1U0LA

Crystal structure of yjeq from thermotoga maritima
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
291
structure length
278
Chain Sequence
LRRRGIVVSFHSNMVTVEDEETGERILCKLRGKFRLQNLKIYVGDRVEYTPDETGSGVIENVLHRKNLLTKPHVANVDQVILVVTVKMPETSTYIIDKFLVLAEKNELETVMVINKMDLYDEDDLRKVRELEEIYSGLYPIVKTSAKTGMGIEELKEYLKGKISTMAGLSGVGKSSLLNAINPGLKLRTTTTAQLLKFDFGGYVVDTPGFANLEINDIEPEELKHYFKEFGDKQCFFSDCNHVDEPECGVKEAVENGEIAESRYENYVKMFYELLGRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Probable GTPase engC
publication title Crystal structure of YjeQ from Thermotoga maritima contains a circularly permuted GTPase domain
pubmed doi rcsb
source organism Thermotoga maritima
total genus 79
structure length 278
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 3.6.1.-:
pdb deposition date 2004-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03193 RsgA_GTPase RsgA GTPase
A PF16745 RsgA_N RsgA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.50 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Probable gtpase engc; domain 3 1u0lA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1u0lA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u0lA02
1I4TD 3A1SA 4DKAC 4A3KG 1YR8A 1IN7A 2CLSA 4GMXA 5KPJA 3QVVA 1AJEA 5G53C 3NC1C 2B7BA 4I99A 1A7JA 1KHIA 1U99A 3GLFE 4PZYA 1KJZA 5LD2C 5IE8A 1R4AA 2UZIR 4D82A 4GOKA 4XD7D 3K53A 4F4CA 1TTTA 4JYAQ 1JR6A 1YHBA 1KY3A 4DR5Q 3GLIB 1Z8FA 1K8AC 1PH8A 1UBEA 3GFTA 3KTAB 4UNQA 3G6EA 3T5DA 2YOHA 4Q4JB 4I4LA 2RCNA 4IW3B 1XNQL 1QVFA 1NTGA 1OB2A 4GOXA 5B58C 5BYKA 1E96A 2X77A 5FR2A 4A92A 1OFUX 1VQ6A 1P62B 2NN6I 4L5TA 1N32Q 1XJQA 2D06A 2J59A 2HLDD 4Q18A 3WYGA 1Q0UA 1NI3A 4NHOA 3CRVA 4FMDB 5DYGA 3LV8A 2W2VA 5JMTA 2JIZA 1BBWA 4V0LA 3H0GH 1AS2A 3IUYA 2CE7A 2RAPA 2NQ2C 2QPTA 5F2EA 1OV4A 3PUWA 4KCGA 1IXRC 3CX7A 3QPVA 1NMFA 1LUZA 2ALYB 1G8PA 1K83H 2C98A 1A2BA 3H4MA 3K9HA 4TQ9A 1XCPA 3TBKA 2GJ9A 2B29A 2FSIA 4JI6L 1KDTA 1N6KA 1YU9A 2C9CA 2ES2A 4LV8B 3RRZA 4A0HA 1XMVA 2P5TB 4XWAA 2O5VA 2WJVA 1HH4A 5GAHC 5DE3A 2VIIA 3RRNA 4CEIB 2JA9A 1HNXL 1G17A 2XJ4A 4B73A 4DB4A 1SVOA 3GTQH 2I5HA 2V6JA 4G5SA 2CCZA 2OAQ1 4GN3B 3CF0A 4DNIA 4IFEA 4Q7KA 3TUJC 1YR9A 2KJQA 1EG7A 2NPIA 4XIGS 2ZTDA 4HJ5A 4TMTA 4DVGA 4OKSA 5EE9A 3OW2A 1EIFA 2OFXA 3Q5DA 4GS3A 4NTZA 2YINC 1D5CA 2I5LX 3K0AA 4JCVE 1R0WA 2ZETA 3K0CA 5P21A 2JATA 3IRBA 2V8OA 3IHWA 4QGGA 3UK6A 2WBLC 2GVDC 1AIPA 1MKYA 4GFDA 2X2FA 3LRPA 1W47A 2WICA 4LF8Q 1PH7A 1L4YA 2J87A 4L8GA 2GETA 3GJ8A 1IXRA 2AL7A 1TWAH 2VW9A 3CCLA 2JLZA 1IBLQ 2VBCA 5G41A 3RZDH 1NLYA 2GTPA 3CX6A 3ULJA 3RC8A 3BZCA 4KYUA 1DAEA 1G3IA 3IIMA 3X1WA 3CZQA 4PC1A 5EZ6B 2KCTA 1IZ6A 4ZO4A 2WZQA 5SZIA 2JA7H 4KAXA 4FCWA 1NMYA 1FW6A 4QGAA 1DO0A 3EIVA 2P5SA 3VNUA 2O8FA 5M3MG 4TQUS 5IP7G 1I3QH 4A3DH 1ANKA 1VPLA 2IUSA 2UXCL 5KSPA 3REGA 4II7A 2PNHA 1SVSA 2Q3MA 4BEJA 2J7KA 2CKZB 2PCLA 3SYKA 1ZRHA 3EASA 4R2HA 3ZS8A 1ZIPA 3K70D 3AVYA 3M85A 4AQYL 5IYCH 4QHTA 3ZJYC 4FDBA 5KUTA 2KBFA 3H84A 3PENA 4TT3D 4OWXB 2O0KA 5EP3A 5GJBA 4AIMA 3OAAA 1SVLA 3KDFA 2UUBQ 2BH2A 2JCSA 4HZIA 1KO8A 4MYTA 4A3CH 2GNOA 1E9AA 4TMZA 2VLIA 1YJWA 2CHVA 1ZC4A 4DSUA 1VCMA 4QGHA 3REFA 4DIEA 3I8SA 5FJ8G 1SKQA 4CW7A 3WNBA 2YYZA 3LVQE 4LRWA 2VP5A 3J81k 3PF5A 3GMTA 1UKVY 3WWVA 3I2ZA 3ZQ6A 2QE7A 3M9BA 4NCJA 3UMSA 4JV5L 2GCNA 4JI1Q 1ZC3A 2PMDA 5JJKA 1GRQA 2QAGB 1YZNA 3MWYW 1N33L 3ZLJA 1LNZA 2VP2A 3SE0A 4LFCL 4TMWA 2WSSD 1RYHA 4CRWB 5JSZA 1LYLA 2VY3A 2DPXA 5CM9C 2B8TA 4R98A 1QZHA 3LXXA 1A4RA 1EUJA 1MABA 2UXDQ 3J81j 1U8AA 2TMKA 3IO5A 1I5FA 5TV2A 1QBKC 2F9MA 1OT3A 2BV3A 5JS7A 2ZS7A 3I56A 1YR7A 1QHNA 4OHWA 4OI1A 5JCPA 2V6IA 4EQ6A 4LJAA 2OTJA 3E2IA 3S1QH 5C4XG 5EP4A 1Y1VH 1E6CA 2FGJA 1SVMA 4R9UC 1N36L 1KZGB 4LOAA 4U02A 3TLXA 1QZGA 3AV0B 2GAOA 2NO1A 3DM3A 1JNYA 1Z06A 3TIFA 4CEJB 4DDVA 5CB8A 2YU9H 3JAMi 5IYDG 3PUXA 3CCJA 1BH2A 121PA 1EX6A 2PEZA 2YWFA 5LMNQ 3SZRA 4IPDA 1UPTA 2DWOA 4XTCS 1DG3A 3HOVH 4JKIA 3DKPA 1PH1A 1GIAA 4HZUA 1DE0A 1FQJA 3D0FA 4GZMA 5EAYA 1NIPA 2ORWA 4B43A 1NJFA 1SMXA 3N2IA 2R44A 2PT5A 2WFWA 1R0XA 2XTMA 2GWHA 4ZCLA 2KHJA 1U0LA 1CJVC 3J7ZC 1E1RD 221PA 2IHBA 3CF6R 3DOEA 3NXSA 4Q1FA 5BWMA 3U44A 1ZNZA 4M1TA 3KKMA 4ACAA 2OSBA 2ODEA 2VQEQ 3ADDA 2AKWB 4MKIA 1SVKA 2F4VL 1L4UA 1SXJC 5IYBH 4NXNL 1YITA 2QA5A 3MJRA 1US8A 1OTCA 2H5EA 3CNNA 4BZPA 3NG1A 1EESA 4X62L 4YLGA 3T1HQ 4DDTA 1NMZA 3OE7A 1L1OC 1PH3A 2Q6TA 5LB4A 3VR4A 5H1YA 2CVHA 3RLNA 4R4QA 3TS0A 4MDEA 1PH5A 4AD8A 4C0KA 1CU1A 4IJHA 1GNRA 4LYJA 3QF4B 1XEWX 2WKPA 2NZ8A 1BMFA 4AK9A 4X8MA 2VH5R 4GNKA 5GJCA 3ULLA 4JYCA 1A0IA 1OXTA 3PVSA 3MXNB 1HTWA 2BEJA 3W34A 3A6PC 3EN2A 4DR4Q 5D3QA 4ZV4A 4HIMA 2E5LQ 2JA5G 1D2MA 1G3QA 2ASBA 1A82A 1Z83A 3CR8A 4RD0A 4Z1MD 3ZVMA 2XSZD 1MJEA 1E4VA 1VECA 3LXRA 2F1IA 2C78A 2ZJPA 2ZRIA 5AWFC 4RKFA 4TL7A 3K80C 2ZS9A 4X8HA 1NN1A 3U7GA 4KHZA 2OBNA 2JLWA 1HE8B 1KMHB 2EFDB 5AUNB 3U60B 3BOSA 4DR2L 5FPYA 5E95A 4IPHA 3S15H 1J2JA 5HCNA 2J7PA 2DHRA 4L15A 5KYKA 4DCVA 3PO3H 4DR6L 3DL0A 1SXJA 1II8A 3FB4A 4YCVA 4YWMA 4NU0A 2ZIAA 1NBMA 3B85A 4AYWA 2I5MX 2JQOA 4IVPA 1NP6A 3T1TA 5HTKA 3I1FA 4F38A 2RHQB 3KF6B 1ONBA 1L1OA 4PG3A 4PPFA 3ADCA 2KENA 3B1VA 5M5WH 4A82A 4HLDA 2PCJA 2NVYH 4OQXA 