1U0LA

Crystal structure of yjeq from thermotoga maritima
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
291
structure length
278
Chain Sequence
LRRRGIVVSFHSNMVTVEDEETGERILCKLRGKFRLQNLKIYVGDRVEYTPDETGSGVIENVLHRKNLLTKPHVANVDQVILVVTVKMPETSTYIIDKFLVLAEKNELETVMVINKMDLYDEDDLRKVRELEEIYSGLYPIVKTSAKTGMGIEELKEYLKGKISTMAGLSGVGKSSLLNAINPGLKLRTTTTAQLLKFDFGGYVVDTPGFANLEINDIEPEELKHYFKEFGDKQCFFSDCNHVDEPECGVKEAVENGEIAESRYENYVKMFYELLGRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of YjeQ from Thermotoga maritima contains a circularly permuted GTPase domain
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Probable GTPase engC
total genus 79
structure length 278
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 3.6.1.-:
pdb deposition date 2004-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03193 RsgA_GTPase RsgA GTPase
A PF16745 RsgA_N RsgA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.50 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Probable gtpase engc; domain 3 1u0lA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1u0lA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u0lA02
2KBNA 3EC2A 3T35A 1G17A 3J81j 3QF7A 1LM0A 4P3YA 1L7VC 2ZI7A 1SULA 1YZTA 4TYYA 2IT1A 1C7YA 3B5JA 2R62A 1J90A 1GILA 3VHXA 2F55A 4TSFA 5GJCA 5IY0A 3KLWA 1VCNA 3EZ7A 4OHWA 4HIOA 5SZJA 4KVAA 3NENA 3Q7PA 3RS0A 4D25A 4DR4L 2K5HA 3BZKA 1ZM3A 1RL2A 2GHIA 1OH6A 3LBNA 3NHAA 4A3MH 1Q12A 4KFUA 4A3GG 3S1RH 4B2IA 4IEEA 2EIFA 1EWIA 2DFNA 4C0BA 4ESHA 4ZV4A 1YQTA 1XCPA 2C99A 2VRWA 2PMDA 4NCJA 3S2HH 4EIWA 4ZKDA 3DEFA 4A4DA 1OIVA 5TB5A 2UUCQ 2OCYC 3S1AA 1W2GA 2A5DA 5FOTA 2VIIA 2ATXA 2ZJ2A 2NPFA 3TGPA 4TMVA 1QHIA 2BA1A 2WWGA 3CB4A 1QDEA 3THWB 1XJQA 2AN9A 3BFVA 4PHFA 1BS1A 2O0HA 3X2SA 3F3YA 4B2PA 1TWCH 2X2FA 4RZXA 4A3DH 1K3RA 2BBTA 2DPXA 4RD1A 2HYDA 4TMKA 2E9SA 3UXMA 3U4QB 4Q5IA 4TQ9A 2QMOA 4QGHA 4BZQA 1E9SA 4A4IA 2GA8A 4PQFA 5KU1A 5TARA 4YMTA 4PO9A 1PH6A 4JLNA 5AJVB 3HOWH 1R7RA 1SHZA 3QVVA 4I1VA 4L9WA 1XMSA 2AXPA 1N36Q 3VR1A 4MGYR 4C3ZA 1VG9B 3A8TA 1PH1A 1EX7A 3AV0B 1TL7C 5AJ3L 3ZZTA 2XGJA 2RKOA 3K0EA 2YYZA 5C4JH 1W4RA 2F1HA 2VQFQ 5TMPA 3WYGA 5GROA 3UMRA 1NKTA 4BFWA 2VUMH 1KHIA 2L15A 2RAPA 1JEEA 1LY1A 3A6PC 3GTKH 3BB3A 4UJ3A 2ZSBA 2O8FA 3IPXA 2O8FB 1PH2A 1XNQQ 4DB4A 1WCMH 1KMQA 2CL0X 2HLDD 2RGCA 2HDNB 2J0UB 3KDFA 2G6BA 1AK2A 2CJWA 4LBYA 2AWNA 1UDXA 4OX9L 2O8BB 2IF0A 1S3OA 3K7UC 5M3FH 1N2CE 1VKJA 2JLXA 4W5JA 1KNQA 1GKHA 2QT0A 3AVUA 2ZQ5A 2B63G 1K5GA 1QVAA 4DLVA 5HY6A 1OIXA 1RZ3A 3EX7C 2DWOA 5ELXA 3E9IA 4IDQA 3EN2A 1NLZA 2QZ4A 1KL9A 1R6BX 1RYHA 3FGNA 4KVGA 1ASYA 3FKQA 4HIMA 4KSCA 1EUJA 2VO1A 3PITA 2MQHA 1WXQA 4JSTA 1IN8A 2QAJA 4OKSA 1IBKQ 2ZTCA 1J5EL 2QP9X 1XRJA 4HLUC 1X8KA 1UE5A 1J2JA 4BA2I 2ZJZA 2GCOA 4LYFA 3I4MG 1CBUA 1Q1BA 3SQXA 1QG2A 4AD8A 4JKIA 2J1LA 2RGBA 4Q9HA 4BEBA 2A9KA 2QGZA 4M2LA 5A4JA 5IRCD 2Z4SA 4TZ0A 3LX5A 2NZOA 2AKWB 4Z1MA 3FHOA 3GLIB 2AK3A 2A1AA 1QHGA 3UE1A 1IY0A 1ZP6A 2FU5C 4PO8A 1NMYA 1QHYA 1N6HA 2RGEA 2BHRA 3QKSA 2HF9A 4P0TA 4IXMA 3WRYC 2RF4A 4AI6A 2UZ3A 3O8RA 4HB3A 1TTTA 1VQHA 2F43A 3C14C 3AVPA 2EXDA 4LF9L 3UMFA 3BC1A 4EKDA 5C0XI 4JI0L 1OV4A 1S0UA 1ONBA 3GFOA 2OLKA 4X64L 3RN2A 4KFRA 3SJCA 4P4TA 3KOJA 4I99A 3F8TA 5JRJA 1EFWA 3OIVA 2PNHA 4PANA 1Z47A 1HQCA 4TYWA 1XDBA 2HIXA 1Q82C 2PBRA 3IIJA 4A1FA 3I2ZA 2WKRA 3MWYW 4PFSA 2QSYA 2HT6A 121PA 1VYUA 2LKDA 3NBYC 3RVBA 4DIEA 4R4IA 2EWWA 4IXNA 1TU3A 2QT1A 5LB2A 2XXAA 3TW8B 3M4PA 3NTUA 3DKPA 1ZM9A 1UKZA 4ALPA 4JZKA 4LJ9A 4A3KH 2ZTSA 5C18A 4O3MA 1G5PA 2C95A 3Q5EA 4WXPA 5L8VA 2D2FA 1JJ2A 4DCTA 2JASA 4GOPC 4K46A 3K9LA 4WA7A 4AIIA 1KD1C 4TSFD 3PO2G 4DV5Q 4Q1FA 2XZOA 3OIWA 1X3SA 1G19A 3J81c 3U60B 4KODA 4IW3B 4HLQB 5M3MG 2YJTD 1WI5A 5E7IA 3HU2A 1XTRA 3L0IB 4GOKA 1V5WA 4E03A 1AZSC 2GEDA 2QRZA 1GKYA 3JZAA 4JLDA 4B76A 4DR1Q 2XNDA 3JAMc 2AD5A 1PH8A 4QG7A 3CCRA 4RZUA 4QGGA 1P9NA 3W90A 3UG7A 1QUQB 5E7JA 5KUTA 5AK0A 2AHOA 4EJSC 1QHXA 1HE1C 1SXJA 3CUEF 3VTKA 3KJGA 3GEHA 1Z06A 2IUSA 1KQSA 1X86B 1SKYE 3ASZA 2KENA 4Q4HB 4BRWA 4ZCMA 3VR5A 3U6KA 3TRFA 4HJ8A 4F7WA 1DO0A 4PZLA 3O47A 4ZI3A 1P3JA 2VF8A 1Z6TA 3KJIA 2AKAB 2DYKA 3RRNA 3ZYCA 1XD2A 1XD2B 3I4NG 2ODWA 4KCGA 4DKAC 3GJ7A 4MYHA 3QPVA 1G4UR 2FN4A 2R7FA 3IRBA 3HOXG 3LW8A 4M1YA 4L5RC 3J81i 5EXSA 1TX4B 1EFRD 1N6OA 2GF9A 1SRUA 2OQKA 3RS7A 2J0QA 1FNNA 3VAAA 1FL9A 4AYXA 2NG1A 4PQYA 1CKOA 4LHVA 2P5TB 2UUCL 4BLSA 1E2HA 2N78A 4M9QA 5FUWA 1LUZA 5A5GA 1OFIA 3LXXA 3EPLA 5EUQB 3T1YL 4V0MA 2NOAA 3QJYA 2QL6A 3OFND 3BAFA 2Y8EA 4Q19A 4UXHA 2RGNA 4YLGA 1N6NA 2GESA 2I3BA 4IVQA 4JI2L 3OEHA 4H1VA 2BV3A 1G7RA 3TE6A 1SVIA 3L7ZC 2I1VB 4O0MA 3RNLA 4DHEA 1OW3B 1NTGA 4FCTA 4KHPL 4LWZA 4QJ3A 4C0AC 2KI5A 2ZTDA 4BLQA 5ELOA 3OE7A 2HCJB 1X6VA 3K09A 4KYIB 2CKZB 4OJQA 4RFSB 1W0KA 3OEHD 1SGWA 2C98A 1UE6A 4LFCL 1N36L 1VCMA 4QNMA 4YMWA 1BOFA 1DAGA 2XX3A 4EQ6B 4ZDIA 3OF5A 2ZJAA 4YMUA 3HU1A 5JWHA 2GVDC 2NVQH 2GZHA 1JR3E 4YDSA 2ZI4A 4Q1DA 4UNNA 4IFDJ 2Q2UA 1RIFA 3IEUA 1E9FA 2WKQA 4HAWA 1RC8A 4URUR 1HR0W 5FUYA 1VQMA 4XVQA 4HYYA 3VKWA 4B32A 2UXBL 1PH5A 3QEOA 5A0FA 3VHLB 1GNRA 4A3BH 4JLOA 4MYCA 2GNOA 3WMGA 1UAAA 1Z0AA 3RN5A 1B70B 4B2LA 3CRVA 4B3SL 1X1SA 1TMKA 