1Z4KA

Structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with thymidine 3'-monophosphate
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
194
structure length
194
Chain Sequence
b'RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase
publication title Structural basis for substrate specificity of the human mitochondrial deoxyribonucleotidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 65
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1z4kA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4kA01
1S2OA 4EZEA 4AS2A 4I9GA 2YJ6A 3PGLA 4IFTA 3UMBA 5ALTA 3UMGA 2W43A 4GIBA 2PR7A 1SU4A 3WK4A 4MUMA 3SLRA 5AM4A 3FPSA 3L0CA 2B1QA 1ZD5A 3U7GA 3ZVNA 4YIHA 1X42A 3F9RA 1L7OA 3QU7A 1EK1A 1WZCA 3E81A 3ZUPA 4UU0A 1NRWA 3QYPA 1L7MA 4Y2VA 3QX7A 1L8LA 5ALNA 1SWWA 1YS9A 1Z5GA 2C9MA 4KN8A 1Z4NA 4BEWA 1AQ6A 3OCVA 3I28A 5ALFA 3ET4A 2C8KA 5AM0A 5AKLA 1CQZA 3KBBA 2I54A 5AI0A 4HYTA 3R09A 3L0BA 4UMFA 2P11A 3ESRA 3VAYA 3FGOA 3N28A 1ZD4A 1TJ4A 1ZRMA 2OBBA 4G9BA 4OFZA 2WM8A 2B1RA 5AW2A 3DDHA 5AW7A 1O03A 5ALLA 1XP5A 4AP9A 5IT4A 3U7FB 2BDUA 5AVYA 3E58A 2W4MA 2WF7A 2PQ0A 2MSNA 2R8YA 3WKDA 4Y2QA 3I6BA 5ALHA 2G07A 2GHQA 2IOFA 2O9JA 1RPZA 1TJ3A 3ZWDA 5AIBA 5ALWA 1XPJA 1Z4MA 3ZVMA 2HF2A 3K1ZA 4C4RA 1YNSA 4EELA 2QLTA 2IYEA 5AW0A 4BKMA 2C4NA 2CFSA 4Y2YA 3ZX4A 1QQ6A 2HO4A 4XQ0A 1K1EA 3CNHA 1Z4KA 1VJRA 3N5KA 4C4TA 5AW8A 2CN1A 3ZTYA 2NO4A 3PCTA 1RKQA 4I9FA 3SD7A 2HCFA 3EPRA 2W11A 3OCYA 1WPGA 5AW3A 5IS2A 3HYCA 1VFPA 1WR8A 1Z5UA 4F72A 1RMQA 1Z4QA 5A3RA 4YH1A 2FI1A 3D6JA 3U19A 4KNVA 1EK2A 3PGVA 1Z4IA 2G80A 2ZBFA 2OYCA 1YMQA 4CF5A 3OCZA 3NANA 3I1YA 5ALQA 3WKBA 1LVHA 4UM7A 4UU1A 1F5SA 1NNLA 3WK6A 1VJ5A 4HGOA 1L8OA 3ZU6A 5AI6A 5AKKA 2OM6A 1Y8AA 3ED5A 1ZS9A 2FPWA 2G09A 2R8EA 3DV9A 3B9BA 5AK6A 2FPSA 4QJBA 3W5DA 1QQ7A 2FUCA 3J7TA 4F71A 4RESA 5AM2A 2GO7A 2FPUA 2C8LA 5FP0A 2YMLA 1J97A 5ALPA 3U13A 5AI8A 2HSZA 4QQFA 1RLTA 1RQNA 1ZJJA 3KOOA 3L8HA 5AHXA 3WK7A 4Y2PA 4L6AA 2FEAA 3SKXA 3W5CA 1RMTA 4CF3A 3MMZA 5E0OA 3ESQA 2B8JA 1RRCA 4C4SA 3KC2A 3ZI4A 2CFRA 2I6XA 2WF5A 4BYGA 3IB6A 3S6JA 3IRUA 1TE2A 4FFDA 4HGRA 5ALKA 2HHLA 3MN1A 4O8CA 2RARA 3R4CA 3M9LA 5AI5A 5AVUA 2BDEA 3P96A 4H1WA 4JDPA 4OCZA 2P9JA 2YMPA 4NABA 2O2XA 3U7EB 4CE6A 3L5KA 3AR5A 2EAUA 1N9KA 4YCMA 4GXTA 4BEVA 2IOFK 3W5BA 2GFHA 3QU9A 4YGYA 1FEZA 2DQSA 2AUTA 3SMVA 3KDPA 1WVIA 2C88A 3AR8A 4NV0A 2RBKA 2GMWA 4UMDA 1U7OA 5AW1A 2D2VA 1RKVA 1RLMA 4UMEA 3SF0A 1CR6A 5AVRA 2ZBEA 2G1AA 5AK4A 3L1VA 3QXGA 4AS3A 2I55A 4DFDA 2WF9A 3PDWA 2VKQA 3QUQA 4KX3A 3NRJA 3QNMA 1KYTA 1RDFA 4Y2SA 3U26A 2HEGA 2YBDA 2IOHA 2JGAA 4G63A 4YIKA 3AR7A 3WKCA 3M1YA 3QU2A 2HF7A 4NWIA 5AW4A 3EWIA 5ALXA 2RB5A 3L8FA 4DWOA 4BX3A 3NIWA 1YDFA 2ODAA 1N8NA 4Y3UA 5AKYA 1U02A 5AI9A 5AW6A 3QUTA 3QUBA 5ALRA 4EX6A 1L7NA 1TA0A 5AK3A 2ZOSA 2GHTA 2R8XA 3BA6A 1SWVA 3ONNA 2OA0A 4Y2JA 2JARA 3MC1A 1JUDA 2JAWA 5AVZA 3N8GA 4JB3A 4HGQA 2HDOA 3WK8A 3CZ4A 4OD0A 3AR3A 4NAVA 3TLMA 2HX1A 2YJ5A 3AR6A 3U7HB 3WGUA 2EARA 5AVSA 1T5TA 1RQLA 5ALGA 4UAVA 4DCCA 4E88A 5AKEA 3ZX5A 2R8ZA 1RKUA 2PKEA 3QGMA 1Z88A 5ALIA 1YJ5A 3I76A 5AVQA 3RFUA 5ALZA 4FYPA 1U2TA 3MPOA 3HLTA 1YV9A 2YY6A 3BWVA 1PW5A 3NALA 2NYVA 3EF1A 3ZTWA 4UATA 4CNQA 2JAUA 2FPRA 1RMYA 3SHQA 5AVTA 3A1DA 3WKEA 3OCWA 4NFLA 3AR9A 5AIAA 3FM9A 3DNPA 4KX5A 5AKIA 2B30A 3B9RA 2JAOA 1TJ5A 3OTQA 4OHFA 2X4DA 2P27A 4UARA 2HI0A 3DAOA 2ZBGA 2HOQA 1IWOA 3L1UA 4RETA 2WHEA 2YJ4A 3ZW7A 4BX2A 3OCUA 4EEKA 2YMQA 4XE5A 4XPZA 5A3SA 1U7PA 4ZEWA 3NUQA 2ZXEA 5AICA 5ALJA 4KYTA 2ZG6A 2NO5A 5ALUA 3AR2A 4UW9A 3E8MA 3R9KA 4B6JA 1Z4LA 4PNHA 2IA5A 1RC8A 4BNDB 3A1EA 3QLEA 1QQ5A 4YCNA 5AKHA 2FUEA 3FZQA 4YCLA 5AKXA 2I7DA 3UM9A 2Q4TA 4Y2XA 2WF8A 2QYHA 5T41A 5ALVA 5AI4A 4HGPA 4UASA 3KZXA 3UMCA 3NASA 3W5AA 1O08A 1U2SA 1L7PA 2YJ3A 3ET5A 3QUCA 5A3QA 3IJ5A 1S8OA 4CF4A 3OCXA 4MWOA 2G08A 2AGVA 1Q91A 5ALOA 1Q92A 3EF0A 4ZEXA 3QU5A 5AKZA 3A3YA 2AMYA 2FPXA 2MU1A 3FVVA 4FE3A 3KD3A 2WFAA 4UM5A 4Y2TA 2YN4A 4L57A 3GYGA 1RLOA 4IG4A 3L8GA 1T5SA 4UMVA 3B8EA 1XVIA 2B0CA 4BBJA 1J8DA 4HGNA 1ZRNA 2Q5EA 2I33A 2B82A 2EATA 4HAIA 4J2TA 2FDRA 1ZD2P 5ALEA 4BNDA 3L8EA 4J03A 1ZD3A 5AVXA 3E84A 1MH9A 3WGVA 3QU4A 5AESA 5AVWA 3WK5A 3N07A 2ZBDA 3L7YA 3WKAA 4BX0A 2BY4A 5AW5A 1ZOLA 3FPBA 2P69A 5AM5A 5ALYA 5ALSA 5AM1A 4EX7A 5AKJA 2RAVA 2Q4RA 2YFYA 2B8EA 3ZVLA 1Z4JA 1QYIA 2AH5A 2WF6A 1L6RA 5AW9A 1NF2A 3A1CA 3N1UA 5AM3A 4L6CA 3WK9A 4DW8A 1Z4PX 3L0YA 4EENA 2CFTA 2G06A 5AK5A 2G0AA 4KNWA 4UAUA 3NAMA 3AR4A 1QH9A 5ALMA 3SKYA 3ZWKA 4XOUA 5IT0A 1LTQA 4Y2RA 1Z4OA 4Y2UA 2I34A 5ALDA 5AKGA 4ZEVA 3RF6A 2YMMA 1T9ZA 5AVVA 3OPXA 5JJBA
chains in the Genus database with same CATH superfamily