4C0QC 3ERSX 3I32A 2XZOA 3LD9A 1CKMA 3RDPA 3KFXA 3GJ5A 2YTVA 4GKKQ 3CIOA 3I4LA 4POGA 4RCYA 4GRAA 3CPJB 5L3SB 2ZR0A 4NDZA 5JWOA 3VKHA 4R71A 2P2LA 1DOAA 1NG9A 3A1WA 4LYFA 1JJCB 1VKJA 1W2GA 1GUAA 3B1WA 2R6AA 3ZD6A 1WYDA 2EWVA 2PEYA 2VP9A 3IKJA 2R93H 3FHTA 1XJ0A 2R7ZG 1OXVA 5JWHA 1KRSA 5E7NA 4L5SA 2W0MA 1EK0A 1N6NA 1EFRA 3B9PA 3QY0A 5H70A 4US2R 2PMZE 2IS4A 3I3SR 3AKDA 4HSEA 5EE1A 2VO1A 4Q1CA 2FN4A 4Q01A 5F9HA 4ZIRA 2QP4A 2K5NA 1F2UA 2WKRA 4L9SA 1X8LA 2QEQA 5EZ5A 2ASEA 5FOVA 3D7MA 1Q46A 4KLKA 2CK3A 3M6AA 4RY2A 1AS0A 1XP8A 3DKVA 4D4KA 2VUMH 5TXGA 1MOZA 3G4SA 3T1QA 1N5LA 1U2RA 4P71A 1H8EA 1FJGQ 1Z08A 1W1WA 2AD5A 2D7CA 2ZVPX 3NWJA 1VQ4A 4BY7H 2HUPA 1GKYA 1IXSB 4JSYA 4MITA 4WZ6A 3K9GA 1K5DA 1BOFA 1KIXA 2P3SA 3CUEF 4B3FX 4R4CA 3QNUA 2RHMA 2HF8A 4PZZA 4UNPA 4BWYA 3IPYA 2A5YB 2EIFA 1MO6A 1RE0A 1DAMA 1XTSA 2D4HA 3BB3A 3P4XA 2ERXA 1G5PA 2REOA 1XPUA 3S2DH 3LX8A 3EZ2A 1SKYE 3PEVA 1NE3A 1VQBA 4AYBG 2QSZA 2VL7A 1VQAA 1Z28A 1KNQA 3CPFA 1RIFA 2ODWA 1U81A 4L16A 4N1AA 5BXQC 1X54A 5CK4A 4JLVA 3CCVA 3L0PA 2RB4A 4B32A 1M1YE 3G71A 3R8FA 2ZYTX 2R62A 3BWDD 2ATXA 1TEVA 3U50C 1RRPA 2QQEA 4KHPQ 3KJIA 2ZSAA 4RFSA 1OH6A 2ZUCA 4EX5A 2HT6A 4N0EA 4KVAA 5IP9G 3EZFA 4OWTB 4LI0A 3UMFA 1TNDA 1VCIA 2W00A 2VEDA 1B7YB 4L5RC 4YHHQ 4Y52H 1HEIA 4IOJA 4MGYR 3W5IA 2MNAA 1F3OA 1SZPA 2UUAQ 4DV7Q 1R9TH 2ZU6A 5HKKA 4P75A 2R9VA 2WOJA 5JRZA 4MKGA 1SKYB 4CT5A 2Q9AA 3PCRB 4HB0A 1LS1A 4HUQA 4TSFA 4Q48A 4HDOB 5H68A 4HAXA 4OJKA 4JLMA 4CEHA 2GXQA 2WHXA 4TVAB 1PV4A 3EC1A 1VG9B 4JI8L 2Y0SG 4JLPA 4O25A 3RSLA 3U4QA 3I4NG 1M7HA 2AK2A 3TR5A 4Z54A 1GSIA 1FX0B 3M4OH 1NVUQ 3ASYA 1KI7A 3KJPA 2X1VA 4F92B 1Z6AA 3QKUA 3NEJA 5L3VA 1QDEA 4MQBA 2WB1E 1D9ZA 2H8KA 2HXSA 2OFOA 2BA1A 1DO2A 2OTLA 3BBPA 2YZ2A 3M1IA 2RF4A 4YXWA 4B2IA 4K0KL 4U5XA 2Z0SA 4D25A 1OB5A 4G5QA 2ZYWX 2J0QA 3HOWH 1UBCA 4IFBA 3IQWA 2OFWA 4FN5A 1U8ZA 2A5JA 4QBHA 4C0AC 3HPRA 1IY2A 1D2NA 1FP7A 1FTSA 5EXTA 4LV6A 2H1LA 3RHFA 1JE5A 2L15A 2W2XA 1KY2A 1NN5A 4NCHA 4FMDF 1G1MA 3FTQA 3KXKA 1PH4A 4Q00A 2IXGA 2NIPA 2GF0A 4Q9LA 5DIFA 2W6ID 4X8LA 1OLOA 2OLKA 2Z43A 3RNUA 4DUZL 2D3WA 3MCAA 3T15A 1Q81C 3CB4A 2RGEA 1BKBA 1KK1A 2I4IA 1JQJC 4PMWA 4I81A 1N6RA 3P20A 1M34E 3PSIA 1UDXA 1CTQA 3EPLA 4G01B 2MFIA 5L8VA 2WTUA 5FLXc 2XZLA 2F3RA 5IK2A 2O8EB 2OT3B 4I1VA 1ESNA 2JA8G 2O8DB 4OI0A 3W5OA 1KI3A 2UU9Q 2OQ0A 5EE3A 4DV1Q 4NXML 3C16C 3VU9A 2B8WA 1SULA 4LF9Q 3F2CA 1GITA 2OLJA 2E2IH 2LKCA 1KJYA 1QVAA 3CNLA 1CJKC 3VR2A 3H2YA 3TSZA 1DGSA 1G18A 2FGKA 4P74A 3LH5A 4A6XA 2F9LA 3RS5A 4EJSB 2RGAA 4P32A 3Q8DA 5AK0A 2OCYC 4D80A 3A1UA 1Z22A 3GTGH 1Z6XA 2AMCB 2BMJA 2RGGA 3AB3A 4H1UA 3OEHD 4M1YA 1SGWA 4RZXA 3KJOA 1OJLA 3V9PA 3FHWA 4WJ4A 2ZU0C 3THYB 3R9XA 2BM0A 2O8CA 4KBFA 3W90A 3QXSA 3SN6A 1ZCAA 2VQFL 2FX3A 3H86A 2WAXA 4MRPA 5LB2A 3H0GG 1QHHA 4E5UA 2GN5A 4YMTA 3CRQA 4A4DA 2FSGA 2FU5C 2VSXA 1Q1QA 1VYVA 2XEXA 1G3RA 4IDNA 1MRSA 4B3ML 3H3VI 2KWIA 4LUCA 5C2JB 721PA 2K5UA 3AVVA 1UAAA 2QMUA 4B3SL 4DV3Q 4BFSA 4BY1H 2AKAB 3PFIA 4PHHA 5J5CA 1W4CA 3FOZA 2R7FA 1N6HA 3VKWA 4C3ZA 3KZ1E 2KE5A 2PLFA 1XNRQ 2WWWA 3S1AB 5TDHA 2GCPA 4EPWA 1G16A 5AUPB 5EUQB 1E7ZA 3FMPB 2H17A 3Q85A 3CRMA 2YC2C 3AM1A 4JT4A 4QNMA 4QQBX 3RVBA 1R6BX 1QG4A 3EA5A 3R9IA 1KD1C 2ZE8A 1NVWQ 2QMHA 4ZDIA 2KCMA 4JYAL 2NZJA 3K9LA 4KU4A 4GOPC 4V0ME 2JJQA 3ICEA 4DR5L 4I1SA 5FUYA 3ER0A 4PZ8A 4P0TA 4PAMA 3BH6A 1G3MA 3SU8A 3B5JA 3VR1A 5FH9A 4PC7A 1W4BA 2D7DA 2QSYA 3NDBB 2G6BA 1RL2A 2JDID 2QL6A 2JJ2A 2F3TA 1N32L 2F3IA 4QKQA 4JLDA 3WY9A 3AGQA 3P1JA 1GKUB 1YHQA 2OV2A 4LHYA 4QBGB 4JJKA 4M8NE 1E0AA 4GNXB 1E9CA 1TU4A 4OO1I 1P4SA 4A3MH 2BJVA 1GRRA 4A3EH 2QT1A 1VQIA 4UXJA 1R5NA 5DN6A 2FPMA 6Q21A 4PPGA 4ZDWA 4FINA 2W83A 1UADA 3EG5A 1E2KA 1YZGA 3RAPR 2EW1A 3GEIA 1GWNA 1OIVA 2JA7G 2XNDA 5EQTA 4C3JH 1EFWA 2FFQA 1X3FA 2O52A 3LBNA 2EQSA 4HIKA 4X65Q 1Q44A 1XZPA 2V7QA 5CJ2A 4RKEA 1WF3A 4TTPA 1AZSC 4RZ3A 2GXSA 3CO5A 4C9BA 3I55A 3KUCA 3AVTA 5GAEC 2F43B 1KAGA 2HQLA 4GOPA 5CIWA 1E9RA 2DFKB 1Q8KA 2D2FA 4FCVA 1WXQA 3QEOA 4D4JA 1OH7A 2WV9A 5IYCG 3GTKH 1NN3A 2VTKA 3CPHA 3FFAA 3THXA 1VG0B 1A2KC 4PZ7A 2OHFA 1VCOA 4PQFA 4A0RA 1ZU4A 2YWHA 3LVRE 1UKZA 3Q8XB 4W5WA 3SFVA 4EQ5A 4GN4B 1K8GA 2E2HH 4A3CG 1HURA 1N9WA 2PH1A 5DHAA 3R7WB 3OFND 3ZVRA 4DJTA 1DAKA 3CPWA 1VHLA 4DC9A 1UBFA 4WBSA 1RC8A 3GLHA 1W44A 4EPXA 3BRWD 4LF8L 1S0UA 4A15A 5CDFA 4K0KQ 1X3EA 4UP8A 3N2EA 1CBUA 3I8XA 1N5KA 3WHLA 3PF4A 4BFTA 4JVSB 2IWHA 2A1AA 1S40A 2GJ8A 2CNWA 5IT9c 1IBLL 1RRFA 2ZJZA 1RIPA 2PZFA 3SJAA 4PHTA 2WKQA 5HY6A 5ELOA 3CH5A 4R2IA 3D31A 2YTXA 4ASUD 4QJ3A 2ZRGA 3T1VA 1R10A 2EFEB 1CS4C 1U90A 5J47A 3GJXC 4EAQA 2ZJ8A 2ZXUA 1XB2A 1N25A 1X8KA 1IBRA 4EIWA 4OONA 1EXMA 1AS3A 1JPNA 1RJ9B 2CCKA 2HEIA 3THWA 4GT1A 3BFKA 1YZUA 2EWWA 4L5BA 4BFZA 4HDQB 4TL9A 2VNUD 4C7OB 2IHEA 1WDTA 2D62A 3PXGA 3EARA 4BPBA 4UKDA 1G64A 1W2BA 4IFDJ 4A3FH 1G20E 3MRSA 4JLAA 4POAA 3VX3A 5H1SE 3I62A 1PH9A 5EXSA 1Y1VG 1OFIA 3ZZTA 5HGQA 2GCOA 1GKHA 5JEAG 1JR3A 3LBIA 4DT1B 1KSFX 1Z0IA 1T5LA 4DKXA 4DEYA 1XNJA 3V4FA 4TTRA 3U3JA 2ZR7A 4IEEA 3GLGA 1XX6A 3HKZG 3BS4A 5AJZA 2ZJQA 3ICQB 2UUBL 1Q20A 3PUYA 3W1BA 1N6IA 4GN5A 1T8UA 4HYYA 2R92H 1JPJA 4IFDI 5M3FH 1QVRA 1Y1WH 4O0MA 2JLXA 5C0XI 2YWGA 1VQ9A 2XX3A 