA 3HWRA 2OCAA 3PE3A 3LA8A 3UG7A 3VU0A 2X9GA 1YI0A 2WSBA 1E4VA 3OZIA 4GEGA 3K3PA 5AKXA 5EWLA 3VHLB 3K0BA 4MWZA 2Z5VA 3AEUB 3NBHB 4I5IA 1NRXA 1QTNA 4PVCA 4DV0L 4I5DA 2F62A 3VXKA 1IRXA 2ODBA 5FWYB 3WIVA 2WVJA 4R8IA 4WFJA 5LQUA 1US8B 4XDGA 1NI5A 2DQZA 5KNBH 1WUHS 4IUUA 3S28A 3QBDA 3RV3A 2QX6A 3QKUA 2HY7A 1ELOA 4L4UA 3EDYA 5DASA 2GHQA 5DRYA 1OLSA 2VDKB 1MX3A 3KF8A 1STGA 3VZCA 1PH5A 2H29A 1GZ7A 5ISRA 2HSWA 3CX6A 3V96A 2A7QA 6PFKA 3LGXA 3DBRA 4PMCA 1A3UA 2W2MA 2YW9A 3ROGA 2DLCX 4LRSB 1WUYA 4Q9HA 1TZMA 3TG2A 3JVEA 1EQRA 5BMOA 5KTKA 1AQJA 3ZGLA 5DNWA 3U81A 4LF6L 2FKAA 5BWOA 4OFWA 1ORDA 3ZZMA 1FUEA 4I2NA 1QH8A 1QJOA 1LLFA 1ULSA 3OPQA 4Q16A 1QFSA 4GSKA 4DT1B 4EKGA 2EKBA 1C3OA 4EPXA 3IP7A 2E87A 2ZDHA 1FFWA 4FYMA 1AUPA 1IUOA 2QSJA 1NBEA 1JOQA 2SCUA 2VTEA 1L5SA 3TRZA 1WEKA 2W8ZA 3EOAI 4I6EA 4TVOA 3N2ZB 1Z4MA 1GGKA 3LUAA 1L1OB 2ZLBA 3RK0A 5I4BA 3AVWA 1A5SB 2EIFA 4ZUIA 3B53X 3JYOA 3CBQA 3COZA 3VJKA 1N5DA 5LMZA 1UE1A 4AJ2A 1SYEA 2CN1A 4H1VA 3FHTA 3D6UA 3H99A 4RSGA 1HY3A 1NQWA 4FDTA 4GNKA 1SQSA 3EIOA 4KLNA 3WGGA 1JB7A 2I4NA 2QN2A 1YJCA 4APVA 4G26A 3WVNA 5EHGA 1ESMA 2C9MA 1QWOA 4K9QA 4R1MA 4BWGA 5A9TA 1SLJA 1RKVA 3G0CA 1TCUA 1E6WA 1NVWQ 2Q6VA 1BN7A 5C0XG 2QRVA 3DAHA 3TNLA 3BYTB 3H15A 4E15A 3LT2A 5JFGA 1J5EL 2VO1A 4QODA 5JZMA 3CJRA 2B1RA 2XXJA 5AOCA 1QRRA 2QDKA 1TWGB 1TPYA 3QKSA 3HOXB 4HUJA 1DO0A 3ONAB 1NXVA 3J81c 2ZUUA 3AGPA 3DHYA 2VQFB 4AY2A 4LG1A 4J0HA 5SY9A 4YCNA 1YACA 1XZNA 3SOPA 3BJMA 1BQQT 1YJ5A 1C4WA 2CBZA 3OCFA 3DOUA 3FKQA 3GLHE 3TEHB 1E3TA 2HFJA 3OP4A 4OP2A 5AMXA 1FJHA 5DW0A 2R8OA 4N3GA 4BYGA 4YT2A 2IHTA 1W6JA 2NVOA 4OL9A 5HIIA 3GAFA 3OI7A 4BFCA 