1Z5PA 2PBRA 2PZKA 3EVCA 2OT3B 4BUCA 2HU8A 2VCYA 4EZEA 1SKMA 1XEWX 5COBA 3EXFB 1FSSA 3MOSA 5T57A 1TK9A 1LI4A 4J2OA 4PPGA 3ZWBA 1RXYA 3G9ZA 4P3OA 4U3JA 2J87A 3OZEA 4GX5A 4AZTA 2ONKA 4BMSA 1PQWA 1TVEA 1NATA 4U9IS 2QK4A 2Z9BA 5B2EA 3O8QB 4Q0MA 3H18A 4PG4A 4JI5B 5HNKA 3UGTA 2PGAA 3QKRB 3OY2A 4G26A 4RENA 1NJSA 4OAQA 1POWA 1XVAA 1V9CA 4PG7A 3L8MA 3UIEA 4AN0A 2PKRA 4NH0A 4OXNA 5F5LA 4EPYA 4DV5B 3KCNA 2O0MA 4HEQA 3TNDA 4LSMA 3VI4B 3Q9NA 1KYZA 3HR7A 4JA0A 1IBCA 3M4XA 1L7MA 2OP1A 4BRWA 3VR0A 1LPMA 3QEBZ 4L5IA 4PSKA 2XT9A 1YBVA 1II8B 1YHYA 1X80B 3QFSA 4URWR 3SM3A 4HG2A 2YIVX 4G89A 2DHEA 4WPGA 2W6IA 3DGFC 4MQUA 2UZ3A 5HS6A 2C98A 3ST7A 4OF4A 1GPNA 3L6DA 4UBMA 4XCVA 4YRBA 5JXGA 2I3BA 3UTDA 3PFGA 5DYTA 1XB2A 1GQRA 1AQJA 1WCXA 1TF2A 1G5FA 1TMYA 2DPXA 5AKLA 4DJTA 5BNIA 2QGFA 4QUBA 3U9SA 4Q34A 2BGRA 4NG5A 4B74A 4EFCA 2F2TA 1XZIA 2Y05A 4IMIB 2PXAA 4GI5A 1I33A 1VMKA 3CLVA 3THXB 5AMXA 3IA2A 4I8IA 4MB6A 4BBAA 2FZVA 3UW1A 2PFSA 3OZAA 2RHMA 3KQWA 4JFAA 4O0MA 2H00A 3PQ6A 5JROA 1RXSA 2XCTB 2ARKA 2WZDA 1B6SA 3AUUA 4N3CA 4OY3A 1TGYA 2BH9A 5JCXA 3RYFB 4A0FA 1U0HC 2QTTA 3H1TA 1R1DA 2MJLA 2V4ZA 2GUGA 3L6BA 3R1IA 1E6MA 3PC2A 4QO8A 1RTKA 1SIUA 1DKMA 3PS9A 5TQVA 2NTVA 2Q2NA 4QVGA 3EAGA 1BGVA 1PS9A 3PTAA 3WQQA 2FVYA 4CDMA 4YWHA 4DJ5X 3FCEA 1UJ4A 3TM4A 1SXJD 2GARA 3B6MA 3WL4A 3BXGA 4R2JA 4X20A 5EUBA 4KPUB 4CLEA 4JBHA 1G2IA 1W6RA 3I6BA 3OQJA 4XARA 2EX0A 4EY4A 2JEOA 2H4HA 1QF6A 3BTVA 3G5LA 4JLBA 5FBWB 1P45A 1L4EA 1YHZA 3X1YA 1XDGA 1UBKS 3IOMA 2B4TO 1Q0HA 2NVUB 5JO9A 1EA7A 3BHMA 4EEXA 4WZZA 1VYVA 5A71A 3ZWWA 5IDQA 3NBUA 2WIJA 4PBSA 1A4UA 4UNNA 3WLTA 2SBTA 3Q7TA 3UUWA 4C0XA 3B1XA 5FOTA 2ODQA 4Z5XA 5BVGA 5JJIA 2B3TA 1T9HA 3V8QA 5BN4A 5HPYB 3DCNA 1T9BA 4DY4A 3M6IA 3CE9A 2Q2WA 3SOZA 3N53A 3ZOZA 3WYAA 5AW0A 2NOAA 1Y7LA 1X2EA 3EEIA 4HQFA 5FOUA 4NU8X 1K8RA 3FVQA 3RS7A 3ZXXA 3QSGA 1U3TA 3JXEA 1JLMA 2OV1A 4JP3A 4TM8A 4Q9HA 3F4SA 4WZAE 1J2RA 4QARA 3SZ3A 2G72A 5K6RA 5DNAA 3GLGB 3NHFA 2WB2A 3CY6A 3QX3A 5EOVA 4DV6B 4D56A 2W58A 1CUYA 4QGHA 3R24A 3AY7A 2IS1A 4TV9F 4MI9A 2GWHA 1FPQA 5LMUB 1NUAA 1Z7WA 3PXDA 1NN0A 1ZICA 3F6RA 2R1UA 4E30A 2BKEA 4XYEA 2VNAA 4EJ6A 2OZEA 3AL2A 2I71A 2JK1A 2V55B 2CL0X 2V7WA 4UM9D 5T4BA 5C5CA 2C7OA 5EIXA 1N2GA 1DU4A 3BF8A 1XV5A 4IFBA 1L4KA 1NI4A 4R6WA 5AQEA 5JCOC 1KQ7A 4PO1A 1FX1A 5HJ5A 2BR5A 4KQWA 3FCSB 3AUYA 1W30A 4S1NA 3DP9A 4MP8A 3ZE7A 3Q7IA 3HA5A 2O07A 1F1BA 2FQYA 3DAPA 3P45A 4KCGA 1DJMA 1DIAA 4IIJB 2XBUA 3O3NB 2IXGA 4E5DA 1KOJA 4JOQA 1NG9A 1NXVA 3L43A 4IFEA 4JP5A 3VPSA 1PSWA 4HGOA 1YFKA 3DXXA 2JB9A 4FT4A 3V4ZA 3H2SA 1WTAA 4ZMSA 3DT6A 2BWJA 4X6YA 2YNMA 1RC0A 1SR8A 3X1DA 5KQPA 4JLUA 3GP3A 2OHFA 3S8YA 4LF5B 4W6QA 4I1IA 5I4IA 1UEJA 1KZ1A 1F0YA 2FPSA 4P80A 4R3NA 2ISSD 1U3CA 1VSUA 2O54A 1U9IA 1OPXA 1YL7A 1YQ9A 2FPUA 2QR2A 5GOTA 2QMQA 4BFYA 4DBZA 1N2JA 2PAFA 3TSCA 2AKEA 1QCDA 1BQ3A 1WSBA 2J6IA 2TSYB 2VEOA 3U13A 1W8IA 3A0RB 3HVUA 4OBBA 5LSAA 3NH9A 5CCEA 4UQLA 3GDOA 1V8ZA 4JJ4A 3DBOB 3C85A 5A6VA 1OXBB 2FRDA 4UFOA 2WKSA 2IHNA 3WL6A 1Y3HA 4BP1A 5CYOA 5IJZA 3VV2A 4YFYA 1DIOB 2O0LA 4ZJYA 1H69A 1T8UA 3BGIA 3LBIA 3U0VA 2HREA 3P0JA 4FJ1A 1PEDA 2WF5A 4P32A 1ONSA 1EWYA 2RGDA 3PUIA 4Q37A 1TE2A 2G7ZA 2I67A 5CURA 4FFDA 4YBRA 5IYZF 5CXUA 2E4WA 4V3CA 1UWLA 2DPGA 4MGYR 1VSQA 1E2BA 4K0RA 4H1WA 1ZSYA 5G0VA 2WUWE 2DWCA 1LS1A 3EXG1 2RHCA 2X40A 4Q4HA 2XYHA 4M87A 1LRKA 4ENPA 2O2XA 4HB4A 5DYNA 4TL7A 2A1UB 5HEKA 4FC6A 2E18A 1YQXA 4OHZA 2ZETA 5I7FA 2XCOA 1UBGA 4RZHA 1BO6A 3R7WA 5EHGA 5EMLA 4YUVA 4ZJUA 2AUTA 3DMGA 4IDQA 4OFBA 3DULA 1FNCA 3JQ8A 4GX2A 3JQ9C 2C88A 4MCJA 5CJ2A 2HJHA 4D3DA 4ZO9A 4UZSA 4KAJA 1GRVA 3LW8A 4BRSA 3C97A 4LRXA 4OXYA 1U7OA 3TV2A 1TKBA 3EEBA 4FGKA 4M36A 4OGKA 5D3QA 4BZWA 5L3SA 1Y8QB 1RKVA 1U0OC 3Q0EA 2Z3VA 2J3QA 3HQ4O 1XQWA 3BICA 4RHXA 3THRA 1R0RE 5A9SA 1K06A 1BVUA 1VA5A 5GONA 2G1AA 1EJ6A 3HJHA 5AK4A 3D7NA 3T12A 4IDBA 2FEMA 2V7EA 3HWSA 3VR6H 1WBDA 3GN2A 2KWIA 1Q7RA 1US8B 1CR2A 4KVAA 4UCWA 2AG1A 4UAJA 4V0SA 2WPDA 3QUQA 4U7HA 1SPBS 1EQAA 1LZLA 1NQWA 4QO7A 1VHTA 1ZZEA 1DOHA 3MGAA 5FKJA 1KTIA 3L6OO 4QPZA 5HMMA 1VG0B 4O5OA 2VYND 4Q93A 3M1YA 1U7DA 3W2EA 2HQSA 3VZBA 2EJWA 2A3RA 2CJXA 4RORA 4YJ3F 1N1EA 4QDXA 4CFSA 4G81A 4NSLA 1RQ7A 3N0XA 4RDXA 2IYVA 4H1VA 3EEQA 2XRYA 2XB8A 4BZZA 5DMHA 4D26A 2PAAA 1KS2A 3IP1A 2XCQA 4E51A 1PTJA 1Z8DA 5AW6A 4ZPXA 1YA4A 4WFJA 5AJTA 3WLLA 5WRFA 2I1VB 2ZBPA 2ASEA 4MEJA 2G8LA 3EGEA 2X7XA 4KGXA 2DM6A 2W6NA 4MDYA 2ZIAA 3KJGA 1RR6A 1RAAA 3NJ8A 1JEYA 1K2VN 2CMKA 3ONNA 2ZT8A 4RFSA 3ZS8A 5EI5A 4HXEB 4CIVA 1SEPA 4CT5A 4TKVA 5HVNA 1TJ7A 1RE5A 2ID4A 2ZTMA 3G89A 5K3FB 4FHEA 4NPHA 2XNKA 1FC0A 1J0DA 4R1UA 1U0BB 3OM9A 1JV2B 2ZR7A 3CZ4A 3MS4A 1RE1A 1KJJA 1TPZA 2A9QA 1NVUQ 2WAYA 3BCHA 3OLCX 2CNKA 1SHKA 3AR6A 3QEOA 4JLPA 4JUFA 4LOKA 3RT7A 1Q7TA 2XDQB 5ALGA 1H5UA 1W0KD 5JYDA 1STOA 2O50A 1OI2A 1EM8B 3KLNA 2X0FA 4EYQA 4A6PA 2VPXA 3CFYA 3V7YA 3FFBA 1KBQA 1G1MA 1UM9B 3GT0A 4J75A 3H0EA 4R9UC 1GTG1 3COWA 4KGZA 3K2EA 4EUSA 2HWXA 1LDGA 2I0FA 2VQ3A 3C1AA 1K8XB 1KY2A 1ZEJA 4L4SA 1J8YF 1L5LA 1J0EA 4RMNA 4AYTA 1W2GA 4N7MA 3ZTWA 1TVMA 4HDKB 4A8JB 1H5QA 1NFQA 1RCFA 1RMYA 1RC1A 1SURA 1TO1E 5LZ7A 4C5CA 2IZ7A 1HOTA 4X6LA 1MX3A 3OCWA 5IMBA 3I72A 4UJ3A 4RDHA 1XU4A 3FM9A 3RS4A 4AJ9A 2XT0A 3LRPA 3SDSA 3VYUB 1CR1A 4KQEA 2XMRA 1C4WA 4JHLA 2ZYAA 3AM1A 3IQXA 1YSCA 1MN6A 2D0PB 1KFBB 4N40A 5KHOC 1CTQA 1XMJA 3HSKA 4GS5A 1EFRA 3F6BX 4WLNA 3AEKB 2AI3A 1GHTA 2IKQA 3LLMA 4S35A 3JAKA 4BMCA 3ZW7A 3DLHA 5KKNB 2P8JA 4W8HA 1V25A 1M2JA 3PXCX 3H65A 3N5CA 4RHYA 2F4VB 1ZHHA 4F9FA 4V0OA 1JU9A 3A11A 3LLUA 4RVHA 1JEQB 