1YJNA 421PA 1NL3A 2R6DA 1XWIA 1QHSA 2GXUA 4A8JB 1KXLA 4LSGA 3HOXH 1JAIA 4KBGA 2VL6A 1XMQQ 2JLUA 4HAZA 1S1MA 1MH1A 3PO2H 1CXZA 1W5TA 3B60A 5FOTA 3ZQJA 3AVXA 2N42A 4QY7A 4JI1L 1R8QA 1OYYA 1RYFA 4UNSA 3LDAA 2IYWA 1W0KA 5DGXA 5F98A 3GLIE 1XD9A 4BA1I 3I5XA 4TMKA 1A5TA 3BU2A 1HR0W 2ZRJA 2XOKA 1OXSC 5BN3A 1LS6A 1Z5ZA 3U7FB 2CWPA 1MRNA 3E0EA 2VZAA 2UXDL 1ZD1A 4LC1A 4TL6A 1TWGH 1PUIA 4A3JG 1G6HA 2B6HA 2B63H 3OHMA 1D6JA 2Q21A 4ESHA 2JA6H 5FTMA 3SR0A 3DMNA 2A19A 3A58B 4CIDA 1HT2E 2HV8A 1Z0DA 4JBMA 2AX4A 3MG9A 3F0TA 5GADC 2I1VB 4A3BG 2W6JA 2V9PA 1IBKL 3LQRA 5E7IA 4JI2Q 4A3GH 1W2HA 2BEKA 4RJLA 1Z2CA 1ZP6A 5LMNL 3DM9B 3GQBA 4PX9A 4W5HA 3VR5A 3D6TB 1DBSA 4KLNA 4A36A 4YCWA 2HIXA 1VQDA 3CM0A 4FMCB 4JOIC 4O3MA 2HDNB 1TQ2A 1CJUC 1GL9B 1LTQA 3BGWA 2N46A 4YONB 1Q1EA 1ZIOA 3PO3G 1EGAA 1P61B 2ZTEA 4DV6Q 2ZRHA 4JT2A 5LD2B 1II0A 4C0SA 2J0UA 2VP6A 4NL4H 2FFHA 4XWOA 4OX9L 5J4LA 4N0DA 5J40A 2VQEL 2CCJA 2NGRA 4PSAA 2ZSEA 4M2LA 5FPSA 4D0NA 1YZ6A 2AHOA 2EYQA 1Z0AA 3BIFA 4JI4Q 1E98A 1U8YA 4LZZA 2QM7A 3T1HL 2CLDX 3AVQA 3QG5A 3CF5A 3K0AB 2LCFA 2FV8A 2YV5A 2XXAA 3B78A 3QBVA 3H15A 3KXLA 4NCKA 2B21A 4QJFA 3JZMA 4IPCA 2GJSA 2V1XA 1V9PA 3QJYA 1N6LA 2JEAI 1CF4A 2VSOA 2ZI5A 4JLKA 4DSNA 4DR4L 4OQNA 4XD7A 2E5LL 2Z0MA 3GDEA 2IEZA 1VIYA 5IHPA 2GZDA 1EQQA 4WA7A 3SJCA 2ZREA 1AE3A 4A3LH 4KO8A 3BK7A 1XXHA 2D74A 4EPTA 4AWXA 4FWIB 4AG5A 1N2CE 4MZ9A 3QXHA 5C4JH 1TUIA 2OXCA 3EPKA 3AEVA 1P73A 3RABA 2P67A 1E2MA 5F9FA 4M9SA 4B2LA 1E24A 1XD8A 2VUMG 1RZ3A 2CJWA 2HLDA 3K7UC 1T3SA 1WCMG 5DNYB 3WHKA 4LNQA 4LJ5A 5KO2A 2O8FB 1GNPA 2H16A 5FTLA 2RMKA 3GLFA 4P31A 3FKSD 1E3MA 1EX7A 1VQMA 3S1NH 1XMOQ 4BY7G 2IYQA 5EXXA 5SZJA 4ARZA 1ODFA 1CSPA 3JVVA 3AF3A 1E9DA 1YKSA 5DLQE 3HR8A 1ZM2A 3HU1A 4HLUC 2N1BA 4P4TA 1EWQA 3C5CA 3AVOA 5B30A 3RS7A 4FMBB 2K50A 1PHJA 1UJ2A 1Q1BA 3X2SA 5KDOA 3KDFB 2ANCA 3TRZA 4GKKL 4L5QA 2OE2A 5ELNA 2QRNA 3K9NA 4KFRA 1W4AA 2HF9A 4JL8A 4QRHA 2G88A 4QHSA 1NY6A 2A5GA 3LLUA 1RKBA 3J80i 1BIFA 2ZI6A 1GNQA 3GEHA 4IVRA 1HQYE 1NY5A 1UKEA 3W8NA 3HR7A 3W5JA 1HZBA 4JLOA 1VQ5A 2FF7A 3BJUA 2QAJA 1EWRA 3JAMc 3LW8A 1IN4A 4NMMA 3K70C 3KLWA 5EXPA 3KX2A 1E22A 1IL2A 2CHQA 4Q7MB 3C14C 3N5CA 1BYUA 1CLUA 3B8HA 5JSZB 1J5EQ 1I6HH 2QBYA 5C3EH 1KO4A 1Z6GA 4DV5L 2JEBI 4V0KA 1OFTA 4LX0A 4OI2A 3FDIA 4B6FA 2OBLA 4DDUA 4LWZA 2MMCA 1MABB 5BW8A 1LV7A 4DV4Q 2ZTCA 1KKLA 3ASZA 5SZHB 3GTLH 1E1QA 4RMFA 4A3IH 3FE2A 4DUGD 4MGZR 1FJGL 3AGPA 4JBXA 4NYJQ 4X8OA 2BDTA 4XH9B 1NY4A 1KSHA 3A5UA 3D3QA 1XD2A 2LWIA 4QHYA 4EQ6B 5BN5A 3UDFA 1IHUA 2Z4RA 4G0NA 4PANA 4DBLC 4E09A 2UUCQ 1SHKA 2QEXA 4FW9A 4X64Q 3VDYA 1FMLA 4Q4HA 2LXKA 4JI5Q 1Z0FA 2CL6X 2QAGC 2QROA 1T5IA 1KYIA 2GESA 3F5FA 4KV9A 4X6AH 4U7DA 2FDCA 1K73C 3PUVA 4CVNA 4LF4Q 5A4JA 2P0EA 1BS1A 3O8RA 2HYIC 4Y0VA 1U0JA 1CEEA 4JZKA 1I4LD 4C2MH 1BO6A 3HOZH 3SJBA 1ZW6A 3HOWG 2J1LA 2VSFA 4FXPA 4HZUB 3NHBA 3ZJYA 1S8FA 1D2EA 1KO1A 1VIAA 2REXB 3W6PA 1AE2A 1EFHA 5A5GA 2ZPTX 4IXMA 3SS8A 1XJCA 3T1OA 2Q2HA 4KHPL 4DR7Q 2GF9A 2JEOA 5FUVA 4A6PA 1SFOH 4DWJA 3U44B 1IBKQ 4TT3A 1KSGA 4URXR 4PFSA 4BASA 2DR3A 4KFUA 3RANA 4D26A 2BBWA 4YHHL 1TUEA 3RR5A 1DAFA 1XU4A 2HIVA 1HV8A 2UUAL 3V4RA 1OPXA 4DV7L 1US8B 1QVCA 3N70A 4HATA 2CDNA 1S72A 4PZLA 1DPFA 4HB4A 2C35B 3DPUA 5ANRB 1ASZA 4PQYA 2O8BA 1OXUA 2AFIE 2PJZA 2W0SA 4FI3C 3CCQA 4LWCA 3FMIA 1S96A 5JHGB 2QENA 1ZM3A 4YMVA 2QRZA 1TMKA 2D0OA 4OX9Q 3A1VA 3K0EA 4GLAC 2ORIA 1ZAKA 1J7KA 4L4UA 2XTNA 5KSOA 4BRUA 3KQLA 4OWWB 2WSSA 4MRVA 3F2BA 4HIOA 5GVSA 3CWZA 4MKHA 1AKYA 4BLOA 1E9FA 2N49A 3CQZH 2FEOA 1UE7A 5DI9A 3QKRA 5GJWC 2Q2UA 1QHYA 1Z6TA 2BKEA 3OIYA 4LFAQ 2D0PA 3BC1A 4BRWA 5JI3E 2HHHQ 1Z47A 2ZANA 3EAQA 5KSYA 3DO6A 3U7EB 4JG2A 4AYBE 4DPGA 4ABYA 3IGFA 3SQXA 1I94Q 5JJLA 1CR2A 2IYXA 1UEJA 4HAVA 4M1KA 4M1MA 3U7HB 3I72A 1SXJB 5J3BA 1HY3A 1II8B 2IYYA 1GKIA 2C96A 2YVUA 3W1GA 4HEJA 1M7GA 4A0FA 5JECA 5KPDA 1XMJA 1FL9A 5HZKA 1ZU5A 4TLDA 1HZCA 1E9BA 2OAP1 1BBUA 4Z8YA 2A3RA 2GVAA 5KSZA 4BY1G 2XAUA 1L1OB 3DZDA 4UPAA 5JFGA 1YZQA 4DV0L 3DDCA 4URZR 3UE1A 2IS6A 4CGZA 2CMKA 1XTDA 3DMDA 2GEDA 2ZJAA 2OCAA 3O8DA 1IY0A 5FL7D 2GZAA 1E1RA 1G21E 3FHOA 1ZM9A 4NB3A 4IDQA 2LXJA 3KJGA 1XCGB 3KDSE 4O0AA 3IIJA 2UU9L 3PG5A 4UNRA 1E1TA 4DV1L 1AH9A 1HNWL 1UEIA 2AN9A 4QOSA 2XB2A 4LF9L 4IXNA 3KYHC 2WSMA 4MYUA 2MSDB 3SI7A 2DFNA 2G77B 3A37A 1LFDB 2WM9B 1KL9A 3NIBA 1Z2AA 5E4FA 3KQHA 1X65A 2CEAA 1P8LA 4DAMA 3CCMA 1CR1A 5EE0A 2DYKA 4P33A 1FVIA 3VTKA 4WIAA 2J3EA 1Z63A 1E2QA 1NSTA 1PUJA 3RS3A 1TQDA 1E94E 2GEVA 3BERA 4IEIA 4DR3Q 4ZIRB 2GKSA 2IYUA 4OK6A 1X6VA 1C9OA 1ZM4A 1F2UB 3U3KA 1N6PA 1XCMA 1FFHA 5GADl 5FPTA 3CC4A 4C3IH 2A9KA 4Q9KA 4LBWA 4OI4A 3SHFA 2WPDD 4Z1MA 4A3EG 1C9KA 1XEXA 2ZAMA 2XSZA 4KYIB 1YZTA 2G1KA 2QPOA 2HXYA 3QXJA 2VHTA 4NKRA 4FWTA 1ASYA 2WAYA 3AFQA 2GBLC 3DLLA 5TY0A 2JJ1D 3IDQA 3EWAA 1EWIA 4NPSA 1DAGA 4EFNA 4DV3L 1J8MF 4B3TQ 1COWD 1YHAA 4TZ6A 1ZM7A 3WMFA 1XNRL 3FWYA 3I4OA 4DV5Q 4PSVA 2X19A 5DSZA 1TWHH 3ZGXA 2NOAA 3B1ZA 1JECA 5M5XH 1KI9A 3EC2A 3HOYH 1VQFA 1Y3AA 3L0SA 1DAHA 4Q21A 3UG7A 1IN8A 5TB5A 3IEUA 2C9OA 2CE2X 2GEUA 3ECCA 4Y0AA 3S1RH 4B2PA 4A93H 1QUQA 2IW3A 1NVVQ 3HYRA 5IF9A 5K8IA 4OBEA 1G8FA 4AH6A 4Y7NH 3QKSA 4LJ8A 4RFSB 3OTOL 3TK1A 2OQKA 5IWAQ 5BR8Q 