2ADFA 4OXKA 5EFOA 1Q74A 4C03A 3CF6R 4GG1A 3VYUA 4BE7B 4J1NA 1T5XD 1K1EA 2YFQA 2YXEA 3RYCB 4MKGA 3AM1A 5THXA 1HPCA 1NI4A 3Q1KA 4KBFA 2K6AA 3I8SA 4WBXC 4BNZA 1NQVA 1E60A 4V0RA 2R7AA 3C16C 5IKXA 2ZT7A 4FBMA 1ADJA 1A04A 2OZEA 2VDMB 3ZLBA 4E14A 1ZK3A 3V34A 4LXTA 4LXUA 1CNMA 2KW5A 1Y8OB 2R6GA 1WULS 4HH1A 2IYAA 3OE4A 3GYGA 1HYBA 4RVDA 2F55A 2G25A 2VRCA 3W8RA 2ZI3A 4ILWA 1D7OA 4AZ3A 2Q3HA 1WPQA 2ZTSA 3O95A 3TUIC 1EGMB 4JT9A 1PZID 3RU2A 2J3IA 4ITVA 3IHWA 3KXLA 4LK1C 3OWFA 3R44A 2K28A 2X6LA 1TWHB 4DPMA 2WNHA 2ZRQA 4LI3X 4UHEA 3OTOQ 2ANBA 3MWGA 2O1EA 4YWJA 4Y2GA 2HOQA 3ZR4B 4K3UA 3LHIA 1Q7TA 2DWPA 1I3OA 4M22A 4RM3A 1PWEA 2ZTMA 4DC0A 4JIGA 1O89A 3HOYG 1GTMA 4POOA 2ZWIA 3OCEA 3M5WA 4M87A 4A23A 1FSZA 2Y76A 2GPTA 1JC7A 1NV9A 1Q57A 1W1WA 4HAZA 4DLKA 2J41A 1YKGA 2PPLA 4PLVA 4CTNA 2C5EA 3I5AA 3RNLA 4TYMA 1LFAA 3NJRA 2IU0A 1HYGA 2XVXA 2J87A 3TIIA 4AJOA 3D31A 1J8IA 1RDFA 3R8FA 3FPPA 4M36A 2YIDA 3NUGA 3U62A 1Q1NA 4MA5A 4YDSA 5EJ2A 4C4RA 3PC4A 4FMDB 2IE8A 3L49A 2UUBL 1HFWA 1E9CA 3SWWA 2NYRA 1HI9A 4S3MA 3R2TA 1FQJA 2XKJE 2XNCA 1LJUA 1T91A 1UBCA 4X64Q 2G07A 1KI4A 1D6NA 4GGPA 2FFQA 3ZHTA 5G3ZA 3V4OA 4YT5A 3FHJA 3MA2B 1XMQQ 5K5PA 2REBA 2X2PA 3HADA 3TLYA 3RO7A 1JE5A 2O2JA 3BMCA 1CJVC 1KZGB 2RKSA 2QRHA 2KHIA 1T5HX 2ZSJA 4HMIA 3EODA 3TW0A 4CCYB 1ML4A 3I23A 1ZEJA 3OETA 3OSOA 1UBJS 5DT9A 3EEOA 3K0XA 2YU9H 3H09A 1C4OA 3EIQA 2P6MA 3T3HA 5BV8A 2EYUA 4J07A 3RHZA 3C2QA 4ZPJA 1KK0A 1A27A 4XB6B 5AW5A 2HYIC 1QP0A 3WDSA 2YWRA 3UC9A 2R93H 3BAFA 5A0FA 4DV1L 3VVLA 1NMSA 1CQZA 5GJWC 1WJJA 4G63A 4KQWA 5BMVF 4Q3BA 3WGTA 1SKUA 5LXTF 3Q7QA 3M6WA 2B29A 3DHQA 4MAMA 5FCDA 5F3WB 1UNSA 