2XMSA 2JZOA 2QTWB 4F04A 4Q19A 3FLMA 4DLAA 2VRCD 3DB1A 1EU1A 2A7QA 4MRMA 1ODSA 1CEQA 2B20A 3QOWA 3OU2A 4JGBA 4CI9A 3TGWA 4ZHQB 1U81A 2WQZA 1E1QA 2XTNA 4XJSA 2VS1A 2JHAA 5IHPA 3MT8A 1REQA 1KIAA 5JWRA 4YI3A 3ANXA 1ZC4A 2QOEA 4O3FA 3WIUA 1MFZA 5H5JA 1RBQA 2ZB8A 1YR3A 1YHNA 3GLRA 3N3BC 5D85A 4EZIA 5ITZA 2GI4A 4MMYB 2DWPA 2IHTA 4ZCLA 4C4PA 1IHDA 1RI2A 3DV0A 3VZRA 5ALVA 1R64A 5CDUA 3NT4A 3CR3C 3OIDA 4PLFA 2GCPA 5T6BA 2O4CA 3KT3A 2G9VA 2R66A 3PYXA 4I99A 2YWCA 4I08A 1DRWA 3T1VA 2IHJA 4UCXA 2Y9MB 5IUJC 3IJEB 3IDQA 1DAMA 3TM5A 4GXQA 5JRZA 1IK6A 3DXFA 3OWHA 4FLMA 4CM6A 4KR2A 2AOXA 4JJ6A 4I1RA 1CS4C 2XHEA 1KRWA 1YR2A 3U3MA 2LZ0A 4GUDA 1L5WA 5M7EA 1G20B 5A4JA 1V41E 3I58A 3S2YA 2NUTB 3BSFA 4M60A 4BNLA 2QRZA 1WF3A 3ACCA 3UA3A 3LYUA 221PA 3W2IA 4ZDIA 5J58A 1PTKA 1M5TA 2NSLA 2V7BA 5I4CA 3FTFA 5E1BA 3ZY5A 3IHTA 1CJMA 3DD1A 1KYYA 4HPXB 4QYXA 4Y9RA 2GM9A 1Y9EA 4BY9E 3BS4A 3V3TA 3AUSA 4O63O 2VFAA 3LXXA 5DIFA 3SYKA 1M54A 1P9NA 3M70A 3PHLA 1EFDN 4C08A 1DO0A 1GDTA 1X9IA 1C7ZA 4G41A 2QYTA 1YIOA 3PUKA 5EXDA 1YO6A 3H6GA 2AE1A 2DBRA 2FDRA 1ZN7A 1X1EA 2JJYA 3U3DA 1J0BA 5H83A 3ROQA 3WRXC 2MSDB 1E5TA 3FIUA 3H17A 2IYOA 3QE3A 3VO1A 2YUIA 3CVUA 5CVDA 7GPBA 1SU8A 5JRJA 1MH9A 2ZRFA 3VHLB 2UYGA 4UBNA 3LBAA 1T4GA 1PYGA 2FPKA 2P3SA 4LJKA 3ZK8A 1K3TA 5CDSA 4J0QA 4P35A 4JK3A 2XADA 3IESA 1C30A 1UPTA 2NO1A 4J90A 3TEJA 4Z7JA 4PLWA 3U9TA 5KNCH 3LA8A 2WSBA 5EZYB 4DQVA 2YIJA 3EIHA 1M1YB 2O8NA 1SCJA 2Q9CA 2OCKA 5GM1A 3E2PA 1SCDA 3HMQA 5AK3A 4KIWA 5ALYA 3GLUA 1QGDA 3HJBA 1KEVA 5AHRA 2VZ0A 5KQGA 1UEIA 4GOND 1DJNA 1JKJA 3LC7O 1BS1A 1VE1A 3I9FA 4TLEA 2PL5A 4OQMA 3KUUA 5K3CA 3O5AA 4HDMB 2JLWA 4ZVMA 1BS2A 5C9ZA 1Z4JA 5JMWA 1FF9A 4CT0A 2PV0A 4AWXA 2OAP1 4B80A 1KA9H 1UWCA 2FFAA 2QUKA 1WHSA 4TYYA 1DWQA 2B7BA 3TLGA 5T64A 4BFWA 1KZ7B 4DWWA 4E4TA 4K8OA 4BVLA 1V8PA 1EFTA 3ICCA 5D51S 1DC3A 3HY3A 5C8YA 2Q4DA 2QY6A 1QTRA 3E5MA 3RU9A 4K6GA 3QVMA 3BPSA 3ZWVA 2CEAA 4CLOA 4J7CA 3F97A 1KFKB 4O2LA 4W5RA 1WMEA 3DR3A 4ETWA 5JDIC 4ZHSA 1NF3A 4GOKA 2I34A 1CQXA 1NR1A 4TS4A 1UKVY 4ZEVA 4HBGA 4GRIA 4OGLA 5BQ5A 4DCSA 1LX7A 3O1LA 2GQ0A 3E5HA 4UPEA 5JJBA 2R79A 4AS2A 1MQ9A 1EXVA 4KL8S 5B7NA 1PW7A 2X1MA 2CLFB 5BNTA 3OTOB 4OYHA 2O8EB 3UMGA 3BGDA 4JASB 2ZDHA 3O4RA 2AB0A 1SU4A 3HJNA 3C0KA 1ZX1A 4XM1A 2JIDA 1JSCA 1B73A 4G4JA 3HV2A 1DIGA 4N01A 4AUKA 4Z6KA 5JMTA 5L6MB 2WAXA 4O2RA 3VPDA 3A6JA 4J4BA 2GLTA 3VO2A 1QDUA 2OOKA 3ZVNA 1TCVA 3CCFA 3U5ZB 1VE6A 4F97A 3N59A 2HMTA 2NPIA 4FK8A 4NU0A 5ERYA 4CMBA 5KVAA 2QA5A 2J3KA 1WZCA 3GN1A 2P41A 1ZH8A 4O4JF 2QENA 1UMDB 1ACLA 4GSYA 3TECE 2WWFA 3OQ6A 2Z04A 2GNAA 1E0DA 4F92B 3KOXA 4BGVA 4I55A 2OLJA 4V38A 1XD8A 2VAVA 5DGIA 5G0TA 4LXGA 1TZMA 4DC0A 1O1YA 2PRYA 3UENA 5JNLA 1Z5GA 4LWQA 4UEQA 2F3UA 3EVBA 2PYIA 3Q1KA 4UHEA 3W7AA 2KMLA 4AP6A 3ZK7A 2PZLA 4ADSG 1Z38A 3D3QA 1DJLA 1X14A 1V96A 2BUAA 1DG1G 3AU9A 3NUZA 3UWPA 1WHTA 3CEPB 5LM3A 3GPDG 5KS2A 3DL4A 4KSYA 4KVFA 4DLZA 1L1EA 1N2CA 1BCRB 2I4IA 1WV1A 2WWYA 2VTVA 1M2KA 2BEWA 2HMUA 4PANA 4V0MA 5D1NA 5KX5B 2JVJA 4UVHA 3AF1A 4Q21A 1XZMA 1BD3A 1GRCA 2H0RA 3EZGA 4MGEA 5K9ZA 1V4NA 1I4WA 3JQAA 4GOMD 1FLVA 4ATNA 1N9GA 5EYPA 2X6TA 3MD9A 4JOCA 1BSVA 1WOYA 2BE7A 2J4CA 4JR0A 4NQZA 3BD6A 1GGNA 1VDZA 4OFZA 4PBTA 1XXLA 1ZJ5A 1ZK1A 2VF7A 4KMSA 4X63A 5J2TA 5JO0A 4X7PA 3AM4A 4CM4A 2C7RA 2J9YB 4P3KA 4URHA 3LO5A 3M82A 2G25A 1U0TA 4YT4A 3ZV7A 2F1OA 3NQ41 3U7FB 2OBLA 1WD5A 4MW0A 3Q8WA 2I76A 4YJHA 5BUSA 3BTSA 2DQYA 2PQ0A 3U16A 2FPLA 2A9FA 5CIWA 3FNHA 5BMVB 1FE8A 1UJ2A 2CW5A 3DMTA 5HBRA 4BLPA 3GJ5A 3NHPA 3P1JA 1M7GA 2IOFA 3GEDA 3TQTA 1O94D 2DPYA 3B5EA 2BFCA 1ORVA 2ZTLA 5T8KA 4B0OA 4A23A 1PK8A 2CL7X 1GM5A 1IW7D 1DHRA 1G5TA 2VJMB 3GJQA 4OMDA 3A9VA 2QJTA 1W5AA 2PL3A 1LDMA 1PJTA 1QFYA 3EVGA 3K1ZA 3OLVA 3OZCA 1KYQA 4S0XA 4U9HS 4O3MA 1V0JA 3H2HA 5K03A 3BIOA 4OB6A 4U3JB 1ULAA 4GBMA 1YB4A 1U1DA 2G8NA 1EDBA 3IV6A 5EJFA 2XLBA 3PDJA 2JH9A 5AT1A 2XIQA 1T2VA 4WZBA 4Q7EA 1E2KA 4GBED 4QNNA 5HQ3B 4L1KA 3F7OA 1WY7A 1KJQA 1KPIA 2R48A 3DHNA 2ZRHA 5KVCA 1V2GA 1ISJA 3DOHA 3WL5A 4TRNA 5BV1A 1DWUA 4OJMX 5CA1A 5JATA 3SQNA 1YZKA 4QPPA 2H7YA 3OPQA 3TIGA 2N47A 1AV7A 1CY7A 3K9CA 1FQJA 1YDWA 2DOKA 5IPFA 2QD1A 3GDWA 4WOPA 4D5GA 5J5AA 2H59A 3RUEA 5KYXA 1YDMA 4KWCA 1A9YA 2UVPA 5LJIA 1J8MF 2AEJA 2ZRJA 4LZAA 4I3GA 5BYBA 3SSAA 4QBIA 5A3RA 1HDRA 2GJSA 3LNTA 3Q6MA 3VR5H 3ISJA 1EK2A 4X8OA 1TYBE 3ORQA 2ZBFA 1YMQA 2PMKA 5ALQA 4DMUB 3TTWA 1V11A 3CEJA 2PQMA 4IQ4A 3RK4A 2LBPA 1K75A 5DCUA 5KC9A 1LVHA 1UZAA 2JL1A 1LA2A 3F47A 1FXWA 1UKCA 2VDMB 4MXDA 2EKLA 5JPIA 5I9SA 3C7DB 3UK2A 3IQEA 4QXRA 3PYMA 4Z2YA 2E4AA 4M0UA 2W00A 5FQNA 5AXCA 4ZZ0A 4DUGD 3TUZC 1MQAA 2FW6A 3R7NA 4OMFG 3ASVA 2B8WA 4Z4IA 1JQ3A 3JQ7A 2CWWA 3PRYA 3TOVA 3CSUA 4BVHA 5LU9A 1DWPA 3RADC 2XGJA 2NUAA 1J9ZA 1JW9B 2RCYA 2O23A 3OSUA 1EE1A 3OX1A 3J7TA 4PX9A 4BOYA 4DZZA 3NFYA 3ZY3A 1J9EA 1BGWA 5DYYA 3BGSA 4J1NA 3BEOA 4JC8A 4C1NA 1XRJA 4X20B 1TM1E 2P0YA 3UG7A 3HCFA 2NZUG 3R7AA 3ZHYA 5DYIA 1NIJA 4JENA 3EVTA 1T9KA 1KFEB 5IULC 1TVCA 1IQRA 3UAVA 3A2LA 4L6AA 1EFVA 3TW4A 4RBNA 3CNEA 3HUTA 3HU3A 5DOVA 1DKQA 3RRNA 4ABTA 1U6KA 3ENZA 3KJZA 2GF2A 2BFPA 3EDYA 