3KXIA 5JWRA 2R6CA 2JLYA 3QI2A 4AIMA 4OX9Q 2VPPA 5IT9c 2OG2A 4MGKR 3WYAA 1XZQA 1RRPA 2I1QA 3NXSA 5H8WA 1NSFA 5HTKA 3HOYG 3LVRE 1D9XA 3IILA 3OIUA 4BY1G 1C0AA 1EFHA 4PQRA 2UUAL 4YWMA 1RJ9A 3QKTA 4JLJA 1GITA 5FPSA 2YKGA 2ASBA 2BH2A 4TL9A 2JA5G 3AF4A 1E2PA 4ITRC 4WIAA 2W6JD 4A8JC 4EPYA 1SKYB 1DADA 2FSFA 5JLJA 1E4YA 2R7ZH 2J46A 5IP7H 5BQ5A 4IPGA 4LF7Q 3THYB 3S16H 3FP9A 2QPAA 5DISB 2REXB 1W44A 2ALYB 5IE8A 4JI6L 2GJAA 4Q7JB 2WWYA 1G64A 1N0WA 2D7DA 3SFZA 3EIQA 1NN1A 3D7MA 3I61A 3RLNA 3GTMH 2H8KA 2JA7H 2QGNA 4WOPA 1Q0UA 3OEED 4GN4B 1G1MA 1JE5A 4X66L 1D8TA 1T3LA 1TQDA 2O8EA 2XOKA 3QBTA 2CHVA 1DTSA 3KJHA 1ZD8A 2LWIA 4GZLA 4H1UA 4PHGA 2BJVA 1JJCB 1QZHA 4GKJQ 2ZVQX 3U4VA 1FP7A 4ZCIA 3J80i 3FHWA 1UBGA 2PL3A 4A75A 3LVQE 4PC1A 5IP9G 4EQ6A 3I92A 4UNRA 5J4KA 2QBYA 1E2FA 4V0ME 3VR3A 2R44A 4BY7H 5CK5A 3BFXA 4YHHL 4GNXC 1QZXA 4JI4L 1JALA 4US0R 2EFGA 5JWOA 2FGJA 3AFPA 3RNUA 2UXDQ 3B60A 1L1OC 2NVXH 4LF8L 3BGWA 1GNQA 2ZRJA 1CEEA 3BE4A 4QJFA 1R10A 5CIWA 3AP2A 2JK8A 5IHPA 1MKHA 4TQAA 4XD7A 2R7ZG 3S1AB 2UKDA 3WBKA 5LMUL 2ATVA 1PHJA 4Z51A 2A78A 4DCVA 4N3NA 1U8YA 4POGA 3AF2A 2OTLA 2ORWA 4G5RA 1FQJA 2XEXA 3H84A 2WV9A 3IIMA 4TMXA 1UE1A 1UFQA 3HR7A 3CO5A 1W4BA 4XTRA 4ZKEA 4KAXA 4AQYL 2R7DA 1M6NA 2AFHE 2FA9A 2R6GA 4MITA 3CX7A 1KJYA 3B13B 3KFXA 3LWNA 1HE8B 4JJZA 4QXAA 1I50H 4A3CG 2O52A 1T9HA 4IOMA 4DV5L 1AZTA 3FB4A 1KDPA 1XX6A 4JI2Q 2IS4A 2K5NA 3IHLA 1R0XA 1N5JA 4URWR 3V4RA 1JPJA 1KKMA 2ZRKA 2DFKB 2WICA 4JLPA 1EWRA 3AVVA 2J0VA 4LGMA 4U7DA 4IDHA 2K4KA 1X1RA 2IUTA 1OFUX 1C9OA 2ZAMA 1KNXA 1T91A 2JA6G 4DR2Q 3DOFA 2HHHL 1LNZA 4QL3A 2ZSDA 2V1CC 5BR8Q 2V7QA 3GJ0A 4UNPA 4BGDA 1E24A 2WAYA 2R6FA 1KJZA 3KFUA 4DLZA 3HYTA 3KQNA 1OXVA 3ULJA 2AHOB 3HKZE 4DCNA 2ZI3A 4Q4AB 1QVFA 4DK3C 2B29A 4HUQB 5HCNA 1SQ5A 3WYFA 4XVUA 2QA4A 1HQYE 2PT5A 5C4XH 1PH9A 1PLJA 1R0YA 4LRWA 3EPJA 2LKCA 3SYLA 1MKYA 3LFUA 4JCVE 3TAUA 3QY0A 2UVQA 3HOUG 2CJWB 3JZMA 4FMCF 4DV2L 1IJFA 2R92H 1I94L 3RWOA 1JXOA 4Z8XA 2ZS8A 4B3SQ 1WA5A 1NJFA 1VIYA 3NC0C 2HXYA 3KKMA 3X1ZA 3ULLA 2IUUA 3OAAD 4BPBA 3UATA 1U90A 1GL7A 1JT8A 2Q9BA 2WJIA 5LMNL 1ZM2A 2VQSA 1FQKA 5EUMA 2CE2X 2ZJPA 1R0WA 1WF3A 4XJXA 3T1OA 4TYNA 1M34E 2P6NA 1F48A 3ASYA 3DHWC 1CXZA 4KYUA 4LFAQ 4R4TA 3SQWA 3CR8A 3THXB 1XB2A 3NWJA 3RS3A 2N1BA 4HAZA 1KGDA 2H92A 2EQBA 1JJVA 2OCBA 4JKYA 4A8JB 2MMGA 3GTOH 5DYGA 4ARZB 4DEXA 3O8BA 3GLIA 5KTYA 1N6PA 2IXEA 4M1TA 2ZJBA 4PHTA 3E5HA 2BMDA 4HI0E 4GPTA 4CEIA 3SNHA 4RD2A 3ZJYC 5AJXA 4B34A 2JJ1D 1IN6A 2CCKA 1K5DA 5SZHB 2RHQB 3GEEA 1N6KA 2VBCA 1Q3HA 1SVWA 1YZKA 4A3JH 2ZSFA 4DPGA 1E2JA 5FJ8G 1IL2A 1ZC3A 1G18A 3KUCA 3RWMB 1KI6A 3SU8A 4ACBA 5J47A 4PZ6A 1Z6GA 4Q03A 3FHTA 1G6HA 2YOHA 3PUWA 2XITA 2PQAB 3QG1A 5AUQA 4ASUD 2ZJOA 3HOZH 2Z6KA 1S3GA 3EIVA 4NCNA 1DAIA 2QE7A 2V54A 4AG5A 2V8OA 5AUNB 3M4OH 2CK3D 2ZU0C 3KDFB 1MRNA 3M3YH 1Z83A 1TF2A 2OE2A 2J7PD 2RHMA 4W7SA 3AVYA 4QHYA 1DAHA 4Q9LA 4Y7NH 3FKIG 1Q21A 4BFVA 4LF8Q 1AQYA 3KJEA 3QUSA 2J7KA 1KO5A 3SOPA 1MABB 5JEAG 1L2FA 3EARA 4ON9A 1L1OB 3X1XA 3JVVA 2CXXA 1MR3F 3V4FA 4ZIRB 1UPTA 4A2QA 1NMGA 4IVRA 3A0JA 3PUZA 1WFQA 1DAFA 1XTKA 3V00A 2QU8A 1E1QD 2YNMA 3IO5A 5LD2C 1RIPA 4X8OA 1SXJD 3THXA 5CDFA 3CPWA 1XD8A 2V6JA 4GLXA 2VHCA 3CNOA 3X1WA 1Y1WG 2IC5A 4F92B 1TUEA 2CWAA 1QVRA 3FFAA 4NBSA 4O25A 4LV6A 1S3SA 4A3FG 3SEAA 3SHWA 4DSTA 2NGRA 5JEDA 2GK7A 1OB5A 1QHHA 2OTJA 3K0CA 1LYLA 4A3CH 3GCGA 1XBTA 4BFXA 1Z6XA 2ZE6A 2WSSA 3QPUA 3QXXA 3W6PA 3M1IA 1E94E 1MH1A 2HHHQ 1AN0A 4KHPQ 5BN5A 4DR5Q 2IHEA 4B33A 2OXCA 2VYFA 2W2TA 3TSOA 4AWXA 2MFIA 4UP9A 2FWRA 1N34L 3A37A 1TWFH 3K70C 2GK6A 1UE7A 3A4MA 5CM9C 4RG1A 1KJWA 1KSJA 4LJ7A 4R7ZA 4C2UA 1NE3A 2IX0A 4GDFA 5F3WB 1OXXK 1S9HA 4LC1A 4JI8Q 4F38A 3OFNA 1X3EA 3AFQA 1TWGH 2FJUA 1CULC 1R8SA 3AVOA 3R9IA 3ZIAA 3ZD7A 2H57A 1TQ2A 4DWJA 2VNUD 5FPKA 1W0KD 1AGPA 4DR4Q 1YZUA 4MGZR 3H0GG 2ZUCA 4WW0A 1LS1A 2CE7A 4C0QC 4UP8A 1EGAA 1ZUHA 1Q8KA 1OHHA 4DUGD 3VMFA 5IYBG 4QGUA 2MMCA 1FUKA 4HJ5A 1J70A 4BECA 2QY9A 1LFDB 3CX8A 4JBWA 2BBWA 1NG9A 4L5TA 2WJJA 4GMXA 2ZRNA 2H5XA 2WWFA 8OHMA 1Q46A 2F1JA 4TL6A 3OZXA 5B2ZA 1VQLA 1FX0A 3A36A 1VQOA 3SGIA 3LA6A 5FOVA 1GIAA 5CM8B 4BFZA 3K0CC 1WCMG 1Q20A 4HLUA 5FTKA 2Z83A 2YOFA 4JVSB 5TXGA 3U3RA 1EIFA 3B6YA 4A3JG 1A5TA 2VSXA 3CMEA 1GFIA 3EWAA 4BLTA 5FI1B 2PCJA 4MUBA 3HDTA 5L3SB 5L3SA 4OO1G 4D2IA 2QNRA 2HYIC 1VQ6A 5JS7A 2FDCA 1IN4A 2Y0SE 4QQBX 1A63A 3U3KA 4RKFA 3K70B 1H8HA 3LAWA 4KHZA 4DSOA 3Q3JB 4C0LA 1S72A 4A82A 1UEIA 3CLVA 5FLMG 4IPDA 4KI0A 1HNZL 2ODEA 1IBML 1XEXB 2W2VA 4B3FX 3UPUA 2V4ZA 5J5CA 5JJLA 1SVSA 4L16A 1NMXA 3U50C 3HFZB 3MRSA 2O8BA 3LQQA 2PI2E 5G3ZA 3TSWA 5TDHA 1Q81C 3U7EB 2G0NA 4GN3B 2YWGA 3EAQA 4F4CA 3ADCA 4MRSA 2GVBA 5BN4A 4DV2Q 1U81A 1XXHA 1QHSA 1AE2A 1GM5A 1F3OA 3W34A 4K0KQ 2H16A 3AH8A 3UE0A 4LPKA 2IHYA 4IHQA 5KNBA 4POAA 2I4IA 2VW9A 1G8FA 2XSZA 4WZAE 4XSGA 1P75A 1YJNA 1E1RA 2VP9A 1CJMA 2RH5A 1E2KA 4TT3D 2ONKA 4JBKA 1DE0A 2AKYA 5C0XG 2V6IA 1VQNA 1UM8A 3LH5A 2IHBA 5KSZA 3SN6A 4HAUA 1LV7A 3WY9A 2WB1E 4LW1A 4TLBA 3AYHB 2W58A 4HB0A 5JJKA 1QG4A 2YOGA 2D2EA 5C4GB 2F52A 1N0UA 4CEJB 2IXGA 1IY1A 1R9TH 2PCLA 2ZE5A 1XJ0A 4DEYA 3O8CA 4E07A 3QEJA 4RFVA 2ZETA 1D6JA 1GRQA 3HYRA 4YCUA 2IEYA 2ZI6A 4ILEA 2FFAA 3RSLA 