1U0LA

Crystal structure of yjeq from thermotoga maritima
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
291
structure length
278
Chain Sequence
b'LRRRGIVVSFHSNMVTVEDEETGERILCKLRGKFRLQNLKIYVGDRVEYTPDETGSGVIENVLHRKNLLTKPHVANVDQVILVVTVKMPETSTYIIDKFLVLAEKNELETVMVINKMDLYDEDDLRKVRELEEIYSGLYPIVKTSAKTGMGIEELKEYLKGKISTMAGLSGVGKSSLLNAINPGLKLRTTTTAQLLKFDFGGYVVDTPGFANLEINDIEPEELKHYFKEFGDKQCFFSDCNHVDEPECGVKEAVENGEIAESRYENYVKMFYELLGRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable GTPase engC
publication title Crystal structure of YjeQ from Thermotoga maritima contains a circularly permuted GTPase domain
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 79
structure length 278
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 3.6.1.-:
pdb deposition date 2004-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03193 RsgA_GTPase RsgA GTPase
A PF16745 RsgA_N RsgA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.50 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Probable gtpase engc; domain 3 1u0lA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1u0lA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u0lA02
1KY2A 5FLXc 1VQNA 1UM8A 2OE2A 3R20A 3CF0A 1XD2A 1GAJA 2QY9A 5EUMA 5FUYA 1PYSB 4CZ2A 4L16A 421PA 2IY5B 3TE6A 1EQRA 1GVPA 2BDTA 2IF2A 3LFUA 3W6NA 2QBYB 2NZ8A 4I1VA 4EFLA 5J3BA 3H15A 4ZIRA 1R0XA 4PAOA 3GLGA 1LS6A 2OQKA 1KSHA 3KFVA 4HYYA 1IN4A 3KUDA 3M4PA 4GLAC 2DBYA 2PMZE 1E2QA 3CLVA 4OKSA 3THXA 5ELXA 2O8FA 2VS1A 4QXAA 1M74A 2CQOA 1XPOA 4QGUA 1PUIA 2ZJ5A 3LXXA 1MKYA 4FN5A 3BFKA 1T8UA 2QE7D 5IWAL 1DO0A 2DFKB 2GXQA 3EAQA 1AJEA 5D3MB 4NBSA 4HIOA 2W58A 3IQXA 1IL2A 1EK0A 4ITRC 4NXNQ 3I73A 4V02A 4PQYA 3DKVA 1WCMH 3QBVA 1Z6TA 4M1WA 4MUAA 1QUQA 2IYRA 1XMIA 4EQ6A 2GILA 3D3QA 4LJAA 5EZ6B 5IWAQ 2ASBA 3KJIA 4N1AA 1N0WA 3U7EB 1JJVA 2R9VA 1LTLA 3AKEA 1HNXL 3S1RH 2NTYC 4N3NA 1Q20A 4Q00A 4D2IA 2UKDA 2WJIA 5KNDA 2QPOA 5A4JA 2WM9B 4U5XA 2L15A 4LV5B 4IOLA 1OE0A 4IFDJ 4PMWA 1L2FA 1E1OA 4IFDI 3KJOA 1RPZA 1A2KC 5BYKA 4DSUA 3G0HA 4HIKA 3GTPH 2A30A 5LB4A 1HNXQ 1AE3A 1VQ8A 1XNJA 1W0KD 2ZR9A 1Q21A 1PH6A 4NHOA 3UDFA 1IBLL 5AR1A 3RDPA 3LQQA 2VF7A 2ZITA 5CJ2A 3I4MH 2NZHA 2H1LA 4BY1H 1T0HB 2CLSA 5J47A 3KXKA 4A3DG 1XJ0A 2ZE8A 3X1XA 1HZCA 4TLAA 3R9IA 1FZQA 2H17A 1Z6YA 4LYFA 4Q7KA 3MXNB 1PLLA 3H0KA 2OZEA 4D4KA 1HR0L 2XJ9A 2GWHA 3OAAD 1IBLQ 4A3FG 2DYKA 2XZPA 4MITA 3T1YL 5FOSA 4DRZA 3MWLA 4JOIC 2EYQA 1Z0DA 5GJBA 4UXHA 1DEKA 2LSSA 4PHFA 3U7HB 1HR0W 5FH9A 4D26A 4EX5A 1HR0Q 1YU9A 2E2IH 1SKQA 5M5WH 5FTKA 2JLUA 1WB9A 4QHYA 2BIFA 1RKBA 2LWIA 3J81i 2D0PA 3J81c 4B3RL 2FV8A 2QNRA 2QROA 4LZZA 1QVFA 2FEMA 2ZSAA 4RCYA 4POFA 3EWAA 1CLUA 2ASEA 4JIMA 3THYB 3GJ3A 1IJFA 3DKPA 3MJRA 5L3QB 4DKAC 3UE0A 1AGPA 2BBSA 1CKNA 4PFSA 4B71A 1OIVA 1Z5ZA 2AXNA 2IXGA 4GP7A 1DG1G 4B3RQ 1Z0KA 2YINC 2F7SA 3QKTA 1VQDA 3P32A 5DI3A 3VHXA 3U4QA 3PXGA 2OCBA 1WQ1R 3SGIA 1W0JD 3KLWA 5JI3E 2WP8J 4EPXA 1VHLA 3BS4A 1YZQA 2F1RA 2BHRA 4AG5A 2XNDD 1LNZA 3TVDA 3AFPA 4PZ7A 2GVDC 2ZEJA 3LH5A 4JLDA 4MRNA 1II8A 2WOJA 3AV0B 1XEXA 2EQBA 3CPEA 4RD6A 3GTQH 1TPZA 1I6HH 5AJVB 3AQ4A 1SR3A 1OT3A 3AKDA 3QKRA 4UNSA 3B1YA 3RS4A 1NBWA 2GCOA 4ASUD 1G5TA 1FX0B 3UIEA 1A1VA 1X3EA 4OO1G 1G7CA 1HQCA 3KF6A 2I4IA 3K9NA 4KYUA 3ZIAD 4F7WA 3KF8B 1XD9A 1G8GA 2VF8A 3I61A 2OLJA 4JVLA 2ORVA 4A93G 2HEIA 1G8YA 1A0IA 4IO9A 2R93H 4P31A 3AVUA 4NH0A 4H02A 1X86B 3MUFA 3ZZTA 4KLKA 1ZCAA 3Q5EA 1N5KA 4POGA 4A3IH 3U44B 4BLOA 2Y8EA 4RY2A 2K52A 2GJKA 3CCMA 1T5IA 1KNXA 1TQ6A 1EFUA 2HLDD 1RJ9B 2P6NA 4OL0A 1R2QA 2ERXA 5JCZA 1P2SA 1HY3A 2KCMA 2AN9A 4WXRA 1G16A 5FPSA 4C2UA 4KO8A 2JJ1D 1RYFA 3LQRA 3TMKA 3ZZ0A 2DPXA 3GJ4A 1B7YB 4BY7G 4QC2A 2R92G 3I8SA 3HJNA 3DZDA 2I5HA 3THWA 1F5NA 2IL1A 3BJIC 4LV8B 3A1UA 2D7CA 3TSOA 4QRHA 4Q1AA 2X77A 4BLPA 1GKIA 3E70C 4L8GA 2R8RA 1WYDA 4DVGA 1QVGA 4A0HA 1NF3A 2BBWA 3PITA 3VR5A 3AKYA 2WTUA 4F4IA 1D8LA 1ZD8A 3ZQJA 2CK3D 3CCQA 1XJQA 4YONB 3U3RA 3KQKA 3EPJA 4M1SA 1RRCA 3THOA 2WPDA 2R62A 4GRAA 4DV1L 2CCZA 4AI6A 4LF9Q 1E99A 4IOCA 1UBGA 3U6KA 2IX0A 1K73C 5C3EG 3HU2A 2W0MA 1VG0B 4MYTA 1BVSA 4ESHA 3AVXA 4PXAA 5TB5A 1EIYB 2XOKD 4AYXA 4B3DA 4Q7JB 2P2LA 4DV6L 3I7FA 3SU8A 4YHHL 3T12A 1ZU4A 1VQ6A 4DUYL 1OLOA 2ZJ2A 2A5GA 5JZVA 1EGAA 5L8VA 4DDWA 4XWOA 2K5UA 4LBYA 4BUJA 2E5LL 2AR7A 3GLIA 1SFOH 2GBLC 4QIWE 1ZINA 3PEVA 1L4UA 1V9PA 4Q9LA 4DV6Q 3TSZA 1GKHA 1AE2A 4YHHQ 4G5QA 4TTRA 5K8UA 1QZHA 1Q1ZA 2CMKA 1YE8A 4O0MA 1JQLB 2V6JA 3WYFA 3W90A 3R9XA 2QPTA 3B1VA 1VQFA 4LUCA 2VHCA 5IK2A 2IEYA 4KBGA 2O8BA 3DZ8A 4DUGD 4OQFA 1W5SA 5CM9C 4AYTA 3SHFA 1EFTA 4V03A 3OFND 5HZHA 4HAVA 1N25A 3C41J 3OZXA 5HPYB 1XWIA 4CT4B 4ZCIA 1I5FA 4C0HA 4ERNA 4DAYB 2HF8A 5HE9A 4LPKA 3ZS8A 4LUZA 5EP1A 4RSGA 2JLVA 2UUBL 2ATWA 1JPNA 4NXMQ 1P2VA 3GDEA 1UJ2A 1XCMA 1YQTA 3AF3A 4JI3L 3EA5A 5J4VA 1OH6A 1MO6A 2OILA 4M53A 2H18A 2VP9A 4LPSA 4B2IA 5LPNA 1LB1B 1YZNA 2ZYTX 3ERSX 4HZIA 1MT0A 1YZUA 2UUBQ 4DV7L 5EE5B 1E69A 1K83H 5FUVA 2FJUA 4JI3Q 1I2DA 1Q7YC 2VQSA 3WBJA 4NZYA 4C7OA 2V7QA 2B63H 5EP2A 5IRCD 3HWSA 3EIQA 1JMCA 2AFHE 3SOPA 3AF0A 4RFSB 3U58A 3OTOL 1VCMA 3QI2A 4I4LA 5F9HA 3S15H 1CRQA 2IXFA 2ZJBA 4X6AH 1P5ZB 2VHQA 3MG9A 4K81B 2GTPA 