2PTSA

Crystal structure of wild type escherichia coli adenylosuccinate lyase
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
458
structure length
447
Chain Sequence
b'MELSSLTAVSPVDGRYGDKVSALRGIFSEYGLLKFRVQVEVRWLQKLAAHAAIKEVPAFAADAIGYLDAIVASFSEEDAARIKTIERTTNHDVKAVEYFLKEKVAEIPELHAVSEFIHFACTSEDINNLSHALMLKTARDEVILPYWRQLIDGLKDLAVQYRDIPLLSRTHGQPATPSTIGKEMANVAYRMERQYRQLNQVEILGKINGAVGNYNAHIAAYPEVDWHQFSEEFVTSLGIQWNPYTTQIEPHDYIAELFDCVARFNTILIDFDRDVWGYIALNHFKQKTIMPHKVNPIDFENSEGNLGLSNAVLQHLASKLPVSRWQRDLTDSTVLRNLGVGIGYALIAYQSTLKGVSKLEVNRDHLLDELDHNWEVLAEPIQTVMRRYGIEKPYEKLKELTRVDAEGMKQFIDGLALPEEEKARLKAMTPANYIGRAITMVDELKHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylosuccinate lyase
publication title Substrate and Product Complexes of Escherichia coli Adenylosuccinate Lyase Provide New Insights into the Enzymatic Mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 166
structure length 447
sequence length 458
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF08328 ASL_C Adenylosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 2ptsA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 2ptsA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 2ptsA02
4MX2A 4HGVA 1TJ7A 1DOFA 1W27A 1Y2MA 1B8FA 2O7FA 2O7DA 4C6GA 3OCFA 2OHYA 4C5UA 1TJVA 1XWOA 4V2RA 2E9FA 1FUPA 4FLCA 3E04A 1KQ7A 1I0AA 2HVGA 3R6QA 4EEIA 3KDZA 2O78A 4BAAA 1HY1A 1YISA 1FURA 2O7EA 4C5SA 1AUWA 1TJUA 1JSWA 2PTSA 3QBPA 1J3UA 5EYTA 1HY0A 1GKMA 1C3UA 2O7BA 5F91A 1YFEA 1Q5NA 1YFMA 2PTQA 1K62A 3TV2A 1T6PA 2QVEA 3OCEA 2QGAB 1GK3A 4CQ5A 4APAA 1EB4A 4ADMA 3CZOA 5EYVA 2NYNA 3RD8A 3RRPA 3KDYA 5D6BA 4NSLA 4FFXA 4V2QA 5F92A 3BHGA 3R6YA 1FUOA 1RE5A 2X75A 1U16A 1VDKA 2RJSA 2FUSA 1U15A 2PTRA 1TJWA 4EFCA 2O6YA 3GZHA 2J91A 4NLEA 2NYFA 1T6JA 4ADLA 2VD6A 1FUQA 2PFMA 3GTDA 3R6VA 1K7WA 1GKJA 1DCNA 1GK2A 3C8TA 3UNVA 4BABA 5HW2A 2RJRA 1C3CA 3NZ4A 4C5RA 2YIIA 3NO9A 4APBA
chains in the Genus database with same CATH superfamily
4IQJM 5M0IA 2VSFA 4MX2A 4HGVA 2FELA 4E88A 1TJ7A 1DOFA 1W27A 1Y2MA 1B8FA 2O7FA 2I7DA 2O7DA 4C6GA 3OCFA 2OHYA 1XMDA 4C5UA 1TJVA 1XWOA 3CRW1 4V2RA 4NFLA 2E9FA 1FUPA 4FLCA 1XLYA 3E04A 1KQ7A 3U19A 1I0AA 2HVGA 3R6QA 4EEIA 3KDZA 2O78A 4BAAA 1Z4PX 2VL7A 1HY1A 1MH9A 1YISA 1FURA 2O7EA 4C5SA 1XL7A 4MWOA 3CRVA 1AUWA 3CI0K 1TJUA 1JSWA 2PTSA 4L6AA 3QBPA 4YIHA 2JAUA 1J3UA 5EYTA 1IW7D 1HY0A 1T9HA 1GKMA 1C3UA 2O7BA 1Z4JA 5F91A 1YFEA 1Q5NA 1YFMA 2PTQA 1K62A 3TV2A 1T6PA 2QVEA 3OCEA 2QGAB 1Q91A 1GK3A 2JAOA 1Z4MA 4YIKA 1Z4KA 4CQ5A 4APAA 1EB4A 3F4RA 4ADMA 