2JLWA 3ZJYA 1R5BA 4GOPA 5KDOA 5LD2B 1ZD9A 3WP1B 2UUBL 3PV0A 2OCEA 2ZAOA 2W6JA 4NHOA 4B6EA 2B8WA 1CTQA 3P20A 3BRWD 4A0HA 4N1AA 2MNAA 2CVFA 3SBEA 4AYTA 4DDTA 1U94A 3K81C 4M1OA 5FBRB 2HF8A 3RRYA 4D80A 1XPOA 4XWAA 3RS5A 3CCUA 1YZ6A 1E9BA 2FSHA 2YWHA 3CRQA 3UG6A 2VP2A 2UXCQ 4DLWA 4S2EA 1KY2A 1AJEA 1VQ7A 1U98A 3FTQA 2YC2C 1G6PA 1NVXQ 1E7ZA 3KYHC 1XEXA 4OI1A 4DV7L 4G1UC 1GRNA 1SE8A 2J45A 3EG5A 2OFXA 3NEJA 3QF4B 2D3WA 4CRWB 4JI5Q 3TRZA 2EU8A 4M9XA 5EE5B 4JT2A 5D3MA 4GLAC 2WJYA 3GLFB 3TQCA 4BUJA 4AY2A 2E87A 5CB6A 4FWIB 4WZBE 3H86A 3ZS9A 1XNQL 4KLZA 1JQJC 1VMAA 3FMPB 3CNLA 4IJHA 5J3BA 3WNBA 3E1SA 3T5DA 4LYJA 4DV4L 3X1YA 3ZQJA 5JS8A 3AP1A 2PMKA 3U61B 3CW2A 2IEZA 3THYA 2IS1A 1G9XA 2FH5B 1DVRA 4DLYA 1OF1A 1G3IA 1XCMA 3VKHA 1E79A 4XIGS 1Q3TA 3NEYA 4GRAA 3KZ1E 1NY5A 1I4DD 2ZJYA 4HDQB 1GNPA 4OK5A 3GTPH 2B7CA 3C4JA 4ZO4A 3J7ZC 2OV2A 3CRRA 3ZZUA 1WBBA 1Q7YC 3S15H 2IYXA 4IEIA 1M1KC 4B44A 1KO4A 3ND9A 4MQBA 3UKDA 4D4LA 4HLDA 4A3GH 5AUPB 2X2EA 3U44A 3CZPA 3W1BA 3I56A 2DFTA 2OEPA 2PLRA 4WZ6A 2ZR0A 4Y0VA 3TR5A 4US2R 1CKNA 1G8HA 1Z0FA 1HH4A 3GLGA 5HE8A 1BMFD 3VR2A 4UP7A 5DHFA 3P4XA 5EP4A 4LJ8A 3A74A 4MRVA 4A8JA 4ARZA 4BFYA 4YWLA 2HEIA 4C30A 2EYQA 1NL3A 5FOXA 1KI2A 4P72A 2B3GA 1BKBA 4EFLA 5EJEA 4DR3Q 5H68A 4AC9A 3GLIE 1G291 1VQAA 1VS0A 2RGAA 4II7A 3UDXA 4BFUA 2JA6H 1E2MA 1T8UA 2ZXUA 5BW8A 3A5ZB 3FDIA 4WAUA 5FBVB 2KBFA 2BKUA 4GMDA 4KO8A 1VHTA 5M5YH 3FHCB 3P27A 4ABYA 3KJPA 1P2UA 4DDVA 4G0NA 1T5LA 3FKSA 4C2TA 3PUVA 2ZR7A 1F2UA 3BH0A 3UK6A 1V43A 2PJZA 5B30A 3B1VA 1DARA 5DGXA 4GS3A 1E98A 3QKRA 4CGZA 3QQ5A 2DUDA 1TEXA 4HDOB 4NYMQ 1Y1VG 1SZPA 2QSZA 4AG6A 2FGKA 5KYKA 1GRRA 2VHUA 5DN6A 4WJ3M 3QXHA 1KI7A 4GBMA 4DKXA 3FYHA 5EZ5A 2XZPA 1G3UA 4LK2A 4UQOA 4NYMR 2WP8J 3U3OA 1XMQL 1P62B 2LXKA 3SHFA 1FX0B 2EFHB 1TWAH 3EZFA 2XZLA 3QG5A 1T5IA 1RRCA 4OHVA 4DB2A 3PEWA 2KCMA 4BXXH 4H9GA 1KDTA 1HZBA 1FZQA 4MKFA 1V1QA 3OESA 5B58C 2V9PA 4Q4LA 4BEJA 5KSYA 2D0PA 4DC9A 2H7VA 1A8VA 4GNXB 1Z0DA 2XSZD 2KHJA 4LF5Q 1KAGA 2J41A 4D6PA 1VQ8A 3O8DA 5JRZA 4M53A 3CRW1 2N49A 4URZR 2CWPA 2WSMA 3IDQA 4A2PA 1KZ7B 1Y1WH 1VQKA 5GAEC 2I0QA 1HJPA 3QF4A 5LPNA 2ZJRA 2P5SA 1UBFA 3N70A 2X19A 3GPLA 4XWKA 4V0NA 3TW4A 5CDFE 2RMKA 3KF6B 2GXUA 2WOJA 4PR0A 1IHUA 3SJBA 4B75A 4CT4B 3CW2C 3W5OA 1AKYA 3G4SA 1A4RA 1T0HB 3ICEA 4TLEA 1L1OA 5TV2A 4YXWA 2QM8A 5D3QA 2XJ9A 2GJ8A 3CF5A 1NI3A 1IQPA 2BOVA 3F2BA 4MYUA 2BMJA 2YWFA 5K8UA 2D7CA 5C0XJ 2JJ2D 1E9EA 4A3BG 2QMEA 4MRPA 3RLFA 1HNXL 5FL7D 2B92A 3C16C 2J59A 2R93G 2VQEL 3QIAA 1LW7A 4U00A 1GVNB 1KI6B 1QHNA 3W9YA 2GDJA 4NXML 4B3TL 1KI9A 4GP6A 1P60A 4OYHA 5EE9A 5UKDA 4HZIA 4Y52H 5CJPA 2BWJA 2IYLD 2UUBQ 4RCYA 3BD9A 2X77A 1HNWQ 5LBIA 5KPDA 1E1RD 5GJWC 4JLMA 3R9WA 4JBMA 2R9VA 2BIFA 3KTAA 5KDLA 3OW2A 1YBYA 4DV3Q 5LDDC 2C96A 3TMKA 1F2TB 1Z08A 1M7GA 4NL4H 4V0OA 4HEJA 3RHFA 3R8FA 4Z54A 5C44H 2Q3MA 3LLUA 2XNDD 2WJHA 3N2EA 4HJAA 1YNXA 1U0JA 2IYSA 4LJ5A 5GVSA 3FFBA 1JB1A 3PIPA 3AVXA 1FOEB 2HCBA 5BYJA 3GJ3A 4EFMA 4DDUA 4BA1I 1TF5A 1OH8A 3CH4B 4DUYQ 3T1QA 1XTIA 3DO6A 3ZD6A 3GDEA 4NKRA 5J4HA 2QAGC 1I4LD 1VG8A 4YHHQ 1YZNA 4OXPA 5DNYB 1NVVQ 4YY3L 3GFPA 2D0OA 5GVRA 1JNYA 4DLXA 3HWSA 2G9NA 1WBDA 2WIBA 2P0EA 4U5XA 5GJVC 2Z0SA 1JR3D 4PPFA 2NO0A 2UXBQ 3GLHA 4JBYA 4NCKA 2A5GA 4JI0Q 3PIRA 4E22A 3MGCA 3T1TA 4P4UA 4LOAA 5JEAJ 5IYDG 5FTMA 1G8GA 1ZAKA 4QC2A 2X1VA 3R7WA 4JOIA 3A1UA 3IO3A 3IBGA 4DR6L 2C78A 4APVA 2EQSA 2EW1A 1AKEA 2GAAA 4OQLA 1UADA 1T3SA 3CONA 5IDVA 4RZ3A 2A8VA 4LUVA 3G71A 3HJNA 2CBZA 4Q00A 3SYKA 2ES2A 1VQDA 1IM2A 1ZD1A 2XNSA 1Y1VH 1XMQQ 1W2HA 3K9HA 4WXRA 4UNQA 1KC8C 521PA 1QHHB 5IYBH 3SE0A 4W9MC 4AK9A 1R4AA 4LJYA 1JB7A 4BBSH 3OHMA 3LX8A 3PENA 2P6RA 4G01B 2Z0MA 3H3VH 2NVTH 4PZ7A 2QM7A 1PLLA 4FMDB 3WXMA 3CC4A 1CKNB 5IT5A 2WTUA 4L9SA 2Q3FA 3C7KA 4AH6A 2GAOA 4A3IG 1SHKA 2GJSA 2G83A 3LRPA 3L82B 4GKKL 4OHXA 5K8IA 1KI3A 4A6PA 4EPWA 2QTHA 1Q86C 3S17H 1BKDR 1KK0A 3GO5A 1CR1A 2BC9A 2QPTA 2XTZA 4YWKA 3K0FB 1HZ9A 4EAQA 1PH4A 3C5CA 4QNRA 3U7FB 2G88A 2GRJA 2UZIR 1VQFA 4JT4A 4R98A 4M1SA 1SN8A 2V1XA 3HKSA 5M3MH 1JECA 4QKQA 2V55B 2VP6A 3CCEA 1ZU4A 5JI2E 4DV7Q 4DZZA 4DJTA 3DOEA 4TMZA 1U9IC 2C8VA 1UEJA 3LNCA 3NG1A 4A0RA 4DR7Q 4RD0A 4Q1BA 4C0SA 3L2OB 4A3EG 5JEEA 3QXSA 3VR6A 1XZPA 3IBYA 5H1YA 3F5FA 4Q7MB 3PEVA 1FTNA 4HB4A 2HXSA 1S96A 4HIDA 1ZNWA 2WWXA 3BWDD 4GN5A 3NH6A 1NN5A 1VECA 1CS4C 1N0VC 2JE6I 1Z29A 4JOIC 4JLBA 3SDZA 5L3VA 2J7PA 3AVWA 4BE7B 4QY7A 3TEHB 2WAXA 4LY6A 1W46A 1ZM7A 4X65Q 1BYIA 2ZU6A 4B3TQ 1YVCA 4OI2A 4DRZA 1TF7A 1Z0KA 3CC2A 4QOSA 5L3QA 4GOXA 4YMVA 3AGPA 2V1UA 4KFSA 1ODFA 2ZVPX 1NSTA 1ETUA 4NYIR 1TAGA 1I2MA 4BBRH 2C04A 1IXZA 2IX3A 1EIYB 4TTPA 3PXGA 3WWVA 1XMIA 2ZRHA 3AKCA 1YVDA 4P4SB 2WOOA 4Q48A 1S1MA 1CUKA 1OKKA 1SVOA 1XFAA 5FR2A 1Z6AA 2HJVA 2O8DA 3KXLA 5EXXA 3CWZA 4JI3Q 1M8PA 3D8BA 5HKKA 4ESVA 1KHTA 3KF6A 4N0DA 3U3JA 3AQQA 4CEHB 1O7IA 2ZANA 1SLJA 4BRUA 1Q22A 1ZJ6A 4Y0AA 2JJ2A 2RGDA 1DG1G 2QMHA 2IYVA 1G51A 1KO8A 3BERA 4D0NA 3UDFA 4MZ9A 2QAGB 3STBD 4JI4Q 2RHSB 1EFCA 2R6AA 1OPXA 1HURA 2Z6VA 2C9YA 2GBLA 3ECCA 1OH7A 4URXR 2F1RA 3G5UA 5G3YA 2G1JA 3U7GA 1R5OA 1PFSA 5DE3A 2P6UA 2VL6A 2KE5A 3ADDA 3B6EA 4JYCA 4JC0A 4DAMA 2QQEA 1KRTA 1AQUA 4TLDA 1AS3A 3QOFA 3KQLA 