2PTSA

Crystal structure of wild type escherichia coli adenylosuccinate lyase
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
458
structure length
447
Chain Sequence
MELSSLTAVSPVDGRYGDKVSALRGIFSEYGLLKFRVQVEVRWLQKLAAHAAIKEVPAFAADAIGYLDAIVASFSEEDAARIKTIERTTNHDVKAVEYFLKEKVAEIPELHAVSEFIHFACTSEDINNLSHALMLKTARDEVILPYWRQLIDGLKDLAVQYRDIPLLSRTHGQPATPSTIGKEMANVAYRMERQYRQLNQVEILGKINGAVGNYNAHIAAYPEVDWHQFSEEFVTSLGIQWNPYTTQIEPHDYIAELFDCVARFNTILIDFDRDVWGYIALNHFKQKTIMPHKVNPIDFENSEGNLGLSNAVLQHLASKLPVSRWQRDLTDSTVLRNLGVGIGYALIAYQSTLKGVSKLEVNRDHLLDELDHNWEVLAEPIQTVMRRYGIEKPYEKLKELTRVDAEGMKQFIDGLALPEEEKARLKAMTPANYIGRAITMVDELKHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylosuccinate lyase
publication title Substrate and Product Complexes of Escherichia coli Adenylosuccinate Lyase Provide New Insights into the Enzymatic Mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 166
structure length 447
sequence length 458
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF08328 ASL_C Adenylosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 2ptsA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 2ptsA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 2ptsA02
1K62A 2FUSA 5F92A 4ADMA 1GK2A 1Y2MA 5F91A 1C3UA 3R6VA 2RJRA 1GKJA 1TJWA 1K7WA 1DCNA 3CZOA 1T6PA 2NYNA 1GKMA 1C3CA 4EEIA 4V2RA 1GK3A 4NSLA 2OHYA 1B8FA 1TJVA 4NLEA 4CQ5A 1T6JA 3TV2A 2RJSA 5EYVA 2J91A 3GTDA 4APBA 1J3UA 1YFMA 1FURA 3QBPA 3C8TA 1U15A 1VDKA 1XWOA 4BAAA 5EYTA 2E9FA 1TJ7A 2PTSA 4C6GA 4ADLA 2HVGA 2O6YA 1RE5A 1HY1A 4BABA 2O7DA 3OCFA 2O7BA 4C5UA 2YIIA 1FUOA 1FUPA 2VD6A 2O7EA 4C5RA 3R6QA 1EB4A 1AUWA 3R6YA 2PTQA 3KDZA 3NO9A 2O7FA 4V2QA 3NZ4A 4EFCA 1DOFA 1YFEA 4HGVA 1U16A 2QVEA 1I0AA 2PTRA 4C5SA 2NYFA 3RRPA 2QGAB 4APAA 1KQ7A 1FUQA 3GZHA 2X75A 3OCEA 5D6BA 3UNVA 3E04A 4MX2A 4FFXA 1HY0A 3KDYA 1JSWA 3BHGA 2O78A 1YISA 1W27A 1Q5NA 4FLCA 1TJUA 3RD8A 5HW2A 2PFMA
chains in the Genus database with same CATH superfamily
1K62A 2D27A 2FUSA 3CI0K 5F92A 4ADMA 1GK2A 5F91A 1C3UA 3R6VA 4YIHA 1Y2MA 2RJRA 1GKJA 5M0IA 3U13A 4E88A 1TJWA 1Z4KA 1K7WA 1DCNA 4L6CA 4YIKA 3CZOA 2I7DA 1T6PA 2NYNA 1GKMA 2VSFA 1IW7D 1C3CA 4EEIA 4V2RA 2D28C 1GK3A 4NSLA 2OHYA 1B8FA 1TJVA 4NLEA 5M0JA 4CQ5A 2JAUA 1Q91A 1T6JA 3TV2A 2RJSA 5EYVA 2J91A 3GTDA 4MWOA 4APBA 1J3UA 1YFMA 1FURA 3F4TA 3QBPA 3C8TA 1U15A 3CRVA 1VDKA 4L57A 1XWOA 4BAAA 5EYTA 2E9FA 1TJ7A 2PTSA 4C6GA 1XMDA 4ADLA 2HVGA 2O6YA 1RE5A 3F4RA 1HY1A 1Z4IA 4BABA 2JAOA 2FELA 2O7DA 3OCFA 2O7BA 4C5UA 2YIIA 1U0LA 1FUOA 1FUPA 4NFLA 4MUMA 