2DWPA 4G1UC 3UWKA 4PR0A 2YOFA 3DM5A 3PIRA 3DZ8A 3ONWA 4MDFA 3M4QA 3LFUA 4LBYA 4G3XA 3I4MG 2IUUA 1NMXA 2FFAA 4ZCMA 5FLMG 1AA9A 1IN6A 5LMUQ 1Q3TA 2AXNA 3RWMB 3QQ5A 3UDXA 1H8HD 1YBYA 3VAAA 4V02A 3K7AH 4DEXA 5CM8B 2GBLA 3ZVLA 4GP7A 1SLJA 3GD7A 2IXEA 4D2IA 4IDOA 1XTIA 4HUQB 4DLTA 3RRYA 1W4RA 1KAOA 3B2EA 1PYBA 1PZNA 4CEHB 4LF5L 4MUAA 4AG6A 3EZ9A 1MIUA 4YCUA 1KKMA 1VYUA 1FPMA 2FJUA 1LVGA 2ZE6A 3ZH9B 2K14A 2GVZC 1QHGA 3U4QB 1OIWA 3CH4B 1SE8A 4M9QA 4DIDA 1IM2A 2PBRA 2QY9A 4BBSG 3FFBA 5DHFA 4UNNA 4X65L 1T9HA 1KZ7B 2A8VA 4M53A 3VQTA 3E70C 2G83A 2ZRCA 2K4KA 4OK5A 3WP1B 3G0HA 4PAQA 2PZEA 4A76A 1AGRA 3BE4A 2V1CC 4KVGA 4BFWA 1G7RA 4Q1EA 3M4YA 4XTRA 4BXXG 2G1JA 1PFSA 2GDJA 4QM6A 1GVPA 1YIJA 4ILEA 5GROA 1G3UA 3P32A 1F60A 2VS1A 3P27A 1WQ1R 3HFZB 1E2HA 4IOMA 5KOYA 5AJVB 1X9NA 3CRRA 1RPZA 3S17H 4W9MC 1R8SA 2R92G 4GLXA 5M3FG 5FPHA 3RYTC 5DI3A 1AN0A 5LDDC 4QJ5A 2F55A 5CYOA 3TJZA 5FOWA 2IL1A 3NTUA 3L82B 1YVCA 1KO5A 2AK3A 1I50H 3HOXG 1SQ5A 2RGCA 3AF1A 4M1WA 5AJXA 1SR3A 4WW0A 1YZKA 2PZGA 3PO2G 5H8WA 1G4UR 1KK0A 4TZ0A 1T6NA 4D4LA 1W0JD 3EPHA 1AQYA 1EIYB 1M2OB 1FOEB 4BE7B 4B3XA 1JMCA 3T35A 2OESA 3MFYA 1OKKD 4Q9HA 3X1XA 2OCEA 1YJ9A 4CT4B 4JBKA 4QGFA 5AJ3Q 1XRJA 8OHMA 3J7A5 2PX3A 2CL7X 3EZ7A 1FP6A 2VYFA 3VU9B 4DCTA 1BKDR 4R4IA 1JB1A 1II9A 3A4MA 4DLWA 4DXAA 3S14H 1DVRA 3AF2A 1F2TA 2ANBA 2GZHA 1P5ZB 2ZYVX 4RD4A 3T34A 2XGJA 2FSFA 5AUOB 4KI0A 1LTLA 1XTQA 4DV0Q 3VR6A 2VHQA 4LUVA 2JA6G 1IXZA 2OM2A 2IHYA 1P6XA 1IYJB 4PC6A 5LPNA 1P7CA 2EYUA 1F6BA 4WJ3M 5E7JA 4Q4LA 1TXYA 2Q3HA 5C4XH 4DSOA 3SQWA 2O8CB 2F52A 4AKIA 1L2FA 2GJKA 5DO9A 2G0NA 2REBA 4M22A 5CLQA 3FMFA 4DZZA 3BFXA 1P9NA 1HNWQ 2BMDA 1R0ZA 4A3GG 3IEVA 1HR0Q 1JXOA 1QHHB 3FKIH 2QM8A 3TVDA 5BYJA 1XBTA 1JJVA 3NENA 2RGBA 3S2HH 3UG6A 3LWNA 1KI8A 5LBIA 4LUZA 3EWSA 3TVTA 2HCJB 2ZROA 1E1OA 2YTYA 4DCUA 1XMQL 4BUJA 4E22A 1GD7A 1M1KC 1YZLA 3GJ4A 5C4GB 2OCPA 4YWKA 4C0JA 4F4JA 1OE0A 4LHVA 2ONJA 1WRBA 2JASA 4B48A 4RCZA 3L0OA 3A36A 4QL5A 1PYSB 4DDWA 4URYR 3ZIAD 3SYNA 5J4KA 2JLVA 1YEZA 1YQTA 2W6IA 4HLQB 3L7ZC 1XPRA 3F1ZA 2EXDA 2AFHE 2FSHA 1LB1B 4H02A 3NVAA 4X66Q 1W48A 2FEMA 3UDGA 3QE0A 4YMSA 4TYPA 2PI2A 1QF9A 2RH5A 3T61A 4QJ4A 4AC9A 1NIJA 1WJJA 1Z0JA 3OESA 3TUIC 5C44H 2Q9CA 5EUMA 2C03A 1E79D 2NVQH 4NYJR 2IS2A 1TQ6A 3KB1A 1KDOA 5KTYA 1OHHD 4PPNA 3NBHB 3TMKA 1T0HB 5CK5A 1G5TA 2K52A 1VDZA 4ITRC 1OSNA 2ZAOA 5K8UA 4B33A 2OILA 1U98A 1O7IA 3P26A 1K8RA 4JI2L 5IT5A 2IS1A 4S2EA 2XITA 4MTNA 2E9SA 2GAAA 3J81i 1FUUA 1N6OA 1K5GA 1K0RA 3U4VA 3HKZE 1DS6A 4MRRA 5FTJA 3T1YQ 3OTOQ 1OF1A 2BKUA 2PL3A 3CBQA 5CB6A 1E2FA 1G8GA 3NBXX 1IBMQ 2P6NA 3SEAA 3OEHA 3NC0C 1WP9A 4GDFA 3CCRA 1WOCA 3S1MH 1J70A 2Q2IA 1PLKA 2WVJA 4DK3C 3NBYC 4XSHA 4BA2I 4M0LA 4PPQA 4CZ2A 3L2OB 4H1VA 3R8CA 4DV6L 3WXMA 3NKVA 4QL3A 3ADKA 2FG5A 1DG1G 4JMPA 1UF9A 3AVUA 4B3GA 2HT1A 2FPKA 1SROA 3EPJA 1TF5A 4GOPB 4J15A 1NLZA 4U00A 2QZ4A 2GJAA 4IPGA 4JLNA 5FBRB 5IY0A 3I61A 1NSFA 2FNAA 1JALA 3THXB 4GNXC 5AJYA 1G9XA 3PJRA 4IRUB 4JI4L 1S9HA 4OQFA 4LF5Q 2WB1G 2ZVQX 1G6PA 1ZNYA 5L3QA 3H3VH 1Z6YA 5FOSA 1HNZQ 2ATVA 4IJLA 4B74A 2OWOA 1S4QA 4WZAE 1E0JA 4FIDA 521PA 3QG1A 2WJJA 4A3DG 3HKSA 2IUTA 3GLHB 5FL3A 2ZM5A 4OJQA 3UWOA 4NCIA 4EUNA 4C2UA 3ADBA 2ZI4A 1KK2A 4D6PA 3ZZUA 2FWRA 4HJ8A 3S16H 1SVWA 1JR3E 1TX4B 1WFQA 4RSGA 1SHZA 5GJVC 1TEXA 2OO7A 1JJ7A 3Q7QA 4TMXA 5B2ZA 2BA0A 3WRYC 4QGUA 1Y63A 4RG1A 1N34Q 3G82C 4GKJQ 2UVQA 2WIBA 3R20A 4NP6A 5FUXA 2ZRMA 4P4SA 5CIQA 2R65A 2RHSB 4GPTA 2I1QA 5C3EG 2ZUDA 4TQAA 3TQYA 3Q9LA 2JDIA 3ZZ0A 4GLVB 2J0VA 4HDCA 3THWB 1DADA 4B3BA 4A75A 1M90C 4JKYA 3QF7A 4P72A 3EZ6A 4A3IG 4WOPA 4C0LA 1TU3A 1DAIA 5D3MA 1ZCBA 2E8GA 2NVTH 2FZ4A 1XMOL 4UJ5A 4HIDA 1EYGA 4QG7A 1KNXA 2KBEA 4ON9A 1Z9FA 2AXPA 2GCOB 3AUXA 3K1JA 4V0MA 4B34A 2GRJA 1PJRA 2B7CA 3A4LA 5JWRA 4JI3Q 2O0JA 3GLGB 3VHLB 3CAMA 4PO1A 4B76A 4BBRH 3E1SA 4LPKA 1S3OA 3HOZG 2ODNA 3PR1A 4BFXA 4GI7A 3X1DA 4YQFA 3CX8A 4OHXA 3WRXC 3LNCA 1XJVA 1YJ5A 2GVBA 1Q7YC 3STBD 1AGPA 1EOVA 1U94A 3K8AA 1W46A 2V3CC 1D9XA 1YR6A 4NCNA 3ND9A 5C1BA 1X86B 1T3HA 3K0FA 5DH9A 1VQGA 3U58A 4LF6Q 3MJHA 3FKQA 3RRMA 3TR0A 3MAAC 4DLYA 1E69A 2ID0A 2YJTD 5JLJA 3AQQA 4AURA 3IPXA 3EXAA 2NMVA 1Q82C 1VMAA 3IILA 3OFNA 3AQ4A 4TWZA 3UPUA 2WAQG 1IN5A 1LM0A 3E9IA 4PC2A 2ZJ5A 3AVPA 3NEMA 3HOVG 1E2JA 2XOKD 1J5EL 2HJGA 3AF0A 3QXXA 3DHWC 1WCV1 2QTVB 3QPWA 3KXIA 3C4JA 4JVNA 2WMNB 3IHLA 3SC3A 1KTVA 2JLRA 4LJ6A 2CBZA 3BXZA 4HAUA 4NE2A 4DV4L 1TAGA 2ZQ5A 3NDPA 1NRJB 3A1TA 1BVSA 1X56A 5JHHB 1V43A 1H65A 3OIUA 3QBTA 1T3LA 3SOPA 2NTYC 2A2ZA 4ASUA 1KI6A 3GP8A 2DGYA 4KXFB 2UUCL 1P2SA 1GL7A 1TL7C 4ZKEA 2H7VA 5B64A 1CR0A 2IYRA 3CP0A 4X64L 5IYBG 2QQ0A 4YMWA 4JI5L 3SHWA 4UP7A 1Q21A 4C4PA 2Z83A 3TKLA 4TLAA 4LF4L 2DWQA 2NVXH 1E3PA 4ESVA 4H9GA 3HPQA 4JLJA 5HE8A 5GQOA 3QUSA 2MSCB 3Q72A 3AKCA 1U5KA 3V00A 4DV2Q 2PLRA 4C30A 2VF8A 3TRFA 4E07A 1CKNA 3DVLA 3CW2C 3OEEA 3GFPA 4TYWA 1B0UA 3GJ0A 4MGIR 1XMSA 1RRGA 3RN2A 2PQAA 1LW7A 4DR7L 2Q0HA 3BD9A 1EFCA 2EFCB 5C46F 1NVVR 1KK3A 2OZEA 1Q1ZA 2J0UB 4JBYA 4YY3Q 3KQNA 3KKPA 2JIZD 1P9RA 2FOLA 1P2TA 2NZOA 4C3HH 2ERYA 2BOVA 3CMAA 2L0XA 2NO0A 2QPAA 2WWHA 4F91B 4JJZA 3O8CA 1WBDA 1G8YA 4CF7A 2WMOB 1P2UA 1KI1A 1UKYA 2VP0A 2AHOB 4LF7Q 2Q2TA 