4LHWA 2MSDB 3U7HB 2A19A 1G7TA 3LBHA 4Q1CA 1L0WA 3LO5A 4NONA 2WJGA 4EPXA 2IS6A 2ZE8A 1ZM4A 2KHIA 1J7KA 1RVDA 2CLDX 2VS1A 1CU1A 1PZNA 1XTSA 1KKLA 2ID0A 1ZCBA 1HNWL 1VQ4A 1ZIOA 4PC7A 5FOSA 2FMXA 1PYSB 4G5QA 2Q2TA 3H0GH 2JCSA 2I5HA 2AWOA 2A2ZA 2C77A 3HOYH 2D74A 3DZ8A 4M21A 5EE3A 2DBYA 3B8HA 1NP6A 2OZEA 2VP4A 3A1TA 1W4CA 5TVKA 3F1ZA 2PT7A 3LW7A 1NVWQ 1V9PA 1CRPA 1Q1QA 2QENA 4QBIA 3EBEA 1CSQA 3L8ZA 4Q9JA 5KSOA 4BBSG 2ODBA 3K1JA 4ZCLA 1UDWA 4HAYA 2OILA 1UJ2A 1B0UA 1NBMA 2OM2A 4LPSA 2JJQA 1H8HD 1FJGL 2BEJA 1FNMA 4LUZA 1FPMA 1N34Q 1M2OB 3KQKA 1KRSA 1KXLA 1XTQA 1H8ED 2FPKA 3PUXA 2YTVA 2X8AA 2I5MX 2OBMA 2GXQA 5G53C 4IVPA 3ZGXA 1XP8A 4CVNA 4JI8L 4YY3Q 2RHDA 1FUUA 3G82C 4K8OA 4IFDG 1X8JA 4PPQA 2YHSA 5JHHB 1T4GA 1MO4A 2NO1A 2GEUA 3NDBB 2O8CA 1I3QH 1U8ZA 5HZHA 2C5LA 3K0AA 2DWQA 2ZRGA 1BVSA 3PJRA 4BLOA 4EJSA 2H1LA 3D3QA 2GJ9A 1P4SA 1M1YE 5DHAA 4LV5B 2LSSA 2W00A 4Q4HA 3CRMA 1M74A 2OCAA 3J80c 3WMFA 2B6HA 4X8LA 1EQQA 2O5VA 2IYRA 2PX0A 4FDBA 4EPRA 1IOZA 4TYPA 1P7CA 4J0QA 5JMTA 1S1CA 4O2DA 1Z2AA 1U99A 4X65L 2ZS9A 4TYQA 3TKLA 2GN5A 2J87A 3ETLA 2B21A 1N33Q 2QQ0A 3CPJB 5G40A 5BXQC 2YZ2A 5JSZB 2QP3A 4MKHA 5CB8A 1J5EQ 4AQYQ 3CM0A 3CF0A 4PO1A 2CL7X 4RKEA 2IYYA 2JEBI 2JDID 4JL6A 4PZZA 3FMIA 3W5IA 1OT3A 2YV5A 2BBOA 3HKZG 3BZCA 5C3EG 1VG0B 3THWA 5F9HA 2QMUA 2WBLC 2N46A 3FE2A 4PAQA 2F3IA 1GKUB 4I81A 4JL5A 1L4UA 1AM4D 1W4AA 3CPEA 3QBVA 4FW9A 2BKEA 1W48A 2KJQA 4OHYA 1E99A 4LUCA 4M0LA 5H70A 1XMOL 3WBJA 4P74A 5HR5A 1UBCA 2FOLA 3KX2A 5DN6D 5AWFC 3FOZA 4C7OA 2OQ0A 4M9ZA 1QBKC 4DUYL 1IAQA 4LZZA 2XOKD 2PMZE 2DGYA 5KOYA 3FMOB 5EE1A 1JI0A 4EPVA 3K8AA 4X64Q 1FTSA 1MO3A 4B3ML 3AKEA 1OJLA 4X62L 4JBJA 5BYKA 5FJ8H 4A3MG 3QKRB 1Y3AA 2EWVA 4OWXB 5DH9A 3ZZ0A 1NBME 2C9CA 4UKDA 1DG3A 4A93H 4IFEA 4QBGB 1YEZA 1SR3A 3TSZA 3ZS8A 3OYYA 1DBSA 4KV9A 5IK2D 5KDDA 5CLLA 821PA 2IYQA 2PLFA 4R9UC 2VF7A 1Z9FA 4DR6Q 3DKVA 1HT2E 1B8AA 4Q4JA 4B3DA 3FPAA 1YHQA 4OL0A 4EQ5A 3ZVRA 5IYDH 5FI0B 5C2JB 1N5IA 1OXSC 3JC66 2FF7A 4LFAL 3CNNA 3MLEA 4AYBG 2ZYTX 1YZGA 1SXJE 2WFWA 2ZSEA 3TR0A 3Q5DA 1YJ5A 5KO2A 2O8DB 4DV6L 5CLQA 3M4YA 2KCTA 2N8NA 3OTOQ 5TY0A 1NLYA 1SMXA 4JYAQ 1KAWA 3E2IA 2FPMA 1RRFA 4HAVA 3K8YA 5KNCA 5ELNA 3PO3G 3U6BA 2REBA 1G6OA 4NCHA 4X8HA 1N5LA 3CMAA 3AF1A 3THOA 3NC1C 4Q21A 1FW6A 3S14H 1E79D 1E9DA 1WYDA 4LJ4A 1YR6A 4NCIA 621PA 2GVAA 3P1JA 4QGAA 3CD6A 1E3MA 1JPNA 2OCPA 4UNSA 5CIQA 3LD9A 4F4JA 5AR1A 1J6QA 1J8YF 2ZRDA 5F2EA 1FMLA 1TUIA 1G7CA 3I5YA 1Y14B 1NNEA 1UBEA 2JEOA 2WPDA 4P31A 3K7AH 2FG5A 3R20A 4TTQA 1W47A 4IDPA 4R4QA 2CHGA 2ZRFA 4L8GA 4TQUS 5DI3A 1I6HH 5FPTA 4A2WA 2HLDA 1NY6A 3KB1A 4GFDA 5DLQC 2AFIE 3GP8A 3A1VA 4JV5Q 1X9NA 4LDJA 1VCIA 3G6EA 4IFDI 2ANBA 3RANA 3U44B 2V3CC 3R9XA 4TZ6A 2VUMG 3L43A 4CT5A 1IN7A 4YDHB 3GTGH 2GF0A 3NDPA 4B73A 4BY7G 3FKSD 4OONA 4XOIA 4IDOA 4MRNA 1D2MA 5JECA 4EPTA 3CCJA 3EPHA 4QL5A 3CQZH 3BIFA 1E32A 4PG3A 1RJ9B 3HOVH 2G3YA 3U4QA 1MIUA 2XAUA 4YONB 1MO5A 3U3MA 4Q1EA 1E2IA 2CMKA 1E2LA 4FXPA 2GZDA 3EZ6A 3N2IA 3RS4A 1BYUA 2Z5FA 1YZLA 5C4MA 3EZ2A 3W3AA 1P2SA 2HQLA 3B1YA 1MRSA 1G3MA 1JAIA 5IP9H 2KWIA 4Z1MD 2F3RA 4D4JA 2F7SA 1Z2CA 2IS2A 3K0SA 3B78A 1N25A 1NVUQ 1RKBA 4PAOA 2FXQA 4PMWA 1A0IA 2FFBA 3I72A 1IBRA 3IQXA 1VHLA 2ANCA 2NO7A 3ND8A 3K9GA 4A9AA 3DPUA 3KUDA 2PZGA 1OFHA 4G5GA 3BJUA 1PA6A 1VIAA 2JIZD 4MTNA 5M3FG 1QUQA 1HUQA 3ZQ6A 3AF3A 2WZQA 5FTLA 5FTJA 3BFKA 5DSZA 1U0LA 3EWSA 4EJSB 4BY1H 4L5QA 1OFTA 1GAJA 3PUYA 3CKLA 4BBRG 1ZIPA 5FUXA 1YI2A 2QRNA 1D2EA 2BH8A 4OK3A 4Q02A 4TLCA 2JLRA 3T15A 3L0PA 4OI0A 3EPKA 3CX6A 5M5XH 5F98A 1L4YA 4GNKA 5C46F 2BMEA 2RB4A 3GLFE 4R4CA 4LJ6A 1AH9A 1CP2A 1XXHB 3AGQA 4JLAA 1IZ6A 3BS4A 2JEAI 3W8NA 4CW7A 1W36C 4JBXA 2BVNA 1N33L 2CNWD 4JMPA 1KO7A 2WMNB 2WB1G 3EW9A 1RE0A 3KB2A 4EFNA 3LQRA 2J9RA 4QJ4A 4QJ5A 2WPDD 2E2IH 2R92G 2O0JA 4P32A 4BLPA 1N6IA 4IPHA 4CYMA 1NMFA 2HT1A 2XTIA 2BCGY 3P4YA 2BCJQ 2TMKA 1N32Q 2Q0HA 3N5CA 4RD4A 1MV5A 4MKIA 4BWYA 1G20E 2CL6X 3P26A 4P33A 3BH7A 2ZRCA 3I4LA 1GL6A 1XWIA 1GD7A 4LFBL 1HT1E 4L15A 5DI9A 2VA8A 4GP7A 2YINC 1KMHB 4M9SA 4RJLA 1QVGA 4LF6Q 3D31A 3MSXA 3MWKA 1K8GA 5K8LA 4URVR 3K80C 2WVJA 3UIEA 1II9A 3PO2H 4N0EA 4PPNA 3TAHA 2F43B 1WJJA 3CCMA 2DCUA 5CJ2A 3HOVG 2REOA 1GVPA 3BXZA 3T34A 3ZVNA 1WB9A 3VKGA 2D4HA 3S1QH 3W6NA 4DR3L 1NLFA 1NN3A 3Q8DA 4JI5L 1COWA 4E5UA 4JI1Q 2NZHA 1Q57A 4NTZA 4PC6A 1XTDA 4BLRA 5E95A 2C35B 2MO1A 4NB3A 2UXDL 1DEKA 4JVLA 5JHGB 4C0JA 3RC3A 4XSHA 1QZGA 3SBDA 3HOXH 1ASZA 1IXRC 4CDGA 4MDEA 2Q2IA 1XNRL 3CIOA 3LY5A 4W5HA 1W36B 1N8RC 4LNQA 4ASUA 3E9HA 1IN5A 2IW3A 3ZDQA 1NJIC 3CF2A 4AYWA 3KTAB 1ZC4A 1OKKD 3GJXC 4UY8C 5D3MB 1FFHA 4TL8A 3A1WA 1DOAA 2ODNA 2F3TA 2FNAA 2HJGA 1KK3A 4KFTA 2Q21A 4PAMA 1JR3A 2W0SA 4BFTA 4B71A 4NPSA 4QHTA 4QGFA 4C2MH 2RGNC 4IOCA 2UUAQ 4OQMA 2OUKA 5EP3A 3ZH9B 1HH2P 2MO0A 4C3JH 3FVQA 3I8SA 4LYHA 1G21E 1VDZA 4OQNA 5FPHA 2IWHA 3FMFA 4B3XA 4DT1B 1G5RA 1W49A 4B3RL 2OBNA 4ZPXA 5DO9A 3TK1A 1G16A 4HATA 4D26A 1DAEA 2RGXA 4FCVA 4LF7L 3ULPA 1EWQA 2WAQE 2KSQA 3HPQA 2JLVA 1XPRA 1P2TA 2FSIA 1JQLB 2DY1A 4JVMA 4E09A 1HR0Q 1X54A 4MNOA 4NXNQ 4LYAA 1NIPA 4YC7A 2OFWA 4A6XA 1M7HA 3B85A 3GEIA 3S1NH 2ZTEA 3DLLA 2ZE7A 3LLMA 3OE7D 4IRUB 1KAOA 1US8A 1E3PA 4FMCB 1K0RA 