4DV7Q 4EUNA 3OF5A 1N34L 4B3SL 2JA7G 3CPHA 2I0QA 4NCKA 5JHGB 1NE3A 2OEPA 3P4YA 3OEHA 2GCPA 3IBYA 3H1TA 1KJWA 2V1XA 1P4SA 1HNZQ 3OTOQ 2K14A 3KKPA 4QL5A 4Q03A 1N36L 3OE7A 4UXIA 1I3QH 3CRMA 1B8AA 5L3VA 2DUDA 1G20E 1E9FA 1VQAA 5H1SE 1G7SA 4X66L 1XD8A 5CM8B 4IVRA 3S1NH 1B0UA 1DARA 1KI8A 4LOAA 3WY9A 2IWRA 4JMPA 1TQ2A 1N36Q 1E9SA 3KL4A 4HLCA 1P6XA 3K1JA 3X1YA 3QXHA 4DIDA 5DN6A 3FKIH 1TQDA 5LMNL 1CTQA 2MMGA 2JEBI 4M21A 1T91A 1P60A 5JMTA 1IYJB 2ONKA 4PSAA 2WWWA 2ZSEA 5C0XG 3HKSA 3LXRA 4KXFB 2PCLA 1UEBA 2WV9A 3P1JA 4IJHA 4A3MH 1E9DA 1EFRD 4QNMA 1OHHA 3SJBA 3X1DA 3EARA 2Z0SA 2CBZA 3NC0C 3NVAA 4MGKR 4OI2A 4BFSA 2IYUA 4C0JA 5FL7D 4B6FA 2AK2A 4MKHA 5LMNW 2RGXA 4IOKA 2LKDA 4YMUA 1AKEA 5LMNQ 5KU1A 1ZM2A 1SN8A 4GN4B 3JZAA 1U94A 2O0HA 3KUCA 2FPKA 4DBLC 1X65A 1PH1A 1XF9A 4ZPXA 2ZRKA 5JCPA 1ZD1A 2ZANA 4IPCA 1IXZA 2P67A 4DSNA 1J70A 1Z0FA 1YR9A 2AKAB 2W2XA 4HI0E 5EZ5A 2ZPTX 3QE0A 3SN6A 2V1UA 4E5UA 2ZRAA 2XXAB 2GZAA 5DLQC 1JQJC 4OX9Q 1TL7C 3TGPA 1A2BA 1H8EA 3NELA 4DR5L 2A19A 2ONJA 4DCTA 4LF8L 2GXUA 5AJXA 1IBML 1H65A 1UBCA 4TL8A 2NZOA 1HE1C 3K0FA 3NIBA 4BLTA 3RC8A 4PO9A 2ZI5A 1NY5A 4IFDG 4OYHA 1PYBA 1N3BA 5HGQA 4QJFA 1TU3A 2QP3A 2RAPA 4LI0A 1QHGA 4I1OA 4DR5Q 1XTJA 3NBYC 1ZU5A 3I32A 1G19A 1ASYA 1IBMQ 2R6CA 3CRVA 4AKGA 2C9YA 1KXLA 3RR5A 5IP9H 2IYQA 2ZRJA 4URZR 3PGZA 1NJIC 1U2RA 2QN6A 1GSIA 3DEFA 1P61B 4XJXA 4IHQA 4H1VA 4CEIB 1E22A 1HNWQ 2WMNB 1N5JA 2FF7A 3W5OA 2FSHA 3DOFA 1VCIA 5J4YA 1GO3E 1A82A 1HYQA 4A3KH 4CW7A 5CYOA 1N6HA 1G3RA 1G9XA 2J9RA 4JJZA 2LCFA 4NYIR 3PG5A 4A76A 1HV8A 2ES2A 2GKSA 2OXRA 4KFTA 5FTNA 4PR0A 3H86A 1Q1BA 4IDHA 721PA 2P5TB 4OI1A 2ZYUX 2PEZA 3TQFA 1KSJA 2AWOA 4BBRH 1Z28A 4BASA 2BA1A 3QF4A 1NBMA 5IYDH 5GADl 4D25A 4BEJA 1CR1A 1OB5A 2WB1E 4WIAA 2KSQA 4LBVA 3SYNA 5LDDC 3QKUA 4PO1A 1FP7A 4TLCA 2OUKA 1AS2A 4Y0VA 3X1WA 4IPGA 1VQ7A 1N6LA 4GBMA 2QEQA 2PLRA 3AVYA 4XVQA 4JI8L 3JC66 4JG2A 2JDIA 4I81A 5J4KA 4PSVA 4YC7A 2FZLA 2FWRA 5FL3A 3R8FA 3ZVMA 5C4XG 2O8CA 1Q57A 5C44G 1KI9A 3GJ7A 3CRQA 3M4OH 3MAAC 4JI8Q 4NDZA 2KHJA 1TEVA 4G0NA 2DR3A 1VMAA 3D7MA 1AA9A 4NCHA 1JB1A 2I1VB 4Q19A 2NZJA 1C1YA 4R4TA 1GWNA 1MABB 2B6HA 2GVBA 2F3TA 2J0VA 3RS3A 4DC9A 3T61A 2WMOB 1AZSC 3U7FB 5IYBG 3Q72A 3A6PC 2HXSA 4MNOA 5FLMH 1HEIA 3GJ0A 4ZI3A 5GAHC 3TEHB 4O3MA 3GEEA 3Q9LA 4CYMA 1JJ7A 5C4JH 1SQ5A 4YWMA 3KJHA 3LAWA 5JI2E 1QG2A 4R1JA 1FMLA 3ZS9A 3FB4A 1SXJA 2WWFA 4OWWB 4EJSA 3VKHA 4NYMR 1OXSC 1XRJA 4KYIB 3EPHA 1YHBA 2VUMH 1CKOA 2ZSBA 2ZM5A 3ADCA 5BQ5A 1VQJA 3RSLA 1K3RA 2GVAA 2VP0A 3CC4A 1GKUB 4BRUA 1M1YE 2C9CA 4QQBX 2OTJA 4NL4H 3EW9A 4Q5IA 3PEWA 2HCBA 4O2LA 1R0ZA 4JKYA 3PVSA 3OEED 2E2HH 1TTTA 5IP7G 1CSPA 1UEJA 1TWHH 2EQSA 5JWRA 1CS4C 1VIYA 2PZGA 3QOFA 3I4LA 3A37A 2EFDB 5E7IA 2WHXA 2WB1G 3LX8A 1BYIA 2NVQH 3CKLA 4I1UA 1D2MA 5JEAJ 5M5XH 5CYPA 3KZ1E 4IKEA 3ZGXA 4F91B 4IVPA 4NYMQ 3UE1A 3NC1C 3PCRB 4GNXB 2W0SA 1L1OB 2A9KA 3TRFA 3J80i 4IEEA 1WOCA 3J80c 3R7WA 1CU1A 4FD2A 1KAWA 3AEVA 1G18A 1XMQL 4POAA 3I72A 4WJ3M 1D2NA 2GNOA 1PHJA 621PA 5CK4A 4JI0Q 1B23P 2FU5C 3QENA 3CMAA 1E6CA 3F8TA 2FGJA 1E9CA 1COWD 2BV3A 2GVZC 5F98A 1ZP6A 3D0FA 4TYYA 4Q47A 1SGWA 2AK3A 1N32Q 5BXQC 1CIPA 4JBYA 1XMQQ 1RFLA 2N46A 4IW3B 2H16A 5JEDA 2GJ9A 3I4OA 4ARZA 3TK1A 2FFAA 4LF4L 4AH6A 1JI0A 1SVOA 5LBIA 4A82A 1S3OA 4TMXA 1S9DA 4YWKA 1UKYA 2D2FA 3L8YA 4DLTA 2UUAL 1MV5A 2JA8H 2VP6A 3PF4A 2IEZA 2P5SA 1D8TA 4CT5A 2FPLA 2GXSA 2YTVA 3FMPB 5C1BA 1MJCA 4JI2Q 4GLVB 3E9IA 2YHSA 1NRJB 4QJ4A 5EQTA 1H8HD 1VQEA 1JNYA 1Y63A 3UK6A 4UP8A 3RC3A 3ADKA 4Q4AA 1Z2AA 1MKHA 1M6NA 4ZDWA 2OO7A 1E1RA 3L0OA 3HOUH 1TUIA 2PQAB 5TVKA 4H1UA 2GAAA 4C4PA 2UUCL 1S40A 4QGHA 2XZLA 1SVMA 4JI4Q 4JBXA 3WMGA 4HAZA 1S8FA 1Z6GA 2IYSA 2Q2IA 1HZ9A 1ESMA 2NO9A 3JVUA 3RRMA 5B57C 2CHQA 3GJ6A 2Q0HA 2REXB 3GQBA 1NJFA 5AJWA 5LB2A 4QM7A 4GOPB 1YI2A 1WE2A 1GRQA 3K0SA 2UUCQ 5IF9A 1RZ3A 2PJZA 1LYLA 1Q46A 2HXYA 4RD1A 1M7BA 3EN2A 4XTRA 1ZJ6A 2DWOA 1TF2A 5EE9A 1VQKA 3K7UC 1UADA 4PC1A 4R2IA 3RRZA 4DCUA 1M7GA 6Q21A 2HYIC 2ZU0C 1KMQA 3TUZC 2Z4RA 4X65Q 3K53A 4M9XA 5KUTA 1X55A 4DV5L 2EFGA 2JATA 2JJ2A 2KBEA 1X3FA 2IYWA 2WWHA 2GZDA 2ZU6A 4TLBA 1HT1E 1PH5A 4ON9A 1P16A 1KD1C 3K70D 1JJCB 2R6DA 1E1QA 1IN7A 3BXZA 1KMHA 2F55A 3FHTA 4ZV4A 1W44A 2H5EA 4OONA 2W6IA 3I4NH 1G4UR 4BLQA 1PH3A 2IUTA 3AEZA 1E0AA 2KBFA 2Q21A 3KKOA 4B48A 2C9OA 5EXSA 4K0KQ 3HOVG 3IO3A 2ZI7A 1E24A 3VR4A 1YJ5A 2A5FA 2XITA 2F4VL 3LO5A 1E2FA 4HZUA 1E2KA 1JR3D 3J81k 2K75A 1JJGA 3AYHB 1QVRA 3Q8XB 1J90A 1D7QA 2JA9A 1NN3A 2P0EA 4WA7A 4A8JB 4A4IA 2XTIA 1WXQA 5DIFA 4II7A 5DI9A 4BBSG 1E1TA 3LY5A 2J7PD 1D9ZA 4LFCL 1ZM4A 8OHMA 2JLQA 2F43B 2D3WA 2HT6A 3CX7A 4K46A 4A0RA 2FN4A 1Z8FA 4PPNA 3KDFB 2G83A 3HU3A 3P26A 2GJ8A 4HB4A 2WSMA 5EE0A 2Z5FA 1L4YA 1NN0A 4L9SA 3TAUA 4IVQA 2IS6A 3NBHB 3DL0A 2D4HA 1J8MF 2QQ0A 5BN5A 2F9LA 1JPJA 4P0TA 3FFAA 1R6BX 1UDXA 3KTAA 4LFCQ 1NI3A 1ZNYA 4XIGS 4LK2A 4PHTA 5CB6A 3LGJA 1YR8A 4B74A 2GBLA 2OLKA 4YMTA 2EFEB 3C16C 4EQ5A 1ONBA 3JAMi 3JAMc 4JLOA 3U6BA 2Q3FA 3DLLA 4GKKQ 3QQ5A 1OYYA 1XD2B 4QG7A 2XNDA 4LHVA 4P4SA 1J99A 5M3FH 1UF9A 2IYZA 5FPTA 4C3HH 1K0RA 4V0KA 3AVPA 4CF7A 1E32A 1N5LA 5JWHA 2YWEA 3VAAA 4ZIRB 4IPHA 2V9PA 4DSOA 2O0KA 1GP2A 4JI5Q 3THXB 4TMTA 3F2BA 4ASUA 4DSTA 