1Z4KA

Structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with thymidine 3'-monophosphate
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
194
structure length
194
Chain Sequence
RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase
publication title Structural basis for substrate specificity of the human mitochondrial deoxyribonucleotidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 65
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1z4kA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4kA01
2YMMA 2Q4RA 2RBKA 2HF7A 3DNPA 3E8MA 5ALVA 4C4RA 4NAVA 5A3RA 3DDHA 4BKMA 2P11A 5ALSA 2Q5EA 4BBJA 5AW6A 3EWIA 1EK1A 1T5TA 1SU4A 4KNVA 2W43A 1LTQA 3ET4A 3B9BA 4UU0A 3QUQA 3WK7A 1QQ7A 1WZCA 4JDPA 1ZD2P 2FUEA 1MH9A 1AQ6A 3PDWA 2QLTA 2JAWA 3NRJA 5AKLA 3AR3A 1RLTA 3L0YA 4XE5A 3SF0A 3ZUPA 5AKXA 3ZI4A 2MU1A 3ZVMA 5AKEA 2IOFK 3IB6A 3CNHA 5ALDA 1J8DA 4UU1A 4UW9A 3L8HA 3QGMA 1ZD3A 5ALQA 4AS3A 1Z5UA 4Y2SA 2YMLA 2ZG6A 2JARA 1YJ5A 3U7HB 1ZRNA 3AR2A 3L8FA 1Y8AA 2BDUA 3OCUA 4HAIA 2C8KA 5AW4A 5AVYA 1CQZA 4EENA 3L5KA 2R8EA 1SWVA 2JAOA 3KBBA 3P96A 3W5DA 4I9FA 3U26A 1Z4IA 3WGUA 5AESA 5AVUA 5AW5A 1QH9A 4L57A 3A1CA 5ALYA 4HGOA 4UASA 4MUMA 1YMQA 2YJ6A 2EARA 4F72A 3U7FB 4Y2JA 4QQFA 3OCXA 2NO4A 5AI4A 3ZWDA 2I6XA 2YJ3A 3QU5A 4G9BA 3I6BA 3BA6A 3ZWKA 1O03A 1PW5A 4Y3UA 2ZBDA 5ALOA 4KX3A 2CFSA 2DQSA 5AKKA 3W5BA 2ZBFA 5AKYA 2AMYA 2HO4A 1NF2A 2NYVA 5AIAA 1Z4LA 4IG4A 1T9ZA 4F71A 1YDFA 1QYIA 2B8JA 1L7OA 2HOQA 2HCFA 2WF9A 2G09A 3AR4A 2FPRA 2WF5A 3ESQA 2WF7A 1T5SA 4Y2YA 4YGYA 4OHFA 5AI8A 5AK5A 5AKZA 3UM9A 2AUTA 3E58A 4DFDA 5AW7A 5AM5A 4HGPA 2D2VA 3QLEA 1ZS9A 2FPWA 1U7PA 2GHTA 1QQ5A 5AM3A 5FP0A 1WPGA 1TE2A 3N07A 3QUBA 1RKQA 4FYPA 3OTQA 5A3SA 3S6JA 5AKJA 5IT0A 2YBDA 2PQ0A 1RDFA 2CFRA 3QU9A 2FDRA 4E88A 1IWOA 3DV9A 1TA0A 5AVQA 3SLRA 3OCZA 5AK4A 3WK5A 5ALNA 1LVHA 4UMDA 4ZEWA 3NANA 2I54A 3U7EB 2GFHA 2NO5A 