2MSEB 5BVGB 4LECA 5BN4B 3UHOA 1QSGA 3OHPA 5ADUS 4TQ9A 3ZI4A 3M6MD 2ILVA 2GVDC 2XNCA 1A4RA 2X8AA 4M0FA 4MUGA 5EQTA 3CW2A 5LP6C 4AZ3A 1AC5A 1RSZA 1MXFA 2RARA 3MJCA 3E9ZA 4FHDA 2BD0A 3E3NA 4FEAA 1FVFA 4IHJF 4JT8A 4B75A 5C7IO 2DKOA 1E3MA 4RJKA 3A25A 4FQ7A 2YRFA 3NATA 4DIBA 1ZL2A 5CT5A 4A4DA 2QZZA 1C9DB 1PJ2A 4UVGA 4DMCA 4CIBA 3W9SA 2Q1SA 4KLZA 1KSJA 2WWTA 3N6XA 3QEMA 2ZUCA 3H5LA 4G0PA 4XVRA 2HRBA 1P60A 1EVLA 2HMYB 3DZJA 3G0OA 4OX9B 1P80A 4D9FA 3EW7A 1PT9A 3VSCA 16PKA 3A36A 1GQQA 2J48A 2REBA 4JI7B 4RLFA 4TT3A 2ZPTX 4R9RA 1QP4A 2CLLB 1R0XA 4BN0A 2D2VA 3JVDA 3K4QA 3CIOA 3JYLA 4JKYA 3PUJA 4MS1B 4RKYA 2PRZA 5T7BA 1SUIA 3SF0A 1KO5A 1ZXXA 2X5NA 3BCSA 4D4JA 3LX6A 3T3DA 5KJFA 1UBCA 3I64A 4RAOA 2GEFA 5KYNA 1MW8X 3AFIA 4ISCA 4EY3A 2X9VA 4L8WB 1GLNA 1I0ZA 3IOEA 4FCCA 1KZ9A 2VKQA 4YRZA 3T5DA 4MS4A 5ED4A 3QNMA 1FYWA 1UKZA 1W88A 1Z37A 5FOSA 1KO1A 2ID8A 2YBDA 2P65A 4TXNA 3VJLA 3W8EA 1H2RS 4L3OA 1X6VA 2CJWB 2VSOA 3PF8A 4IIEA 1RRPA 4Y1FA 5E7QA 2H9YA 2PSEA 3QU2A 4PLVA 2FE4A 3T0IA 3QY9A 1OB2A 1UPFA 1JG4A 3NBQA 2NW6A 4QM6A 4AYXA 3ORSA 1FFAA 4EM6A 3P8ZA 4UOEA 3Q40A 5F7OA 1N6LA 2AXNA 1MEEA 3SR0A 1LF5A 1DC8A 1ZG3A 4GLBA 4TMVA 3D7MA 3CB2A 1T1SA 1OOEA 1U2PA 3KKQA 2FZWA 4S1PA 5FPSA 1NZFA 3PI7A 4JELA 5FDFA 1NV8A 4ZDJA 4YUWA 5CBPA 4U02A 1E6LA 3H7IA 4NAUA 1ECPA 4O08A 5JFGA 3S1SA 4BNNA 1HA3A 4XWOA 3IGFA 4JVLA 1PJAA 4NU6A 1HL7A 2ERXA 4OB7A 3OJ0A 1L4UA 5JTUA 4ZYXA 4QUHA 4OD0A 4NS1A 2Q0HA 4YQYA 3W5VA 4JOBA 4ZO6A 1YZHA 4A8HA 3O1JC 2Q7OE 1NR7A 2EJUA 3ER6A 1WNFA 4LVOA 3C41J 4Y2HA 1ESCA 1G4UR 1QKKA 1TXGA 2EARA 3DE7X 3N8NA 3IT3A 1L4GA 2E89A 3NVMB 1UADA 1LPAB 1C5KA 2GBLC 1BJTA 3L1JA 4IDOA 3BXEA 2FMXA 1G41A 1WCWA 2PKEA 3SS8A 2FV8A 3L84A 5DKFA 4NMWA 4DMMA 3PHJA 1CY8A 1NVWQ 2VDUE 3V5NA 2XYVA 4R7GA 1BKYA 1D1PA 3VTZA 1U2TA 3EBOA 4LYJA 3R7WB 1T0JB 5DCWA 1NWCA 2PS9A 1JR2A 4BVGA 3JQ8B 2DTEA 2X22A 2GEDA 2O1XA 3IQHX 4KLNA 1KYWA 1MA0A 1MT3A 2W2MA 2W90A 2XKKA 1QVWA 4LE0A 2PZBA 2LCIA 2V8BA 4JJIA 3A7EA 5L3SB 3KZNA 2EBWA 1TVKB 2YC2C 3AB3A 3CR7A 1FRNA 3OIUA 1Y4SA 4KX5A 5AKIA 4BZXA 1ODLA 2PZAA 4H6VA 3IS3A 1Z5OA 3GGDA 1IC6A 4TMTA 3WY9A 3JQBA 4YRNA 3RVLA 1AKNA 1NSYA 5GONB 4YDRA 4O29A 1JQKA 1E9DA 1C8KA 2MYUA 1P1JA 1BEEA 2Q6KA 3G2JA 2HJVA 3LDAA 4I0WB 1O54A 4JB2A 4P83A 5HDQA 3F3MA 1E18A 4YJ2A 3RRMA 1NW9B 3VNSA 2BDTA 3EFBA 2P2ZA 2HMAA 5K0NA 4MW4A 2A92A 4Q16A 4EHAA 4WLOA 5MFPA 2FPMA 3FNGA 4LNHA 4XX1A 5ENZA 6YASA 2W2PA 1Z45A 3D4LA 1NRJB 4US0R 1U7PA 2I4MA 4MQ5A 1Q14A 1YI1A 5BYKA 2DZDA 2H1RA 2QW1A 4ZRMA 1VIAA 5KAMA 2JFBA 2EW2A 1Q15A 4GYWA 1NBIA 4XH9B 4H08A 3VH1A 4RF4A 4NBNA 4AL4A 3HGMA 1XMSA 3C98A 4M98A 5DM2A 5AHWA 3V9AA 4CKWB 3PXEA 1AK2A 2H54A 2R4TA 4G9GA 4G25A 4OK3A 4JEIA 4DRZA 4HVCA 2FG6C 5EERA 5CB0A 3Q8MA 4TZKA 2J8ZA 4CQMB 1ZR2A 4KHPB 2E9SA 2ZSHA 4N8DA 3A04A 3BE6A 4LY9A 2EWMA 4RLHA 4ENRA 3D43A 4EFDA 1M5UA 2NPOA 2MDTA 1L7BA 1UDRA 4I9HA 1FP6A 1LBSA 4GMXA 2G17A 3V8BA 3H4VA 5JYCA 4RFSB 3UMCA 2OBFA 1JIUA 1L1QA 1TIKA 3KQPA 4A92A 5IZCA 4L4ZA 1O08A 2PL1A 3I6YA 4K2AA 1GQFA 1W2HA 3PGMA 4NZOA 2VF8A 4KQGA 1QYCA 2VT2A 4DSNA 2GNPA 3P2IA 3THYB 1TMGE 1XN4A 4YVFA 1E99A 1JYSA 3VO8A 5AK0A 3LFHA 2KI5A 4MVJI 2HADA 3GAAA 1KK2A 2WA2A 5DRYA 3VM6A 2VUHB 1XVVA 3A3PA 3ZDZB 1BEUB 3MT7A 4DKXA 5EE3A 2BGWA 1TJNA 5JPDA 4F7DA 2RJOA 1RNLA 1R6XA 1Q12A 2OQVA 4IRUB 3DVAA 3W1VA 3PFIA 5GMOA 2PRJA 3C6XA 4WERA 2IU0A 3U3OA 1MBZA 2WYHA 4DREA 1DZ3A 3UT5A 3FDFA 2AFVA 1ITZA 1XCBA 3PJGA 4JLOA 1F4PA 1TJPB 1HC7A 2J6BA 1V4VA 3UC9A 1TTTA 4RMGA 3L7BA 2I6QA 1WXEA 1DKLA 1MFPA 5CRIA 2YZGA 3VNBA 5IEJA 3CBGA 2VRCA 1DTSA 5FPHA 4B35A 5BW4A 4RTNA 3ENQA 2YOGA 4M0CA 3QIVA 5CYPA 1IM8A 1R6AA 2OCIA 4FZJA 1WB4A 4NEHB 3DM9B 3NFRA 1O58A 2QMEA 1TLLA 1SXJC 4D0RA 1GAQA 1YKSA 4PHCA 2WYOA 1G5IA 3JAKB 4IDEA 3EG5A 2C9DA 2XODA 1GQYA 5KTKA 1RWOA 3MT0A 4LQDA 1G1AA 2V45A 2X75A 5A5VA 4P84A 1YB7A 1E59A 4HDRA 4G0WA 4F3TA 3P4YA 4OBEA 2VK4A 5JZSA 2HA6A 2ZIWB 3EMDA 4YMVA 2BZSA 1SGWA 2IXAA 3LOUA 3GFGA 4E5KA 3OA2A 3BKWA 1M6WA 2GZDA 4XIIA 3FOFC 3HCCA 2Q4RA 3ABZA 4JLNA 2JFHA 4JLVA 2J59A 1QVVA 3ZHOA 3HYTA 5FWAA 1GGFA 5F64A 3EIXA 4B4VA 4ONEA 4MUJA 1PR2A 2F17A 1FSPA 1DADA 2I03A 3WK9A 4E5MA 3UJNA 1WY5A 1VOTA 4MWZA 4E5YA 1P4JA 4Q1DA 3I39X 2HRCA 1WSAA 2H5IA 3OZTA 4M8LA 2BJHA 3DV0B 1TM2A 3QE2A 4D0LB 2XB4A 3H2KA 2V6MA 2A94A 4N54A 3WBFA 2OKCA 4PGMA 1G0OA 2QAJA 1ENPA 1S4QA 1Z4OA 2BTQA 4G2NA 2YASA 4LEIA 5CD1A 4CL0A 1E9VA 4JI6B 4BV8A 5E4JA 1GZVA 2Q5OA 1DAGA 3O4HA 4I1UA 4DCPA 4EJSC 2ZAOA 3AMVA 4J1TC 5FUVA 1PFUA 2WSMA 3RM3A 2PR7A 4Q3EA 3STUA 1QZZA 4V2IA 1NAHA 1WMAA 4JLMA 1DTEA 3QTBA 3ROPA 3ZXSA 1Z6YA 2WG1A 4EPRA 3RYHA 1N2CE 2ECFA 4F1JA 2C1EA 2P30A 3U31A 1AB6A 3LUFA 4V0ME 2GN4A 4GH5A 4C4YA 4OI0A 1PEKE 2V5VA 3NGLA 4ZICA 4W82A 1UDCA 1L7OA 4GF5A 3TO5A 4PSVA 4W5HA 1C0KA 2P6MA 3ERCA 3ZUPA 1UFKA 5LIRA 5KQSA 3IUYA 4EF5A 3AI2A 3OI7A 5EUQB 1BX0A 4UU0A 5C0OE 3AHIA 3QF4A 4E6EA 2K2WA 5I01A 4B3GA 1VCHA 2CFIA 3U44B 1FYFA 1GPMA 1SWWA 3IP8A 3L93A 2IDJA 1IZZA 3NZEA 3UMYA 5J1SB 5AOAA 3QMPA 2FFJA 2NG1A 4IJUA 3TSWA 5DGCA 2PX6A 1ZA1A 4RCZA 2JIRA 2WJWA 4HZGA 2JGMA 5LA6F 4BQQA 1DX4A 2PFGA 2Y27A 1P1BA 3VNQA 3BILA 