2WIAA 5FTMA 3CIOA 3KJEA 1YKSA 5FBQB 4BFZA 3M1IA 4MRSA 1EESA 2DWQA 4GKJL 1NN5A 3FKSA 4WXPA 3DDCA 3NBZC 1E3PA 1G1MA 221PA 1MRNA 2Z83A 3HU1A 4TLEA 3OHMA 1N8RC 3NBXX 4J15A 3T1OA 1KK1A 3WRXC 2AHOB 1HZAA 3KYHC 1I4DD 3S1AA 3HDTA 3BJUA 2Q9AA 3LLMA 2NO6A 3RZOH 3NDPA 2R6GA 3B6EA 1KL9A 1K9MC 1Z0IA 2PMDA 2ZRCA 4G3XA 1QUQB 4UPAA 4GKJQ 5L3SB 3TBKA 1WF3A 1VHTA 2ZI3A 5EXPA 1U0JA 2C99A 2YC4C 1IN6A 3DPUA 3ASZA 1N2CE 2RB4A 4FINA 4W7SA 4FIDA 3PUXA 3TS0A 3E1SA 5FR1A 4YMWA 2JLYA 2YZ2A 4AURA 1VQBA 4S35A 5H8WA 1WDTA 4V0ME 1WP9A 3QUSA 5TY0A 3H3VI 1R7RA 4Q02A 2QSZA 3BB4A 2EIFA 2A8VA 3Q3JB 2WAQE 2BH8A 4DLVA 4JLVA 4OHZA 3CP0A 1DAFA 1Z3IX 1YVCA 3LBNA 1VTKA 4P4UA 1ZRHA 3PO2H 2A78A 4M2LA 5BYJA 2YTYA 2EWVA 3A1SA 3O8CA 2BM0A 4G1UC 3CMEA 1KDRA 3EXAA 1YZTA 1SXJC 1HT2E 4EJSC 4OI0A 4FCTA 1W49A 1E79A 3HOYH 2V1CC 2B29A 1T6NA 5EXXA 2JLXA 1KI4A 2HIXA 4AKEA 4QJ3A 2VSXA 3QEOA 4BLRA 2J0UA 4JLJA 4AYWA 2LKCA 4IDPA 5BN4A 1LS1A 3S17H 1UEIA 4XTCS 2V55B 1L8QA 3V4FA 3SFVA 1E2MA 1GUAA 2RGNA 3I62A 1FJGL 1I4TD 2X1VA 1CF4A 121PA 1ZM3A 2EFHB 2DHRA 2JE6I 3KJPA 1KJYA 3L0PA 2MO1A 3BH7A 3CX8A 4B76A 4PHHA 3E2IA 4AQYL 5GVRA 3WHKA 5GJCA 4M1KA 1R5BA 1U98A 1YR7A 2D62A 4AYBE 4UJ3A 2BMEA 1Z63A 2ECKA 2R7FA 2ALYB 1JR3E 2FFQA 4W5HA 1UE1A 4ZKEA 4NTZA 4EPVA 4WW0A 5KDDA 2PNHA 4X8HA 5M3MH 4DCSA 4AQYQ 2ZRMA 1ZCBA 5KO2A 4JL8A 1HH2P 1NMGA 4MDEA 4B3XA 4RD2A 2VY3A 4TWZA 2ERYA 3CW2A 2ZROA 3IHLA 2WOOA 1RRPA 1CKNB 1KQSA 1W2GA 2C96A 1XMVA 2WKPA 1MIUA 3MWJA 4O0AA 5L3RA 3ULJA 4D4LA 1OXUA 2OV2A 4L5QA 4GOJA 3B5JA 3UXMA 1C9OA 5DI3B 3QG5A 4Q1CA 3HYTA 1S0UA 3T1YQ 1GVNB 1IOZA 2KHIA 5FR2A 2XB4A 1E9RA 1W1WA 2NO0A 1HURA 2QZ4A 4US0R 3MGCA 3FE2A 3EZ2A 3GFOA 3W3AA 3B1XA 4TTPA 1XU4A 4DR4L 4C3ZA 2WAQG 3WBKA 3TIFA 1O3YA 4DR1L 2I5MX 3BE4A 3TVTA 2DCUA 5K36G 1SE8A 1DBSA 4MKFA 2QMEA 3A4MA 4P74A 4M9QA 1XTDA 2MQHA 3ZYCA 1CJVC 1A5TA 3NTUA 2AXPA 3FMIA 4LJ4A 3S1QH 2BMDA 3RWMB 1DAIA 3VX4A 4TSFD 1LM0A 5DO9A 4DR1Q 1YNXA 1KTVA 3M0EA 1K8AC 1EXMA 1J7KA 3C5CA 4MYUA 1WI5A 1C4OA 4HUQA 5AUNB 2OHFA 5JHHB 1OH7A 3MWYW 4CGZA 5HKKD 4HEJA 2X2EA 2IA5A 3A4LA 3L7ZC 4B32A 5JSZB 1E3MA 3STBD 1P75A 3PENA 4P71A 5E7JA 4XWAA 1Q3HA 4C0LA 2GDJA 4XD7D 1K8GA 3WNCA 3M4YA 2W6JD 4QGAA 4TMVA 5JRZA 1OH5A 3JVVA 4MGZR 2GN5A 1VQ9A 1EX6A 2OAQ1 1Q0UA 1NJGA 3AVQA 1BBUA 2D0OA 4UXJA 2QTFA 4BEBA 4FWIB 1EQQA 4NCIA 2ZAOA 2ID0A 1E2DA 4TYQA 1U0LA 2QTHA 3TSWA 1Q81C 3NG1A 3WMFA 3Q5DA 1Y1VG 3H3VH 1RIPA 3BH6A 4DJTA 1US8B 3G82C 3QPWA 3V4RA 2QA4A 1P2UA 2CJWB 5FJ8H 3IBGA 3FOZA 5FPYA 3A8TA 4TLDA 3THYA 1A8VA 3CF6R 4JSTA 2E1RA 2XX3A 3PR1A 5A5GA 1P2TA 5L3QA 1W36C 1U8AA 1F48A 3LRPA 3UATA 1X3SA 1EFRA 1IXSB 1G7TA 4DV0L 4Q9IA 4MGIR 1OXTA 5H70A 1E2LA 4FCWA 5DHAA 4M1MA 3U60B 1X9NA 4LV6A 2C5LA 3LD9A 3K7AH 3NENA 1U99A 1HJPA 1AN0A 4PSKA 3NDBB 2G0TA 3GTJH 1M90C 4C2MH 2UU9L 1QHSA 3EASA 2EFCB 2REOA 4PZZA 3CNLA 2QA5A 3SC3A 4PX9A 4DV0Q 3RRNA 3SJAA 4BZPA 4XVUA 4HIDA 3BIFA 1KC8C 5A0FA 1GILA 4R9UC 3DMNA 3GCGA 2ZRGA 1WRBA 2B92A 4DB2A 1EWIA 3FP9A 2VRWA 4O25A 4EIWA 2PL3A 4X62L 2UU9Q 3HYRA 1DADA 2OQ0A 3N70A 1YRBA 3W3ZB 1D2EA 1Y1WH 1KO7A 1R10A 1UDWA 1FX0A 3EG5A 1IXRA 3EC1A 4HAXA 4Q48A 5C18A 4NE2A 3ADDA 1KKMA 1JEDA 1VDZA 3BZKA 3MWKA 4KFRA 3RYTC 4Z1MD 4US1R 2BOVA 3GLHA 4PPQA 2IS4A 4HAUA 2IBMA 5E95A 4X64L 3WYGA 1XZPA 4ABYA 2J0QA 1WCMG 3O47A 5FPKA 4DV1Q 3H84A 4TVAB 4YMVA 1NVVR 1E2NA 4C0SA 4WAUA 2JA6H 1OJLA 1EUJA 4HAWA 1LW7A 4FI3C 4GZMA 2VZAA 3TR0A 1RJ9A 4A2PA 4MDFA 1R8SA 2AD5A 4G5SA 4ZO4A 5DSZA 4MQBA 3W6OA 3TJZA 4A3EH 4Q18A 4W5JA 4C9BA 4DUYQ 2I3BA 5DYIA 2GXAA 3JZMA 3W6PA 2EXDA 3FMOB 4P4TA 1VCNA 2RGBA 2E5LQ 2B21A 3SJZA 3D31A 2J7KA 3BH0A 2W2TA 1UBFA 4OQNA 1VQGA 1OKKA 4KAXA 1CJMA 1GOTA 5C4MA 4IFBA 4DR6L 4OHYA 1TWAH 2JAQA 1G3IA 5IDVA 4L5TA 1UE5A 1SZPA 2YTXA 1NVVQ 2D74A 3GLFE 1DTSA 2AL7A 2F3RA 4OK3A 2AMCB 5EP3A 3ZDQA 2ZS7A 4C7OB 1YIJA 3SE0A 3CNNA 2OT3B 2Y0SE 2Z4SA 4KSBA 3I4MG 5LMUL 4N0DA 4BY1G 2GK7A 2JK8A 3LVRE 3CR7A 1N6IA 1Z08A 2IYLD 2CCGA 2OXCA 4QOSA 4UP9A 1EX7A 4OQLA 4A75A 1XXHE 5KSYA 3HOZH 5M3MG 1CULC 4DZZA 2QRNA 3EZ6A 4QY7A 1G7RA 1CKMA 2G6BA 2ATVA 4IDOA 1DVRA 2FSGA 4LNQA 2WWXA 2Q9CA 5KPDA 1ZM9A 1NSTA 4EKDA 2NO7A 1RIFA 1KY3A 2KJQA 3AM1A 1IY2A 1FPMA 3E0EA 4JS0A 4KODA 3QXXA 2F9MA 2QAGB 4C0AC 3G71A 1Q1QA 2PI2E 1ZVQA 2NIPA 2Z0MA 4KV9A 4Q01A 3PUYA 4M8NE 3KDSE 5ELOA 2K4KA 1ZUHA 3OIVA 1QHHA 4JZKA 5CITA 1T9HA 5LD2C 4RFVA 3RLFA 1NMZA 5G53C 1E4YA 1PUJA 3IUYA 2ZS8A 3F5FA 2CVFA 4P73A 1E0JA 2NN6G 3MMPA 1PA6A 1VIAA 2CLDX 3SJCA 3K8AA 2K5NA 1BH2A 3AP2A 5H1YA 1MO5A 1IN5A 2CE7A 2PBRA 2WJGA 2G9NA 5IYCH 1N34Q 4B3SQ 3QF7A 2IX3A 2GK6A 2V4ZA 2VHTA 4B3GA 2RGNC 5CDFA 2WAYA 3C7KA 1KAGA 4HDQB 2JLWA 1I94L 1XEWX 3UG6A 2ANBA 1LTQA 3LBHA 1XB2A 3ULPA 2YWHA 1S1CA 3AQQA 1UKZA 4FXPA 4DR2L 2RGAA 4Q4JB 4R2HA 3IRBA 3WNBA 2D7DA 4DUZL 2FPMA 2HV8A 2ZUDA 4X66Q 4KFSA 4YY3L 2VLIA 1VYUA 3IIJA 1YRAA 3IDQA 1KI6A 1R8QA 4ZI2A 1Z0JA 3TLXA 1Q8KA 1G4AE 4FMDB 2ANCA 3BOSA 2Y0SG 4MRVA 3T06B 2JLZA 2WICA 2G88A 1D6JA 4DR2Q 2JLRA 3GLGE 4DUZQ 3CONA 2R93G 2HQLA 2CL0X 3CW2C 3U4VA 4YY3Q 1NLYA 3G4SA 3A58B 2WJYA 3EC2A 3Q7PA 1PV4A 2JCSA 1FQKA 4IDNA 4KSCA 4FMCB 821PA 2EW1A 4A3IG 3EZFA 5HCIA 2QRZA 4Q21A 2HUPA 2ZJRA 5IE8A 2YNMA 4DLZA 1N6KA 4PZ6A 4A9AA 