1RKVA 5ALRA 4UAUA 5AVTA 3NAMA 3MMZA 4DW8A 1ZJJA 5AKIA 1RMTA 2HI0A 1U2TA 1TJ4A 2MSNA 3PGLA 2OA0A 2G80A 1RMQA 2G0AA 3WKAA 2ZOSA 3AR5A 3WKBA 5ALZA 3AR8A 2EATA 3L8EA 3UMBA 2CN1A 3FZQA 3ONNA 1L6RA 2O9JA 4I9GA 4Y2VA 3SMVA 4CE6A 2HEGA 2P69A 3ED5A 2WF6A 5AM0A 4DWOA 5IS2A 3ET5A 5AHXA 3WK9A 3KOOA 2G06A 1KYTA 3W5CA 5A3QA 3EF0A 3PGVA 2ZXEA 4NABA 2FUCA 4L6CA 3A3YA 4QJBA 3FPBA 3AR7A 2IOFA 5AKGA 1VFPA 5AW8A 1SWWA 3QU4A 3I28A 2IOHA 5AVXA 1VJRA 3ZVNA 1S2OA 1RC8A 3HLTA 4CNQA 1ZRMA 2P27A 5E0OA 1RKUA 4YCLA 1X42A 1XPJA 2VKQA 3QXGA 2IYEA 5ALMA 4RETA 3I76A 1YNSA 5AIBA 2RB5A 3OCYA 3ZVLA 2HSZA 3WKCA 2BDEA 2YFYA 4H1WA 2GO7A 1YS9A 1RLMA 4BX2A 2W11A 2HDOA 5IT4A 2PKEA 2PR7A 2HX1A 2YY6A 3EF1A 3MN1A 4EZEA 2WFAA 3FVVA 1YV9A 3E81A 2B8EA 3WK4A 4XOUA 2BY4A 3IRUA 1Z88A 2ZBEA 4GXTA 1Z4KA 4ZEXA 3B9RA 1JUDA 3SD7A 4UMVA 2B1QA 1L7PA 4BX3A 5AW0A 4YCNA 3SHQA 2YMPA 4IFTA 3B8EA 3J7TA 3QU2A 1Z4OA 2AH5A 4UARA 5ALPA 2I33A 1RMYA 4Y2PA 4B6JA 4DCCA 3W5AA 3R4CA 5T41A 4NWIA 5AVSA 2G07A 4Y2QA 4HGRA 2FI1A 4BEVA 1L8LA 4GIBA 4Y2XA 1Z4MA 3L0CA 4Y2TA 4CF5A 3FM9A 4J2TA 4RESA 4OCZA 3KZXA 3NALA 1L8OA 5AM1A 3BWVA 5ALEA 2YJ5A 4O8CA 3KC2A 4L6AA 3MPOA 2B82A 4YH1A 4CF3A 3GYGA 2B1RA 4EELA 3N28A 4EX6A 4YIKA 2G1AA 2B30A 3N1UA 5AI0A 2OYCA 3RF6A 1XVIA 2HHLA 2ODAA 1Q92A 3SKXA 1RRCA 1L7MA 2W4MA 2CFTA 3F9RA 3U7GA 2R8ZA 3WKDA 3K1ZA 2RAVA 4NV0A 3VAYA 2FPSA 4MWOA 1L7NA 2IA5A 3WK6A 4BNDA 2WM8A 1RLOA 2YJ4A 1S8OA 1RQNA 3R9KA 1U7OA 1N9KA 1TJ3A 5JJBA 4YIHA 2FPUA 2AGVA 2QYHA 2WF8A 3E84A 4UMFA 5AICA 3M9LA 1TJ5A 4KN8A 2I7DA 4BNDB 1J97A 1XP5A 3FPSA 3AR9A 1O08A 1Z5GA 1ZD4A 2FEAA 5ALXA 5ALJA 3UMCA 3WKEA 3WGVA 2ZBGA 1VJ5A 3L8GA 3QU7A 3OCWA 3L7YA 4ZEVA 4HYTA 1QQ6A 3A1EA 3NASA 5AW3A 4KX5A 2G08A 3N8GA 2WHEA 1K1EA 5AVZA 4CF4A 2JAUA 3AR6A 2Q4TA 4HGNA 1NRWA 5AW2A 2R8XA 5ALTA 1Z4PX 2R8YA 4FE3A 5ALUA 5AK6A 3ZW7A 3D6JA 2C4NA 5AM4A 3QUTA 1ZOLA 4KNWA 3KDPA 3NUQA 3TLMA 2EAUA 4KYTA 4YCMA 