2C03A 4M1MA 1U9IA 3GLFA 3REGA 1G8PA 4PZYA 4QIWE 1OYWA 2HV8A 1Z22A 3CF6R 4M4SA 4PPGA 4Q4AA 4JYBA 1FGUA 2CLCX 2GCNA 2CNWA 4IOAA 1JXMA 1WRBA 1YRAA 3MXNB 2ZPTX 3QENA 2CQOA 5E4FA 2ZUBA 2UXCL 1W5TA 4IPCA 1SXJB 2A7QA 1N3BA 3CCQA 3R7WB 4A3LH 2J3EA 3MJRA 4RZ2A 1LB1B 2AK2A 3TBKA 4ACAA 5IWAL 4OWWB 4Q66C 1OH5A 2WJVA 3M6AA 3DL0A 4IJMA 1UKYA 3ZIAD 2K75A 3VNVA 3UWOA 1GDDA 4C3IH 1PJRA 4JV5L 4MKGA 2ZM6Q 1E0SA 1OE0A 1OHHD 3DMDA 1TQ6A 2JA5H 2GTPA 4Q9IA 1TWHH 3Q9LA 5EXTA 1VYTA 3NVAA 3AEZA 1MJEA 4B43A 4YXWD 4DV4Q 2VQEQ 4OBEA 5BWMA 2IBMA 3WHLA 4B35A 2IX1A 1JR6A 3DMNA 4YMSA 1W0JA 4GSYA 1J8MF 3VNUA 3RZDH 3MWLA 3EIEA 1IBKL 2E2JH 1SROA 3NBFA 4CEJA 4JG2A 1GSIA 2CEAA 1LTQA 4FD2A 3QSYA 2FX3A 3G0HA 4C0KA 1JAHA 3Q7QA 3PF5A 5J4LA 2JLUA 4IO9A 2XTNA 3RLOA 4GT1A 1E0KA 2K52A 2F4VL 2QN6A 4TVAB 3CCSA 4LF4Q 4DV0L 4GKKQ 2WWWA 2YVUA 3AUYA 3EXAA 4UXJA 2J0SA 1RW4A 2VTKA 4DV6Q 1AGRA 1P61B 3AVQA 4LJAA 1KI8A 1Z07A 4Q47A 2IYWA 2EFDB 1VQPA 2VLIA 3F0TA 2N3SA 2CLSA 1KO1A 2WSSD 4B3CA 3KKNA 4BZPA 4I1UA 4JJKA 4QFMA 1ANKA 2NZ8A 4GOJA 1GO3E 4XVRA 1ESMA 2DB3A 3B1WA 4M1WA 1WMSA 2C2HA 5HPYB 3NHBA 1YR7A 5B57C 1XJVA 1WCV1 3REFA 5GJBA 5AJ3Q 3AP3A 3OAAA 4RCZA 5FR1A 4MH0R 2QROA 2AD1A 2VL7A 4DV1Q 1BBUA 4KBGA 4TT3A 5FL3A 4A76A 3C8UA 1YIJA 3U58A 2P67A 2ONJA 2CK3A 1VQBA 1PUIA 1S9DA 4PHHA 2ZJQA 1KI4A 2BBSA 2JDIA 2QORA 3MMPA 3QNUA 2JA8G 2K14A 4G3XA 4PSAA 5B64A 2D62A 1I4TD 2PZEA 3B1XA 2ZS7A 4TMWA 3A4LA 3KQHA 4ZI2A 1M7BA 4LV8B 2YWEA 3I4OA 1P73A 2QEXA 1II0A 1MJCA 1SVKA 4MUAA 3SS8A 4C9BA 2ZRMA 2IWRA 5CK4A 3ICQB 4JLVA 1X3GA 3HR8A 3I4MH 4LHYA 4HJ7A 1CR4A 1X6OA 2ASEA 5P21A 1ZYUA 1ZMXA 3I32A 5JCZA 2PX3A 2JJ1A 1NIJA 4KITB 3IKJA 1PLKA 3T06B 1O3YA 4IKEA 3MEFA 3M4QA 4D4MA 1VPLA 2VZAA 2QA5A 4OI4A 5FTNA 1GL9B 1EG7A 1E0AA 3GJ8A 2NO6A 3PQCA 4C4PA 3HPRA 2GBLC 1VQIA 4H02A 3KJOA 1COWD 2QEQA 4NXNL 3KXKA 4HZUA 1K73C 3TUZC 2ZM5A 2GXAA 1G41A 4ME3A 1GZSA 3CPFA 3M7NA 1W5SA 2VP0A 1IXSB 3JVUA 1ZVQA 1F2TA 1WP9A 1U8AA 1YJWA 2GETA 5EQTA 1XMJA 4KXFB 4B3GA 4OK6A 4DDWA 3MWJA 3PGZA 3NIBA 1S4QA 5JBQA 2FZLA 3AEVA 3BH6A 4RVCA 5IK2A 1CJTC 3PSIA 3UWKA 5K8TA 1IJEA 4I1OA 3UMSA 4C3HH 2JQOA 3TUIC 3SZRA 5FBQB 3I73A 421PA 1OYYA 1AS2A 1ZINA 2E1RA 4FN5A 3S2DH 4LF9Q 3NBXX 3H2YA 4YQFA 2JGNA 3RSOA 4PC3A 4A92A 4NPHA 4NYJR 1D8LA 3BB4A 3F2DA 1RYFA 3CCVA 4POFA 2W83A 2G77B 4B74A 4GI7A 2K50A 1E9RA 1VQ9A 2KBEA 5GADl 4JLKA 3GTLH 3L0OA 3QXJA 1E9CA 3B82A 2QP4A 1CIPA 2ZI5A 1X3FA 3KKOA 4R1JA 4DLTA 1YHAA 2YTXA 1E1QA 1O87A 3TS0A 2FFQA 3RABA 1ZRHA 2OAP1 2IHFA 3RRMA 4YCVA 4X6AH 3T1HL 1CSPA 2K5VA 3SJZA 3T1YQ 4XD7D 5DLQE 1RRGA 4DT1A 1YHNA 1L2TA 3RYTC 4BASA 2E8GA 2A5JA 3MD0A 1D9ZA 1MOZA 1T0JB 5L3RA 2R8RA 4MGIR 4PXAA 3TNFA 3OEEA 4AKGA 5FLMH 1IONA 5KPJA 3NKVA 3LXRA 1T3HA 1XCGB 1AA9A 5EP2A 3CZQA 5E7MA 3W6OA 4HJ9A 4AYBE 1FJGQ 1F6BA 3NEMA 1HYQA 4IFBA 4Q01A 4TTRA 4BQSA 1XXHE 4URYR 4D0LB 2GKSA 3TLXA 5GAHC 4GNXA 1BMFA 2VP5A 3AB3A 1Z5ZA 4EUNA 4LFBQ 6Q21A 2NMVA 2L0XA 2ZRLA 4G5SA 1UKEA 3BJIC 3K09C 4TLAA 5SZIA 1KK1A 2SHKA 3WMEA 4ERNA 2OO7A 2QBYB 4HUQA 2DHRA 2ERXA 3VFDA 1W0JD 1D2NA 2MSEB 4IOLA 2QI9C 2QTFA 3WHKA 2R65A 4LI0A 1TEVA 5C3EH 4FMBB 2ZJ5A 1C1YA 3BB1A 4UXIA 4HLCA 5FBLB 4ZIRA 4YCWA 4DV1L 3I55A 1ESNA 2FZ4A 2ZYWX 1SKQA 1IY2A 4JI7Q 5M04A 3TH5A 1CR2A 2ERYA 3I5XA 4DCSA 3PEYA 1NJGA 1ZCAA 2B63H 4I4LA 1G7SA 3L2PA 1A2KC 2WWIA 4O2RA 3VU9B 3GLGE 4V0LA 3PCRB 3KL4A 1VYVA 2ZSAA 2ECKA 4DK6C 2IK8A 3NELA 2IYZA 4HDCA 2JA8H 4D81A 1KIXA 2DR3A 2VEDA 3B9PA 3VR4A 1C9KA 3T61A 1YRBA 221PA 1E1TA 1G4AE 1ZUIA 2Q3HA 2QTVB 4S35A 4JI6Q 4AKIA 3GD7A 1CJKC 1NMZA 1JEDA 2J0UA 1GG2A 4BFSA 1Z63A 4B6FA 5G41A 1IBLL 1XPUA 4LF4L 4FIDA 5EAYA 1T6NA 1FVIA 5J4VA 1R2QA 1EFTA 2FEMA 1S2MA 1XEFA 2FE4A 4HSEA 1K8AC 4Q18A 4OQXA 1PH7A 1CRQA 1E2GA 2YC4C 1HZCA 2H17A 1X8LA 2G0TA 2A5YB 1QF9A 1NG1A 4DR1L 1XMOQ 4CIDA 2VH5R 4KBFA 5JSZA 1EX6A 4M8NE 3ZVMA 3IEVA 2JA7G 3R8CA 1N6RA 1SVMA 5FBWB 4B48A 1U2RA 4OWTB 3CAMA 2IA5A 1AS0A 1SVLA 1YU9A 3SC3A 1M90C 1EQRA 5GADC 4MYTA 3QE0A 3PEUA 4LX0A 4LHXA 5H1SE 2Q6TA 4P73A 5GAGC 3A4NA 4CEHA 1B23P 4M22A 5FH9A 3KFVA 4KJZA 1BO6A 3AM1A 3K0XA 2UU9L 5HGQA 1US8B 1E1OA 3Q85A 3EC1A 1OXUA 4R2IA 2PJRA 4NE2A 1E4VA 1KYIA 1K8RA 2G1KA 2GXSA 4MA4A 4QBHA 4DLRA 5C1BA 2O8CB 1DGSA 3PCOB 5FLXc 4J15A 4DR7L 4DXAA 1GWNA 4P4SA 1N9WA 3QKSB 3NBZC 4BZXA 3U5ZB 2ZM6L 1TADA 1BH2A 1YHBA 4G5OA 3M9BA 4D82A 1K9MC 1I5FA 1HEIA 1XTJA 1VQCA 2OBLA 3ERSX 2P2LA 1XEWY 4OO1I 4R4OA 2QG6A 3IQWA 5AUOB 1II8B 2ORIA 1II8A 4HB2A 1PVOA 2D06A 3KKPA 5EXPA 3SR0A 4R71A 2PH1A 3P32A 5K36G 1Z6YA 4PZ8A 2ZRBA 4A3LG 2EFEB 4XH9B 1X56A 2RGGA 2AMCB 1DELA 3ADBA 1OXTA 4KU4A 4B47A 4QRHA 4JYAL 2ZRIA 5JI3E 1KI1A 2HUPA 1C4OA 2F4VQ 2PZFA 1MT0A 1SFOH 4BXXG 2PEYA 2QPOA 4Q1AA 1OLOA 5KSPA 1TXYA 1E9AA 2BJWA 4LC0A 3WP0A 1E22A 4C7OB 1DAKA 1YITA 4FMDF 4WVFA 4NU0A 4P71A 2ZJ8A 1A82A 4KSBA 1OSNA 5KHOC 4JI3L 4A15A 2CDNA 4RSGA 4W5WA 3RR5A 1LF0A 1RPZA 3PR1A 4GKJL 5EE0A 4Z8YA 1GKIA 1I2DA 1KOFA 1E69A 3TREA 2QUZA 2CVHA 3L8YA 2JA9A 3I4NH 5E7NA 3ER0A 3CR7A 3H3VI 2JJ8A 4MDFA 2A3RA 2JLSA 2ZI9A 2R93H 4A3KG 4DLUA 1MABA 3MJHA 5HE9A 4KLKA 3H1TA 1KIMA 3B9QA 3TVTA 1X65A 5J4YA 4FINA 2H18A 5SZKB 3J81k 1HA3A 1PV4A 4TWZA 3HOUH 1EFRA 4A36A 3KQUA 2XB4A 3SYNA 3X1DA 