1ZL2A 1GUAA 1UXKA 2PUWA 3DS8A 1FMFA 2OQRA 2B99A 1CUCA 2L0CA 3NP7A 5J9FA 1OD6A 4NQZA 3DXFA 1E3DA 4O4LB 3NHAA 1TTTA 1CY7A 2HTEA 4KK4A 2OHOA 4NDZA 3DZ8A 4XIIA 1CYEA 1APBA 4X65L 2C1EA 2EW1A 3ER6A 5U4QA 3GVPA 4BNLA 3AWIA 1KVRA 3I09A 5TEVA 2AMLA 1U9JA 3MCTA 2PVPA 5ALDA 2AN5A 1QR6A 1B8PA 4YCLA 3NX4A 2KCCA 1ZUNB 1C29B 2EFDB 3W5VA 3BE8A 1ZXLA 2DP4E 3G2IA 3SBXA 3TZBA 4FM9A 2VT7A 4QEKA 4DMLA 4WDRA 2JIPA 2ZB3A 1RI5A 1ZOLA 1HLGA 2CUZA 3EBPA 1QYRA 4WA8A 5I7UA 4OD0A 3OLQA 4RSRA 3FKIG 4RSHA 4FUQA 2GR9A 4D9HA 3NBMA 5CK5A 3N2KA 3AFIA 4OHVA 2G7ZA 5KX5B 3ODPA 2ZE6A 4AI6A 2X6GA 3THWB 2HHHQ 1DDIA 1L4FA 2C4MA 3H8VA 1EZ8A 4ZVQA 4A27A 3AH8A 3L77A 5DEOA 2MSDB 3QIVA 5CURA 1YB7A 1O5OA 1K3RA 5C0XH 2FETA 3HA5A 5HOQA 1K2VN 5B3JC 4H16A 4Q03A 5CB4B 2HUGA 1E2EA 1MJHA 2ZI7A 3IIMA 5EJEA 5KNLA 1T0UA 2JIBA 2JIDA 5FTWA 1BEUB 2ST1A 3PEFA 4QELA 1EUCB 1SB9A 4YJFA 2E8GA 9ABPA 2PD6A 3P0EA 4W7HA 2DB3A 3I8OA 4GI3A 2PTRA 2DX7A 2FPGA 3SZMA 4GPEA 4AAYA 1YF3A 3DV9A 1JIXA 3OUZA 3HBJA 1GLVA 1LVGA 1N34B 1IH8A 2QX7A 4D5EA 1H9RA 3NWSA 3M4PA 4W9RA 3E5NA 5JSZA 2AV6A 3SEBA 3GLSA 3KKOA 1VHWA 1D6EC 4AROA 3O0DA 2W2KA 1RTKA 1FTNA 1YXMA 5AVWA 5JRJA 4P7GA 4Y9RA 4M1KA 5K0GA 2RD2A 1BDOA 1LA2A 2D62A 4BLSA 3JZMA 3GQVA 1TJ7A 3K5HA 4X62L 3L01A 4CKCA 4BFSA 3A55A 3FPAA 2P91A 4YJHA 2I6UA 5IXSA 1ZH8A 2JLCA 3A6LA 4KJNA 1UOPA 1LT6D 1OFUA 3AHFA 1B9NA 5U4XA 2O19A 4ZVNA 4H6WA 2O5IC 4J7UA 2JFXA 2WJYA 2GBPA 3UW1A 4KFUA 3AVVA 2PSFA 1MIOB 4FINA 4G7ZC 4J0QA 3HCBA 5SZHB 3ESDA 2N8NA 3FMGA 1PTOC 4ARBA 3TUZC 5LZ8A 2Q50A 3TQSA 2P35A 4EHNA 4TROA 3C43A 5C2JB 5BR8B 3KM0A 2XIQA 5BWMA 3A6ZA 4B6RA 2NT3A 1WDTA 1XUOA 2NXJA 3DMPA 1GRNA 