1FFWA 2JF0A 2FWJA 1OFTA 3MWJA 2F9MA 3O95A 4RTSA 4AZWA 2LNDA 2Z2KA 4ENSA 3R09A 1R6DA 3L0BA 2G36A 4UBLA 5K8LA 5FOQA 2BVNA 3EQZA 4WJKB 4JYMA 1TJUA 2FUKA 2WUDA 1JHDA 3PX2A 4EHKA 5LD2B 5KJ6A 3WYBA 4AM8A 4U7DA 4X71A 4U2KA 4QUGA 5KJ1A 3IAXA 1L5MA 2H4YA 3NOOA 3KDAA 2O2JA 2YFKA 2H4JA 2CHVA 1BNCA 3W77A 4EPXA 1GXSA 3NP9A 4LRTB 1UDAA 2WHXA 1WHSB 3T3PB 1N2SA 4RE6A 4BNXA 4WBNF 5JS8A 3TLGB 3G2MA 3M4YA 1GUDA 3BXPA 2N3ZA 4WZBE 3SBXA 4LVNA 1E3IA 4B71A 4E15A 1FS5A 2POCA 4KQMA 2AN1A 4F3CA 2EGHA 2QTRA 2VRNA 4I3HA 1F8UA 4CLOB 1VLQA 3BXOA 3K8ZA 3WJ7A 3RYCA 2ZRCA 2CL6X 1ENZA 2HA4A 2JK0A 3BD8A 4MRSA 3DZIA 5JH7B 1OAAA 1OLOA 2P5TB 2WKRA 3ETCA 1K2WA 1YAJA 1SELA 3LRTA 5TV2A 3JQCA 3P9KA 5FNVA 4EYKA 1D8TA 4OM7A 3WV5A 2OCPA 5GJVC 1DRKA 1U2QA 2F1HA 2J09A 1YE8A 2IYEA 1L1RA 2J30A 2CVHA 3NP7A 3D8NA 3SLGA 1NJ1A 4PYQA 1HGXA 2CV0A 1F17A 1JLHA 2P1ZA 2BKUA 5G4LA 5B1SA 1JWLA 1U3WA 2M2IA 3HO6A 4B7AA 1SCNE 1Z0DA 1DCKA 4IOKA 2XZOA 4E94A 2FFRA 3PPYA 3T1HB 1QBGA 2A67A 5F5XA 5BRNA 3MINA 1X8LA 2R85A 1ZK3A 2YZ7A 1FB5A 4IVRA 4OHWA 4I4TF 1O5IA 1SXJE 2JD2A 5IVIA 2CN1A 2QD4A 3TW0A 1PV4A 2D6FA 2ES4A 4KN9S 3TRJA 3MS2A 3NBFA 1JI3A 3ANSA 5K0TA 3TF5A 1RBZA 3K05A 3GT3A 3PL5A 1RKQA 3QP9A 2G70A 2JFGA 4OEHA 1LDYA 2W11A 3NR2A 5CM9C 4YT5A 4F5YA 3DDCA 5CNMA 4OK5A 3REFA 5CK5A 1E79A 3C3WA 4OIFA 3QPWA 2B9EA 5F9MA 3L0IB 4OHRA 4PY2A 1ZMBA 3OQBA 2PUDA 1WHTB 1EP2B 5CEJA 1GYRA 3AV0B 3BD9A 3CISA 5CK4A 1FNDA 2J5XA 4H17A 4F2PA 5HXAA 3H1GA 3OSZA 3I1YA 4IIYA 5FO1A 4DCJA 3RV4A 3C3AA 2E5WA 1NHGA 2I4NA 2LPMA 4MRNA 3U62A 4A0RA 3FI9A 4EHHA 2GETA 1N8TA 3JQAB 5JADA 2P90A 1N9GB 5EYPB 2W98A 5B3JC 3D8HA 4QX6A 1W9HA 3OFNA 3CF4G 2QRVA 3OE5A 3CUEF 3W9BA 1H0SA 2CDNA 4K40A 1JHOA 1DIHA 2V0CA 5J2TB 2R6JA 1IZ9A 2XUKA 3F4BA 1O94A 4CM4B 2V74B 4H9GA 3B9BA 5EE5B 4P54A 1E69A 1HQDA 3W5UA 1Z15A 2AZ4A 4ZQBA 3BIWA 3GLFE 4RPKA 4MKHA 2ZT6A 2EDAA 1QPGA 3KV1A 4I7EA 3UAXA 2VJLA 3KEOA 3ETNA 4PBRA 3ETGA 4PZAA 3KVOA 4Z4GA 1NA5A 2E49A 4EQZA 1SC1A 4C0WA 1CZLA 2PS3A 3OFKA 4TLMB 3AERA 2EFHB 2VDLB 4IX9A 3UPTA 3ZDCA 2BFCB 2LRHA 1DI0A 2DQKA 1YH3A 2KB0A 3K2IA 2XOKA 2WICA 3MTIA 4BL5A 1UMKA 3ENNA 2V7VA 3UJPA 1C9JA 4MVJA 4ZP1A 1AF4A 1M9NA 1RWMA 5DVZA 4AJNA 1CZHA 3QFTA 3V32A 2JCGA 2FEWB 1HMYA 3GFFA 3ITKA 3MQ2A 1M76A 3G59A 4OSPA 2CBXA 4P34A 1F8YA 3E27A 4GM4A 5KCMA 3TX6A 1GNLA 4IP0A 5AVUA 4JBNA 1A8UA 4RL4A 3DTVD 2XWSA 2HJSA 2NIPA 4GLLA 2A1TR 2P9JA 4G23A 1WP9A 2PIAA 5HOQA 1X1DA 5E6UA 1S89A 3KKNA 3UOGA 1N2BA 1SXGA 2DTXA 2JGDA 1H94A 2R4UA 4O2AF 5JQGA 4LV6A 1URPA 3LQFA 3K9HA 3L5KA 3OESA 4R1PA 3VC1A 5CA1B 2OVBA 4I36A 3HB4X 1XU7A 2QPLA 4IIXA 3V1MA 4IXTA 3U17A 4A6DA 2ATXA 3H86A 4KITB 4CODB 2GFHA 3U6BA 4Q00A 5J2UF 2GD2A 3ZHXA 2H63A 4MROA 3QM1A 2RC6A 4AROA 1RT9A 4TXMA 5KYXB 2EFEB 1YR6A 3PQEA 2PS0A 4BGDA 3V48A 2UVPB 1TADA 3Q1LA 1Q1EA 4UMDA 2YBEA 5KOJA 2C3YA 1ZRHA 2J3LA 1D2EA 1GTRA 2QROA 2QVYX 3IAEA 2WOJA 3DMNA 3RIMA 4D8UA 2VQFB 2D2XA 1ZRSA 1UOQA 3FAKA 5SY4A 3AEZA 1RJWA 1I2BA 1V11B 4UNIA 1W49A 1QFJA 2V7PA 2QMHA 2X0RA 3E18A 5IKXA 1J23A 1XWWA 1ICIA 1KP2A 2KJQA 4ZARA 4DDUA 1NT2A 3EC7A 1V8BA 2QKYA 1E4EA 5JY1A 1WBJB 5TJHA 3BWXA 3RVBA 3PUXA 3NRJA 4ROTA 1KYTA 4Y2SA 2IU6A 3PXXA 2OMKA 2PZEA 4WOJA 3ZWYA 1E98A 1JT9A 2QG6A 3FF1A 5JEEA 2C5EA 4PAGA 3OCCA 1G5RA 1HDYA 1ODFA 3C45A 4TMXA 3AK4A 3VR2A 1MQ8B 4MOWA 1D7AA 4FDTA 4UVIA 4P1ZA 3RUCA 3EUEA 3TZ6A 2NUAB 2PG3A 1MF7A 5FOVA 5U4XA 4HDAA 2PGIA 3J81k 4H7FA 2ODAA 2ADOA 3U1VA 4BQFA 3A6PC 1IY1A 1FP7A 2HRRA 2NZ8A 1D1TA 2OV3A 3O6VA 4JQOA 3BB4A 4XRRA 5E1DA 1KI1A 1U7TA 5AI9A 2V58A 4P7FA 2VOJA 2AEEA 1RAEA 1F3OA 1YZVA 1DCTA 5B6PA 5JCJD 3H19A 1EFVB 1T6ZA 2D1TA 3OVMA 2Q8NA 2RHBA 4ZOQI 1N7JA 1Z0UA 4OI2A 2H07A 5ITVA 4AO7A 4BKQA 1ZU5A 1FTQA 2ZI4A 4Y2JA 2JAPA 1JUDA 3T9CA 3ORRA 3FHCB 1UBMS 2IUTA 1NYQA 2PKQP 1RZVA 3DTYA 1KRHA 3HP7A 2IV7A 3M3DA 1YK1A 2QN3A 4M0MA 4QOSA 3RBVA 4YXWD 2VHUA 3QHAA 3IBTA 3ZHVA 2X8JA 4RVDA 1RQLA 3M1IA 1UAAA 4Z49A 2PMEA 2Q0SA 5CDFE 1WKVA 3L77A 2P35A 4W1PA 2R8ZA 4V03A 5EG5A 5CITA 2AXQA 2O0JA 5E8RA 3QEMB 1CZNA 3I76A 4ZT2A 4U7JA 4C6TA 1U7UA 5BSRA 4NC9A 1MIOA 4ZT4A 3ITDA 4F8EA 4FDVA 5I9NA 2PUWA 1CDZA 2Y6VA 3V3KA 3G82C 1PW5A 4P86A 2G88A 3AILA 4JJGA 4YP6A 3UB2A 3ZDYB 3KZKA 2JAUA 2BFEA 4KUEA 4X41A 4M76B 3RVNA 3AUTA 1QGED 4NJOA 4YRKA 5AVTA 3D1LA 2HWYA 1CF4A 1U16A 3TFWA 5F35A 1N3YA 2UAGA 1SXQA 4NI5A 3A6ZA 2LKDA 3V7UA 3W3AA 5T4EA 2X58A 1PEAA 3U9LA 2UDPA 4LPKA 3X1WA 4D7AA 4TZ0A 5FLXA 4N5IX 1NC3A 1UDBA 3JAWB 3L7LA 1MJGM 4D43A 4AJ2A 4LDQA 2QGNA 3DDSA 4DLLA 2WHEA 1C7IA 4AUMA 4UHDA 1MEJA 4NK4A 2CDAA 3HI4A 4MS4B 4ZVRA 4JITA 1CX9B 1C2TA 1J0CA 4RTJA 1BS9A 4FVTA 5B2ZA 1OXSC 3WB1A 2QZ4A 2QTNA 4FONA 5A3SA 4YAKA 4PU0A 4D57A 4JBGA 4FLEA 1SUDA 1YQWA 1QH8A 3TSZA 4CDGA 2OECA 4ER3A 2DX7A 3D4PA 5JR3A 1QMPA 4GPZA 5B64A 3AVXA 2O57A 2XGSA 5EINA 2M6KA 3Q8LA 1XJWA 4NKRA 5EMHA 4UZEA 2BRUA 3AJ8A 2IYUA 1MPTA 2J08A 2GDZA 3R41A 2RMKA 2QZ9A 2AEFA 5I7AA 3UXEA 2VUIB 3TL3A 3KQUA 1XTTA 5AKHA 1NPYA 4DSOA 1JVSA 3GJXC 4G84A 1ZVVA 4XWGA 3PR2B 4OBWA 2Q4TA 1OJLA 2YR0A 3PC4A 1W0JD 5COAA 4IQ8A 3VR4D 1CUZA 5CBPB 3M6AA 1U8XX 5BQFA 4YR7A 1U2DA 4ND3A 5FUXA 2H1LA 2YJTD 1XCLA 1I7LA 