2VD6A 1T9HA 2O7EA 4C5RA 3R6QA 1EB4A 1AUWA 3R6YA 2PTQA 2RCNA 3KDZA 3NO9A 1Z4JA 1MH9A 2O7FA 4WNLA 2JAWA 4V2QA 3NZ4A 4EFCA 1DOFA 3BWVA 1Z4LA 5H8WA 1YFEA 4HGVA 1U16A 4A15A 2QVEA 1I0AA 1XL7A 2JARA 2PTRA 4C5SA 2NYFA 3U19A 3RRPA 2QGAB 4APAA 1Q92A 1KQ7A 1FUQA 3CRW1 3GZHA 2X75A 3OCEA 5D6BA 3UNVA 3E04A 4MX2A 1Z4PX 1XLYA 2FENA 4FFXA 3F4SA 4IQJM 1HY0A 3KDYA 1JSWA 3BHGA 2YV5A 2O78A 1YISA 1Z4MA 1Z4QA 1W27A 1XMCA 1Q5NA 1XL8A 4FLCA 1TJUA 2VL7A 4L6AA 3RD8A 5HW2A 2PFMA
chains in the Genus database with same CATH topology
1K62A 2FUSA 5F92A 4ADMA 1GK2A 1Y2MA 5F91A 1C3UA 3R6VA 2RJRA 1GKJA 1TJWA 1K7WA 1DCNA 3CZOA 1T6PA 2NYNA 1GKMA 1C3CA 4EEIA 4V2RA 1GK3A 4NSLA 2OHYA 1B8FA 1TJVA 4NLEA 4CQ5A 1T6JA 3TV2A 2RJSA 5EYVA 2J91A 3GTDA 4APBA 1J3UA 1YFMA 1FURA 3QBPA 3C8TA 1U15A 1VDKA 1XWOA 4BAAA 5EYTA 2E9FA 1TJ7A 2PTSA 4C6GA 4ADLA 2HVGA 2O6YA 1RE5A 1HY1A 4BABA 2O7DA 3OCFA 2O7BA 4C5UA 2YIIA 1FUOA 1FUPA 2VD6A 2O7EA 4C5RA 3R6QA 1EB4A 1AUWA 3R6YA 2PTQA 3KDZA 3NO9A 2O7FA 4V2QA 3NZ4A 4EFCA 1DOFA 1YFEA 4HGVA 1U16A 2QVEA 1I0AA 2PTRA 4C5SA 2NYFA 3RRPA 2QGAB 4APAA 1KQ7A 1FUQA 3GZHA 2X75A 3OCEA 5D6BA 3UNVA 3E04A 4MX2A 4FFXA 1HY0A 3KDYA 1JSWA 3BHGA 2O78A 1YISA 1W27A 1Q5NA 4FLCA 1TJUA 3RD8A 5HW2A 2PFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K62 A;  2FUS A;  5F92 A;  4ADM A;  1GK2 A;  1Y2M A;  5F91 A;  1C3U A;  3R6V A;  2RJR A;  1GKJ A;  1TJW A;  1K7W A;  1DCN A;  3CZO A;  1T6P A;  2NYN A;  1GKM A;  1C3C A;  4EEI A;  4V2R A;  1GK3 A;  4NSL A;  2OHY A;  1B8F A;  1TJV A;  4NLE A;  4CQ5 A;  1T6J A;  3TV2 A;  2RJS A;  5EYV A;  2J91 A;  3GTD A;  4APB A;  1J3U A;  1YFM A;  1FUR A;  3QBP A;  3C8T A;  1U15 A;  1VDK A;  1XWO A;  4BAA A;  5EYT A;  2E9F A;  1TJ7 A;  2PTS A;  4C6G A;  4ADL A;  2HVG A;  2O6Y A;  1RE5 A;  1HY1 A;  4BAB A;  2O7D A;  3OCF A;  2O7B A;  4C5U A;  2YII A;  1FUO A;  1FUP A;  2VD6 A;  2O7E A;  4C5R A;  3R6Q A;  1EB4 A;  1AUW A;  3R6Y A;  2PTQ A;  3KDZ A;  3NO9 A;  2O7F A;  4V2Q A;  3NZ4 A;  4EFC A;  1DOF A;  1YFE A;  4HGV A;  1U16 A;  2QVE A;  1I0A A;  2PTR A;  4C5S A;  2NYF A;  3RRP A;  2QGA B;  4APA A;  1KQ7 A;  1FUQ A;  3GZH A;  2X75 A;  3OCE A;  5D6B A;  3UNV A;  3E04 A;  4MX2 A;  4FFX A;  1HY0 A;  3KDY A;  1JSW A;  3BHG A;  2O78 A;  1YIS A;  1W27 A;  1Q5N A;  4FLC A;  1TJU A;  3RD8 A;  5HW2 A;  2PFM A; 
#chains in the Genus database with same CATH topology