2GHQA 4BEWA 4G63A 1ZD5A 4BYGA 1U02A 5ALLA 5AVRA 3U19A 4UAVA 2P9JA 4XQ0A 3NIWA 2FPXA 4XPZA 3QNMA 2C88A 1WVIA 4UM5A 3ZTYA 3CZ4A 4UATA 3M1YA 4PNHA 1F5SA 2O2XA 1N8NA 4OD0A 3RFUA 4J03A 3QX7A 4UM7A 3ZX5A 4NFLA 1NNLA 3N5KA 2OM6A 5ALFA 5ALKA 3WK8A 2GMWA 1RQLA 3OPXA 2I55A 2JGAA 3ESRA 1Q91A 2C8LA 2X4DA 5AI9A 1EK2A 5AW1A 3MC1A 5AI6A 4FFDA 3ZX4A 4Y2UA 3L1UA 3DAOA 3OCVA 3PCTA 5ALHA 3EPRA 4HGQA 5ALWA 3I1YA 1FEZA 3A1DA 2YN4A 4OFZA 3SKYA 2HF2A 5AK3A 3HYCA 1Z4NA 2OBBA 3QYPA 5ALGA 2I34A 4Y2RA 3ZTWA 1RPZA 4AP9A 5AVWA 2RARA 3L1VA 3QUCA 4AS2A 3ZU6A 1WR8A 2C9MA 5AI5A 4C4TA 1CR6A 4UMEA 4EX7A 2B0CA 4JB3A 5ALIA 4C4SA 1Z4JA 4BX0A 3KD3A 3FGOA 3IJ5A 3L0BA 3UMGA 1Z4QA 5AM2A 5AKHA 4EEKA 3U13A 5AVVA 5AW9A 2YMQA 3R09A 1U2SA
chains in the Genus database with same CATH superfamily
4KV9A 3BB4A 3W2FA 5I9BA 1N1DA 2I76A 5BPFA 2D13A 3CQ9A 4BKPA 1KIFA 1DCMA 1UWVA 2QL7A 2J9FB 5BOSB 2C42A 1RVV1 1N6HA 2VI5A 2ATXA 5C1IA 3JWJA 3GNTA 1RXWA 3IUBA 1DIBA 2XCLA 5FFFA 3CLUC 4Z8XA 5TX7A 1CYEA 5IUKC 3HV0A 5LU9A 5HM6A 2Q1XA 4L78A 1Q84A 1Z6GA 1T5IA 4WLVA 5FL7D 4OGLA 2C84A 4K26A 3K0SA 4IZ6A 4MUJA 1VHJA 3DGFC 2OV2A 2JBAB 2ZIEA 4L27A 3QLVA 4OM8A 3DTTA 3H5WA 3GWGA 4TVOA 3FNBA 5LVAA 1ZXLA 4V02A 4NSLA 2FUEA 1QHIA 1C8KA 1VRVA 3NOOA 3ZLJA 3TIVA 5C8YF 5HFAA 1JQJC 1N2BA 2Z08A 4Q7JB 1UPCA 1J90A 2IITA 3KX2A 3MB8A 3OA0A 4YJDA 3IE0A 1VA5A 2XB9A 4CCYA 4RMJA 2VP2A 1G7RA 1GAXA 1G2OA 2FNAA 1E4YA 2J1LA 1TVEA 4JGIA 1NLZA 3MJSA 4RD0A 3HKEA 4ARUA 4LJ5A 1A1SA 4J1TC 1E60A 2EP5A 3D9QX 4MMXB 3AUYA 3TSOA 2C1XA 3GRVA 1CF4A 3RYFB 3ICOA 4ZHSA 2XZTA 3HNOA 2D1RA 1KEZA 5FQOA 4B8ZA 1D2GA 1N6PA 1VZ2A 2MDTA 2ZREA 3L0PA 3U7GA 4HAIA 2Z8YM 2SECE 5AW4A 1CQZA 5NLLA 2PRSA 5J63A 1M0TA 1QTNA 3HZOA 4B0OA 1EVEA 4DLAA 2NTJA 4GBJA 4GECA 3SZRA 3WR5A 4DQ0A 2D7DA 1XTTA 4IDBA 4Q4AA 4JJEA 3WXMA 3R0ZA 2C7RA 2H3HA 5ALYA 4DAOA 3EY9A 1DXQA 1HZZA 3GZ4A 1WY5A 3TAXA 1E2PA 1Y5LA 2TECE 1T9KA 3HABA 2H4JA 