3H1PA 3KZXA 5AI4A 4ZCMA 5A2QA 2AWOA 1I36A 2WU3A 1JH8A 1K92A 3JYPA 4AX4A 4CLXA 3JZFA 2J7PD 4D9KA 1F8XA 1D04A 2Y1GA 3IQFA 4LHXA 4KR6A 2ZGVA 3OX2A 3FSGD 3OKFA 4IH4A 4AVYA 4C0QC 4IVPA 4HUQA 3I8OA 2D2FA 3MF4A 4POOA 3JVUA 3SU8A 2ZZNA 2JFOA 4LNAA 4DILA 4YQEA 2FHPA 1QS0A 2JATA 3SXUA 5TX7A 1QF9A 3ZCTA 4HNRA 5BO5A 1J6UA 3PFCA 1T5IA 2QU7A 2WJVA 3IDSA 5HOEA 3RU2A 3CEMA 4HQRA 5I8WA 1RAFA 2ZBQA 2ZR0A 1FDTA 1CPYA 4W5JA 3RTEA 4BXOA 2YKGA 1A1SA 1X0VA 1QBKC 3GYGA 2ZBVA 4NIMA 3QEAZ 4AU1A 1X39A 3S8EA 1T5SA 5M3BA 2JHPA 4IM7A 3OA0A 3LWZA 1VSBA 4ZYYA 1HE8B 1OI7A 3BJRA 3NBXX 3QBPA 2QRLA 1BU5A 1RYBA 3ML1A 4D9NA 2DF8A 1XELA 2CXOA 4WJZA 3E23A 2EX4A 1M75A 3DEJA 3KO8A 4N39A 4CV2A 3DLBA 4G0NA 2HIAA 4J0CA 3TIXB 1NKVA 3AYZB 1XMXA 5B1DA 2GTIA 3GVXA 4QYTA 3GDGA 3R3YA 4ZTBA 5DSXA 4Z1OA 3KQOA 1QYVA 1AUPA 4UNQA 2F8SA 1HT2E 2YXDA 4TTAA 2Z4TA 1IZ8A 2XVXA 4DY6A 3DKVA 1OZHA 3IMCA 4NDZA 3OCEA 4O6VA 3VZPA 1ZOLA 2ZIFA 3QFHA 2DY0A 4XCXA 3RBAA 3OJWA 3VPCA 1ZLXA 4PLTA 4U9UA 4EY7A 1XZ8A 4N5DA 4BO4A 5AP9A 1XF9A 4IOLA 4EX7A 4R8RA 2GEKA 2HBQA 2WT4A 4C43A 1TF7A 2Z8ZA 3F67A 2JG3A 2VP9A 2Z30A 1H9AA 2A8YA 4C20A 3DE3X 2H17A 5IFKA 1TX4B 1NMXA 2VPIA 1E1RA 2GBIA 1G21E 1ONPA 3SQXA 4D4KA 2HCJB 2I3AA 1ECBA 3VKWA 4BFCA 4KK4A 4GPD1 4BB9A 1ESZA 5KOHA 3IUEA 3QLUC 5KREA 2B98A 1N5MA 3A1CA 4NRDA 1Q0RA 3COVA 3NV9A 5K8VA 3HN2A 3NALA 4KG7A 1S3IA 2PJRA 4WNAA 2Y9PB 2OUKA 1IG0A 3LQ2A 3F2IA 3NTOA 3WXMA 1RAGA 4S3MA 5HTKA 3KLOA 2J0VA 2BGUA 1WW3A 3IQDB 2YHBA 4FD3A 1DINA 1KMIY 4IKPA 3RASA 1T4CA 3DMYA 3DT8A 4J0KA 4TV9A 2NP6A 2EKBA 1XNHA 2AF4C 1QFSA 2LGJA 4GX0A 3PNBA 4NXMB 4BO7A 4V0RA 1ACMA 3FPAA 5DWDA 1SHLA 4DBVO 5KQLA 5KSOA 1UJ5A 1ZMXA 4HQ0A 3R20A 1FXSA 2J9RA 5FXMA 5BUQA 3UMBA 1JAXA 3W6NA 2HB6A 3G1TA 2GFIA 4V39A 5E7MA 4JIGA 5JS7A 521PA 3NAQA 1HZJA 5JANA 1GAEO 3ECAA 2GEBA 3DVAB 3L7AA 1JL3A 4FOOA 1UFVA 4YACA 5JVDF 5DHQA 5I7RA 3LL7A 1RVV1 1A77A 2OAGA 4YC7A 4Q6BA 3GXOA 4RF2A 4X97A 3MSCA 4ZAGA 5A3JA 1I6KA 1T8TA 4GQBA 1GPUA 1EK1A 1NW6A 4JAVC 2FLVA 3RJZA 4HH4A 1XQ9A 3N74A 1Q74A 4W9NA 3B1WA 2XGGA 3FMFA 5J5CA 3IIEA 1SC3A 3ELYA 3BFKA 4WGFA 2W70A 3CURA 3BB3A 3DF7A 4PO3X 3KAKA 4M1ZA 4XR9A 5AUOB 5JNWA 4LYHA 4F1KA 4TUYA 5EQDA 1AQIA 1P9OA 3B12A 1Y5IA 5JHHB 4MI3A 5L45A 2M6LA 5G1NA 2JLXA 1WDTA 3TJZA 1J7KA 3CZPA 5KWVA 5KOYA 2F8TA 4J0GA 5KCZA 2V0GA 4KN8A 3ZHRA 1J22A 1LVGA 4N65A 2UVDA 4O2BA 2IZ0A 1TAHA 2IPLA 4MRAA 2Y93A 6REQB 3LV8A 4LV8B 1D0VA 4J9VA 1J99A 1UCFA 2FZCA 4Q3DA 4HY3A 4HDRB 3EAFA 1CFJA 3Q3EA 4HYTA 4HMPA 4XW2A 4UMFA 4DR1B 5F1OA 2RHDA 4NK5A 4J1QA 2HPAA 1E3TA 3HWRA 1E6KA 1WG8A 3FBGA 1NVGA 3FGOA 1J5XA 2C5FA 2IDZA 1PR3A 4IZOA 5K0LA 3U7JA 2QX9A 4INOA 1ZRMA 1Z2PX 1VSVA 3M9XA 2A9RA 1AJEA 4P4UA 2QTCA 1N5DA 4BX8A 5IYZA 1E0SA 1TQHA 4R8VA 3K3PA 4ZANA 3OZDA 1VE7A 3AUAA 4JYBA 4L5CA 5BXYA 1BMDA 4KFCA 1D9ZA 1T13A 1M2NA 4K6KA 5K0ZA 4C78A 1NURA 1QRUA 5IJ0A 3AV3A 4EZBA 4KH0A 4DCVA 3F3KA 3STXA 4BVKA 4L2IA 4D4GA 2RH4A 1NVKA 2PX5A 5AJHA 1M1ZA 1E7QA 1HI9A 2WR8A 4QLAA 5HRCA 3R5HA 3RNOA 3H5RA 3MWDA 3DO6A 5C4IA 1O0SA 4M7RA 3ZBQA 3TG8A 2WAMA 5B3LA 4ZTZB 1TT5A 5JLJA 5DHSA 1T2NA 3G17A 3ELDA 4IF4A 1A7UA 1Z7BA 5FBQB 4ZC8A 4PYIA 5H70A 4HCJA 4KK3A 4S1OA 4C4ZA 1FK8A 3I9MA 3GJRA 4NPCA 2GAFA 4EGFA 2E4YA 2F90A 4PRKA 721PA 1JHQA 2YXEA 2C42A 3H05A 3LL4A 4BPRA 3WLMA 1UPUA 4F46A 3V2HA 3ZJUA 4EW1A 2ZE7A 4XJTA 1JNYA 3BRCA 2XLCA 1N6HA 3DUWA 4CIYA 2ZYTX 3WL3A 4D74A 5TE9A 5SICE 3V1YA 2EW1A 1W7AA 2GZSA 3CCCA 1AY0A 5IF9A 5L7TA 1HT3A 3K94A 4KBGA 3QXJA 1MVLA 3DHWC 3GZTB 1Q1BA 4IKOA 5SY9A 4AX8A 1X92A 3ZTYA 2GM5A 4PTZA 4DM4A 1ZUD1 2NZYA 1K7FB 4ZZIA 2YTZA 4RFVA 4ZCQA 2FSIA 1NN1A 2J9XB 1HR0B 4FGUA 3SD7A 4DN6A 4EL0A 3AW8A 4F5DA 1QYXA 4ND7A 1EWTA 3L0DA 4NY1A 3IHWA 3PXGA 1JA0A 1IRXA 2QGAB 2YWDA 1VHLA 2FMHA 1S2GA 4FTWA 4P0TA 4DXAA 3FOEC 2VATA 2QL5A 1A04A 4C6HA 2UUCB 2BGKA 1Z5UA 2OKGA 3WFIA 3WNCA 4F72A 1Q7GA 1YIDA 2A86A 2GEVA 2PD6A 1N6RA 3BA1A 1GNPA 3IAAA 4G1FA 1JFSA 3I4FA 5DPMA 1OTYA 3IPYA 3SG0A 5JS2A 4CN8A 3BB1A 5JSQA 2OYCA 1PKXA 2H48A 2H11A 3F5DA 1Z7EA 4CF5A 1NGSA 1N3LA 4ITUA 3WKBA 5EGNA 1GTL1 5AJZA 3OM0A 4U2CA 3VNRA 2IW1A 2NZWA 4DNPA 3HJGA 1E64A 3UJHA 3BL5A 1EUDA 1KEZA 2P9QA 2WM3A 3DE1X 3P19A 5IJAA 1WEHA 1KJ8A 2ST1A 3LQYA 4CMHA 3BRQA 1A7KA 4UE6A 3UC5A 3HM9A 2ZJOA 1JI0A 3Q5DA 6AT1A 2IUUA 3MRTA 3S70A 1GXSB 1JLLB 3JSXA 3CMMA 4O4IA 2X13A 1E61A 3DC7A 1Q6YA 4NVRA 3RAJA 2CHEA 3NONA 5CLFA 2C61A 2GAOA 1WM1A 1N8SA 1UBNA 3EZ6A 4I9UA 4D8WA 4EB3A 1Z33A 4MYSA 3VH2A 4DLWA 1OIVA 1V8FA 4MYDA 4YP0A 2C58A 3UJAA 4GMDA 4GZLA 2H5JA 3B89A 4KLAA 4C4OA 3AVPA 4ZQHA 1DO2A 5FP0A 1J97A 3RYCB 5B53A 4TMWA 3WWPA 3GZNB 1Z8HA 1JIXA 4MV8A 1BFDA 1GUYA 2I6UA 4UHCA 3TRKA 3T7RA 4GL2A 2O2CA 4R2KA 2RC5A 2J0UB 3AF2A 4X6XA 1BC5A 1DT3A 2DBVO 2Y1WA 5B37A 3UAWA 5FNVB 4BMOB 2VQ6A 5EWLA 2BLNA 1VJDA 4DQ0A 5E0OA 2Y2UA 1HG1A 1Z62A 3SNKA 4CM3A 1IAVA 3AIKA 1USKA 2L2QA 1ZGHA 4N3AA 1D09A 5GV7A 1GPBA 2ZJ1A 4FXOA 4JYPA 1HT0A 2D4HA 3R44A 5EKDA 3SZLA 4HJXA 4C4XA 4LRYA 1CQIA 3PFBA 1NLYA 2WB4A 2R7NA 1KH1A 3M9LA 1GA4A 3NVKI 2HXGA 1PWEA 2XZDA 1CVIA 2ERCA 4WMLA 2QI9F 5ERXA 2A5FA 1QYDA 1WKBA 1C7RA 2EDCA 1I5OA 2PMCA 1MTOA 2W7TA 