3PITA 3K09C 4RD6A 4YDHB 3EX7C 4B3RQ 2VQSA 3GEEA 4HUTA 3IIKA 3UDIA 2ZYUX 3CNOA 4DLSA 2C95A 3WP0A 4K81B 5JEDA 4ERNA 4B3DA 3KB2A 4NYIQ 2XXAB 2ZRAA 4HAYA 2HJVA 1Q57A 3QSYA 2F7SA 3E9HA 3KUDA 2B92A 2JA8H 4IOCA 2VHUA 4LHXA 4Q4AA 1NJGA 2ZTSA 4LJYA 3IBYA 4NZYA 2N8NA 3U3MA 2JK8A 3KKOA 5A0FA 4DLRA 2XNSA 2K5VA 1YRBA 1JJ2A 4W7SA 2ZRLA 1KQSA 2PMKA 3CW2A 3LY5A 1XXHB 5TARA 4DLVA 1G5RA 3AKYA 5JRJA 1XTRA 4JI7Q 4LFAL 4Q1DA 2UXBQ 3PQCA 2DBYA 2HHHL 3PEWA 1J90A 2IK8A 3K0CC 1Z07A 3J80c 3MSXA 3TW8B 1B23P 1I94L 1ZNWA 1X1SA 2OUKA 4G5GA 3B7GA 2R93G 2CJWB 4IKEA 5GAGC 1VQ7A 4KSBA 3K09A 3TS2A 2NPFA 4LJ7A 2IYSA 5FUWA 3GLFB 3GLIA 1NKTA 2H18A 4JOIA 3HDTA 2K5HA 3KTAA 3Q3JB 4LBVA 4ARZB 1G7SA 1CUKA 2ZJBA 4Q4JA 3TH5A 4AKGA 1G8HA 2AWOA 2WWGA 2ZSBA 2QTHA 1K9MC 2EQBA 4ACBA 1UE1A 1DARA 4DK6C 2KI5A 1KMQA 1JI0A 2WWXA 4UQOA 1HQCA 1X1RA 2ORVA 3TSOA 3HOYG 4A4IA 2XTZA 3RLOA 2FZLA 3UANA 1L2TA 2ZRDA 4URWR 2JLSA 4C0BA 4JL5A 2IY5B 2GK7A 2VHJA 4WXRA 4RFVA 1A62A 4A93G 2FA9A 1VG8A 4PZ6A 2WJGA 2QI9C 1N0WA 1EFTA 2FFBA 2R6FA 4CDGA 1MO5A 1N0VC 821PA 1VHTA 3OAAD 4DR1L 2P6UA 2JGNA 2FXQA 1RW4A 3AP2A 4P4UA 5E7MA 4MGKR 4DB2A 4DR3L 2JE6I 3QVUA 3K81C 3RZOH 4OHZA 1FGUA 4CEIA 4KODA 1S2MA 1C4OA 1WBBA 2NZHA 2BMFA 3DOFA 5AR1A 1VQEA 3PIOA 3LQQA 5EE5B 2QBYB 4XVUA 2LKDA 3GCGA 2ZM6Q 3NBZC 5KHOC 2CFMA 1AK2A 1FL0A 4XWKA 1E1QD 4JSTA 5CLLA 2V54A 3IO3A 1DELA 5C4MA 1VQ8A 2QE7D 4OQLA 4NPHA 1BYIA 1YI2A 4IOAA 1XD2B 5JEAJ 1CKOA 1GILA 3ZD7A 1Q12A 3I7FA 1Z0KA 4NONA 4TYQA 3GPLA 4JI0Q 4O2DA 1HZAA 1JQLB 1VG1A 3BB4A 3QEJA 4Q4HB 5DLQC 3U6BA 4B3TL 3EIEA 3VNVA 1ZVQA 3LLMA 3W6OA 1GTVA 4R4OA 1B70B 4O2RA 2KBNA 2GHIA 2ZSFA 2QTFA 4BLTA 4TLEA 4FCTA 2GILA 2QNRA 4W5JA 3VKGA 3FKSA 2ZI3A 4HLUA 1OH8A 1FMJA 1YVDA 3W3AA 2YKGA 4JVLA 3RWOA 1RRCA 4QC2A 1NF3A 2WJHA 3W9YA 3K70B 2VF7A 3AF4A 3ZVNA 1ZBDA 4ZI3A 2OBMA 3OIVA 2O0HA 1XTJA 4CYMA 1D7QA 2G0TA 3GTMH 1LF5A 5IWAL 5BR8L 4IO9A 2QN6A 3RLFA 4GZLA 5DYIA 4F7WA 3PIPA 1S3GA 2FH5B 4POFA 4HAWA 1PA6A 2J0SA 3MEFA 2R7DA 4LYHA 1CJMA 4D0GA 1W7AA 4M1SA 5LMUL 4QXAA 3B9QA 3AYHB 3KF8B 4BFYA 2WOOA 4KJZA 2IBMA 3SJZA 1A1VA 1LF0A 1QZXA 2CCGA 2CXXA 1MJCA 4A9AA 1CRQA 1VQOA 1U0HC 2O8BB 3CD6A 3CR7A 2EFGA 4DLZA 2P65A 2J41A 4KFTA 3ZYCA 1E0KA 1M6NA 2ODBA 2QMEA 3OIWA 2RGNC 3QPUA 3UKDA 2WWIA 2BM1A 4BECA 5C18A 4KITB 1J6QA 1UWVA 4RD1A 5FOXA 4M9XA 3AKEA 3S24A 1YNXA 3LW7A 1HA3A 3RSOA 4A1FA 4HI0E 3W6NA 2LSSA 1N0UA 5BN4A 2RGXA 3OE7D 2VRWA 4MNOA 4XOIA 2HCBA 3CPEA 3HOUH 3QKRB 4PSKA 1KSJA 1YE8A 4P73A 4DUGA 2E2JH 3A5ZB 4AKEA 2ZJOA 4B71A 3PV0A 4TN1A 4A2QA 4GBMA 1BMFD 2QAGA 1SXJE 4A2PA 3CMEA 2EFHB 3GTOH 1NBME 5JEEA 1X3GA 2YNMA 3FMOB 1IJEA 5FTKA 4K46A 1PVOA 3W8RA 1NNEA 4LUOA 3FKIG 3TE6A 4EPVA 4OYHA 1N3BA 3IBGA 1G4AE 2IT1A 2WWFA 2PT7A 3BH0A 3U6KA 3L8YA 4QIWE 1N5IA 4QFMA 1XNQQ 1G41A 1ZYUA 2BJWA 3BAFA 4WZBE 5FI1B 5G3ZA 2CWAA 4YWLA 3TAHA 3CC2A 1VQKA 2DB3A 1XTKA 3KFVA 1GFIA 4Q1AA 4A2WA 1D8TA 4EFLA 2RGNA 4PTLA 2J7PD 1B8AA 2C77A 2ECKA 1SXJD 3QENA 3M0EA 3Q5EA 3A4NA 4CEJA 1NBMD 2E87A 2VPPA 4UJ3A 4A0GA 3KKQA 4NYMQ 2AR7A 4XVQA 5AJ3L 1MR3F 1E2DA 3KJEA 3JVUA 1KGDA 5AUQA 4LPSA 1XEFA 5UKDA 1GG2A 1MV5A 1CR4A 5KDLA 3A74A 3A8TA 3CLVA 4US1R 1T0JB 2W2TA 3MWLA 4IOLA 1QHIA 2I3BA 5HR5A 3LX5A 1CP2A 1N8RC 3NH9A 4RZUA 4JI6Q 4UY8C 4A3JH 3SBDA 3VMFA 3KQKA 1AQUA 5C44G 4ALPA 2G3YA 4JBWA 3ULPA 3GFOA 3HP1A 3MGCA 3B6EA 3T5GA 1XZQA 3WBKA 2MMGA 1HNXQ 2QP9X 4LK2A 2IX3A 4E03A 4A3KH 4IHQA 2B3GA 3NELA 1WA5A 4A3BH 1KI2A 1TF7A 3C7KA 4AKHA 2VP4A 5DISB 4ZI2A 4JS0A 1A63A 1HR0L 1QG2A 4JVMA 2Z6VA 5CYPA 1EFRD 1XEXB 4O2LA 5FBQB 3UMRA 4PHFA 1VQCA 2BMEA 3BORA 3FGNA 4LDJA 1OIXA 1KIMA 2Y0SE 4B3CA 4BZQA 4DLXA 4Q19A 1V1QA 4DR1Q 2ZRNA 3I5YA 2ZSDA 3MWJA 5ELXA 4YMUA 5K8TA 1E2GA 3QF4A 2C2HA 2EU8A 1KO7A 1YRAA 1S9DA 3EIQA 4OXPA 3LAWA 4TLCA 1NMGA 2C9YA 3SBEA 2XGTA 3CCUA 2AD1A 3AEZA 3G5UA 4HJ9A 3GJ3A 1F48A 2CK3D 3Q7PA 2YWEA 4DRZA 3ND8A 1OXXK 3ZS9A 2BBSA 5J4VA 2QT0A 1C0AA 2Q3FA 2ZRFA 4A3MG 1H8ED 1R2QA 3MD0A 1ZINA 4DUYL 1T4GA 4LJ4A 4ZDKA 1MO3A 5M5YH 1GAJA 5CITA 3U3RA 1CJTC 1VS0A 4OK3A 4MYCA 2MO0A 3CZPA 3QI2A 2A30A 4JIMA 1QUQB 3PCOB 4LV5B 3C5HA 1KMHA 3X1YA 4DHEA 4PO9A 1NG1A 3WNCA 1W36B 4MKFA 4RD3A 4LFBL 4X66L 4GL2A 3QKSB 1TF2A 2R6CA 2ZJ2A 3BFVA 2IF2A 2OG2A 1UDWA 5FL7A 3GO5A 1V5WA 4URUR 4PQRA 1HUQA 1IONA 4PXAA 4BLQA 1J99A 4GSYA 3RN5A 4IDPA 1SN8A 1R5OA 4DCNA 1P9WA 2UXCQ 5G3YA 3U3OA 3C15C 5HPYB 2KB0A 5FI0B 1X6OA 2H92A 2A7QA 3KF6A 2NO9A 4UXHA 4BFUA 4P3YA 1R7RA 2QMOA 4AQYQ 4JL6A 3AP1A 1P72A 2C8VA 4I1OA 3RNLA 1UE5A 1AKEA 2J45A 4LHWA 5EJEA 1ZD9A 3MMPA 1VYTA 5KNCA 5FPKA 3T1YL 1I4DD 4UP9A 2BBOA 4LC0A 1IBML 5HZHA 4MRNA 5L3SA 2HYDA 3GJ6A 2F1RA 1P60A 3QIAA 4Z8XA 4ZKDA 3TUZC 4RZ2A 5KNBA 3CONA 4LJ9A 5HKKD 2QORA 3B6YA 2DCUA 3UIEA 1WCMH 3FYHA 4F4IA 2IX0A 5HE9A 5AJWA 2WPDA 4AIIA 2N3SA 2BHRA 2OCBA 4TSFD 1PH2A 1G51A 1GP2A 3RS2A 4JV5Q 2OXRA 4OO1G 3MLEA 3D8BA 3QKTA 2YOGA 1N33Q 1T8TA 2JJ1A 1HJPA 2AWNA 3LBHA 4LFCQ 2QGZA 1PLLA 2UZ3A 4BBRG 2G9NA 5IDVA 1JBKA 1COWA 1HNZL 1F5NA 2X8AA 4IVQA 4QBFA 3B82A 5DI3B 4IOKA 4M4SA 1OH5A 4NYIR 4M1OA 3MUFA 4A3FG 1S3SA 1VQNA 1W49A 2ZI9A 3NEYA 3UXMA 5M3MH 4YXWD 3M7NA 5IP7H 4QBIA 2BH8A 3T12A 4Q66C 3W3ZB 2CLCX 1L8QA 2R2AA 3OF5A 1EQRA 2XTIA 1E4YA 1N36Q 