4ZKDA 5BW8A 1L0WA 2P6RA 3J7A5 1HA3A 1W48A 2IYXA 5BR8L 3RLNA 3AP1A 3PIPA 4A3CH 1T3LA 4QFMA 3QVUA 3I3SR 3TQYA 3UDIA 2CL6X 1G3UA 1TX4B 3HPQA 1G21E 3B13B 2B7CA 3ZZUA 1JECA 1Z83A 3F2CA 3F3YA 2XGJA 3W5JA 5BR8Q 3PV0A 5TDHA 3M85A 3W5IA 2NPFA 1EWQA 2O8EA 3CWQA 1P62B 1VECA 2WIBA 4LJ7A 4ACAA 4LF8Q 2F1IA 4BXXH 3RNUA 1XFAA 2X8AA 5EAYA 4A92A 2WPDD 2R2AA 1WBDA 4AY2A 1K5GA 3M9BA 3N2EA 1CR0A 4OQMA 4QL3A 2RHMA 3VR3A 3B1ZA 2B7BA 2YYZA 2ZR7A 3KB2A 3RLOA 1AS0A 1KKLA 2MMCA 1E96A 2C77A 3HOXH 4H9GA 4K8OA 4U02A 1TMKA 3IILA 4B2PA 2F3IA 1JJ2A 3K70B 1GNQA 1GRNA 2Z43A 1RW4A 1YZGA 2JASA 3M7NA 1FNNA 4YLGA 1KRSA 3BB3A 2CVHA 3KQUA 4MTNA 1QBKC 3W34A 4GMDA 4B6EA 2JA5H 1OSNA 4M1YA 3GFTA 1EOVA 1PLKA 3W1GA 1UBEA 2PX3A 2RGEA 2ZJOA 4FMBB 4TN1A 3WNDA 5EJEA 2A2ZA 4CVNA 2BMJA 4CEJB 3DVLA 3GTOH 1VQLA 3CCVA 4I99A 5JLJA 3FFBA 4LJYA 4WBSA 4PC6A 3T5GA 5KDOA 2UXDL 2HYDA 2B8TA 1AGRA 2ZVQX 3K9HA 1FP6A 1SULA 2GZHA 4GI7A 4GSYA 5IT5A 2O8CB 1EG7A 1MJEA 1GL9B 5IK2D 1TF5A 1M8PA 1YZKA 4BZQA 5K8LA 3BRWD 3AVWA 2Z6KA 2BJWA 2VYFA 3T15A 2N1BA 1CJKC 2XZOA 5DLQE 1G3QA 3CC7A 1E0KA 1AM4D 1CXZA 4FCVA 2MSEB 2UXDQ 2Q3HA 2ZI9A 1SVKA 2KE5A 4R4OA 3LV8A 3CRRA 3KQLA 2ZI4A 1RVDA 4JVSB 4AWXA 3QPUA 1N9WA 4CEIA 4JBKA 4M22A 3PIRA 4A3GH 2NPIA 4WVFA 1UAAA 1A62A 1ANKA 4GP6A 3AVTA 4R71A 1FMJA 2ZE5A 4JSYA 5K8IA 2G0NA 3VHLB 1NTGA 1J5EL 4PQFA 4RD4A 2RHQB 3T1QA 2R7ZH 4TQAA 4XSHA 3CCLA 1IXRC 3VTKA 1KO4A 3P4XA 3J81j 2B63G 3H0GH 4M1OA 5AUQA 5AUOB 1E0SA 4TT3A 1HE8B 2IXEA 3PQCA 1DG3A 3MCAA 3VU9B 2ZI6A 1HH4A 4TYWA 1IY0A 1JAIA 1ETUA 2V7QD 1W7AA 2AKWB 1XPRA 2QP4A 1W4BA 2EU8A 2FH5B 3U3MA 5HZKA 1FL9A 4G01B 2NVTH 2E2JH 2UVQA 1XTKA 4PAQA 2ODEA 2QL6A 1IZ6A 4DK6C 3UDGA 2IS2A 3BU2A 1YBYA 4JVMA 1XP8A 1JAHA 5KNCA 1VS0A 1DAGA 1SHKA 3CCRA 2IHEA 3OEHD 1XDBA 4UJ5A 4E09A 4ESVA 2ZJPA 3RRYA 3RN2A 2FNAA 1G8FA 4A4DA 1SVLA 1N6PA 5TXGA 1OIWA 2QMUA 1DAEA 3OE7D 4IRUB 4DDUA 2OBLA 2O8DB 4DV2L 4KI0A 1FNMA 3R7WB 1JR6A 1XNQL 2YOFA 3LLUA 2WWGA 4DT1A 2ZRBA 1BMFA 1NVXQ 1ZNZA 2JA1A 1KZ7B 2XTNA 1QHNA 2ORWA 4MH0R 1Z9FA 5FOWA 4P72A 2JEOA 2IHFA 4AIIA 4QJ5A 5KOYA 2YVUA 3L2OB 3U7GA 3CC2A 3KX2A 4GPTA 5JS7A 3S1MH 3CAMA 4B3TL 4X8OA 3FKIG 4DV2Q 2QM7A 2QT0A 5D3QA 4YXWA 5DN6D 4KJZA 4A3LH 3QXJA 2WSSA 1IONA 4A3MG 1MABA 2Q6TA 3CH4B 3L0IB 3B9QA 4ARZB 2ZJYA 3QY0A 3HOWH 1XJCA 4MYHA 1OHHD 3KXLA 4B3TQ 1QVAA 2IYTA 2JIZD 2N8NA 5FBWB 4OWXB 4TL7A 1YHNA 4QNRA 5EE3A 4JC0A 1OTCA 3LX5A 1KZGB 3NH6A 3KFUA 3NBFA 1AK2A 2MNAA 3I55A 1FUKA 2VHUA 2CNWA 1F2TB 3F2DA 1IBKL 3GTMH 3AP3A 3ND9A 4GN5A 3KKNA 3QKSA 4J0QA 2N49A 3RABA 1XEWY 4D4MA 4M9SA 2IWHA 2J0SA 1IHUA 2F1JA 4PC3A 4GZLA 5DYGA 4C0BA 3S2DH 2WJHA 4AC9A 3GP8A 3PJRA 3CCSA 2GJAA 4GL2A 3GJXC 4M0LA 1VQCA 3CD6A 2VSFA 3SEAA 3UANA 3EA0A 1P73A 5JWOA 3GLIE 1H8ED 3N5CA 1QVCA 2ZJ8A 5JBQA 4RZUA 4HJ7A 1E2EA 4B3BA 1CEEA 3ZQ6A 4DDVA 2OBNA 1KK0A 5LD2B 1ZIPA 3RS7A 1D9XA 2OCAA 2QE7A 3RN5A 4OO1I 2PX0A 4LF4Q 4YWLA 4JLKA 4IFEA 4MRRA 4DCNA 4Y7NH 4XVRA 5FOTA 2UUAQ 4PTLA 4DB4A 2RHDA 1VQHA 1SRUA 1NN1A 1ELOA 3W1BA 3HKZE 2YWFA 1NMXA 2FG5A 4NKRA 2VH5R 5IP9G 1KDOA 4GOKA 3U2QA 1L1OA 3DM9B 4HSEA 4NU0A 4JLMA 1E2JA 5IT9c 3M4QA 3EIHA 2WJJA 3KQNA 3ICQB 3DM5A 2GEUA 3HOXG 4EAQA 5FBRB 4LRWA 2XSZD 1S4QA 2UXCL 1VQIA 2A5JA 2PZFA 2RKOA 4A3KG 4OHVA 1KI2A 3AVOA 2P65A 3GJ8A 2ZTSA 1DO2A 1KMHB 4HLDA 2J87A 3LVQE 2MFIA 5HR5A 1E2HA 2Q2TA 3GLFB 2I5LX 3EBEA 3AF2A 1K6MA 4D0LB 1U90A 4KHZA 1I4LD 1NKSA 3ASYA 2E8GA 2I1QA 4F38A 4ALPA 2PEYA 4WZ6A 1QZGA 3AF1A 1O87A 2Q9BA 4LY6A 3EX7C 3HFZB 1W0KA 4BBRG 2ODBA 1KRTA 1W4AA 1DAKA 1XXHB 3SR0A 5IYDG 2XJ4A 3RWOA 2UXBL 4OJQA 4URXR 5HCNA 1J6QA 4S2EA 1NBMD 4D0GA 1S3GA 1M2OB 3IIMA 4RCZA 2OWOA 5CLLA 2QGNA 1VG8A 4HJ9A 2V3CC 2JLSA 2GF0A 4JI7L 1T4GA 4A3DH 2QENA 1MR3F 2IYYA 1F2UA 1QHIA 2A5YB 4DV5Q 2WKQA 2E87A 3F0TA 3OAAA 4A6PA 4U00A 4CEHB 2ZREA 3CO5A 1EFCA 3ZD7A 1RE0A 3QPVA 4A1FA 2J41A 4A3FH 1YEZA 3DO6A 4MA4A 2JDID 1KSGA 1WBBA 1CR4A 1ZIOA 4LUVA 1BOFA 5FOXA 4ACBA 4E03A 4JI7Q 4JBMA 4QBHA 2ZSFA 2J45A 4LDJA 1M1KC 2V6IA 2IUUA 4NONA 2ZJZA 2ZUCA 4MRPA 1UKEA 1PVOA 1E98A 4IXNA 4B34A 3QXCA 4G5RA 4Q4HA 1Z06A 3WXMA 4GOPA 1WA5A 2G3YA 4CIDA 1II0A 3X2SA 3GO5A 2Q2HA 1QG4A 4JJKA 3SYLA 1M34E 1RRGA 4KFUA 2F4VQ 1XTIA 2MO0A 2QGZA 3A36A 2A7QA 4KLNA 1IQPA 5F2EA 4LF7L 3HKZG 5B30A 3VKWA 5FLMG 1N33L 1K5DA 3BWDD 1S1MA 3TS2A 1EFHA 2WJVA 2W00A 1XMOL 2RGCA 3NH9A 1KK2A 1T3SA 1T8TA 1W2BA 2X19A 4Q9JA 3VNUA 5SZJA 1P3JA 1H95A 3CQZH 4UNRA 1YHQA 1TWFH 1II9A 3A1WA 1FQJA 3B1WA 3KFXA 3CZQA 3CXCA 4LFBL 4OHXA 2VUMG 2OFXA 1W0JA 2ODWA 1N33Q 4M4SA 1SXJD 3I2ZA 2OCPA 3A1VA 1VG1A 4HB3A 3S1AB 2HJVA 4Z8XA 3HP1A 2QT1A 2ZIAA 4KBFA 2O0JA 2WWIA 5M5YH 1IBRA 4DV3L 3GTLH 1T5LA 4APVA 2C04A 2JJ8A 4JL5A 3GLGB 2W6JA 1N6RA 2IC5A 4A3JH 5GADC 3K81C 1VQPA 2BKUA 4KU4A 4XOIA 5G3YA 4A6XA 3K0AA 5FI0B 2KENA 1S3SA 1XPUA 2Z6KC 4A2WA 4F93B 4A8JA 2K50A 4QHTA 1W47A 3ZIAA 4DLSA 2R65A 3SHWA 2PZEA 2C35B 4DV3Q 3FMFA 2SHKA 2OSBA 4RVCA 2F43A 1ZD9A 4A93H 1Y3AA 2QMOA 2VHJA 4BFWA 4JLBA 2BKEA 1KO1A 3KDFA 3GPLA 4I1SA 4R98A 1TUEA 1FUUA 2ZS9A 2L0XA 3IEUA 1N0UA 3IPXA 3HPRA 4DWJA 2HLDA 4PPGA 1XTRA 2H8KA 1NP6A 4R7ZA 3CUEF 3K70C 3AH8A 4EQ6B 3UMFA 3CF2A 2VIIA 4BZXA 2JJ1A 1Q22A 2CHVA 1VQOA 3EZ7A 1KYIA 5KPJA 1OB2A 3FHCB 