3MINB 1R9MA 1NVEA 2EOAA 3ORYA 5DP1A 5FULA 4LISA 3V2UA 1EFPB 3EWNA 1FOEB 5EXEA 1LDEA 2FRXA 2WAAA 1I3OA 1UK8A 2PD3A 1BDBA 2AVDA 1R2QA 2IF2A 2FP4A 2V03A 3AR5A 1IY9A 4EB6A 4ETIA 3UK1A 5JAIA 1C7FA 4ZKEA 3TTYA 1CW2B 4GXTA 2JLSA 5LFAA 2FSSA 4RQAA 2F6RA 4B81A 2J45A 3EB9A 1FEZA 1P1HA 3HUDA 1PN3A 3P0EA 2DFNA 3BHNA 3WGTA 2PWZA 3DGEC 1WVIA 2XSZD 3M6XA 3M89A 2CK3D 4ZGBA 5DLPA 1L5KA 3F73A 5ELXA 2C92A 4B3TB 5FA5A 1LSOA 1GPLA 5KC8A 4JT9A 2YHIA 2VK8A 1B2RA 3PG5A 3L79A 3EGOA 4QASA 1JE0A 3K9BA 3SFZA 4NS4A 1ZSNA 2GPJA 3FB4A 4R83A 2H7VA 5F78A 4CJXA 1RQ2A 1X1CA 1FMLA 4U6NA 2ZWPA 4Q7KA 5DTRA 4EARA 1U9CA 5LKRA 1O6GA 4BNJA 3E6AA 1G3IA 1YVEI 1AB5A 4GLOA 5FWXA 4DR6B 2ZDQA 1QC5A 4Y7CA 2OG2A 1XC7A 3NEAA 2I9PA 4G86A 2PUAA 1XEXA 1Z2AA 2RGBA 4B3JA 1I1NA 4MVJH 3PKZA 1YASA 5DLQC 1HM5A 3WDMA 4D8TA 2JLRA 2IPAB 4LIPD 4RPHA 4HTFA 5CW2A 3V8EA 2OBXA 2QRVB 2ZTVA 3IR6A 3PGA1 4BGUA 3B2EA 4Q02A 3R8XA 1UUFA 3ICWA 4X91A 5K8JB 5ABPA 3WKCA 5G41A 1C80A 1ZGZA 4YRPA 3SJZA 2PD4A 1GU1A 4JI4B 1NBHA 4TX1A 1OFUX 4JLWA 4CXMA 3WDSA 3IR7A 4MKGA 1FFEA 2Z3WA 3DOFA 4PFKA 4WKOA 1JG1A 4X8LA 3RUAA 5C1DA 3HL0A 1U02A 3T1TA 4C2UA 2NTEA 3DM5A 3UV6A 3AERB 1GPYA 3G8CA 2ZM6B 1KK0A 3OEED 3THWA 4NBVA 2XVYA 4NENA 1R6VA 4PAOA 3ZCPA 1DXOA 1VPLA 2FRDC 3BAZA 2E21A 5TMPA 1E3SA 2P2GA 4EB8A 1WKCA 2FETA 2MMGA 4P4TA 3LDUA 2OA0A 5HZKA 2VHWA 4MX2A 2H6EA 4JX9A 4QYIB 2JARA 4MB0A 1O89A 4N41A 1F0KA 4RNCA 4YRGA 2HQOA 2BBOA 3SK0A 1YBMA 4WN3A 5CJPA 3Q3GE 2HX1A 4X5OA 4E2XA 3NMUF 1H3NA 1GV0A 1PF7E 4G8BA 3JYNA 2XDAA 4INPA 4RYDA 1YJXA 2FW1A 4NYJQ 1M33A 4L76A 3NC0C 4QOIA 5E6UB 4MV6A 3S3TA 4BJ5A 1ZUNA 1IHOA 2JGDB 3QGMA 3P4UA 4S12A 5JQGB 2QVBA 5CB8A 3R6LA 3CYFA 3K5HA 5K7SA 2XEDA 3TBFA 2HL6A 2ZB4A 1P1CA 3HLTA 2Z6UA 1KO8A 4F5WA 2F3PA 2CDRA 3E9EA 3BWVA 1NXSA 3T7DA 3X43A 2JDID 5BWCA 4FHZA 3KPVA 1F60A 3FBWA 1QGYA 4QU8A 4RA6A 4TM7A 4U2BA 2ZUWA 5EZYF 5KOJB 1CIPA 2B21A 4GD3Q 1TCCA 2MSCB 2G4LA 4IMPA 3QBEA 1SRRA 3AR9A 3EZLA 2J3IA 4WFKA 4WCDA 5F4BA 3QV1A 2B30A 1BKSB 3C7KA 3WIOA 3B7GA 4XX0A 3NLLA 1TJ5A 1U4NA 3MHTA 3R2JA 4QOFA 3SZUA 1ULTA 2ZPUA 1RI4A 4JGGA 3DFFA 5GINE 4IWYA 3VUEA 3L1UA 3K9GA 2OHVA 1E4EB 4H60A 4BX2A 3AKEA 4RKFA 3C3PA 4Z7QB 5IASA 4APAA 3EULA 1HL3A 2HSEA 5HQJA 4ESVA 1ZN2A 3ABIA 3ADOA 4MV0A 3DE4X 3WRWA 2Y1KA 5JJKA 1VDKA 3ZE1B 5EVJA 4U7FA 2FB9A 1F2DA 3U61B 4Z9AA 2FKAA 2O3JA 3PX7A 4WH0A 3AIOA 2KLHA 1J90A 1GPH1 3B2NA 3EVDA 3SSMA 1G3RA 2O7SA 1BG6A 3BTOA 1BEZA 4JA2A 3WL8A 1TFRA 4TLCA 2AOVA 3RGWS 3GMTA 4EO9A 1CLEA 1ULSA 2LV8A 3K0EA 8LDHA 4BNDB 4QM7A 4OHOA 1XJ0A 1CJBA 4XGQA 1QQ5A 2EGUA 2CXNA 4NNJA 3UY4A 4B48A 2I7DA 1Y7HA 1ZGGA 3OZFA 4YXWA 1RRVA 1WQ4A 4W7SA 2BGTA 1HNNA 4I66A 4TVBA 4WLEA 4C0HA 1GUZA 1PE0A 2ZREA 2A9OA 2TECE 4WZ6A 2E5LB 4KPGA 3SX2A 1NONA 1NDUA 3K16A 3ADCA 3DAHA 1Z2OX 2JFPA 4O4JA 4FNMA 4PW0A 1RHKA 4RY9A 3LT1A 1UJ6A 3GUYA 1K0UA 4PZDA 1RYMA 3M5WA 1IXRC 2F43A 4HYQA 3WRYC 1JA1A 1AKRA 4I1SA 3TLZA 1IN8A 3DT9A 4YASA 3W3AH 3JYQA 3ZZMA 4B9EA 4EW6A 3E3AA 3G0DA 1LKZA 4NP6A 4E5PA 1EK5A 5BN5A 2AKYA 3G02A 3OCXA 8ADHA 4DDKA 2NUPA 3HRIA 4MQEA 4ZV7A 2HJRA 1G9SA 2X0KA 5C3MA 1G6KA 3EGDA 3O8NA 1KEUA 4EF6A 4GO1A 1NU6A 5IDYA 4UPVA 4OQLA 1DBQA 3LF2A 1P44A 1USGA 3A1TA 4C6TB 3RAFC 3QX8A 1IXSB 3CH5A 1MIOB 2IE0A 2ENUA 4U1RA 1IAQA 2BISA 2YXLA 3AXTA 4PG8A 3NS7A 2JZCA 1P9LA 4PZCA 2RI1A 4BVJA 2HO5A 1NVTA 1CUVA 4FFBA 2BFEB 3R77A 4FYVA 1H66A 2C5BA 3L8GA 1CC1S 1GCGA 1O95D 4NCIA 4TTSA 1XVIA 4X85A 4D99A 5LWHA 4BBJA 3INGA 1YBHA 1P5HA 3IX7A 4U0JA 5CGQB 3VJMA 5C8XA 5DLEA 1WBBA 3SDZA 3W8NA 7REQA 3AF3A 4YO7A 1JEEA 1ODTC 4EGAA 3QVXA 1AV6A 4RS3A 2OY0A 1JG2A 2GZAA 4URUR 3CVJA 3FTCA 4GDMA 1YZGA 2H52A 1FUIA 1JDNA 3FYUA 3PDUA 2DTDA 4KACA 3RABA 5AVWA 3B20A 3AO0B 3ZJVA 1O6CA 4MWCA 3WKAA 1GIAA 1LZKA 2C7VA 1BMQA 5I9MA 5L53A 3NWEA 2ZYWX 1Q21A 3IDZA 5EMKA 1QHXA 4ENTA 4AJJA 3U09A 5BQPA 2C2XA 2DG2A 2G0NA 2P69A 4J4HA 2EU8A 3OT1A 1XCPA 2Z8XA 5JSHA 3FDIA 3MJSA 5ALSA 1IPEA 1W0JA 4HSEA 4Q82A 5AKJA 1Y1QA 3HXTA 3V8NA 3VR4A 5KVVA 2VJDA 2VPZA 1AHHA 4KMRA 4P4LA 2HYDA 3R5SA 4OUKX 4Z9XA 5LYJF 4MDEA 3WGQA 1AZSC 4XUCA 1GDDA 3LWNA 2XE8A 1AHIA 3HO8A 5GAJA 2J7PA 1I7SB 2AH5A 2Z1DA 3UN1A 1SOMA 4IHAA 2RAFA 1Q3HA 1ZW6A 4NYIQ 2XD9A 3KJIA 4N5NA 3FSGA 5K0EA 1PBTA 1PHPA 3V80A 2BZ1A 2X41A 4E7OA 3KB1A 2C7PA 4JLKA 2CMFA 3HKDA 1M73E 1S9HA 3DE5X 4CM7A 3M2PA 1GLGA 1E1LA 4IDCA 2IY9A 5KZMB 1H1DA 1DUSA 2DC1A 2Y1DA 3NTUA 1MZVA 3PNOA 1G8JA 4IEEA 3K1YA 2OWEA 2RE8A 1J06A 2YL2A 1JJIA 2GX6A 4COKA 3BSYA 1EZ4A 5KMGB 3CLTC 1ISMA 5BQOA 3NAGA 4DLBA 1OX4A 5LP1A 4HUQB 2EFDB 4KOEC 5E38A 5EWMA 5IVDA 4FPXA 5U4QA 4EUEA 2ZJ0A 1SUSA 2ZJZA 3I9OA 4LVCA 3HXOA 2H2GA 3QMWA 4BO9A 5A5DA 1QS0B 3L9XA 2YWRA 1DRVA 4IFTA 3SXUB 4HB2A 2C31A 4LDNA 2IZ1A 5K51A 5TF0A 5B7GA 1C9YA 3TS1A 1MU0A 1AX9A 2E4XA 1VL1A 2G9UA 3DFZA 5AM4A 4BXOB 1MC4A 2VZ8A 4TS3A 1XRMA 4L74A 3WAKA 2HYIC 5KNDD 3SJ7A 3LYHA 1HQKA 5AHOA 2O7QA 1Y1TA 4GKJB 2SKDA 4NJEA 4XYLA 5KTSA 3U56A 4DR7B 1E5VA 4FE7A 1ZYUA 4EGCB 4OHXA 1CRPA 1AZTA 2RJ3A 3P2EA 2B5OA 3HBNA 3FYSA 3PGKA 1I3KA 1K5HA 1TAGA 4W5QA 1T26A 4MUBA 2GWRA 1RPTA 1N4DA 3T1QA 5EJ7A 3T3HA 1XTKA 3DL2A 3VPHA 2A14A 2O1EA 3TI7A 