2JLAA 3K1YA 3OU6A 2J9RA 5H59A 5HKKD 3U9SA 2XRMA 4X6YA 5K3AA 4D96A 1M1YA 2B7BA 4XLZA 3EPLA 5JASA 4A26A 2I1LA 3UH1A 4PHGA 4MV4A 4TMYA 4WZZA 4P38A 4YRMA 4A36A 3VYWA 1Y8QA 4JBJA 3IC5A 5JAQA 3UMMA 2QAGC 3S1SA 3SYRA 4DNPA 1HTBA 2PMFA 4QBKA 3AUFA 3CRLC 3JQAB 3OX3A 4JGIA 5G0WA 2JFHA 3EASA 4NMLA 2Y1EA 1JLLA 3OIUA 5ENVA 3RRYA 1CS4C 2V58A 3WNCA 4QGBA 4EMTA 2OFFA 3S2SA 3C8UA 5DNYB 1I6VC 4GEKA 2OYCA 3RSLA 1Q15A 4RJTA 4K5VA 4CMHA 1JCKB 1JHQA 1WCYA 1KEEA 4V24A 2PUDA 1N32B 1MFPA 2I1QA 4NZ9A 4LF4L 1FNCA 1MLDA 1FMJA 1KMHA 1WMAA 3GLRA 1M34A 1X92A 2BMEA 4ENSA 5BW8A 3GA7A 2CYBA 5I9NA 4YJ2A 4UC0A 4R2HA 1MTZA 4WLOA 1JA9A 2AMJA 3ABQB 2VHUA 4KE6A 5IMBA 4BUJA 4OHWA 5A2GA 1UH5A 1WE2A 3NTHA 3AY0A 4HJ7A 1T8SA 1EQ2A 4RK4A 2TSSA 3I4MH 5AFWA 3EZLA 1NSTA 1PN3A 1ZH6A 2WJHA 1R7RA 4NU8X 3SP1A 5D01A 4G0WA 3SSOA 1HE2A 4J94A 4L63B 1MAUA 3Q12A 2OZLA 1YHBA 3EJWA 4QBTA 1U1DA 2QRUA 5GONB 2E3JA 3GLVA 4US2R 4P4NA 4ZAIA 1Z0IA 2AGVA 2V7XA 2YJ3A 4BY7G 2ALYB 1KSJA 2H2GA 2XUAA 1F2MA 3FAZA 3TREA 3IHKA 3PXAA 3ZIAA 4AG5A 2DHEA 2PX3A 3CPHA 3EPPA 2ONKA 3ZCUA 3T1OA 4HT3B 2OBYA 5KBYA 3LLSA 1GT6A 1K8QA 3AHIA 3PQ5A 2WD9A 2P2GA 3SSAA 5JO0A 3KQMA 2OHVA 3MMZA 4J8PA 3T5AA 3VDYA 1P7ZA 4OIFA 2CV0A 4HD8A 4PTYA 4QPPA 4JCCA 3K70B 2ZYWX 1JQDA 1EFWA 2VSNA 4XSVA 1PR3A 3RN5A 4F21A 3EFBA 2B2TC 3NTOA 5ICFA 5I45A 1KTVA 3T1TA 2PX0A 4FXOA 4YO7A 3ZWWA 4D8TA 1SUWA 4J0IA 4ZVMA 5KWSA 5L53A 5H8WA 1U5BB 2JI9A 3D2LA 3K0SA 1G21E 1T8TA 4R3UC 1ZK0A 5TGTA 5D3DA 2VHYA 1ATZA 4NFLA 3FDIA 1K8GA 1YIDA 3M9LA 4C7BA 4YP7A 2PO7A 2RIPA 3IHLA 1ISSA 1Z8DA 2PS1A 4MUHA 4TKMA 4ZO4A 2XXBA 2ACEA 1QV7A 2GM4A 2VSQA 1GOTA 4JU9A 1U8TA 4G5HA