2ZSDA 1B70B 1X8JA 1JBKA 4OHWA 4A36A 4TMWA 4BY7H 2R92H 521PA 4TL9A 3GJ5A 4HLUC 1DOAA 4OI4A 2R44A 2BH2A 2OCEA 2IX1A 2GESA 2VP4A 2ZE7A 1QHXA 4TTQA 1OFHA 5FTJA 3OW2A 1GTVA 4DCVA 2CK3A 1S2MA 3T1VA 2FX3A 2JA8G 5SZKB 5C0XJ 4LHWA 1V1QA 2Z6VA 3CNOA 5B58C 2GAOA 4NXNL 2ZAMA 5C0XI 4NCJA 1X8KA 3O8DA 2BEJA 4LYJA 1RRFA 2XOKA 3NEJA 4LHXA 5C3EH 4Z1MA 3LW8A 2CWAA 4JLAA 1X8LA 4PZYA 4YDHB 4C0KA 2KCTA 4O2DA 3V00A 3A74A 2YC2C 3RSOA 1NBME 2AHOA 3HOUG 5FPHA 5KNBA 3ADBA 2C98A 1FTSA 4ME3A 2BMFA 4IJLA 1NLFA 4D82A 1E1RD 1NY6A 3ER0A 1ZAKA 4IDQA 2MSCB 4B2LA 2QBYA 3ZVNA 5L3SA 2G1JA 3CR8A 4XH9B 1Z29A 1CJUC 3F1ZA 2AKYA 4MKIA 4QGFA 1SVWA 5KSZA 1FJGQ 4BE7B 4BWYA 5JFGA 3BFVA 3A1TA 5CLQA 2WWYA 4LJ8A 4C3IH 5D3MA 3K80C 1SKYE 5FFMA 1WJJA 4DUGA 4B3FX 2C78A 2YU9H 1SROA 3A5ZB 3U3JA 1OYWA 4PO8A 4NYJR 1PFSA 3OFNA 3CCJA 2PMKA 3H4MA 2V54A 3B60A 3BB1A 4DEYA 4U7DA 3RAPR 1BYUA 4IOAA 1KHTA 1MO4A 3CBQA 3BBPA 4AK9A 1SMXA 2BJVA 2JJ2D 4EPRA 4BPBA 4HIMA 2VQFL 1N0VC 4WOPA 3U4QB 1YR6A 1W36D 3OIWA 4MZ9A 1LF5A 2C2HA 4QGGA 1TADA 1TEXA 2CKZB 1E1QD 2GCNA 1XJVA 3I4NG 4DEXA 1KO8A 1V5WA 1ZMXA 4HUQB 5DISB 2V8OA 2W6ID 4B44A 3RHFA 1E2PA 2IT1A 4TYPA 2ZRIA 2EVWX 1XMJA 3IKJA 5F3WB 1SXJE 2VQFQ 3NHBA 3A0JA 1KGDA 1PH9A 1II8B 1XEXB 4NYJQ 1ZC4A 4OK5A 3EWSA 3QKRB 3ONWA 5KSPA 5GJWC 1CJTC 3EIVA 2GCOB 4HLQB 2YWGA 4JI6L 3KF6B 3UDXA 4DLRA 1QF9A 4L5RC 4DR4Q 1QHYA 1N6OA 3MFYA 4GNXC 3A5UA 1KK3A 4TL6A 1L1OC 4Z51A 5JEAG 4LUOA 2FE4A 5DHFA 4PHGA 2ZTDA 3FGNA 1DE0A 3ZJYA 2JA7H 3FPAA 2OAP1 4DNIA 1E2GA 1TWGH 1KNQA 2BWJA 1Q86C 2IF0A 4JI6Q 4HB0A 2XGTA 4A0GA 4LHZA 4Z8YA 2ZRNA 4DKXA 2VA8A 3M3YH 1OH8A 1W4CA 4JLNA 3K0CA 1OPXA 3ETLA 3K0XA 3B2EA 4URYR 3EPKA 4JYCA 3NKVA 1W2HA 3ECCA 1XTQA 3OIYA 2J3EA 5ANRB 2BBTA 2ZRHA 4AYBG 2HF9A 3UG7A 1KIXA 1NG9A 4PQRA 4HUTA 1GM5A 3P27A 3GD7A 1TF7A 2CCJA 3THWB 1XNRL 1G6OA 4WJ4A 2RH5A 5M3FG 4ILEA 1Y14B 2IYVA 5C2JB 1Z22A 1FL0A 3IPYA 2CFMA 2HT1A 3CPFA 4A3JG 3WYAA 4A2QA 3G6EA 4DK3C 1G5PA 2XTMA 4GNKA 4LCBA 4RZ2A 2NVYH 3TKLA 1XNRQ 1NIPA 5FL7A 4GFDA 2XTZA 1JE5A 3O8BA 5E7NA 4JT4A 1UPTA 4RD0A 1G3MA 3FKSD 5GAEC 1MH1A 5JJLA 2NOAA 3GLHB 5CIWA 1IAQA 2KI5A 3V9PA 3DMDA 4LGMA 2VW9A 5HTKA 2UZIR 4QBFA 3GLIB 3CCUA 1YJNA 3IO5A 4WZAE 4D4JA 5JSZA 4DR7L 1C0AA 1PJRA 1ZNWA 3GMTA 3TAHA 2FOLA 3U3KA 2RF4A 2H5XA 3BERA 3U50C 5IY0A 1JB7A 4JBJA 4GOPC 2DFNA 2REBA 5GQOA 3CWZA 4LJ5A 4TZ0A 3TRZA 1BIFA 4O2RA 3W9YA 3R8CA 3VKGA 3WMEA 3EZ9A 1W5TA 1QDEA 1KSFX 4G5GA 2KWIA 3IGFA 4JCVE 4LBZA 3TW8B 1E4VA 4A15A 4LF9L 1FGUA 4DR7Q 3KOJA 3QVVA 1US8A 3WP1B 2O8BB 2PT7A 4BA2I 4X62Q 2CJWA 1O7IA 3PO2G 4JL6A 5CK5A 2G77B 3TUJC 3U44A 1KI3A 5DE3A 1GNRA 3RZDH 5M04A 3FYHA 3QXSA 2VP5A 3S14H 2QMHA 3B85A 4P3YA 2LXKA 2RGDA 3HOYG 1X3GA 2RHSB 1U81A 1VKJA 1ZNXA 3SBEA 4P33A 5SZIA 1Z0AA 4TYNA 2ODNA 4BRWA 2O5VA 4X64Q 4B43A 1E79D 3AGPA 1CR2A 1N6NA 2VL6A 3LNCA 2P6UA 4HATA 5E3HA 3NEYA 2QPAA 1NMFA 3STBC 4YQFA 4PAMA 1NVWQ 2CE2X 4ZCMA 4LF6L 1IJEA 2G1KA 3AUYA 2VBCA 3K09A 5B2ZA 3OYYA 1E9BA 2CCKA 1NSFA 3NEMA 1BO6A 2H92A 3ZH9B 4YCWA 3HR8A 2OFOA 4RKEA 4A8JC 4KHPL 5DH9A 1OF1A 5TMPA 3PEUA 4Q1EA 3K0EA 4P75A 4W5WA 5C4GB 1DELA 2PLFA 3TUIC 1G6HA 4LF6Q 2ZXUA 2FDCA 2VP2A 5FBLB 3T1TA 5KSOA 3VMFA 1U9IA 4DR6Q 2JQOA 4KHPQ 1QHHB 5EUQB 1F60A 4CDGA 3VFDA 4N0EA 4NB3A 4LFAL 4NXML 1LY1A 2VNUD 1XTSA 1OIXA 5LMUQ 2FSFA 2CDNA 5GAGC 5TARA 4F4CA 5JJKA 3LBIA 2F52A 1NIJA 1FFHA 4Q1DA 5H68A 1OXXK 1VQMA 3BZCA 3SI7A 1ZUIA 1N5IA 2ZE6A 3G5UA 2R6AA 3Q8DA 1FTNA 4EDHA 1BKBA 1EYGA 2CL7X 2GEVA 4UY8C 2QM8A 4BFVA 4EFMA 1E9EA 1W36B 4LFAQ 4OWTB 4D81A 3IHWA 3VNVA 3T35A 3REGA 4TMKA 3VX3A 1R5OA 2N3SA 1DS6A 5AUPB 1WMSA 2J59A 2VPPA 1X56A 5C4XH 2QP9X 4GOXA 1NVUQ 4YCVA 5C44H 3MLEA 2AWNA 2CXXA 1G8PA 3K9GA 3AKCA 1YJ9A 2QUZA 4C0QC 2DGYA 4ZDJA 3FHOA 3UWKA 1PH2A 1KI6B 4L9WA 4D0NA 2IHBA 5KTYA 5J40A 1HUQA 2O8FB 2GETA 1GKYA 2YOGA 5JJIA 2ZR0A 3NXSA 4UQOA 4RG1A 4AIMA 5IYBH 1G41A 1OXVA 1HNZL 1YHAA 1R5NA 5GJVC 4EFNA 4LF5L 1EWRA 3IQWA 1KAOA 1J2JA 2DFTA 2ZRLA 5DGXA 4YDSA 5CB8A 1NL3A 3BK7A 4OQXA 1GNPA 2D06A 5JS8A 1X54A 3T1HL 3UMRA 4NCNA 3CZPA 4IXMA 1TNDA 2F6RA 4YCUA 2ZJQA 1Q44A 1G5RA 4D6PA 1LF0A 2QG6A 4JLPA 3P20A 3I92A 2BA0A 3PIOA 4Q1FA 4KCGA 4RJLA 1I94Q 4LJ6A 4RZ3A 4LF5Q 1X6VA 1AQUA 3OEEA 2QEXA 4PPFA 2QAGA 3I5XA 4UNNA 1GIAA 1WCV1 4RFSA 1KOFA 2B3GA 1A4RA 3T1HQ 4LYHA 3K0FB 4RZXA 3WP0A 5IP7H 5FOUA 3AVVA 1W46A 3FWYA 3ND8A 1ZM7A 5FJ8G 2PJRA 3KXIA 4QBIA 4LWZA 2WVJA 3N2IA 4ZDKA 3D8BA 1S72A 3MD0A 2ZRDA 4RKFA 1BKDR 1L7VC 4URWR 2O8EB 5FBVB 2OTLA 1SHZA 3OESA 2OFWA 1TU4A 4GDFA 3B82A 2OESA 3GEHA 1RL2A 2BM1A 1KIMA 4YMSA 5AJYA 2DY1A 1A7JA 5SZHB 2HHHL 2JIZA 1G64A 3ULLA 3QIAA 1IN8A 1PH4A 1ODFA 2A1AA 1VCOA 1HQYE 1TWCH 1WFQA 1EIFA 4A3BH 4XSGA 4F92B 1XCPA 2ZTCA 4OX9L 4HAYA 4IEIA 1OFIA 1COWA 4A0FA 4TQ9A 4Q4JA 4LC0A 1MO3A 3KQHA 2HHHQ 5C46F 1JEEA 1ZC3A 4X8MA 4LYAA 2AD1A 5G41A 3SNHA 1GITA 2GA8A 4GMXA 4KVAA 5EE1A 2ORIA 4BFUA 1Y1WG 2B8WA 1AS3A 1L2TA 3K9LA 4JKIA 1GD7A 2K5VA 2K5HA 3PFIA 5G40A 4DR3L 1G291 1Z6XA 3ZJYC 2WBLC 2ZYWX 4HJAA 1VYVA 3L8ZA 4FW9A 4KLZA 2XB2A 3D6TB 3FHWA 1S9HA 3QF4B 5K8TA 3GFPA 1R0WA 4DAMA 1G6PA 3RS2A 4B73A 2N78A 1H8HA 3A4NA 3VDYA 3K0CC 3C8UA 3B7GA 2JA6G 1HNWL 4Q4LA 2H57A 5TV2A 3T5DA 4DR3Q 2IS1A 3VR1A 1E7ZA 