1JEEA 1P3JA 5F3WB 2J46A 1Q3HA 2IC5A 3CXCA 3VHXA 1DEKA 1G291 1N34L 2QP3A 4GKJL 1H95A 5G40A 4EFMA 2QA4A 2CHGA 2WWYA 3ZDQA 1Y1WG 4BGDA 2N78A 3MWKA 3CWQA 3HWSA 1JXMA 1Z3IX 4LY6A 1WB9A 3M4PA 1I2MA 1F2TB 3KL4A 1H8HA 2BCJQ 2NG1A 2PJRA 5FJ8H 2H5XA 4FMCF 1IOZA 4KLZA 4B47A 3TQFA 4D81A 1Q22A 4Q7JB 1D8LA 2QU8A 5FBLB 3AVWA 1FNNA 5IK2D 2V55B 2OEPA 5KDDA 3LGJA 1GZSA 4XSGA 1MO4A 4OL0A 1UM8A 2F4VQ 3H1TA 4JI3L 1Z29A 4HB2A 4Q5IA 2RHDA 3NHAA 4NXNQ 4DLUA 2P6RA 1QVGA 1VCNA 4YC7A 5HCIA 5LMNW 1E0SA 2X2EA 3P4YA 3RS0A 4X62Q 1ZMXA 4XJXA 3SNHA 4QM7A 2CQOA 4DAYB 5FTNA 2B63G 3GJ7A 1FUKA 2Z4SA 3CC7A 1TADA 2PI2E 1C1YA 1ZUIA 2CL0X 5SZKB 4LHZA 3PGZA 1TWFH 3HYTA 4PO8A 4S35A 2NO6A 3B1XA 1E2LA 1UBGA 4KFSA 1C7YA 3OZXA 2ONKA 4V0NA 4BEBA 4LF6L 2VHCA 4Q47A 2ZRBA 1R0YA 1HYQA 4Q9JA 3L0IB 3WMEA 3PEYA 1L7VC 4M21A 1PH6A 1FX0A 1RVDA 4UXIA 1A8VA 3J81c 1E2NA 5FR1A 2E1RA 4DCSA 4HB3A 4AY2A 5IYDH 1HT1E 3VFDA 3VR3A 5JBQA 1FNMA 1ZNXA 2JAQA 2DY1A 1ETUA 3WYFA 3KKNA 1RFLA 4IFDG 1VQPA 5C0XG 2BWJA 2MSEB 3TSWA 4EJSC 2D2EA 4EKDA 3DEFA 4DR2Q 2KSQA 4US0R 1KHTA 4D0LB 1E2IA 1Y14B 2XZPA 2ZEJA 1HE1C 1W0JA 4DR6Q 3O47A 3I92A 3KJHA 1ZUHA 1UFQA 1OKKA 5JI2E 3UE0A 1TWCH 2MQHA 5K8LA 1X55A 1E9SA 3SDZA 4DUYQ 3F3YA 2IF0A 2FPLA 1FQKA 2GK6A 2V1UA 1XFAA 3A0JA 4BLSA 4TL8A 4BZXA 2IEYA 3QOFA 3SGIA 1E2PA 3CF2A 2WJYA 2MO1A 4PC3A 4LFBQ 1SVIA 2NO7A 4JYBA 3L2PA 4AYXA 2V4ZA 2IX1A 3NH6A 4DV2L 1I2DA 3HU2A 5FFMA 3TW4A 2O8EA 2O8DA 2JJ2D 4JBJA 2QG6A 1TPZA 1NBWA 1YHNA 4LYAA 4V03A 3K0SA 2IA5A 3LA6A 2UKDA 1GOTA 4IDHA 1JEDA 4YY3L 1N5JA 2J9RA 4L9WA 4PAOA 2ZUBA 2JA5H 1IJFA 1XDBA 3KFUA 4A3LG 3AP3A 3FVQA 5L3RA 4EJSA 3KQUA 3CRW1 4N3NA 5DN6D 3CCSA 5KU1A 1OYWA 1G7TA 4LF7L 4Q1BA 4RVCA 4K8OA 4B3RL 2DUDA 1EFUA 5BQ5A 3THYA 2WAQE 2K75A 3NBFA 4BFVA 5L3QB 1CRPA 2XNDD 2DFTA 2ATWA 4LBZA 3GLHE 2ZR9A 2V7QD 3OYYA 1Q86C 5CDFE 3EIHA 3THOA 1KAWA 5IRCD 2NN6G 4J0QA 3B1YA 3FPAA 1ESMA 2BBTA 2C99A 4GP6A 3U2QA 4QNRA 1WE2A 1MT0A 2ZRPA 2ZJRA 3BH7A 4LCBA 2KHIA 1JJGA 3CCEA 3ZIAA 1M7BA 4BQSA 3H0KA 1IAQA 4APVA 4G5OA 4WAUA 2FMXA 2ZE5A 2XJ9A 5TVKA 1LY1A 3I73A 1WMSA 2A5FA 4HLCA 3S1AA 2JLQA 4JI7L 1J8YF 5JS8A 4B35A 2UXBL 4R7ZA 4TMVA 4P4SB 621PA 4URVR 3O8BA 1GO3E 1CSQA 3BB1A 1E79A 2R8RA 5B57C 4PHGA 1OHHA 3EW9A 5FOUA 1GVNB 3JC66 2C5LA 5GVRA 4NBSA 1IY1A 4HJ7A 4F93B 1AZTA 3AUYA 4ME3A 1R5BA 2CNWD 3AFPA 5D3MB 4FD2A 5TMPA 4GMDA 2ZRKA 4MYHA 2R7ZH 3U5ZB 2ZS8A 1KI4A 4MA4A 1XEWY 4Q02A 2JJ8A 4BLRA 5JJIA 1M74A 3GLGE 1CIPA 2ZE7A 2A78A 1U9IC 2GA8A 4YDSA 1KDPA 4LGMA 3IQXA 2AKYA 4B6EA 1IQPA 2I0QA 1XMIA 3LO5A 1KJWA 1ZD8A 2BC9A 5FBWB 3EBEA 3TEHB 3TNFA 3X1ZA 1HH2P 3PUZA 1UE6A 4GNXA 3TAUA 4AI6A 1GL6A 2R6GA 2IYLD 2IYTA 2RKOA 5EP1A 5M04A 1HZ9A 1DTSA 3EA0A 1JT8A 4NYMR 4ZPXA 1JR3D 1K6MA 4Q7LA 3WBJA 3G48A 2ZJYA 3SYLA 1K3RA 1G6OA 3K0FB 2J5XA 1CKEA 5KNDA 2IXFA 1ELOA 1L0WA 4JI8Q 3UATA 3GTPH 1FZQA 4TYNA 1NVXQ 2IHFA 2Q9BA 3WMGA 1TQ4A 2Z6KC 4GOJA 3HJNA 2FE4A 4Q03A 3BZKA 4MH0R 3T06B 3K8YA 4JLBA 2F43A 4JC0A 1KOFA 2WIAA 3I4MH 4B75A 1GM5A 5FLMH 4OHYA 2F6RA 1VQHA 1G19A 2W58A 3BJIC 2ZM6L 1E32A 4WVFA 3U4ZA 1M8PA 2QGNA 3AH8A 4ZDJA 1P16A 3B13B 2DFLA 2PX0A 2RGDA 1AM4D 1W5SA 4MUBA 1X3SA 4BLPA 1QHXA 1MKHA 1U9IA 3F8TA 3STBC 3K0XA 2H57A 2BVNA 1UEBA 3R7WA 3WNDA 1KI6B 1NLFA 4XVRA 3E5HA 3U61B 1O87A 1P2VA 3PEUA 5IP9H 4IJMA 4JI0L 1W0KD 3M3YH 2BCGY 4KSCA 3SFZA 4ZCIA 1PLJA 1E2EA 4Z51A 1X8JA 2JLYA 3C41J 5CJPA 4M9ZA 4BBSH 4DUZQ 2QGQA 3KOJA 3HOUG 2ZI7A 3JZAA 1G7CA 3QXCA 2GXAA 4HJAA 5C0XJ 1O3YA 4EPRA 3OEED 4A8JC 1P75A 4RD2A 3TQCA 3TGPA 2YHSA 1CKNB 1E99A 4BXXH 2BIFA 2Z6KA 4EDHA 3R9WA 2WP8J 1KDRA 1QRAA 3RS4A 3HU3A 2XB4A 4NXMQ 1WI5A 4TLBA 1GDDA 2W6JD 2PQAB 3TREA 4WXPA 5EP2A 2QUZA 1GRNA 1CULC 1RJ9A 2F1HA 3C8UA 2WJIA 3L43A 1NN0A 1XF9A 4OHVA 1W3SA 3I4NH 4OQMA 2IWRA 4D4MA 4B44A 3ETLA 2JA1A 4C7OA 5FBVB 1ZUNB 2F1JA 5JCZA 4AYTA 4TYYA 1KC8C 1S1CA 4DSTA 1NJIC 1VQJA 3FP9A 2IYVA 4LW1A 3GTJH 1JB7A 1OFHA 5JZVA 4G5RA 5E3HA 4DT1A 2Y8EA 5K36G 4C0HA 1KRTA 1SRUA 1T91A 2YC4C 3CKLA 4R1JA 4MRSA 2IYZA 3FHCB 2A5DA 2VQFQ 4Q9IA 4NH0A 1JAHA 1E9EA 3F2DA 5J4HA 1W36D 2CVFA 4R4TA 3L8ZA 4Q4AB 4EPYA 2VA8A 4I1UA 2EVWX 1NKSA 4V0OA 5J4YA 4B3MQ 2C04A 2Z5FA 1W36C 1XXHE 2SHKA 3RC3A 1FTNA 4B3SQ 2ZITA 4TTQA 4C2TA 4A8JA 1VTKA 1VQLA 1OW3B 3WYAA 3VX4A 1XPOA 1ZJ6A
chains in the Genus database with same CATH superfamily
3LBFA 2H2DA 3P97A 3QU4A 4GMXA 2Y0DA 3OLVA 1KJZA 1XLVA 2PZUA 5KX5B 2F3UA 3H13A 5BVHA 4OP2A 4WKCA 5F52A 4ITRC 4Q18A 2OC4A 1W0CA 4G1BA 4NQZA 1XKQA 1OV4A 3PUWA 3CX7A 3BD7A 1XQVA 2C98A 1QCDA 1RMYA 2E2WA 1VL5A 1XWOA 1PJQA 1SVOA 4AXXA 5FBHA 1YR9A 2NPIA 3Q5DA 2YINC 2ZETA 5K3CA 1O0BA 1MKYA 3UFXB 1I5EA 2J87A 4LJKA 2FW6A 3UMYA 3MD9A 3JD3A 1XQ9A 3HADA 4PG6A 4FNAA 3KU4A 2B20A 1OZAA 3OKCA 3EASA 2F3VA 4ZO9A 1HEYA 5HDBB 3UAYA 4GE0A 1YS4A 4M0EA 1SXGA 2FKNA 2VNSA 1XDSA 3K1YA 1VMKA 5M5BA 3WWVA 3I2ZA 1K7XB 1A04A 4D45A 2QAGB 1ZJ5A 2ZIZA 4CKWB 2HWWA 2HA0A 2B8TA 3LXXA 4LTMA 3OCZA 3HG7A 3LZCA 3E2IA 3S1QH 4EJ2A 1SVMA 3QEAZ 4I50A 4FSHA 2PT9A 4A3MB 3UAZA 4F7DA 2DWOA 3EQ8A 4CWAA 1K27A 4DS3A 5GV7A 5EINA 2KHJA 3KR2A 4CQMA 7YASA 2Q6VA 3ADDA 2F4VL 3RD5A 3TAXA 1YITA 1SNOA 3DNMA 4Y9SA 1UK7A 1YB2A 1L1OC 2Q6TA 5BSTA 4AD8A 2DY0A 1P29A 1WDKA 1PYGA 4M46A 