4BLOA 1NQOA 2Q2QA 3G2KA 4G8JA 2DB3A 2GN9A 3AKDA 1BVHA 1TC2A 1ZIXA 4Q47A 1PT5A 4MITA 5AOBA 2DBZA 3EVEA 4X00A 3ET4A 2BEVA 3LUHA 4I5FA 3K4HA 1O97C 1PZFA 3C3BA 3KL2A 4RGQA 2I54A 3I37X 2G5PA 1BFUA 3BHIA 1YC5A 1QIKA 2RHJA 1FIUA 1HY3A 1E9FA 2OV6A 2WLSA 3EYWA 5H68A 5CT8A 3U7EB 5I4KA 3HUFA 4D45A 1ZD4A 2C2ZA 1RM3A 5ARBA 3WI7A 5LD2C 1HBJA 3EDCA 3AOEA 4ME6A 1M7BA 4D80A 5K05A 2C29D 2LKCA 5KOHB 4C2AA 1A8SA 3QFCA 1A27A 1HNWB 1L5HB 4ER6A 1A9PA 1SUPA 1NVMB 3O83A 4QYSA 3URMA 3OETA 5B1EA 2K6GA 1PDVA 4DR4B 2IUYA 3LLCA 3ORFA 4PPQA 3ZD7A 1XNGA 2VP3A 3FWKA 4X6UA 5IAEA 3EPKA 3HFJA 5IEBA 3EUAA 5J9FA 3W2TA 1HSOA 1C8VB 4OQNA 3MMNA 5A62A 4BO3A 1NQVA 4NYJR 1T4CB 4DIKA 4LXUA 3O74A 1J1ZA 4AJ1A 1F12A 4TV9B 3UGQA 4DQUA 1RHJA 4BN4A 1KKUA 3GNSA 1YS6A 4YMTA 2O9JA 5FBHA 1UL1X 3BH0A 1KJWA 1GITA 1K8ZB 4XGIA 3IPXA 4C0KA 1DBVO 2ORYA 3EHEA 4XB2A 1H6DA 5D1HA 4EI9A 4OGFA 4X44A 1ZK4A 5H0IA 4LMBA 2D5CA 1VI2A 3GK3A 3L2OB 1IOVA 1XZFA 2WJJA 2V6JA 5JBQA 2G9RA 5T4FA 4AQ7A 1C9MA 1J2UA 1X9GA 2X5JO 1CHNA 1LNZA 2I2CA 2Y67A 3O8OB 4HNAA 2B5WA 4L3VA 2VWQA 2OD2A 3ZDDA 1CYEA 3LP6A 4NR0A 3H11A 1PJ8A 5AOCA 1L7DA 4RIIA 5AH0A 3NCHA 3T5MA 3JSAA 3E0QA 2VHQA 4OOEA 1AVTA 5IU6A 5JW6A 2QM7A 3K0CA 1VA4A 4B6PA 3A3KA 4XQ9A 1C1DA 4G5RA 4JXXA 1NAIA 1N77A 5TNXA 3WQHA 1ZM9A 2C5HA 1USUA 1O77A 3A6LA 3OTGA 4CZ2A 5KYYA 1FTNA 2GCOA 5EIAA 1M2EA 1XTPA 5KJEA 4C7MA 4CUJA 5AW3A 1VFPA 1JHVA 2BGNA 2QE7A 4HEJA 3ZD9A 5CXQA 1SUBA 4LHSA 1HFJA 3HUUA 4N8SA 4O2BB 3DL7A 3NYRA 1Z4QA 2H3EA 4PLHA 3NHRA 3FOWA 3L46A 4RA9A 4WUVA 3D6JA 3TEMA 4C6RA 4CL3A 1J2EA 2MYNA 2CMHA 3PQ3A 4RTPA 1EHIA 1UBLS 1Z2NX 3E9QA 2NN3C 2GZ1A 3AEXA 3U4DA 3HTXA 2VBFA 3MUOA 3O3CA 3RF7A 1KI6A 3G9QA 4C5AA 1IUOA 1RWPA 1ZVKA 3D64A 4TVOA 5BNWA 4RTMA 2G5GX 4NG4A 1EJ2A 2BW0A 3OCFA 3CSDA 5DN6D 5DXJA 2CUKA 4RK7A 4QPCA 4MLPA 2E4UA 4H0FA 2NZXA 1KMMA 4M7OA 3RJ5A 1I30A 1XRLA 1U5BA 3G9UA 2OM6A 3RIGA 4JEUA 4Z4FA 2VP4A 1NOJA 3FGZA 3NYWA 1GCAA 4M6WB 5IYZB 3OMLA 1L7XA 1YL6A 2W6MA 3DV9A 1BA2A 3L8ZA 4A9AA 5HW2A 1CZKA 3PHGA 5KVSA 1G8YA 4HNTA 4I1YA 1KWGA 4PCAA 4HADA 1IBLB 1A4XA 1OX5A 2FUCA 1JKFA 2PXHA 5IJ0B 1EYZA 3VMMA 1TQ8A 2GGSA 4H4EA 4L2IB 2HLHA 4LC9A 3UATA 2AR9A 3VH3A 2OFFA 4D5EA 3ZJTA 1KSGA 1ISGA 4FKBA 3MWDB 1U2GA 1Z83A 1Z7GA 4XUEA 5CX1A 5ES3A 2IUEA 3QE0A 1TT5B 3CZMA 1IN4A 5D00A 3ZLJA 3JRXA 1KKMA 3CPHA 1PX2A 1QYWA 2EFCB 4I6GA 3JYHA 4KKXB 3GFTA 1ILEA 2Y4OA 3BX1A 1ATZA 3NHWA 1I14A 3S6JA 2N1BA 3C6MA 1M2WA 1RM4A 2A0XA 1OC4A 3C14C 3JWJA 4HAXA 4E4RA 4HNHA 1EX7A 3F46A 1KE2A 1D07A 5BVHB 5HKAA 1KEWA 4N9WA 3UXHA 3T1NA 5MDHA 1DUVG 1L4NA 3OOWA 4QSMA 5FT9A 4OCZA 3DV2A 1ORRA 3SHWA 3VO9A 3ZTTA 3UO8B 1RRGA 2MHCA 1SBZA 4Q7JB 1XZBA 2JI9A 3FX2A 5IC4A 2BHSA 4IDGA 3TJMA 3GRVA 2B4KA 3LWBA 3L7DA 5TC4A 3UUGA 4E11A 3KKKA 1KHTA 2FPGA 4NMXB 1VE9A 1PFVA 1W4BA 3M4JA 5D6NA 2J0QA 4HMOA 4MX8A 1G0NA 3VSDA 3LUKA 3CZ5A 1TA9A 1L4MA 1T24A 5AUNB 2RBKA 1H2AS 1N1GA 3HEMA 4I81A 4YJ3B 1C50A 2Z43A 5DTQA 2HSDA 3GEEA 3FSEA 4DT1A 1F20A 1I4OA 2WIFA 2INGX 4BBZA 3ZD6A 1U28A 4LJRA 2Z2JA 3K0FA 2PDAA 5BPFA 2ATVA 4LXTA 5C7LO 3AVQA 3GRRA 4DVGA 4E21A 2GYVA 1VCNA 2QE6A 4BQIA 1IM2A 5IABA 5HKLA 3VYTB 3PEWA 4NYIR 3HVKA 4LMPA 4AKTA 1R8QA 2JD0A 3SHFA 3P9CA 3TQHA 4WQMA 1EUDB 4UU7A 4G65A 4TMFA 2ZAYA 4DG5A 2O4UX 3AUJB 3HNRA 1UXKA 2DFLA 3BG5A 2P5YA 1IPHA 3FR7A 2O2GA 3DVLA 2WOOA 3EVNA 3FROA 3ICOA 3QUSA 4N49A 4F38A 2C04A 3QE9Y 2ZWOA 4C76A 3UQYS 1Z7YA 2NZ2A 3QWAA 3K15A 4HL6A 4HVTA 1QWOA 3B9QA 1W85B 4O4IB 1W73A 3BVPA 4DIEA 4DDTA 1VMAA 2QUJA 1EX6A 1FX0A 4AMZA 2ZRIA 4FYWA 1YT5A 1WXDA 3BL6A 1I0LA 3JARA 1FU7A 1PI3A 2JIMA 1HF3A 1Y89A 3L40A 3P9YA 5L9AA 1E9CA 4JN6B 4IJ5A 1W93A 1N8NA 4LN1A 3BERA 4QT4A 3IVMA 2NWQA 2GESA 1XL1A 3DYIA 2Z98A 1LRJA 1NT4A 4KWIA 1LXCA 3KR9A 4YHHB 2VF2A 1HLDA 2O3UA 1S01A 5ALRA 4CMEC 1Q2UA 2GEJA 4EHNA 3HCOA 3R0IA 1XKQA 1ZSVA 4FIZA 3HFRA 4UHBA 1RM5A 4LCJA 5EWLB 2FJ0A 3QWFA 1P5RA 3RKUA 3IEIA 4Z3DA 1SVMA 3ROXA 1Z5NA 4TV8A 1XLTC 1MORA 2W2NA 1XMVA 3ICPA 3P0FA 1RWNA 1NVAA 3CX6A 4KOAA 3TTTA 1EPUA 1CQIB 1MB0A 2ZB2A 1FFDA 2G5CA 3AR3A 3MUFA 4NAVA 3R4VA 5DULA 4F9GA 2VSYA 1OWMA 4B8ZA 3O47A 2XSZA 4H2DA 2CK3A 2OO5A 1CNEA 1GNTA 4K05A 4WOCA 2JLAA 3WGUA 3RTDA 3TTVA 3EH1A 3GH1A 3FMPB 2XB2A 3TFQA 4B31A 4PRYA 2FP4B 1T1JA 3LBYA 1T9CA 4MEAA 4EB6B 5K6AC 4UTRA 4MRRA 4E08A 3H2BA 4K3UA 3COJA 5B1YA 3B5JA 5CAEA 2VF4X 3IKVA 2R96A 3I12A 4MW2A 3BAFA 1KQ3A 3LPAA 1G42A 1PZNA 4ENQA 4ZOEA 5ARCA 4PG6A 2V3CC 3N7TA 3ND6A 2YHIB 1VBMA 1Z28A 5JBIA 4URYR 1MVOA 1TIBA 2AFIA 3WIEA 4QDUA 4GI3A 3ZDRA 1JFTA 4RULA 3D0KA 5FTNA 3UWMA 3R8CA 2X4DA 1Z9BA 3FWNA 4YP1A 4ZN6A 3TIIA 3C74A 5FWXB 2I91A 4YA6A 5IT5A 3SR4A 1IMOA 2CNBA 4E6PA 1TKCA 3C7CB 3ZGYA 4YMGA 2I3DA 3DOCA 3KYDA 1ZAYA 4ZQGA 4X62B 4EEKA 4IDHA 1L5RA 1IY0A 1WTCA 1KP3A 4HTFB 1WL8A 4NV1A 4DNQA 5KTMA 4MVCA 5HUJA 1MO4A 2NAFA 4IGAA 3Q12A 1X8JA 1LBQA 2IITA 2ZIXA 4EAAA 5K0CA 2Q5QA 3D2BA 2PPVA 4P38A 3DBHA 3WWCA 3ZHQA 4DJJA 5EEGA 3EQ7A 2CVPA 1X87A 2A5YB 3BJZA 1O0BA 3L04A 4GLFA 2ZG6A 1ADCA 4ZVTA 3KSAC 4CEIA 5BOSA 2NO5A 2I3GA 3DPIA 4AY3A 2I2DA 2P3LA 3RSFA 4JBWA 1G8SA 1ZHFA 4WEQA 1BHQ1 3GQVA 5KAPA 1WUTA 3F96A 4FSXA 3KWFA 5FADA 3S1LA