3UPUA 4F4JA 1JXOA 3NHAA 1P72A 4C3JH 4A3EG 4GLXA 2CEAA 2GHIA 3VR2A 2XXAA 2GF9A 2NO1A 3I1FA 2IK8A 1G51A 2R6FA 2RMKA 3U4ZA 4AKIA 1IY1A 4V0MA 1K8RA 2IHYA 4HDOB 2XSZA 2C03A 1SKYB 3L43A 4LC1A 1KJZA 2MSDB 2YJTD 2R7DA 3S2HH 1FOEB 1KI7A 5J5CA 4LJ9A 1S96A 1YZLA 3PCOB 2ZM6L 3CB4A 5UKDA 5AJ3L 1KDPA 3MSXA 3I56A 1YZ6A 3AB3A 3RS5A 1OKKD 3PSIA 2A5DA 4FWTA 1CBUA 4NPHA 3ZD6A 3J7ZC 4QBGB 4PANA 4HJ5A 1XX6A 3SQWA 3AF4A 4NMMA 1JXMA 5KHOC 4UP7A 1M7HA 4QM6A 2ZM6Q 1SVSA 4L4UA 5FOVA 5AJ3Q 1R0YA 2FMXA 1PH7A 1ESNA 3HOZG 2O52A 1LUZA 1F3OA 4LSGA 4OK6A 5CIQA 3SBDA 4DIEA 4TZ6A 1P9NA 2TMKA 3CF5A 2FEOA 1SXJB 4BQSA 1AZTA 4EJSB 1ZW6A 5G3ZA 1DPFA 4P32A 2GRJA 3Q85A 3GEIA 4Q9KA 1NKTA 4ZCLA 3CCEA 4NYIQ 1UE6A 3TREA 3BORA 1LVGA 1P9WA 2E9SA 4BFTA 2QQEA 1CP2A 1PLJA 3RVBA 2NMVA 4HLUA 4CEJA 4Z54A 3HOVH 2J46A 5AK0A 1MOZA 4DT1B 3VR6A 4HJ8A 1J5EQ 1JR3A 1F6BA 3G48A 2ZUBA 1HTWA 5FUXA 1FVIA 3PO3H 2PT5A 1W4RA 4PC2A 1XEFA 1W3SA 1NNEA 2FA9A 1PZNA 3BGWA 3WRYC 5J4HA 4DV4L 4XWKA 4GN3B 4AD8A 5IHPA 3I5YA 2J7PA 3U5ZB 4Q7MB 2AX4A 2D2EA 1GDDA 2FZ4A 2OBMA 1P8LA 4BBSH 2DFLA 3TR5A 4BECA 4AKHA 3GTGH 4HDCA 1ASZA 4B35A 3BC1A 3QBTA 4Y0AA 2CHGA 5IYCG 5AJZA 2QGQA 3AGQA 3S24A 3KB1A 3GTKH 4DV4Q 3RS0A 1SLJA 4MGYR 4B33A 4V0OA 1RYHA 1OV4A 3TQCA 4EPTA 3K09C 1QRAA 2HJGA 3TNFA 1EFWA 3PUZA 4PZ8A 1NLZA 2FFHA 3LA6A 2WFWA 3LDAA 2ATXA 1X1RA 1U5KA 2QU8A 5BN3A 2JJQA 1OFTA 3QKSB 3C14C 2QTVB 3UKDA 3B9PA 1XNQQ 3C15C 3SDZA 4CRWB 3ICEA 1D5CA 1U9IC 1V43A 3E5HA 1Q82C 1CSQA 3VU9A 1G17A 2C8VA 1SVIA 4V0NA 1UWVA 3ZVRA 4E07A 4DLUA 1E2IA 3EIEA 4R4CA 1U0HC 2F1HA 2ZETA 5JEEA 1DAMA 2BCJQ 1J8YF 4DHEA 3SZRA 1YVDA 1TXYA 2QSYA 3AFQA 2BEKA 2PH1A 4URVR 2P3SA 3SYKA 4HB2A 3AUXA 4IPDA 4JI0L 2A3RA 4Q4AB 2C95A 5HE8A 3TW4A 1TAGA 3GLHE 3FKQA 3MRSA 3Q7QA 4A3CG 4JYBA 2O8DA 3O8RA 1Q12A 4UNPA 1N32L 3FDIA 1VPLA 1IBKQ 5P21A 1U8YA 5FTLA 1KHIA 4A3BG 2BCGY 4GT1A 4Q66C 5E7MA 3TH5A 2ZRPA 4JOIA 2EWWA 1AH9A 4GS3A 4Q7LA 3CM0A 4JBWA 4DLXA 3NWJA 4RMFA 4B3ML 4BXXG 4Y52H 1Z2CA 4JI2L 4Q9HA 3WHLA 4PC7A 3DM3A 2ZYVX 2W2VA 4L15A 2DWPA 4GNXA 2VQEL 1XZQA 2HIVA 3VQTA 1RC8A 3CPWA 2PCJA 5HY6A 4LWCA 4KVGA 3B8HA 4ZDIA 3BAFA 2CLCX 4B3MQ 3M6AA 1HZBA 1G8HA 2EYUA 4OJKA 3UMSA 1CUKA 1Q3TA 2GJSA 5JECA 3LWNA 1R9TH 2ZQ5A 4M9ZA 2Q2UA 1GL7A 4URUR 2VQEQ 2JA5G 4JI4L 1F2TA 3L0SA 3L82B 1NG1A 4G5OA 2OM2A 1GG2A 2FSIA 1F2UB 1U8ZA 4IJMA 3ZVLA 2QAGC 1C7YA 2IUSA 5AWFC 2YOHA 2VEDA 3KKMA 3MJHA 3QJYA 2UXCQ 4NP6A 1DGSA 2LXJA 3BD9A 3KJGA 2VO1A 3LW7A 1YJWA 4JT2A 3UWOA 4JVNA 1YITA 4L5BA 3W8NA 1UKVY 2WZQA 2H7VA 3FVQA 1JALA 1CKEA 4HZUB 5EP4A 2WAXA 3W8RA 4C2TA 1XCGB 4UNQA 4OXPA 1GL6A 2NG1A 2NQ2C 3DOEA 2BVNA 4X65L 4NPSA 5GROA 2BBOA 4MYCA 4Q4HB 2J5XA 1BBWA 3QSYA 1UFQA 3PF5A 2VSOA 2XEXA 2J1LA 2XNSA 2RGGA 1JT8A 1ZUNB 2N42A 3CX6A 3WWVA 1A63A 2UXBQ 4EPWA 3SQXA 2PQAA 4JI1L 2YV5A 1PH8A 5BWMA 1FW6A 4BA1I 4BFXA 1Z47A 4US2R 2QORA 3CH5A 5E4FA 4JV5L 3RNLA 3IEVA 2OCYC 5J4LA 4A3GG 1QZXA 3KTAB 2BC9A 4X8LA 4FMDF 4C30A 1CRPA 4IOJA 4L5SA 4BFYA 1KO5A 4K0KL 3T34A 2JGNA 4QHSA 2DB3A 3C4JA 1XBTA 1UE7A 4JI1Q 3QNUA 1XMSA 5CDFE 3E9HA 1IM2A 2OG2A 2R7ZG 1KDTA 4M1TA 4FMCF 4BLSA 1T3HA 3U61B 4JV5Q 1GZSA 3GLFA 3H0GG 3KKQA 4DLWA 2KBNA 2FFBA 1GFIA 1Z07A 4P4SB 4R4IA 3QEJA 4TT3D 5CJPA 4B47A 4B3CA 1BS1A 1X6OA 1TQ4A 2IW3A 4E22A 1E9AA 3PUWA 2KB0A 4QKQA 1DAHA 2QI9C 3PO3G 1XXHA 4W9MC 1I2MA 1VYTA 3K0AB 5ELNA 4TMZA 1AQYA 3REFA 4BGDA 2RCNA 4UKDA 3RANA 3ZLJA 2ZRFA 2FXQA 4TSFA 3FTQA 4LF7Q 3MEFA 3H2YA 1E94E 4FDBA 1P9RA 4KITB 4WZBE 4R4QA 1VG9B 4LHYA 3L2PA 1NMYA 1T0JB 4EPYA 5DNYB 3R9WA 3IIKA 4CEHA 4PZLA 1XMOQ 1ZBDA 5HKKA 4LX0A 4PG3A 2W83A 4DPGA 3QG1A 3SFZA 5KDLA 4V0LA 2PI2A 1I50H 1GRRA 2HCJB 2X2FA 4XD7A 3C5HA 3X1ZA 2NVXH 4GKKL 4LFBQ 1ZYUA 2QAJA 4LBWA 5FI1B 4DXAA 4LW1A 4MUBA 1BMFD 1OFUX 4TQUS 1AKYA 2VL7A 2ZJAA 3I8XA 3EPLA 3CRW1 1X1SA 5GVSA 2YKGA 1LV7A 3HR7A 2AFIE 4JYAL 1R4AA 2CWPA 2Q3MA 1Q1EA 2UZ3A 3PUVA 2ZTEA 4JI5L 4DLYA 4A3LG 1VQ4A 5FUWA 1Y1VH 4YXWD 2NGRA 4AG6A 3PEYA 3B78A 1AIPA 2WSSD 4OBEA 3HOWG 3S16H 2FGKA 3DHWC 4D80A 2ZVPX 2VTKA 2WKRA 1NY4A 3CPJB 3K8YA 5KYKA 4JYAQ 1VQ5A 2JEAI 5B64A 1KI1A 3OIUA 4IOMA 5JRJA 2NN6I 2XAUA 3U3OA 1C9KA 5EXTA 1OW3B 1P7CA 1LFDB 1MRSA 2GEDA 4MKGA 3SS8A 2HDNB 4RD3A 3B6YA 1Z6AA 2J0UB 4B75A 4Q1BA 2CNWD 4DDTA 5F9FA 3BFXA
chains in the Genus database with same CATH superfamily
1ECPA 4JLSA 1KARA 5F23A 4JLWA 1GLGA 1LQTA 1V3TA 1YK0A 3WK7A 5JMOA 4JOBA 5EKKA 1TYEB 2N0SA 2C3OA 4OKSA 2OHGA 2PS9A 1Y4AE 1MKYA 3H6GA 4CM1A 4NBSA 4IV5A 2OORC 4NXNQ 2MJLA 4PQYA 1WCMH 4DK0A 3ILHA 1I01A 2ASBA 2A9VA 5JAMA 2FEWB 1UDRA 4Q00A 2AOXA 4IOLA 4KWHA 4F4DA 1R9NA 2PG3A 2PO5A 3CC8A 2H2WA 2QGAB 2AN1A 3F4KA 5CJ2A 4BY1H 2P40A 1EUQA 1WXDA 3QFHA 5GJBA 4BJ5A 3B8EA 4DBVO 1ZHHA 5FTKA 4BNIA 4QHYA 2BFMA 1TIID 4Y7DA 3ZXXA 2FEMA 3DJYA 3FM9A 3KYCB 4JIMA 4GBJA 1RXCA 2VYND 4BO4A 1AGPA 1CKNA 3EZXA 2I4TA 1Z5ZA 5IH3A 3QKTA 2P7IA 3U4QA 4GQBA 3LPLA 3DE7X 1F9RA 1ZMOA 4ZQGA 3W5UA 3OT1A 1V16B 4UNSA 3RS4A 1G5TA 1FX0B 1A1VA 1UM9B 3KF6A 2O3TA 5EIBC 1IUNA 4KIGA 4QECA 3JQEA 3AG6A 4H02A 1P9LA 1QF7A 1N5KA 2Y0PA 4LZWA 3D2BA 1T5IA 2P6NA 2ZT9C 1R2QA 3T5CA 1L4HA 1PWEA 4KO8A 2R92G 3FCSB 2DKOA 3PSHA 5AVYA 3PYXA 1NF3A 2BBWA 2KEDA 2O3QA 3U3RA 4YONB 3EPJA 2EKLA 