 1K62 A;  2D27 A;  2FUS A;  3CI0 K;  5F92 A;  4ADM A;  1GK2 A;  5F91 A;  1C3U A;  3R6V A;  4YIH A;  1Y2M A;  2RJR A;  1GKJ A;  5M0I A;  3U13 A;  4E88 A;  1TJW A;  1Z4K A;  1K7W A;  1DCN A;  4L6C A;  4YIK A;  3CZO A;  2I7D A;  1T6P A;  2NYN A;  1GKM A;  2VSF A;  1IW7 D;  1C3C A;  4EEI A;  4V2R A;  2D28 C;  1GK3 A;  4NSL A;  2OHY A;  1B8F A;  1TJV A;  4NLE A;  5M0J A;  4CQ5 A;  2JAU A;  1Q91 A;  1T6J A;  3TV2 A;  2RJS A;  5EYV A;  2J91 A;  3GTD A;  4MWO A;  4APB A;  1J3U A;  1YFM A;  1FUR A;  3F4T A;  3QBP A;  3C8T A;  1U15 A;  3CRV A;  1VDK A;  4L57 A;  1XWO A;  4BAA A;  5EYT A;  2E9F A;  1TJ7 A;  2PTS A;  4C6G A;  1XMD A;  4ADL A;  2HVG A;  2O6Y A;  1RE5 A;  3F4R A;  1HY1 A;  1Z4I A;  4BAB A;  2JAO A;  2FEL A;  2O7D A;  3OCF A;  2O7B A;  4C5U A;  2YII A;  1U0L A;  1FUO A;  1FUP A;  4NFL A;  4MUM A;  2VD6 A;  1T9H A;  2O7E A;  4C5R A;  3R6Q A;  1EB4 A;  1AUW A;  3R6Y A;  2PTQ A;  2RCN A;  3KDZ A;  3NO9 A;  1Z4J A;  1MH9 A;  2O7F A;  4WNL A;  2JAW A;  4V2Q A;  3NZ4 A;  4EFC A;  1DOF A;  3BWV A;  1Z4L A;  5H8W A;  1YFE A;  4HGV A;  1U16 A;  4A15 A;  2QVE A;  1I0A A;  1XL7 A;  2JAR A;  2PTR A;  4C5S A;  2NYF A;  3U19 A;  3RRP A;  2QGA B;  4APA A;  1Q92 A;  1KQ7 A;  1FUQ A;  3CRW 1;  3GZH A;  2X75 A;  3OCE A;  5D6B A;  3UNV A;  3E04 A;  4MX2 A;  1Z4P X;  1XLY A;  2FEN A;  4FFX A;  3F4S A;  4IQJ M;  1HY0 A;  3KDY A;  1JSW A;  3BHG A;  2YV5 A;  2O78 A;  1YIS A;  1Z4M A;  1Z4Q A;  1W27 A;  1XMC A;  1Q5N A;  1XL8 A;  4FLC A;  1TJU A;  2VL7 A;  4L6A A;  3RD8 A;  5HW2 A;  2PFM A; 
#chains in the Genus database with same CATH homology
 1K62 A;  2FUS A;  5F92 A;  4ADM A;  1GK2 A;  1Y2M A;  5F91 A;  1C3U A;  3R6V A;  2RJR A;  1GKJ A;  1TJW A;  1K7W A;  1DCN A;  3CZO A;  1T6P A;  2NYN A;  1GKM A;  1C3C A;  4EEI A;  4V2R A;  1GK3 A;  4NSL A;  2OHY A;  1B8F A;  1TJV A;  4NLE A;  4CQ5 A;  1T6J A;  3TV2 A;  2RJS A;  5EYV A;  2J91 A;  3GTD A;  4APB A;  1J3U A;  1YFM A;  1FUR A;  3QBP A;  3C8T A;  1U15 A;  1VDK A;  1XWO A;  4BAA A;  5EYT A;  2E9F A;  1TJ7 A;  2PTS A;  4C6G A;  4ADL A;  2HVG A;  2O6Y A;  1RE5 A;  1HY1 A;  4BAB A;  2O7D A;  3OCF A;  2O7B A;  4C5U A;  2YII A;  1FUO A;  1FUP A;  2VD6 A;  2O7E A;  4C5R A;  3R6Q A;  1EB4 A;  1AUW A;  3R6Y A;  2PTQ A;  3KDZ A;  3NO9 A;  2O7F A;  4V2Q A;  3NZ4 A;  4EFC A;  1DOF A;  1YFE A;  4HGV A;  1U16 A;  2QVE A;  1I0A A;  2PTR A;  4C5S A;  2NYF A;  3RRP A;  2QGA B;  4APA A;  1KQ7 A;  1FUQ A;  3GZH A;  2X75 A;  3OCE A;  5D6B A;  3UNV A;  3E04 A;  4MX2 A;  4FFX A;  1HY0 A;  3KDY A;  1JSW A;  3BHG A;  2O78 A;  1YIS A;  1W27 A;  1Q5N A;  4FLC A;  1TJU A;  3RD8 A;  5HW2 A;  2PFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...