5L37A 3MXNB 4JK3A 5I7FA 1MJEA 1IZ7A 4GM1A 1MH9A 4RKFA 2O4XA 2ZS9A 4KHZA 1BNCA 5D87A 4E88A 2XOXA 5CVTA 3BGIA 5KYKA 1HYEA 1TA4A 3DL0A 4YCVA 4NU0A 3B85A 4GVPA 4A3FB 1X39A 2CYBA 4PG3A 2G04A 2KENA 3MQ4A 2CW0D 3GJ5A 2ZR0A 1HSOA 1DOAA 2P3QA 3B1WA 1QPBA 4QEZA 2R93H 3O4HA 3E15A 2MCFA 3F2IA 5H70A 5I51A 4JLWA 3VH1A 2FN4A 5F9HA 4ZIRA 1Y6FA 1F2UA 5C5MA 2ASEA 4RY2A 4UM7A 4OLAA 1AS0A 3DUFA 3D3NA 2YIMA 4ZYTA 4KXYA 2Z9BA 3IPYA 3NBIA 4XYEA 5DZSA 2QXUA 1MO6A 4FOLA 4MQFB 4W5NA 4IY1A 2CFIA 3HNRA 1Z28A 2BLLA 3FLAA 4LYGA 3HLYA 3P9YA 2CXSA 2J3LA 2HDHA 2BZSA 1D0IA 2QKYA 3GEGA 4OQQA 3ZE2B 4RPHA 2W00A 1A3CA 4CTKA 1IH8A 3RCBA 2PS0A 1LUAA 2R9VA 4YMIA 1Z5NA 2YYYA 2HA3A 1FYXA 2BDOA 2JFHA 3ODGA 1EYCA 1NKVA 3DMHA 2UYQA 5TQ2B 1Y1LA 3O3MB 4QXMA 4RANA 1VBNA 4D3YA 2BGTA 2NU8B 2X8BA 4R40A 2A6HD 3V42A 1C3CA 4ZT3A 4Q00A 4PNZA 5DIFA 2W6ID 4H7EA 1YE3A 2JNWA 1BKBA 2PQ0A 1WNFA 4PMWA 1SE2A 2J5QA 3NO9A 4FFNA 1LPOA 3BYTB 1DFHA 5DCYA 1Z6XA 3THYB 3R9XA 2P2YA 3J80L 2FX3A 3L4KA 2GZMA 2WAXA 1H2BA 3H0GG 2Q45A 4F45A 1VYVA 1BXGB 4B3ML 3H3VI 4N7JA 3QU2A 2W6MA 2K5UA 2NYVA 3KTDA 3PXCX 3NZEA 4EPWA 2HK8A 5DYWA 3QOYA 4MJXA 4NXNB 3IIEA 3OOEA 2NZJA 4IVNA 4RY8A 2WA1A 3IAEA 5CA1A 2CWWA 4NI5A 3VSCA 2G1UA 4NOLA 3SK6A 4RETA 5ESWA 2QLTA 1MTOA 2MP1A 1D09A 3ZHQA 2GOYA 4GNXB 3COVA 2QTTA 1P4SA 1GRRA 4UXJA 1R5NA 5DN6A 1QYCA 3DT9A 4JGBA 1MP0A 5EQTA 5JXJA 1UPFA 3TNDA 1VMCA 4C9BA 1GFZA 4KD3A 4Y9TA 3QEOA 3O4GA 5IULC 3SFVA 1WIWA 3BYZA 3QU5A 1PAUA 1BQ3A 2YRWA 3BRWD 4Y6GB 4WZAB 4RSMA 3WK9A 3SR3A 4CN8A 3AR3A 5F51A 3BL6A 1U90A 4XWGA 2EPBA 3BFKA 1CB7A 2EXZA 3EARA 4IQ0A 3HGTA 4BPBA 4UKDA 4IFDJ 4JLAA 4KQXA 2WF7A 2FFJA 1JR3A 3FDZB 2ZJQA 3W1BA 4HYYA 4BO1A 4ZHQF 1JPJA 4IFDI 4FEEA 4LMAA 3IKMB 2G9HD 2FVXA 1QFZA 2Y68A 3UMCA 4E94A 2F2TA 5ALLA 2EKBA 2ZWOA 4KO3S 1JHPA 1TZKA 5H9WA 1OYYA 1LNSA 2IYWA 1T5EA 4N8DA 3AEKB 4DXGA 3K92A 4M98A 5JSQA 2VZAA 1ZD1A 4AJNA 4G8JA 3OHMA 4NNOA 4Q1VA 2BUCA 1NW8A 3F0TA 4ZP1A 4XEHA 2W6JA 2Y71A 1WCMB 1V1MB 4U7GA 3PUKA 5CGKA 1MAAA 5IEBA 2C3OA 4IMJB 4KMRA 1E89A 1LTQA 2BY4A 4EGVA 4RK5A 4POOA 1Q84A 2ZGVA 2AHOA 1K5HA 3Q4GA 4JI4Q 1U8YA 4MN3A 2G9DA 1YULA 3CF5A 4TRDA 3GT0A 2XXAA 1QIKA 3E7PA 2PXXA 1UOPA 4ZT2A 2ZI5A 3X44A 3DBIA 3G1TA 3GDEA 2CD9A 1VIYA 1JB3A 1EQQA 1Z68A 2Z6BA 3KUUA 4KO8A 5JNTA 1Q16A 2FMKA 4NZMA 2DNCA 4GLLA 4RDXA 3LRTA 4YT4A 1E24A 2O8FB 1QAOA 4MQEA 4D3ZA 1RXCA 2C4MA 4ARVA 1E9DA 3RYFB 3U56A 2YJ6A 4ER3A 4H77A 1Q1BA 3QVWA 4U39A 2JH8A 3RIEA 1L4GA 3VU3A 4RZQA 4C1NI 1OV6A 3A4YA 2OHGA 1TMYA 1PWYE 4AU1A 3JAME 5I01A 3SG0A 3OIDA 3OEWA 2FF7A 4FQ5A 4CKEB 1IN4A 3BRQA 3K5WA 1TWCB 3COJA 4EZIA 3T3HA 3DBHA 1MABB 4A3IH 2QN8A 4J0CA 4PANA 2QEXA 1RXUA 3VDYA 3KFLA 1KNEA 1SNMA 3PUVA 2REQB 3CN7A 2RI0A 5HURA 1Y8RA 4U0JA 2QD1A 2I87A 1UJNA 4BZZA 3FIJA 4FILA 1EB8A 1QHEA 1CZGA 5B6PA 2QDXA 2GDZA 3BILA 1I3KA 3LGSA 3VAYA 2XNKA 1N5RA 2W0SA 1L7NA 3FMIA 1S96A 1VDKA 1WULS 4GLAC 4OWWB 4DYDA 1I4WA 1Y8OB 2HBYA 2NAPA 4QSHA 3P2IA 1BKSB 3QFTA 4H15A 2ZJ1A 4OSEA 3VA7A 3MTEA 3GTPB 1VFNA 3NWOA 4G65A 4MS3A 5IAJA 1H6BA 1IY0A 3JD4A 5A62A 4YJ3A 3ZXIA 4HSVA 3JYNA 4MK4A 3H91A 1WAMA 1OBFO 3SVTA 1VE5A 5TX7A 5EE0A 1Z63A 1W5AA 5I3ZA 3M6MD 3ZTWA 3L7OA 3WA7A 3D3WB 3RIMA 3ZHUA 1MA0A 2D4AA 5ARCA 5IAAA 1W19A 1ILEA 4YCSA 5IJ9A 2D0DA 2PGLA 4YP6A 4MMZB 3VO1A 2G1KA 2XSCA 2QPOA 2FW0A 1ASYA 1ZH4A 5H59A 3DLIA 2C94A 5AESA 2Q5QA 1RRKA 1Y3AA 1HOTA 2L82A 1Z9BA 3ECCA 3IALA 4G0UA 1QUQA 2YBEA 3QLVC 4FT4A 4E5YA 5FX2A 1BU8A 2FPXA 5I4CA 2PUGA 1JIXA 3DZ8A 3ONWA 5JG7A 1USVA 1NMXA 2BFOA 1ONNA 2EP8A 3GD7A 1RI5A 1T35A 4PVCA 1KKMA 2FJUA 4I08A 4G24A 2K14A 2GVZC 3CNQS 4Y2RA 2QY9A 5DHFA 1KZ7B 2K4KA 2Q99A 4NIMA 4UBNA 3OQIB 5KINB 5H3HA 2G1JA 4YCCA 4H08A 4ILEA 3KV3O 4EGFA 2IYOA 4IS3A 3CXUA 3IEXA 2B8FA 3RGWS 1VJRA 3TJZA 4LA4A 1VLZA 1KO5A 3H0CA 4TZ0A 1HYGA 1M2OB 3GGJA 2PX3A 2CL7X 2QVLA 1OGYA 1PSWA 1LTLA 2H7XA 4XQQA 4RTKA 1T6YA 3V4VB 2AB0A 2PRSA 1F6BA 5E7JA 4ID9A 1L5RA 2UAGA 2GJKA 1SHJA 1EA7A 1R15A 2FHTA 2WYUA 2ACWA 3TVDA 1PK9A 3CSSA 3WYDA 2E82A 5K1ZA 1UFRA 3TVTA 5CBPB 4OX9Y 3KL2A 4QDTA 1HZZC 1OE0A 4B48A 3BDLA 1HK7A 1RLOA 2W6IA 2ZYGA 3UDGA 2F9FA 4DBZA 1QSGA 5DHPA 2HCFA 4O1MA 4WESB 4FE4A 1U98A 2VBIA 2QRUA 3K5OA 1X42A 1K5GA 3PQEA 3CF4G 3ROXA 5CB6A 1OJ7A 3NFYA 4OXXA 1UF9A 4CIBA 1QBGA 4LC9A 3D3RA 1JALA 2QTGA 1MQ9A 3LZ6A 2VSYA 4FYMA 1PQPA 1E7WA 1E0JA 2IUTA 3I52A 4R0MA 1PG0A 4D6PA 1RJGA 1TX4B 4HWPA 1UZMA 2PE5A 4CTMA 1V8FA 3WRYC 1CI3M 1HC7A 1F38A 1XDUA 1DX4A 2Z8YM 2RHSB 1QRUA 3TZDA 1H0RA 3QW4B 4HDCA 3AMUA 1CY4A 1YONA 1ZOLA 1EWKA 1SYEA 4QDKA 3K16A 3G9TA 1GUTA 4JOBA 3HMQA 3FPBA 2R1UA 1PJRA 1DC6A 2I78A 2O0JA 4U8HA 4G5HA 5KYLA 4QYMA 1Q7YC 1TQOA 2D59A 4IQ8A 3RRMA 5JLJA 4IIEA 3IPXA 4EFDA 2PKEA 1LI7A 1VMAA 4B81A 2ISQA 3NEMA 4G01B 1SUAA 2HJGA 3KXIA 3BRWA 4GI2A 3R9KA 5FKAC 1TM1E 3HG9A 4NE2A 3A6GA 3I2IA 1G2IA 2EKQA 4EHKA 5IZCC 4HTAA 4J6HA 1AMOA 2HZ7A 1CR0A 3PC7A 2AN1A 3RVMA 5AHOA 5HE8A 1EGVB 3G2PA 4E07A 1TCBA 4TYWA 3IURA 3P52A 1R0SA 2RG1A 1NXSA 4C01A 2P7IA 3W4KA 1CUVA 1NVVR 1N2JA 2L0XA 4BY7B 1PS0A 1R0KA 3M1AA 4K6CA 3R7DA 2VQSA 1I0ZA 1M10A 3D2AA 1U7HA 3VDQA 3F8SA 4Q0MA 1YZVA 3VISA 2JA8H 2VHUA 3KZVA 2RIRA 2XR1A 3F4KA 4K14A 1H2WA 3FVTA 3G5TA 4LFAL 5CT4A 4RHSA 1U3TA 