4QPNA 3HU2A 1I36A 1UOEA 4ESHA 4IQJM 1JAXA 4G4GA 2P2LA 4G26A 1JI3A 5IDYA 5HEKA 2G1AA 3FCAA 1H1LA 4X64B 3TN2A 2LW7A 4F5EA 4RK5A 1QZHA 2CMKA 4G0YA 1RABA 1BCPB 4LMRA 3EBLA 4OQDA 3PQFA 2VHCA 4DF7A 2IPXA 2FCRA 4KBGA 4Z53A 2FOXA 4JWTA 4LGVA 2O2CA 3UT5A 2QYHA 2IH4A 1NNXA 4EVSA 1URPA 3BM5A 5FUVA 1T5XD 4RGNA 3PZRA 2B63H 1YZYA 1MC8A 1EEFD 1E3WB 4ZOLB 2JA7G 2OEPA 3OEHA 2I29A 4AZSA 2PQ6A 1L5MA 3S1NH 1TC1A 1B0UA 5MN4A 2XMSA 4YWJA 1T9DA 4FSHA 1NFFA 2WV9A 1EFRD 4OI2A 2GSDA 3LMKA 2Z58A 4YMUA 3DUFB 4DBLC 2AW3A 1PH1A 3R6GA 2GD0A 3D4PA 1ZD1A 3T53B 1K3BC 5AH0A 4WE3A 3VYVA 5HGTA 1MPTA 3WI7A 4DR5L 1MG0A 5FK9C 2I0FA 4GDMA 1NY5A 4QF4A 3BXXA 4S1PA 2LV8A 2YV1A 2B37A 1A9XB 2IIPA 3ZCSA 3W8DA 3DOFA 4PFQA 3F3SA 2JKVA 4DL9A 2R96A 4FDMA 3HSKA 4Z0PA 1WTVA 1SXGA 1LLQA 1Z28A 1DDIA 1G4HA 1CR1A 3C3MA 3QKUA 4GVLA 3CF4A 3X1WA 2ENBA 5BSRA 3WIOA 2WNHA 1TC2A 4Q34A 1DC3A 2JKYA 3PR3A 1ECFA 5IN4A 1L1FA 4EARA 3NOXA 2WMOB 5IABA 5JU6A 3L7YA 3X2FA 3DO5A 3A6PC 2HXSA 5FLMH 4QNNA 1J5XA 4KLRA 3L79A 4CLRA 1OWOA 3KS9A 1Z7TA 2J9FB 1ZSNA 4I08A 4AM8A 1AHPA 2MIIA 1YO6A 5EINA 3CPSA 1Y6GA 3PVSA 3OEED 4WESB 3R75A 1QK4A 3F97A 2EFDB 3KQVA 2O05A 5HS6A 1TVKB 4U6QA 5BMVA 5GZ6A 4LAAA 3TRFA 3J80i 3TW0A 1GPAA 1D2NA 1T1JA 3WLRA 5DEIA 3EDYA 5FWDA 2C5SA 4BWGB 3K6SA 3UJDA 2ARKA 3IA7A 2N46A 2EBHX 4CHTB 3A2NA 3C5WP 4AH6A 1BVRA 5LBIA 5JADA 3Q0TA 3R5HA 3U1VA 2IEZA 2BEUA 3ZI4A 1GA4A 2B2XA 2P62A 4PF1A 1W6JA 1VE7A 3QMVA 1MKHA 3BK2A 1E1RA 2OBXA 4PSDA 2UUCL 4BKPA 2IBSA 3BKWA 3DLAA 3B2QA 5IF9A 3BCHA 1RC0A 2DWOA 4K1XA 2OQVA 3G1WA 3UM9A 3G3EA 2C3UA 1DCNA 2IHVA 2PKYX 2C82A 3MMNA 1CY4A 1JJCB 3ITPA 4OFZA 5HRUA 2WAOA 2QR2A 2V7PA 3AEZA 4XCXA 4ER7A 4FE4A 2GNPA 1PR0A 5C6AA 4A4IA 1K9SA 1W8IA 3FWHA 5EE0A 3MSCA 1UDXA 3OZSA 1M2KA 2IQ5A 4JLOA 3VR6H 3W2FA 4N18A 1M72A 3WE7A 1JEQB 4H1WA 2YWEA 2K6GA 2DWQA 1HGXA 3DDCA 1W1UA 3ZUGA 2GD6A 3VU1A 1HZAA 3RZOH 1KL9A 4BNTA 1D1TA 5ARBA 3ASZA 3NM5A 1EZ4A 4GVPA 3BIWA 3H3VI 3Q3JB 4G23A 3M83A 3G8YA 4P4UA 1ZK4A 3VKVA 3O8CA 4C7BA 3WZMA 3EXAA 4M37A 3ZWVA 3CRLC 3NX4A 4XTCS 1L8QA 4BB6A 5HA5A 5ADHA 4WN9B 4J7AA 2OCDA 2ECKA 2JYOA 2VUTA 2QRGA 2AYYA 3HG9A 2HSZA 3BYTB 1QPGA 5AKKA 1NMGA 1EJ6A 2ERYA 1A76A 4LSZA 5EMHA 1OFGA 4GOJA 1JHVA 1A77A 1EGVB 3NYIA 2NO0A 3R40A 3GLRA 4TTPA 2B1RA 2WAQG 3WBKA 5EPKA 4B45A 1FIUA 2VKQA 2DCUA 1XQWA 4GL4A 2VRNA 4M9QA 1YC2A 2ZYGA 3O2JA 3S6JA 3WGMA 1KTVA 1J7KA 2K87A 3HVRA 5HKKD 1K7YA 4G56A 2R97A 1LA2A 3BQMB 4N7BA 1D2RA 2UYOA 2PTGA 5G3LF 3HS0C 3NG1A 3CLTD 1IZZA 3JQ7A 2FWMX 1A8VA 3CF6R 3UAVA 1W36C 3AJ8A 2IU6A 3KVYA 2OY0A 4KQMA 2H1EA 1EFLA 1HJPA 1AN0A 2GZMA 2NXNA 5BRNA 3HDGA 2LTAA 1POWA 3EASA 4BZPA 4FFSA 1EJ2A 4O25A 2D5IA 1VXOA 4U4AA 3RYTC 4KFRA 3SBOA 4PPQA 2CWDA 2PAFA 1GPUA 4ABYA 4YB8A 4TSRA 4BBAA 4TVAB 1DIHA 1FDRA 2RGYA 4WAUA 3MQ4A 3TR0A 4MQBA 1MZVA 1GEGA 4P4TA 1PG2A 2W2TA 1WIWA 1X0XA 3RC2A 4UUOA 4F1WA 3R3SA 4CLEA 1NXOA 1BMQA 4WINA 4YHHB 4EGCB 4PTZA 1NQOA 3P0IA 4JKOA 1QAMA 1WG8A 3IP9A 3HOZH 1MJGA 1C0IA 3ZGYA 5LLDA 4MP3A 1XLUA 3FA2A 2FSGA 4KQGA 5THQA 5LMCA 1ZM9A 5JV5A 3QA9A 1XALA 3EXG2 3LHDA 3DMRA 2Q5QA 1THGA 3LKBA 1TS4A 4A1OA 3MTAA 3MJSA 5FJJA 3ZE9A 2HAEA 2G9NA 4HDQB 4G0MA 1C7EA 4BVGA 2PYZA 2NSJA 4YY3L 3IIJA 1HDOA 2QJWA 5KQPA 2Y0SG 2JGIA 3GLGE 5CTJA 2R93G 1DCKA 1QO0A 2WJYA 3WK4A 2Z6UA 4FMCB 3KZCA 4Q21A 3NC4A 3SBXA 1BXGB 1HA3A 3HCDA 2IYXA 3LXMA 2XXBA 3QBDA 4NZ9A 1OPRA 2F8LA 2QL7A 3O92A 1JEYA 1YCFA 3ZW9A 1FB5A 5J5VA 3TP7A 1RJTA 4JITA 1ZG3A 4LF8Q 1WD5A 2RBKA 1QANA 4WOCA 3GJQA 4XYBA 3N2EA 1K6JA 4GUAA 3OQIA 1OWPA 4GMDA 2JA5H 4KOAA 3LC7O 2ZJOA 2XVYA 3G0GA 4F6CA 3HG7A 3AI1A 1EG7A 3EBOA 3SLKA 1WTOA 2P77A 4D8TA 2LNDA 1G55A 1FX1A 2G5CA 1RKNA 1CXZA 2V6FA 5DYTA 3S7ZA 3NIFB 4CEIA 3UK0A 3AVTA 3G02A 3UWPA 4JSYA 1NTGA 1J5EL 3A1EA 2VT6A 1CC1S 3PQCA 5JALA 3V55A 1YL6A 4PWYA 2ZUEA 5HZKA 2ZUUA 2AG1A 3B36A 4JJ6A 1YS7A 3L1UA 4DQUA 3OEHD 4X61A 5IGFA 1Y4SA 4UJ5A 3HFGA 4FDTA 1SG0A 4IRUB 2OCLA 3CLUC 4R81A 3A8JE 1AT1A 3ETEA 5HK8A 2GEBA 1SWVA 4FXGC 4A3MG 4HRVA 2NU6A 1LBQA 3KXLA 5LXTB 5FBWB 5LDGA 3NBFA 3IODA 2CDCA 2FPGA 3KKNA 4YP9A 1X74A 3VUFA 1ZKOA 5JWOA 2ZJ8A 4I46A 3NK9A 2OBNA 4N3CA 2QKIC 2QE7A 3HDHA 2Y1FA 1UXHA 1IK6A 4IUBS 3W1BA 5K45A 3HCEA 3CVJA 4P22A 4EAQA 4E32A 1VQIA 2ZUTA 3T3MB 3C5VA 1Y9EA 2PU5A 1P39A 1DO2A 5IJ9A 1XMXA 1QGUB 4GPAA 1OJ7A 1NKSA 5BVGA 5CFPA 1SUWA 5FA5A 2RC5A 2WSIA 1Q14A 1P18A 4EG3A 1OBVA 4DV5Q 1EFCA 4A1FA 4PNEA 1YEZA 4K0RA 1ZIOA 1BOFA 3NOVA 3QOWA 3EF1A 4E13A 1EI9A 4JJKA 3WDMA 4KLNA 1USGA 4CM4A 1K5DA 1S1MA 4B3JA 1KAHA 2X19A 4RJTA 1TECE 1E1KA 1KDYA 1V47A 2H48A 5HZGA 5KSWB 4HB3A 2VDRB 4KBFA 3GTLH 1QHEA 2AJCA 1TS2A 2KENA 3IRVA 5EJ5A 2ZOSA 2R65A 3CYFA 4GKKB 4YO8A 3MOGA 4HRXA 4DV3Q 3K5NA 2WACA 3K70C 1NP6A 2C2KA 3CF2A 3V42A 5ICGA 2JJ1A 1WTRA 3D8RA 4CQMB 5KX5F 1DRWA 3WLLA 5CGQB 1ML0D 4LGCA 2ZE7A 3OW2A 3UXHA 1MNAA 1EXWA 1N8SA 4MW6A 2UZ1A 1CUYA 3NEJA 3PFGA 3VH4A 3GPDG 3WISA 1MIOA 2I55A 4O2DA 2RSLA 4XYOA 1NLFA 1E1RD 2HJ9A 2PRJA 1SSOA 1GGNA 3ICOA 1DC6A 5KSZA 1I5OA 3JWIA 2C5GA 3BZDB 3ZK7A 1B50A 4DJJA 3ZJTA 1BYUA 5AOCA 2P5ZX 2NVUB 3TZDA 1GUOA 1YR1A 4MZ9A 1S3IA 4GPD1 2GCNA 2V8OA 1I2ZA 4TYPA 4GWGA 2OV4A 1M6HA 3NHBA 1XELA 2VSNA 2BFBA 4FHCA 3EWSA 1REQB 2XD9A 1CJTC 3R3OA 