3CZOA 5EYVA 2NYNA 3RD8A 2FENA 3RRPA 1U0LA 1XL8A 3BWVA 1Z4LA 3KDYA 4WNLA 4L6CA 5D6BA 1XMCA 2JAWA 2YV5A 4L57A 4NSLA 4FFXA 1Z4IA 4V2QA 2RCNA 5F92A 4A15A 3BHGA 3R6YA 1FUOA 1RE5A 1Q92A 2X75A 1U16A 1VDKA 1Z4QA 2RJSA 2FUSA 1U15A 2PTRA 1TJWA 4EFCA 2O6YA 3GZHA 5M0JA 2J91A 4NLEA 2NYFA 2D27A 1T6JA 2JARA 4MUMA 4ADLA 2VD6A 1FUQA 2PFMA 3GTDA 3R6VA 1K7WA 3F4SA 1GKJA 1DCNA 3U13A 1GK2A 3C8TA 3UNVA 5H8WA 4BABA 5HW2A 2RJRA 1C3CA 2YIIA 3NZ4A 4C5RA 2D28C 3F4TA 3NO9A 4APBA
chains in the Genus database with same CATH topology
4MX2A 4HGVA 1TJ7A 1DOFA 1W27A 1Y2MA 1B8FA 2O7FA 2O7DA 4C6GA 3OCFA 2OHYA 4C5UA 1TJVA 1XWOA 4V2RA 2E9FA 1FUPA 4FLCA 3E04A 1KQ7A 1I0AA 2HVGA 3R6QA 4EEIA 3KDZA 2O78A 4BAAA 1HY1A 1YISA 1FURA 2O7EA 4C5SA 1AUWA 1TJUA 1JSWA 2PTSA 3QBPA 1J3UA 5EYTA 1HY0A 1GKMA 1C3UA 2O7BA 5F91A 1YFEA 1Q5NA 1YFMA 2PTQA 1K62A 3TV2A 1T6PA 2QVEA 3OCEA 2QGAB 1GK3A 4CQ5A 4APAA 1EB4A 4ADMA 3CZOA 5EYVA 2NYNA 3RD8A 3RRPA 3KDYA 5D6BA 4NSLA 4FFXA 4V2QA 5F92A 3BHGA 3R6YA 1FUOA 1RE5A 2X75A 1U16A 1VDKA 2RJSA 2FUSA 1U15A 2PTRA 1TJWA 4EFCA 2O6YA 3GZHA 2J91A 4NLEA 2NYFA 1T6JA 4ADLA 2VD6A 1FUQA 2PFMA 3GTDA 3R6VA 1K7WA 1GKJA 1DCNA 1GK2A 3C8TA 3UNVA 4BABA 5HW2A 2RJRA 1C3CA 3NZ4A 4C5RA 2YIIA 3NO9A 4APBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MX2 A;  4HGV A;  1TJ7 A;  1DOF A;  1W27 A;  1Y2M A;  1B8F A;  2O7F A;  2O7D A;  4C6G A;  3OCF A;  2OHY A;  4C5U A;  1TJV A;  1XWO A;  4V2R A;  2E9F A;  1FUP A;  4FLC A;  3E04 A;  1KQ7 A;  1I0A A;  2HVG A;  3R6Q A;  4EEI A;  3KDZ A;  2O78 A;  4BAA A;  1HY1 A;  1YIS A;  1FUR A;  2O7E A;  4C5S A;  1AUW A;  1TJU A;  1JSW A;  2PTS A;  3QBP A;  1J3U A;  5EYT A;  1HY0 A;  1GKM A;  1C3U A;  2O7B A;  5F91 A;  1YFE A;  1Q5N A;  1YFM A;  2PTQ A;  1K62 A;  3TV2 A;  1T6P A;  2QVE A;  3OCE A;  2QGA B;  1GK3 A;  4CQ5 A;  4APA A;  1EB4 A;  4ADM A;  3CZO A;  5EYV A;  2NYN A;  3RD8 A;  3RRP A;  3KDY A;  5D6B A;  4NSL A;  4FFX A;  4V2Q A;  5F92 A;  3BHG A;  3R6Y A;  1FUO A;  1RE5 A;  2X75 A;  1U16 A;  1VDK A;  2RJS A;  2FUS A;  1U15 A;  2PTR A;  1TJW A;  4EFC A;  2O6Y A;  3GZH A;  2J91 A;  4NLE A;  2NYF A;  1T6J A;  4ADL A;  2VD6 A;  1FUQ A;  2PFM A;  3GTD A;  3R6V A;  1K7W A;  1GKJ A;  1DCN A;  1GK2 A;  3C8T A;  3UNV A;  4BAB A;  5HW2 A;  2RJR A;  1C3C A;  3NZ4 A;  4C5R A;  2YII A;  3NO9 A;  4APB A; 
#chains in the Genus database with same CATH topology