1WQ1R 721PA 1U5KA 1OTCA 1G5TA 2WM9B 4V02A 1JJGA 2IYTA 2NQ2C 3T1VA 1BIFA 2OXRA 3L0SA 1VQGA 2FSGA 2ZITA 4QBFA 4TN1A 3GTQH 2B7BA 1KZGB 3NBHB 4A0FA 1ZNZA 2XTMA 1VCOA 2JIZA 3B7GA 4AURA 1L8QA 4RD3A 1Z0JA 1YKSA 4AKEA 2F9LA 2PI2A 1GUAA 4Q4JB 3RC8A 2WWHA 1VQJA 3A1SA 1E2DA 3TIFA 1UWVA 1CJVC 1CKEA 1NKSA 2BA0A 1WE2A 2OFOA 5CYOA 3H15A 2WAQG 3DDCA 3WNDA 4JVNA 2IF2A 3I62A 1GTVA 2W0MA 2F1IA 4LF5L 2AL7A 1VTKA 3MFYA 1ELOA 5FPYA 4IJLA 1JJ7A 3Q8XB 2YTYA 5HZKA 3WRXC 3IIKA 1R5NA 1P72A 1NBWA 1VG1A 1F60A 2Z43A 2GZAA 1HZAA 2ZIAA 3RRZA 1E2NA 1Z3IX 3STBC 5BN3A 1ZNXA 5M5WH 1W7AA 1B7YB 2FEOA 2Q9AA 3ZLJA 1KY3A 1YR9A 4LFCQ 2ZUDA 3WNCA 4L4UA 2AR7A 3HP1A 3AQ4A 4NDZA 4ZDJA 2E5LL 4JSYA 3LBIA 5AJZA 4LWCA 3D0FA 1XEWX 4HZUB 4A3IH 1KSFX 3VQTA 3SI7A 2CCZA 1A7JA 1IXRA 1NRJB 4FI3C 4V0KA 4JI7L 4TL7A 2NO9A 4X8MA 2I5LX 4US1R 2OESA 5FUVA 3VDYA 3I8XA 3TQYA 3A5UA 1G8YA 3UANA 5HCIA 1ZU5A 2QGQA 4RY2A 1F2UB 1HNXQ 2EFCB 3ADKA 3BU2A 2E2HH 1J99A 4NYIQ 4DBLC 1WDTA 1P5ZB 2IL1A 2BMFA 3FKIH 1T8TA 3EIHA 5J40A 4FCWA 4OHZA 1ZBDA 5LB4A 4NXMQ 2IXFA 5DIFA 4C0HA 2GCPA 3U2QA 2Z4RA 3K0FA 3CXCA 2WIAA 3CC7A 2JAQA 3U4ZA 3C41J 5LMNW 3S1MH 3T1HQ 1XMVA 3D6TB 3GJ4A 3B1ZA 1N32L 3PG5A 2ZR9A 4LUOA 2FPLA 2EVWX 4WJ4A 1XD9A 1EFUA 2JLQA 2NN6G 2WHXA 1U0HC 2ZRAA 1SXJC 4PTLA 5GQOA 4DV3L 3SJAA 4CEIB 3J7A5 1S40A 2OHFA 1HY3A 1KSGA 4OJKA 4L5SA 1Z28A 4PSKA 1Z0IA 1P6XA 2Z6KC 2F6RA 1A62A 1S8FA 3NH9A 4LF6L 3DM5A 1KTVA 2AX4A 4DAYB 1P16A 5AJWA 1H65A 3BBPA 2VSOA 3DZDA 1X55A 4Q7KA 2ZYUX 2GCOB 3MAAC 5HKKD 3EASA 2PQAA 1E2QA 4EX5A 3RS2A 4F91B 4X66Q 2VY3A 3I1FA 1KK2A 2H5EA 3BK7A 1P8LA 4DUZQ 2JLZA 3KKQA 2OAQ1 2VQFL 4OQFA 3DM9B 1PH3A 2R2AA 1K83H 3F2CA 4AKHA 2UU9Q 2GWHA 4XWOA 1H8EA 2BM1A 1CLUA 2NZJA 1XU4A 1UEBA 3GJ5A 3GMTA 4DLSA 1XNRQ 1XF9A 3KF8B 2YU9H 4NH0A 3GLHB 3W1GA 1A1VA 3AKDA 1D7QA 1TPZA 2N42A 3AF0A 3PVSA 4B3MQ 3E70C 1F5NA 4RMFA 3TUJC 4X62Q 2F9MA 1LTLA 3QKUA 2QAGA 3CP0A 3B2EA 5FFMA 5JJIA 1AE3A 1W2BA 3CH5A 2OT3B 2J5XA 1RFLA 3MCAA 5LMUQ 1FMJA 3UDGA 4O0AA 1MO6A 2IY5B 1Q44A 2RCNA 2VSFA 1A2BA 2MSCB 4IDNA 3PF4A 1E6CA 4A93G 3I3SR 3TQFA 2GJKA 4PX9A 3TJZA 2FV8A 1LF5A 4V03A 3MUFA 2O8EB 1UF9A 2VHTA 2CFMA 4D0GA 2GEVA 3CPHA 3RZOH 3GQBA 1NN0A 3LDAA 1IBLQ 1PUJA 2GILA 3S24A 3GLGB 1AIPA 1XNJA 2NIPA 3EA5A 4RD6A 4HIKA 4L5BA 3IPYA 1IBMQ 1ZW6A 2V7QD 4M1KA 3RAPR 2NTYC 3OTOL 3A58B 3IHWA 4NZYA 5ANRB 2JA1A 1R8QA 4DR2L 1TNDA 3TS2A 1EESA 4DSUA 5C4XG 2Y0SG 4QM6A 5BR8L 2K5UA 1GOTA 5IWAQ 2NVYH 1NF3A 3K9NA 3GTJH 2LXJA 3M85A 3W3ZB 3PO3H 3MG9A 4CZ2A 2DFLA 3T5GA 1EOVA 5JZVA 4JI1L 3IUYA 1G3RA 3QVUA 3LGJA 5F9FA 2ZROA 1Q1EA 2R6DA 4ZDWA 4DVGA 1GP2A 3HU3A 2XGTA 1JBKA 2VHJA 4R2HA 3K70D 1IYJB 1H95A 1CR0A 1LVGA 3DM3A 3W5JA 4B3BA 1I94Q 1YR8A 1HTWA 1CJUC 2WKPA 4DUGA 5CITA 3EZ9A 3T12A 4WBSA 3GFTA 1W36D 4TMTA 3QPWA 5LMNQ 2P65A 3ONWA 1KDOA 2B8TA 1D5CA 3QXCA 3PIOA 4F4IA 1P2VA 1W1WA 4CF7A 3GLHE 2BEKA 3K53A 3OIYA 4DV0Q 2WMOB 4A3DG 5DYIA 5EP1A 4NYJQ 3EA0A 1JMCA 4B3RQ 4LSGA 5IYCH 1R0ZA 1YZQA 2W6IA 2OSBA 2C9OA 4LBWA 1P9RA 1YJ9A 1EK0A 1XJCA 3RDPA 4O2LA 3IGFA 4XTCS 2HIVA 3JAMi 1HR0L 3ZVLA 4DSNA 3HOWG 3DVLA 3VX4A 1OIWA 1NY4A 1TU4A 2XJ4A 4UPAA 2Q9CA 1QVCA 2ATWA 1OB2A 2NN6I 2OWOA 4DCUA 5JFGA 4IOKA 1EXMA 2CCGA 3HOZG 2NPIA 1HNZQ 4JS0A 3TVDA 4GOPB 1PYBA 3GJ6A 1N5KA 3BORA 2AXNA 2BDTA 4HAXA 4LBZA 3VX3A 5C44G 2E5LQ 1LS6A 4LBVA 4PC2A 5AJYA 2EYUA 1KMHA 4RFSA 3V9PA 1BBWA 2JATA 2ZYVX 1DO2A 4JIMA 1KDRA 5EZ6B 5FOUA 3H4MA 5FOWA 4UJ5A 3FWYA 5KNDA 2W6ID 3G48A 4LHZA 5CYPA 2VHQA 5FL7A 3VU9A 1KSHA 1HV8A 1G3QA 1NVVR 5JCPA 4QHSA 1W3SA 3AUXA 3CWQA 4K0KL 1DS6A 2ORVA 1N6LA 2PEZA 4DNIA 4HUTA 2LCFA 4K81B 5DI3B 1DPFA 1E96A 3Q72A 4DIDA 4F93B 1DAMA 2BM0A 4GLVB 4D4KA 1EYGA 2XB2A 4NMMA 2FFHA 2W2XA 4JL8A 4PSVA 3K0AB 4KLNA 1CKMA 1FP6A 3KDSE 1P9WA 2A5FA 3SFVA 1ZNYA 2ZEJA 3AKYA 2XXAB 3CCLA 4A3EH 2CCJA 2ZRPA 4A0GA 1WOCA 2GVZC 3BOSA 4GL2A 1CF4A 4GZMA 5L3QB 3LV8A 2DWPA 2ZREA 4A3FH 2IYUA 4I1SA 1TQ4A 3E0EA 1K6MA 1Y63A 2QE7D 5IF9A 1VQEA 2A30A 3UDIA 3C5HA 4EDHA 1E0JA 4Q7LA 3I7FA 1YE8A 1Z8FA 2KB0A 3M0EA 4LCBA 5E3HA 2CHQA 4P75A 4MRRA 2P3SA 1FL0A 2O0KA 2OLJA 4FWTA 1E2EA 3H0KA 1ZUNB 1NBMD 3C15C 4U02A 2Q2HA 5IP7G 4DUZL 1UKVY 3W8RA 3AVTA 4QM7A 3CBQA 1VQ5A 1QRAA 3PFIA 4DR5L 4Q9KA 1Q1ZA 4IOJA 4ZDKA 4NP6A 5IYCG
chains in the Genus database with same CATH superfamily
5ELEA 3FLMA 3GCWA 3U4GA 2O3UA 1NVEA 1I30A 1LBIA 2RE8A 2ZI7A 3X3MA 3T9AA 2R1TA 4S1WA 3BSWA 1C7YA 2HZBA 3X3HA 3HZZA 4N5LA 2R62A 5KRUA 1J8VA 1GILA 5FBKA 1NYQA 2FEPA 1G59A 2PGJA 3F6EX 2F55A 4NBUA 3OJLA 2E4AA 5LHY1 5LUBA 4CUZA 4LFBB 4OHWA 5C9ZA 5LZ2A 3JZFA 5TGZA 2JAOA 5IASA 3NENA 2B36A 2P90A 4U6NA 5FIUA 4KQCA 3RS0A 3SSOA 3BZKA 1CR6A 2IUYA 3DEAA 7AT1A 3H5RA 3VH1A 1Q12A 2YVAA 5JXIA 4KFUA 4B2IA 3ACDA 2DFNA 1EWIA 2OOSA 2JPDA 3KAJA 4L5JA 3ROKA 4L3OA 5HXAA 1PT7A 3WSTA 4ZKCB 4NCJA 3Q0EA 4H7DA 4EIWA 3LKDA 4MVJD 3S99A 3DEFA 2JGJA 3L5KA 5TF4A 2OCYC 3COZA 3PSHA 4K9PA 4RV9A 3SQLA 4DRYA 1GZ3A 2CJPA 4UUQA 1F8FA 2A5DA 2PGOA 4ZU6X 1I7LA 2NPFA 2K7FA 3B48A 1X1CA 4LJZC 2JA6B 5TVGA 3CB4A 1FBTA 1QDEA 2BSAA 1EZ1A 2GDZA 3H9BA 4BDTA 4B3TB 2AN9A 2PDAA 2WFAA 3I9MA 5HIMA 4QJBA 5MF6A 1CETA 1QGUA 4FGSA 3WVNA 4B2PA 8AT1A 2WTEA 4RZXA 2DY7A 1GADO 3KVOA 2NVXB 3HKEA 