1X15A 3BULA 5BOSB 2VDVE 2ZTDA 2NO4A 3ZJYA 2VB2X 1NVGA 4L5IA 1E2GA 4RPHA 3E7FA 4JI6Q 4A0GA 5CMLA 3H9CA 1EY0A 5TJ9A 4TWJA 4NLEA 3BN3A 2HF9A 1AKUA 1M9NA 3FPCA 4WJ4A 3KYCA 5B7PA 1Z22A 2OD9A 3T5TA 4ZZIA 3BG3A 4EY3A 3Q8WA 5C0XH 4GFDA 3PX7A 1ZOSA 3I5MA 4OUDA 2AI1A 4NAUA 1BHSA 2QRVA 1PR4A 4X24A 5EIXA 2H5XA 1UM9A 2GN2A 1QDEA 3HP7A 2XECA 4P4LA 3EOAI 3E58A 1FGUA 1US8A 4KQHA 2BFEA 2BONA 1CVIA 1T9AA 3TG8A 3BMNB 3QXSA 1VFPA 4B6GA 1XZKA 5LLSA 1JVSA 4P33A 2ODNA 4R8IA 4RO0A 1DQYA 1WABA 2QZZA 1HT0A 2R1TB 1YA4A 2CE2X 1PTOC 4MHOA 3HR8A 3TKYA 2POCA 1OF1A 3H18A 3OHPA 3UMBA 2PLFA 4DEVA 4GAEA 4TWAA 4GX2A 4CIXA 3ZWYA 2ZWPA 2AKEA 5GAGC 5JJKA 4Q1DA 1OXXK 4E14A 3VX3A 1GCIA 1Q0SA 1LSSA 1Y7LA 4IDCA 2AWNA 1VGVA 4DCGA 2KLHA 5DHQA 4AIMA 2AR9A 4EEXA 4I9HA 1HG0A 1GYPA 1USUA 2ZRLA 2FUKA 2EJBA 5T3YA 3BGDA 2YHUA 2XYGA 3IBFA 3RQSA 4Q6BA 5C3WA 3U09A 5KAPA 4ZOLA 1XLVA 3KXIA 4X66B 3P94A 1BKDR 3UI2A 3ZK9A 3OP4A 1G2QA 4J2HA 1A7JA 3QIAA 1K75A 1WVIA 5F12A 4CR7A 1I33A 3OBBA 3V80A 3FJ1A 2HHHQ 2KPOA 1Q0PA 4BFUA 4V190 1SOUA 1MORA 4DIMA 4FW9A 4ZT7A 2N78A 3C8UA 4FF4A 3RS9A 4HWRA 2XTJA 1N2CA 4B83A 2DHEA 5JQWA 3U4ZA 4V0MA 2XSZA 3Q87B 2BYTA 4C3HB 4X20A 5J5CA 3SIXA 4LJ9A 4A3JB 1LBTA 1YZ6A 4K2AA 1E6WA 1U6JA 1P0CA 3SQNA 4X1OA 2J4FA 1OWNA 1ZN9A 1A9XA 3A1DA 3BTSA 1PH7A 1QZ3A 2V9CA 3PIO3 1Y7PA 3DQPA 3QE3A 3ZW8A 4LXYA 1I14A 3TZLA 1F5SA 1P7YA 2J0EA 2NMVA 4CEJA 5A2GA 4Z54A 2PT5A 2FA9A 2AUNA 3I5YA 2FY8A 4BBSH 4E5YA 5K0LA 3WNQA 1Z7YA 2PWPA 2MSWA 3UQZA 1N9KA 3FZQA 3LYLA 3EJWA 1XAIA 3HBFA 2QTVB 4B9XA 4CRWB 4UULA 5CCBA 1V43A 3ELWA 2C8VA 4V0NA 2R2GA 2BR3A 2VUSA 2QRLA 4DLAA 2P9BA 1UANA 1HL7A 1QO0D 2QSYA 4I6JA 2QTAA 2JAHA 4RH3A 3FKQA 2NWGA 3Q7QA 1C30A 3I6IA 1VPLA 5EKLA 5I6WA 4WESA 5ALJA 4ZICA 4Q4DA 3ZC3A 3HCAA 4D5EA 2MPMA 3T3EA 2PCJA 2YMMA 2ZTHA 3UBTA 2DUJA 3BAFA 4MVJM 1LC3A 1QV9A 1CQIB 1GL7A 1CW2B 4G5OA 1GG2A 2IUSA 4CHTA 3DB1A 1X38A 2UXCQ 1DGSA 2WM8A 1JALA 1DAOA 5D1HA 3DAGA 4RGVA 4EG0A 2CNLA 2XEXA 2RGGA 8ATCA 4EPWA 3CH5A 5IZCA 5BN5B 1IM8A 2B4TO 1CRPA 1YE5A 2PVSA 4DREA 4EI8A 5I2XA 5CDFE 3NW9A 2EQAA 4TZKA 3ZGVA 5L6MB 4ZK6A 3PUWA 4Y6QA 4ZGWA 3NHZA 4TSFA 3X0DA 4LE1A 3CTMA 4FDBA 3UGQA 1ZVMA 1D7AA 5DNYB 4CEHA 3SFZA 3H7IA 1D4OA 1HYBA 4MJ3A 5E6RB 1OFUX 3BBLA 3CRW1 2FR8C 3D02A 1Q1EA 1OBFO 1AUOA 2VTKA 2CDRA 1VA4A 4OXKA 4P7GA 1RQLA 1KI1A 2C7BA 2B4AA 1C9KA 1OW3B 4KAAA 3UN1A 3K2QA 4II3A 4ZT3A 5EUMA 1Q19A 2GFIA 3DJFA 2Q7OE 3PC6A 3EXIA 2QD5A 1XVAA 4J0FA 2QE7D 4MVJE 1EK0A 1O0BA 4LSWA 3DKVA 1KFKB 1Z6TA 5EBCA 2FX5A 3CVXA 4XVHA 1DOZA 3P2JA 5AHWA 5BP7A 4IFDJ 4QDKA 2WFLA 4PMWA 1GGEA 4NJEA 1HNXQ 2ZR9A 1PH6A 4C0XA 3K1AB 5IT9A 5JPNC 3UHOA 4DADA 2ZE8A 2CNBA 4Q7KA 2OZEA 2XZPA 4F9TA 3NDIA 2FZGA 5FHRA 5DCWA 4D26A 2ACWA 1G0OA 1RXWA 2CUTA 3TB6A 1X1BA 4ND2A 3GJ3A 1N2EA 3QWHA 4CPDA 2DR2A 5AOVA 5DTJA 4FKZA 2YINC 2F7SA 3FNBA 5C34B 3T5PA 3ZWNA 3E5MA 1NAHA 3SGIA 3M6VA 3ERCA 4Q3NA 1VHLA 3QEKA 4D9BA 1OLUB 1LNZA 4MV1A 1MT3A 2XUHA 5C7IO 2QX7A 3UIEA 3I5UA 4KYUA 4WPGA 1CUVA 3NR2A 1VB3A 1QVVA 1ZCAA 4POGA 4RA9A 4CCWA 2JARA 2GJKA 1OV6A 5AK5A 5FPSA 1JT2A 2JJ1D 2E2DC 5LIPA 4O4LF 3DZDA 1A5BB 4OB7A 1VSTA 4BE9A 1SE3A 2BZ1A 2IL1A 5IODA 5F92A 4BO3A 2R8RA 3L6RA 4DNQA 3AKYA 2OAGA 4YUVA 2Q4TA 4DV1L 4Q93A 1NQ5A 1AV6A 2YMLA 1ODIA 3AVXA 1BD4A 4N6NA 4DV6L 1DAPA 1E6EA 4XWOA 1U5BA 1ZJZA 2GZ2A 2E4VA 3OZGA 3TSZA 4G5QA 4G5FA 1YE8A 2F3QA 1HRJA 4LUCA 3TD2A 3PTAA 4WJWA 1EFTA 3T54A 5HPYB 4EGAA 3DMPA 4A6EA 5DM1A 3U7JA 2ATWA 1C7FA 1UJ2A 4MUGA 4EHLA 4MV3A 1QSGA 4BS9A 1HSZA 1KWKA 4V38A 4BYMA 1YZNA 3R6LA 5IJ0B 2YW2A 3UICA 2W48A 1UBJS 2JLBA 1K2WA 2GEFA 1QK3A 2EF1A 1O8BA 3SOPA 1QE5A 4PZAA 1Q92A 3OF5A 4B8ZA 4MUIA 1X2EA 3ESZA 4W6ZA 4CL2A 1SM4A 2PKRA 1R9TB 4DW8A 3FTDA 3OWEB 1TYBE 5L3VA 1G20E 1VHDA 3G0OA 2XDWA 3I42A 4FM9A 3C24A 4FZVA 4MXDA 4MW1A 5EQFA 3EFHA 1J8QA 1F7VA 3A11A 2ONKA 4MLCA 3X1DA 3WL8A 3W5AA 2AK2A 1KHHA 4ZYTA 5LMNW 1BJTA 1SN8A 4GN4B 1PJLA 1X65A 4GI5A 3QWIA 1IY9A 2ZRKA 1A8QA 5AW9A 2ZANA 4HR7B 4RKYA 1MAUA 2VATA 2GZAA 5D65A 3NP7A 4JBHA 2H2AA 1IBML 1W30A 2NZOA 5DWVA 4OFWA 1KP3A 3IUMA 3L05A 3RIEA 3CQZB 1HTLD 1ZU5A 4AKGA 5IP9H 3U4AA 3FPFA 3ZG6A 5FUQA 1U63A 2AUJD 4AMVA 4DDHA 2WVHA 3OD5A 4ZC1A 4P4GA 4I6EA 1ZWLA 4QVKA 4A76A 2OXRA 2ZT8A 4QX6A 5TMEA 2P5TB 2CJYA 3P0RA 2IVZA 2B2WA 3LUCA 1VZ3A 3E7XA 4F11A 1JDUA 4BMZA 1OWMA 2WB1E 3TSSA 4OGGA 2RHTA 3NWOA 3WL7A 3AEQA 1Y7HA 4PSVA 4XFJA 5WRFA 5JJCA 2G5TA 2C58A 1BCPD 5C44G 3M4OH 1IG0A 4E51A 2DY8A 4Q19A 2NZJA 1GWNA 1JSCA 1K7CA 1UK9A 2F0NA 2L82A 2GBCA 1DX4A 3H42B 4B08A 3LAWA 5JI2E 3LJKA 1M5RA 3RYCB 4IHKA 3JZIA 4F3TA 1JHQA 3GJYA 3BXEA 3LX6A 3BDAA 3CC4A 1GKUB 5C35A 4NL4H 3EW9A 2HCBA 3IB3A 1UEJA 3GTPB 1QLHA 1VIYA 3QOFA 1E5LA 1R6VA 3PCRB 2G67A 2HQ1A 3S55A 3WYCA 3DEOA 4PV7A 3ZZNA 4TYYA 1SGWA 3R7AA 3GT7A 2A74C 3A7AB 2VKTA 3IAXA 1DM0B 3MTJA 1S3OA 1SCUB 1BNZA 2OXPA 5GY7A 2OV1A 1TS5A 1D8TA 3ZHYA 2C20A 3N8HA 3E9IA 1IKLA 1VQEA 1VRVA 4P34A 4AG3A 4ZDWA 4C4PA 4H3VA 1S40A 1LGYA 3FEWX 3GV0A 4D8YA 1DKLA 2YXPX 1KJIA 4PC1A 4JH0A 3K9CA 2FR0A 2QM3A 4M9XA 4NMXB 5T57A 5AKJA 4A3IB 2IYWA 4MR9A 2GZDA 5BVHB 3MJTA 4ZV4A 5T4BA 3C1EA 4KMMA 2P2GA 4HWSA 4B48A 2VT3A 4P84A 4E08A 1EGQA 2W4MA 4U673 4JC8A 5DIFA 2ATCA 1K0UA 5LZ8A 13PKA