 4IQJ M;  5M0I A;  2VSF A;  4MX2 A;  4HGV A;  2FEL A;  4E88 A;  1TJ7 A;  1DOF A;  1W27 A;  1Y2M A;  1B8F A;  2O7F A;  2I7D A;  2O7D A;  4C6G A;  3OCF A;  2OHY A;  1XMD A;  4C5U A;  1TJV A;  1XWO A;  3CRW 1;  4V2R A;  4NFL A;  2E9F A;  1FUP A;  4FLC A;  1XLY A;  3E04 A;  1KQ7 A;  3U19 A;  1I0A A;  2HVG A;  3R6Q A;  4EEI A;  3KDZ A;  2O78 A;  4BAA A;  1Z4P X;  2VL7 A;  1HY1 A;  1MH9 A;  1YIS A;  1FUR A;  2O7E A;  4C5S A;  1XL7 A;  4MWO A;  3CRV A;  1AUW A;  3CI0 K;  1TJU A;  1JSW A;  2PTS A;  4L6A A;  3QBP A;  4YIH A;  2JAU A;  1J3U A;  5EYT A;  1IW7 D;  1HY0 A;  1T9H A;  1GKM A;  1C3U A;  2O7B A;  1Z4J A;  5F91 A;  1YFE A;  1Q5N A;  1YFM A;  2PTQ A;  1K62 A;  3TV2 A;  1T6P A;  2QVE A;  3OCE A;  2QGA B;  1Q91 A;  1GK3 A;  2JAO A;  1Z4M A;  4YIK A;  1Z4K A;  4CQ5 A;  4APA A;  1EB4 A;  3F4R A;  4ADM A;  3CZO A;  5EYV A;  2NYN A;  3RD8 A;  2FEN A;  3RRP A;  1U0L A;  1XL8 A;  3BWV A;  1Z4L A;  3KDY A;  4WNL A;  4L6C A;  5D6B A;  1XMC A;  2JAW A;  2YV5 A;  4L57 A;  4NSL A;  4FFX A;  1Z4I A;  4V2Q A;  2RCN A;  5F92 A;  4A15 A;  3BHG A;  3R6Y A;  1FUO A;  1RE5 A;  1Q92 A;  2X75 A;  1U16 A;  1VDK A;  1Z4Q A;  2RJS A;  2FUS A;  1U15 A;  2PTR A;  1TJW A;  4EFC A;  2O6Y A;  3GZH A;  5M0J A;  2J91 A;  4NLE A;  2NYF A;  2D27 A;  1T6J A;  2JAR A;  4MUM A;  4ADL A;  2VD6 A;  1FUQ A;  2PFM A;  3GTD A;  3R6V A;  1K7W A;  3F4S A;  1GKJ A;  1DCN A;  3U13 A;  1GK2 A;  3C8T A;  3UNV A;  5H8W A;  4BAB A;  5HW2 A;  2RJR A;  1C3C A;  2YII A;  3NZ4 A;  4C5R A;  2D28 C;  3F4T A;  3NO9 A;  4APB A; 
#chains in the Genus database with same CATH homology
 4MX2 A;  4HGV A;  1TJ7 A;  1DOF A;  1W27 A;  1Y2M A;  1B8F A;  2O7F A;  2O7D A;  4C6G A;  3OCF A;  2OHY A;  4C5U A;  1TJV A;  1XWO A;  4V2R A;  2E9F A;  1FUP A;  4FLC A;  3E04 A;  1KQ7 A;  1I0A A;  2HVG A;  3R6Q A;  4EEI A;  3KDZ A;  2O78 A;  4BAA A;  1HY1 A;  1YIS A;  1FUR A;  2O7E A;  4C5S A;  1AUW A;  1TJU A;  1JSW A;  2PTS A;  3QBP A;  1J3U A;  5EYT A;  1HY0 A;  1GKM A;  1C3U A;  2O7B A;  5F91 A;  1YFE A;  1Q5N A;  1YFM A;  2PTQ A;  1K62 A;  3TV2 A;  1T6P A;  2QVE A;  3OCE A;  2QGA B;  1GK3 A;  4CQ5 A;  4APA A;  1EB4 A;  4ADM A;  3CZO A;  5EYV A;  2NYN A;  3RD8 A;  3RRP A;  3KDY A;  5D6B A;  4NSL A;  4FFX A;  4V2Q A;  5F92 A;  3BHG A;  3R6Y A;  1FUO A;  1RE5 A;  2X75 A;  1U16 A;  1VDK A;  2RJS A;  2FUS A;  1U15 A;  2PTR A;  1TJW A;  4EFC A;  2O6Y A;  3GZH A;  2J91 A;  4NLE A;  2NYF A;  1T6J A;  4ADL A;  2VD6 A;  1FUQ A;  2PFM A;  3GTD A;  3R6V A;  1K7W A;  1GKJ A;  1DCN A;  1GK2 A;  3C8T A;  3UNV A;  4BAB A;  5HW2 A;  2RJR A;  1C3C A;  3NZ4 A;  4C5R A;  2YII A;  3NO9 A;  4APB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...