2BBTA 1SYDA 2DPXA 1R0SA 3Q7TA 4OXXA 2IV3A 5BRAA 3M6XA 4HGVA 3DAOA 3R3UA 4TQ9A 4NZNA 1SCIA 2V7UA 5CNIA 1Z5WA 4PQFA 5KU1A 4MVJA 4J1NA 5TARA 3IBTA 5HUJA 4BO1A 2P6OA 4I1VA 4L9WA 1R6VA 4FFMA 1G5IA 2FPGA 3DOCA 4V39A 3VR1A 1PT9A 1CK4A 3RG2A 3A8TA 1V9CA 1VP3A 5CW1A 4QU0A 4B09A 2RKOA 2FMFA 3AERB 4UMEA 4ZK9B 1X7ZA 1W4RA 2GHQA 2VQFQ 2UXCB 3ZW7A 5J58A 4QRDA 2FPOA 2VLBA 3QFSA 4BFWA 1VJ5A 3UKOA 1KHIA 2VQ3A 2RAPA 4URHA 3WIOA 2OK8A 4D9CA 2EATA 3DQQA 4K5WA 4B0OA 4BCCA 1IBLB 3PXEA 3Q6NA 3BB3A 5ICEA 2OCGA 4G1EB 1KZYC 2VDJA 4HVTA 2RGCA 2GTIA 2Q50A 2HDNB 1G8KA 4R16A 4LBYA 5K0EA 2AWNA 2CQAA 1AY0A 3IQFA 2PKWA 3V6LA 2IF0A 4C5BA 1GKHA 2XYHA 5IULC 3AVUA 1QVAA 2CL5A 2INGX 5DHTA 4DLVA 1ZQ9A 4F9TA 1HNNA 1XYGA 1H2EA 2O2GA 4MTKA 1NLZA 1STEA 1KL9A 1R6BX 1RYHA 3O6VA 3QK7A 2DHCA 3D8SA 4IINA 1OT5A 1GEEA 4HIMA 1WKBA 4KSCA 4RL4A 3HSKA 3SK6A 2LVBA 3PITA 2CMFA 4JSTA 2KM1A 4S3MA 3RBZA 3V4SA 3WV5A 1STNA 4B4DA 4LYFA 1XRJA 4OLJA 1EDZA 1ND5A 1Y3BE 4BA2I 2MYTA 3ANYB 1CBUA 1Q1BA 1VCHA 4MXDA 4JJ6A 1QG2A 4AD8A 1QGUB 1QQBA 2QW7A 1VPTA 4HWRA 4Q9HA 4A3BB 4M2LA 5EHGA 4BEBA 3BMNA 4ETIA 3PFBA 3R8XA 2J85A 2JIOA 1DV1A 3LX5A 1C4KA 3OBBA 4O1MA 3S70A 4A6DA 4AY4A 1V8BA 4QU9A 3NEPX 2QQFA 2GPAA 2AK3A 2A1AA 4RABA 5IJZA 3MD9A 3ZTTA 3G6JB 5IGCA 3UE1A 3TTTA 1GNVA 4N48A 1XZFA 1NMYA 4JI3B 1KERA 2ATIA 1N6HA 4YAIA 2BHRA 1DFGA 5I45A 4IXMA 4V190 5HF6A 4AI6A 2ECPA 3UUGA 4HB3A 4E5NA 1VQHA 2F43A 2HDWA 3ZWOA 5FB3A 2EXDA 3UMFA 2EBWA 2WU3A 4BS9A 3MGKA 4JI0L 3HXQA 3UO8B 3LXMA 4MV1A 1FU8A 2HO4A 4EHFA 5J3JA 4JIGA 1K6JA 3WOFA 4REMA 4GGPA 4LKOA 3UY4A 1FLVA 2PNHA 2DUNA 4Q9NA 5G0UA 2QLTA 2FWNA 4K0KB 2ZXOA 1BCRB 2Y2UA 4MW1A 3TL2A 3I2ZA 4BGVA 1VPEA 5GM1A 5BNTA 1T0IA 5DBFA 1PGNA 4WSOA 2QSYA 2Q8RE 1Y8PB 2WM3A 3IXLA 3T3DA 2Q7OE 2EWWA 4YFVA 1QUEA 3UOGA 2F00A 3DL4A 3CKKA 2A14A 3UVEA 5JADA 5G1NA 5L6MB 1YWGO 4Z9CB 1ZM9A 1DUVG 4LJ9A 4OF4A 1NR4A 2ZTSA 4O3MA 2UUOA 2Y76A 2QZPA 3EVDA 3KBBA 4TVBA 1SD5A 3Q5EA 1K0FA 4DCTA 2P0YA 2EYJA 4Y9UA 1E3JA 1DL5A 4K46A 4NZOA 4PLFA 4AIIA 3PO2G 1AK9A 4GSLA 2IOHA 4Q1FA 4IFDH 1M8AA 3FXAA 4MWOA 3DJFA 2Z2XA 3L4BC 4KQGA 4TRMA 5AVVA 3F4KA 5HJ7A 4MP3A 1FDIA 1KRWA 1EBBA 4HLQB 4IW3B 4KE9A 4LJRA 2EFJA 1P4GA 4I14A 3QBDA 4H35A 4PVCA 3VBEA 1D2GA 4K9OA 1JHYA 3P9KA 4UE6A 3K05A 4DR1Q 2LY7A 3JAMc 1V3UA 1XJWA 2X5KO 4QG7A 1M54A 1UDAA 4GYJA 4RZUA 3W90A 4AS2A 4KAAA 2Z1NA 4MV5A 4DAOA 5JSUA 5KUTA 5T1IA 1GPNA 1Z5OA 5ILOA 3HY6A 5AK0A 5HFAA 5I9NA 3CRLC 4FBLA 4X1KA 4B46A 4NZMA 2E5LB 3CUEF 3FZGA 2ZQYA 2RI1A 5MHTA 2X0EA 4DR5B 3G7LA 3T56B 1YKFA 2IUSA 1KQSA 3ASZA 1SKYE 2QLFA 3HYNA 3N7TA 4JYAB 4KXWA 1E5QA 1L5VA 3HJCA 4F7WA 1DO0A 4PZLA 5G4KB 5TMEA 4DDHA 2VF8A 4ZI3A 1Z6TA 1TT5B 2W6OA 3RRNA 2D2VA 1WMAA 5BYAA 2BOSA 3ZE0B 1XD2B 1O7JA 3BTVA 5C1IA 4AJKA 1Q0RA 1VL0A 4G9GA 5D3KA 1B8NA 4MYHA 1QIHA 4XGQA 3SEBA 1EPUA 3IRBA 3KWMA 3IIIA 3LW8A 4F3TA 4L5RC 1LPNA 3KTFA 1TX4B 1WXXA 3H65A 2RHHA 3N8KA 1BOSA 4IDDA 4RHYA 1FNNA 4R2XA 3AZQA 1H6CA 3D6NB 3NT5A 3RS7A 3PFKA 5AM5A 3EGEA 3FYCA 1CKOA 3T5BA 3URMA 2P5TB 3THRA 2UUCL 4YJKA 2N78A 1XKQA 1CF2O 1LUZA 1EXWA 3IOEA 3H9GA 4M9QA 5FUWA 1OFIA 4EVSA 3EPLA 2FSPA 3GCDA 2CYAA 4FD3A 5BORA 5B6IA 2PUBA 5FA6A 3DFIA 3QJYA 3L0CA 4YLEA 3MXUA 3K58A 3BAFA 3OFND 4IMRA 4YLGA 1N6NA 2GESA 2I3BA 3CTPA 4XVCA 2BV3A 4DA4A 4NOJA 4QDOA 4EUHA 3L7ZC 4EL0A 2B63B 3B5IA 1NTGA 4HDNA 3H5LA 5B58T 3TZUA 4LWZA 4IOJA 4QJ3A 1L5QA 3AI7A 3IURA 4HEHA 2KI5A 2ZTDA 5KYIA 5ELOA 1K6IA 1NI4A 2CKZB 2QCPX 3QWHA 1NJ8A 2H1SA 3LK6A 3N2KA 4RFSB 1SGWA 3ZWNA 1ZRNA 1C14A 4LFCL 1VCMA 3H8SA 1PZEA 3ESZA 4QNMA 4RH3A 4YI5A 5A3RA 5IDXA 3OOEA 1SYFA 2FMHA 1N77A 1TRHA 4LI3X 2E4UA 4HWSA 4ENPA 1VKOA 5F3RA 1SIUA 2ZI4A 4UNNA 3DDZX 4IFDJ 3DVQX 3NM4A 2WKQA 3F9IA 1HL7A 3D02A 5AXBA 4XYQA 1WDLA 4URUR 5FUYA 2DNCA 1VQMA 4B32A 4CQMD 1QJOA 2UXBL 4LYEA 2AV6A 5DHQA 3L79A 5D00A 1H2BA 1ECLA 4G1MB 1EUCB 1XOIA 4OUKX 5CH3A 3LGXA 3T0FA 3V1UA 5IJWA 3K2EA 1Z0AA 2Q2NA 3IJ5A 1H2FA 3ZU6A 2OM6A 4B2LA 4E5MA 2PGXA 2YFQA 1X1SA 2EQ5A 5H9WA 1QGAA 2R6CA 3RWBA 2GT1A 4OX9Q 3KUUA 5IC5A 1ABEA 2OG2A 5JAUA 1XA4A 3AUFA 3WYAA 3UHOA 2I1QA 2GN6A 5BN4B 1D9XA 2PLAA 1C0AA 2ZYAA 1OX4B 1RJ9A 3B1FA 1IUPA 3A14A 3RIHA 1YNJC 2B37A 4K03A 2P9QA 2W6JD 3F49S 1PBNA 1ZMTA 1DADA 1D0VA 1XZGA 4PHCA 1S2OA 4ZV9A 5IP7H 3MMNA 4M8IA 1JA0A 1NVKA 5SYMA 3S7ZA 4KRYA 3TRIA 1KZ1A 2ZXFA 2QPAA 4IF4A 3U4DA 1KF0A 4BVGA 4CUKA 3THYB 2REXB 2QN8A 5IE8A 1N7IA 2GJAA 3ZC3A 3ORRA 1N0WA 2D7DA 3W7BA 4MV7A 1U65A 4YK7A 1ISJA 2FETA 3R5TA 1U7OA 2JA7H 1CJCA 1Q0UA 1Y80A 3BCUA 3R09A 1HSOA 1K2WA 4P7GA 3HCOA 1G1MA 1ZWLA 2YMQA 1TQDA 3IKLA 3S1SA 3WDSA 3SDSA 4YRAA 1DUIA 2CHVA 2AN1A 4PO3X 2LWIA 4H1UA 1F6DA 5TGTA 1QZHA 4G86A 1R4MB 4WJZA 3U4VA 1YOVA 2R8BA 3IUSA 3JPYA 3WWPA 4D57A 3EFOB 1LBSA 4RKBA 1M76A 1T2CA 1YR2A 1Z7WA 2HIAA 3R8BA 3AW9A 3AR8A 3NRBA 1RMYA 1M34B 1E2FA 2X40A 4RCVA 5GOZA 2BJHA 3O0DA 3VR3A 3TSSA 3GTDA 4BY7H 1AQ6A 3BFXA 2C9MA 2CFOA 3DVAB 5CLIA 1JQKA 2GEKA 1EYZA 3TEFA 1JALA 4YCNA 1EGVB 2EFGA 3T4EA 3EQLC 2NTJA 1L1OC 2X6RA 5FQOA 4TZ0A 1GNQA 2ZRJA 1CEEA 3BE4A 5CFMA 3G5LA 1E1NA 4K6DA 2ZWPA 2Z8LA 5JD3A 4YT8A 4PRYA 2HHLA 4MAMA 2EY5A 3AKZA 2ATVA 3VNSA 3E8XA 3A2LA 2RIPA 3BMCB 5EAIA 4N3NA 1U8YA 2ZYGA 4QEZA 3CLUC 4D9BA 3FOFC 