2J0EA 5I7RA 3O84A 3RS8A 2IYSA 1CFMA 3KV1A 1NKTA 3HDTA 2JFFA 1G6KA 3C97A 4YRNA 1WCIA 1G8HA 2FPGB 2QTHA 4BY9E 1K9MC 5NULA 4ACBA 2YZKA 1J6UA 2VQFB 4QDXA 1QYDA 2PO5A 4A4IA 4DIMA 3HQ4O 1CQVA 3WB9A 1HYBA 2C7PA 3AP2A 2PTQA 2ZIFA 5JBIA 2JE6I 5CX1B 1FGUA 4KODA 1TVXA 3DOFA 4RKRA 3LQYA 1FL0A 2P9JA 1ULAA 1VQ8A 3D5TA 1P39A 3QEKA 1J9EA 4O2DA 1X0XA 1PYDA 3EVTA 4Q4HB 1TFRA 3VNVA 1B70B 2CLFB 4OGWA 3JQAB 4PFJA 1RRCA 3SC6A 1YO6A 2FH5B 4POFA 4G8DA 2J0SA 3I90A 4X92A 2O20A 3AYHB 2DKFA 1T0PA 1LF0A 4F85A 1RF2D 3WI7A 5C5EA 1CRQA 1U0HC 3QFCA 3ZR4B 5KIAA 2ZTHA 1OX5A 2X3FA 4KITB 1PZFA 4M9XA 4QDUA 4LRQA 1OGJA 1NDHA 2PJDA 3OE7D 3I70A 3VR4D 3PRHA 4BO4A 1YE8A 1K92A 1K8YB 1NVGA 3PV0A 4TN1A 3IMGA 3T7CA 4EPVA 3QYFA 1D1SA 4F2DA 5K4AA 4J0IA 2PT7A 3G8BA 1CX9B 3L8YA 2WUEA 3O90A 2H9IA 3MGAA 3NUZA 2XE8A 4BQFA 2G40A 5J5AA 4NYMQ 3AU7A 4XVQA 3KJEA 1NV8A 1XE3A 4MTLA 1TRHA 3CYFA 3MUEA 2B5OA 5ADHA 3GDGA 4A3JH 1AQUA 4TLMB 3DAFA 4TUYF 1G8ZD 1JLLA 3G2NA 4DDHA 1WA5A 4HWKA 1NUTA 2QW7A 4UBJA 4JVMA 1VPVA 3O2QB 4BZQA 1KIMA 4LXUA 3OPXA 4YV7A 5DNCA 1PRTF 1KDZA 2FMUA 3P9CA 3DP9A 5EUBA 3ZDFA 5CNMA 2BHNA 1WWKA 1U3WA 1QE3A 4ZRDA 1FUPA 4MYCA 3CZPA 4WLUA 2SCUA 1KMHA 1VLJA 4ZT4A 4X66L 4L07A 4BPRA 5ELFA 2IH2A 2XYQA 2GK4A 2Q0QA 1TTQB 1P1IA 2D0IA 1J99A 1H9SA 4EVOA 2O06A 4JBLA 1R7RA 4BN0A 4F88A 4J6EA 4V1CA 3TNYA 4BXOA 2X22A 3WOHA 1P60A 4RZ2A 3B6YA 2DFVA 3A06A 2SKCA 2OCBA 4TSFD 2JP1A 2OXRA 3MLEA 4MW6A 4MNTA 2QGZA 4OAOA 4A3GB 4RHEA 1RC0A 1HNZL 1RZUA 2X8AA 1YK1A 2A88A 2R7NA 4UAUA 3MUFA 3WS7A 3QH4A 4MWCA 4F0JA 2FP4A 1OI4A 4O5OA 1NJ5A 2PZKA 1L5OA 2XLCA 2Z6UA 2P1ZA 2CHGA 4L4YA 5AVJA 3ONNA 1CHDA 3KL4A 4KY5A 4O5AA 3MTSA 1SD2A 1UBKS 3COSA 1D8LA 1I24A 5TQJA 3D6VA 1GZSA 2B34A 4OL0A 2O3JA 1REQA 4WEQA 1PWZA 4LK1C 4HB2A 4OKIA 4PN7A 1TZMA 1U5BB 3RS0A 4UHHA 2HMYB 5KCMA 4KIJA 3DNFA 3SHTA 5SZKB 2HQRA 5BMOA 4S35A 4P82A 3GW8A 1C7YA 4TM7A 2AQKA 5EUCA 4Q9AA 3F46A 1PH6A 3KUKA 2GR9A 3J81c 4DCSA 1WS6A 3DPIA 2XQJA 1STAA 4D0LB 4D99A 4EJFA 4A3SA 3TD2A 2EW2A 3UGKA 5JIBA 2IX1A 5EJIA 3TW4A 3L4BC 2QN1A 4QLBA 4N3CA 1QGED 4Y67A 4P5DA 1DMSA 2C4HA 2IP1A 1IJFA 3CNBA 3V1YA 3T99A 4TWRA 1WMBA 1R4MA 2DUDA 3BGOS 3FFTA 4HMOA 1JG6A 3Q10A 3MJFA 3RTGA 3WK6A 5AVQA 1MJHA 5IRCD 1YB5A 1L7AA 2BBTA 1MT0A 3QHAA 2FMXA 3LVBA 1JA1A 3M83A 5KVQA 1WW2A 3A8KE 1UBNA 3ICVA 1OILA 2K87A 621PA 3O8BA 4CU5A 3FJ1A 3A6LA 4FZRA 4XEUA 2C58A 5GVRA 1FFAA 4NU6A 2GTIA 4ME3A 4HNTA 2ZZKA 4BLRA 1VL0A 2ZE7A 1QYVA 1WQ3A 2JGFA 2RI6A 2GA8A 1YH3A 1UZAA 3U62A 5LOVF 3TNFA 2RHGB 4F6RA 5DDIP 3O4JA 5JAIA 1O77A 3R76A 2HU5A 1G6OA 1GGEA 1S2OA 2Z6KC 2FE4A 4G4KA 1ZK0A 1VQHA 3O2NA 4WVFA 3LC0A 2OYCA 1J7JA 3O8QA 4MUKA 3C1TA 3U7QB 4X63A 4KAJA 2QGQA 4IJ5A 2W2MA 1L4FA 5F2OA 3RKSA 1QAMA 3TQCA 2VKQA 5K99A 4C3IB 5HWSA 2AEJA 1CULC 1E1LA 5FBVB 3CO0S 1TKAA 4TYYA 1S1CA 1GZHB 3BF7A 4B8ZA 5AVZA 1L7OA 1RKUA 1H0HA 3D0QA 3ZBPA 4U7TB 5IHXA 1MT3A 2ZZMA 1W36D 3PXEA 2IV2X 3SSNA 3WWPA 1ZKOA 1DCMA 1XXHE 1VTKA 2HBZA 1MCZA 1RACA 1ID1A 1ETHA 3I2JA 4UMDA 5MFPA 1PI3A 1NF9A 4UNQA 1L1QA 1Q95A 1XL0A 2P9YA 4FR5A 4GOXA 1RS0A 4UAGA 4HYEA 4NHOA 5DYYA 2BF7A 4C6SA 3IUYA 4CM8A 2CE7A 2QJTA 4KCGA 4FNMA 1NMFA 1HDYA 3I6IA 5JNSA 2P5TB 1HH4A 2Q8QA 1DIAA 2OAQ1 1VIMA 4TMTA 1EZ6A 5D84A 5IN5A 1CT9A 3OW2A 3SM3A 1D5CA 4BV9A 3K0CA 1JFFB 3V4PB 4C5AA 3EK2A 4DTIA 4GFDA 2I91A 3FYTA 1W47A 3K4PA 4CDEC 4L8GA 1U3FA 5J2UF 4G97A 3CCLA 1I6WA 2HMWA 2ETVA 3HEAA 1MX9A 3ICCA 3AUFA 1OI2A 1RADA 3OU2A 1SNDA 2RHCA 4A3DH 1C7ZA 4F3YA 4QYTA 3K70D 3M85A 4JI4B 3QO2A 4KB5A 1WNTA 2GNOA 4S1OA 1XA0A 1MF7A 4I9GA 4NENA 1N7GA 1NU6A 1M6WA 2VP5A 4K5QA 3ZQ6A 3V8BA 3M9BA 4CJ2C 4YR9A 1FXSA 4A5OA 3EFHA 3TRHA 2VY3A 5K3OA 5A03A 4U6NA 1JZTA 2O4UX 2V6IA 4EQ6A 4RK4A 4LOAA 1JNYA 5IFKA 1FSZA 3K96A 3G49A 4HZUA 1GIAA 1ULTA 4Y98A 3N2IA 4O2BB 5D1HA 1JEJA 2ZDGA 3NXSA 3VKUA 2MINA 4F9FA 1P74A 5K0TA 3CVVA 1SYBA 3ZEIA 5K0LA 1HE4A 2AYZA 1N3IA 1W2WB 1EESA 3FVRA 1ADCA 3OE7A 3VR4A 4TT8A 4WLNA 1QS0A 4BEWA 2IY7A 2YY5A 2AG0A 3HKEA 1RCTE 5KWSA 4EATA 1ARZA 4G63A 2FKAA 2F1IA 5C35A 1CS0A 1YCHA 5KOJB 5IBQA 1PDVA 4Y6OA 5HCNA 3LPCA 1R3DA 4O02B 3JR7A 2R11A 5HTKA 2RHQB 1KH1A 5M5WH 2II6A 4PX2A 5LBTA 5L3SB 3KEOA 1NQWA 2FZEA 4YWJA 3CINA 1GUAA 4ETIA 1EK0A 1N6NA 2IEAA 5AO9A 3G0DA 1EUDB 1IBSA 1NXXA 4XXEA 1SAPA 1XP8A 4YT5A 2RE8A 3HFJA 3GGPA 3QWIA 3OWEB 4DQLA 4LZPA 2A5YB 1RE0A 2MYPA 2UZ1A 2R00A 4R3NA 3EZ2A 5K0NA 2WG1A 4J0DA 2ODWA 1RQGA 3GZHA 2FZCA 1SN7A 1EM6A 2RB4A 2Q41A 2ZSAA 4N0EA 2I3AA 3H1BA 3GBSA 5B7GA 1PGPA 1J2YA 1LWOA 1SZPA 2QV7A 2UZ0A 3PX7A 4DV7Q 3HBFA 3INGA 3VR6D 1DIOB 5C8ZA 1EY0A 1X9HA 3FPLA 4HB0A 2QW1A 4TSFA 4Q48A 4HDOB 4OJKA 4TVAB 1PV4A 2YWRA 4O25A 2AZDA 3I4NG 3M3DA 2XF8A 2WTAA 3ASYA 1NVUQ 4AZVA 1YNNC 2HTFA 5AVXA 5IGEA 3M1IA 3BBPA 1ES9A 2Z0SA 5I9NA 2J0QA 3IP3A 4PGFA 1FCJA 3ID6C 4K6MA 2H1LA 1WTXA 4OBXA 1LX6A 2VJMB 4BWGB 1NN5A 4DMGA 4QBTA 4RGMA 1ZH2A 2QTAA 4XQNA 2VK8A 3MCAA 2HW8A 4I81A 3EZNA 2O8EB 3JARA 1S2IA 2WUVA 2O8DB 1DJNA 1KQNA 3DVSX 3VU9A 3NTIA 2FGKA 3RS5A 5CEEA 6REQB 4PV7A 4EYKA 1U4RA 3Q24A 1TVEA 2BEUB 1V1OA 3KJOA 5JD3A 1HDCA 3W90A 2H51A 2HEGA 2FU5C 2XEXA 4IDNA 1ZMBA 1UAAA 2B4KA 3FMCA 3VTAA 1TM3E 2GX6A 3IUNA 1CF2O 3C24A 2ZPUA 1DZIA 1ZA1A 4GLOA 2RONA 4V0ME 1KZ9A 2QMYA