3AF2A 2XBUA 4BRSA 2A0YA 1ADYA 2NP6A 4N47A 2OTLA 1K4KA 3EH2A 4DJEC 2FR0A 4TMXA 4RHUA 1UE1A 1AHHA 2O7SA 3EZLA 5BYBA 3VKFA 2RHLA 3MT7A 2R7DA 5IS2A 2R6GA 5IYZB 1KJYA 3B13B 3KFXA 3NGMA 5FP0A 4D8XA 1NATA 3UAVA 4DNPA 1K3FA 4H0NA 1UKBA 2R8EA 4DV5L 1AZTA 3L6RA 3QUBA 2PUWA 1KFJB 3IHLA 3LUHA 3S9WA 1R0XA 4URWR 3ZCSA 1N5RA 1KKMA 3SSNA 4LY0A 2WICA 1C1XB 5I8PA 4IDHA 1X1RA 1H1DA 1OFUX 1C9OA 2GTHA 4MR9B 1DBPA 4RVOA 4CMEA 3I9FA 4KV6A 2UVDA 2DNEA 1SH7A 1EFPA 4M98A 4TUYA 1PHRA 4KG7A 4UNPA 4RTJA 3H5OA 2HH9A 3MJVA 4BGDA 4I1YA 2Z1CA 5D14A 1C9EA 2R6FA 4QYTA 3L05A 4ZVLA 4DLZA 2V96A 2Q27A 5TQ0A 1FDRA 1Y1KE 3L92A 2JFGA 3GDFA 4DK3C 4BX9A 5HDBB 3JALA 1U5AA 3LDFA 1EUZA 1SQ5A 3QVXA 3MT8A 2QA4A 2L9HA 1R15A 3WYFA 3LOUA 4M0UA 3Q6IA 3BDVA 1ZDMA 2BUAA 1EA5A 3JYNA 4G65A 3SZGA 1PLJA 2H1FA 3U5TA 4WNYA 3TAUA 1LD3A 5CPFA 3HOUG 2CJWB 3JZMA 4FMCF 3I91A 5LBUA 3FPEA 2R92H 1Y9EA 3FOAA 3I2FA 5J9FA 4IO0A 4Y2UA 2QLMA 2ZS8A 3GRAA 4RL6A 3ROZA 4E4TA 4PRKA 4PTYA 3NC0C 3CZAA 1U4LA 3X1ZA 2C4KA 1C8VB 1JQ5A 4O4IF 1CZHA 3HKBB 2CE2X 2Z5VA 1QM5A 1XHEA 4O4JB 1TT7A 1CXZA 2Z3VA 2BEWA 4CM3A 2H9AA 2NYAA 3EVBA 5K0CA 1XVAA 3VA5A 3K9CA 2OCBA 4XYBA 5KQLA 1J0BA 1XNQB 5JO9A 2A1TS 4JJ4A 1JS1X 1ZO8A 3KNZA 3PJGA 4WOKA 3GLIA 3B5EA 1PFVA 4PX2A 3VSEA 4DZTA 3F73A 1Z73A 4B6GA 5HX7A 4BMPB 4R9RA 2BMDA 3IE1A 3NRJA 3NTOA 3ZGZA 3U4IA 1UOPA 2XUPA 2D1YA 4W1PA 4XM2A 2RBKA 3MCUA 4QQFA 5CG1A 3URKA 4LF9B 4LF5B 2JFBA 3VR6D 5AVZA 1YC2A 4DLPA 5J2UF 3HJRA 4U39A 1U0GA 3RKUA 1HETA 1JJAA 3ZNOA 3GEEA 4R2MA 3B3QA 1LRJA 3OM1A 4YJGB 1Z25A 2PWYA 4OKNA 5E6SA 4NS1A 3PLAE 5ICSA 5DNFA 4A3JH 1EFKA 2ZSFA 3HK2A 1G18A 3GLQA 3GT3A 1KI6A 3KUCA 2OPBA 3PC8C 2A69D 2J5RA 3HFGA 3IEPA 3QG1A 2YOHA 3ZWQA 4F12A 2PQAB 3FHTA 3KQSA 2FP4B 5FKJA 1GPH1 2YNMD 2PFMA 3EIVA 3C3KA 5M7EA 2HR1A 1DAIA 4N03A 4YJDA 4AG5A 1JLLB 2ATEA 3M4OH 3MXPA 1YB5A 2CK3D 2HA5A 3KDFB 4IIHA 5E1OA 1XCJA 4Y2RA 1P44A 3CNQS 4LZLA 4Y7NH 4N82A 1H4QA 3BE8A 1IKLA 1ZH6A 3KFLA 4WFKA 1AQYA 4H08A 3QUSA 1IEWA 1KO5A 1RABA 4ZALA 1MABB 5KOJB 5DHUA 2WHRA 1L1OB 2BZ0A 1IL0A 3JVVA 3ZDEA 5K8CA 2OKCA 2EBFX 5TEWA 5F91A 3G2MA 4A2QA 1ZCZA 4CR8A 1QCZA 2QUAA 5LQNA 4MP6A 3V1LA 3PUZA 1WFQA 1FNCA 2Z3ZA 1M5RA 1WTCA 1L7DA 2YNMA 4KQ2A 2I7VA 4N6NA 2NUTA 3V00A 4AJ4A 1P17A 2R68A 3ZNNA 1V8OA 1HT3A 4J1QA 5FCDA 4FEAA 4CF6A 1P3Y1 2HCFA 4IILA 4QTTB 1UH5A 4L02A 2Y92A 4F92B 1BQEA 2Q5LA 3TG2A 1QVRA 2ZXRA 1BCPF 3FFAA 3O8OA 4XX1A 3C3YA 3L8DA 4JY7A 2O50A 1S3SA 4X63A 3N8GA 2NGRA 2Z9BA 3AK4A 3Q41A 4NPAA 2PSFA 3V46A 5JEDA 4UBJA 1AKRA 3GCGA 4GPEA 1RI5A 2ZE6A 1K2VN 5A6SB 2VN8A 3OT1B 1BRMA 4RLHA 1XWEA 1I8TA 3FPLA 1E1CA 2X0KA 5BN5A 1ZJ4A 3Q24A 2JGIA 3NGLA 2IHEA 3R3SA 2YS7A 3WLJA 3E5SA 1Y8RB 5KVQA 2WQ7A 4N8X1 4UP9A 3A37A 1TAQA 4E5VA 3K70C 1V5GA 3A4MA 2F3PA 3V8EA 1CUZA 4R7ZA 1E7RA 3H11A 1KS9A 3MIZA 2IX0A 5AIAA 3QWFA 1F20A 4JI8Q 1HG0A 1R8SA 1CULC 3MA2B 1OREA 2W2MA 3BQ9A 3CR3C 2DTXA 2H57A 3PT5A 3R9IA 3ZIAA 4F11A 2O14A 1W0KD 1AGPA 4FYMA 1U5BA 1NV8A 4MGZR 4QUBA 4RHTA 1JKFA 3UJBA 4BE4A 3TG8A 5LL6P 1EGAA 3AJ9A 1PZXA 1ZUHA 3E0QA 3VPGA 2ISSD 1YS4A 3IP6A 3U17A 2MMCA 5D51S 2Q9UA 3GNQA 4V1CA 5JSHA 3SMVA 1LFDB 2XNAC 4XW2A 5E1FA 3V7NA 1CVLA 2WJJA 4MLPA 1V16A 4IX9A 1D04A 3P94A 5K4HA 5C4XB 2WWTA 8OHMA 5HQ3B 4TL6A 3OZXA 1MA0A 1ZA2A 3HQ4O 4G9BA 1DXYA 5B2ZA 4AUMA 1PL6A 1VQLA 4NXMB 4TKUB 1VQOA 2AZ4A 3LA6A 3FF1A 3N0XA 4KDRA 5F77A 5M3BA 3VVMA 2I6GA 3L8GA 4BFZA 2OQIA 1K3UB 1Q20A 2R6JA 2FWPA 2PV7A 3IUJA 3UMVA 3L7KA 4UU0A 3RYCA 4EW3A 4CU2A 4G4GA 4A3JG 4TV8F 3L1UA 5BWCA 3BWYA 2PCJA 1FRVA 2A0XA 2CXPA 3DE4X 3KSDO 3L7NA 2W43A 1RPAA 3PNQA 2R7AA 5JS7A 2Y0SE 2X9GA 1A63A 3DFKA 4WZBA 2V5AA 3ESRA 1H8HA 5CC4A 3Q3JB 1XROA 4DFAA 1S72A 1NUUA 1WSBA 2PBLA 4PLYA 4XLLA 1LPMA 2ODEA 2F0IA 4KI0A 2OSVA 2XNCA 1XYYA 4B3FX 5B7PA 5C7IO 1Y6FA 3R77A 2C42A 2QR5A 3JALB 1KC1A 2Q3BA 3OJEA 2XSCA 1TGVA 3I04M 1NFFA 4L16A 1RTKA 2X69A 1E58A 2ZP1A 3GFGA 5K8JB 2O5IC 2A4MA 3GP3A 4OFBA 5DDIP 2O8BA 1Q81C 1DQYA 3NBQA 1ENCA 2G0NA 2AE2A 1B3QA 2YWGA 1EHIA 2FPSA 3O3MB 4E32A 2PM8A 4EW2A 5CAEA 5HM6A 4MIOA 4X3CA 4DV2Q 4XWGA 2FEWB 3UF0A 1QAMA 3VKUA 1GG5A 1QHSA 2WJWA 4PFKA 1C30B 3H16A 5AT1A 1KY5A 2G9RA 5A9SB 1XTCD 3FYDA 5GV7A 3OZDA 1G8FA 4X3PA 5F21A 1E1RA 1ENZA 3BUSA 4K9RA 2JZCA 2HEGA 3ASUA 4OREX 1U3FA 2V6IA 3PHBE 4QFDA 4BWFB 1H66A 2X7XA 3BVZA 1P0PA 4PNZA 4LW1A 2AQ1B 4N54A 4TLBA 2Q46A 1TECE 4HB0A 5AW1A 5JJKA 2YOGA 4EDFA 2D2EA 4D5GA 2F52A 2YN0A 1A2OA 2GAFA 4E13A 4CEJB 4NOKA 4BMYA 4WBNB 2H1VA 3QEJA 4TX1A 1QNFA 1GRQA 2VAPA 3HYRA 2IEYA 3QPCA 4CGYB 4ND2A 3WWZA 4QAQA 2PO7A 5KDOA 1B26A 1ZD9A 4MI3A 5B2FA 4K9KA 3Q8LA 1ZN9A 3PV0A 4KKTA 1F3LA 4MR7B 1SU4A 3LCCA 5AKIA 3I4NB 4OLFA 1JG2A 4R6XA 5DF1A 1NVDA 2B2VA 3HZOA 1QHFA 2G70A 4DDTA 2SKDA 2HBQA 1U3VA 4JBNA 3L0ZA 4M1OA 3NYQA 3L3BA 3AF5A 3KWFA 5FLYA 4E94A 5EKKA 1OY1A 3G9TA 4FW8A 3CCUA 1Z18A 4IG9A 1YZ6A 5JQGB 1W9HA 4MV4A 1LVUA 5FQNA 3U3DA 5FLXA 1HDZA 1F0PA 1AJEA 5T8KA 3SF8A 3ZXIA 1L7PA 1CRZA 3GFFA 4DV7L 2X7JA 4GQAA 3STXA 3V1NA 4TRNA 1FMFA 2OO3A 2QD3A 4BNNA 4I7AA 5I47A 2HY7A 3EG5A 1Q0QA 3I09A 4ZVVA 2A1UB 1S5DD 2CB9A 3HEMA 3QF4B 4L28A 4C56C 4N7JA 1KEKA 3TRZA 1IM5A 1WD0A 4GS5A 3RV3A 2B39A 4GLAC 3EAGA 3A6FA 1UFKA 2VDWB 1K7XB 4WLNA 3OPXA 4TSRA