4KEAA 4R1MA 1Z9BA 3G0IA 4K7JA 3VHLB 1Z62A 2R6GA 3BK1A 5IZCC 3CNOA 2ID9A 1O4WA 2XITA 3NC1C 2JJQA 5CEFA 2H7XA 4N7MA 1S4QA 2BZGA 4HUQA 4D92A 2W2OA 2NU9B 1E1YA 4Q9AA 4LF9B 1J4AA 4ZRNA 1KMCA 4EY6A 4IGIA 2IHTA 3ZJ4A 3ND6A 3GNLA 1DRJA 1XJWA 3GL9A 3TZQA 3ZBQA 5AKKA 1ZZEA 5AR1A 1AGYA 3T9EA 5B37A 1U63A 1EXNA 1JKIA 2WJ4A 2JIBA 3JZMA 4YMSA 2FP3A 4AROA 3A6DA 4MYTA 3IT2A 2AZDA 1VMKA 2A92A 1A5ZA 5AIAA 1VDKA 1FUIA 2H85A 4P7BA 4D1YA 4H0FA 4I4CA 4DBZA 1YDFA 2NQTA 1CUAA 3KZNA 4RKRA 2HOQA 3WC4A 5A5FA 1HOTA 3DZBA 2D1QA 4PS0A 1D1TA 3CH6A 4OQLA 2FPRA 1RJWA 3C4VA 5DISB 1KOJA 4XW2A 5A05A 2QYTA 1E3WA 3NP7A 3EG9A 3R0XA 4RCYA 2QV7A 3VI4B 4QG3A 2OOKA 3EEBA 4WINA 3Q6NA 2ODWA 2ZQZA 3G2KA 3TQRA 1HDYA 2KPOA 1FIUA 1HE5A 1FNNA 3DDNA 2X8BA 1CUEA 2C9OA 3TGPA 3T3HA 4PRYA 5LZ9A 3QLEA 5K3OA 4FD2A 2Y93A 3OIDA 3HU5A 1A9QA 5DLQC 2QGAB 1T36B 1TZ2A 2B4AA 3BFXA 3G89A 2ZZMA 4ZMSA 2JHAA 2XMPA 5BPHA 1O1YA 1Y5NA 1QWSA 2I67A 5KNBH 4OLJA 3W2EA 3IOYA 4EHJA 3I9KA 3RD8A 2UVPB 3O3CA 5JJCA 3IL2A 3UEOA 4BNWA 2J31A 2NU6A 3REOA 4G0VA 1D0IA 2F9FA 1JWLA 1HA3A 4P34A 3FYDA 2PXXA 5KVQA 3CURA 2IPOA 3C7DB 4NZPA 4AJOA 1JDZA 3IQDB 1YFMA 7YASA 3ZE2B 1T3LA 4GP9A 4PTYA 2GCOB 3B53X 2NNWB 5FTKA 4P38A 1VPTA 3KYBA 3ZBTA 4A2PA 4I1PA 1QG2A 1X38A 1TC2A 3I04A 1UJNA 3BIOA 2QUAA 3A1FA 3I32A 3LT2A 4TLDA 3VZRA 2OP1A 1TT5A 1C7EA 3UXHA 4AWAA 3QZUA 2YZMA 3BWMA 4F3YA 2AJCA 4YRTA 3HXLA 1TVCA 1I0LA 2AFHA 2VDKB 2WICA 3H8SA 5HF5A 3R6VA 3SJZA 5BWBA 1GVNB 5KQMA 1V2HE 1OWOA 3QBPA 1GAEO 2QT1A 2CMGA 4V0MA 1EKXA 4TTJA 1J1ZA 3VISA 4ZICA 1K7CA 2PGLA 1KARA 5E6RA 1ZBQA 1ZK1A 2QT0A 3O21A 4MQEA 3VSEA 3IB3A 2QX9A 3AFIA 4MV7A 1QV7A 3VPBA 3C3YA 5K3EA 2IP2A 1SHKA 4GICA 2VQ3A 4QOIA 5FA5A 2BEVB 5C37A 3PCXA 2Z9DA 5HKLA 5I7FA 3DOJA 2DG2A 3KKQA 2QVBA 4CMEA 2ZLBA 2PSFA 5EJEA 1PL6A 2HMWA 2YDXA 1VSUA 3AUJB 4MRPA 4QFBA 2FX2A 1MABB 1YL5A 4CLEA 1CJCA 4HAZA 2BFFB 2J0VA 3MJFA 1VE7A 1TD9A 4JLWA 4WACA 4NBRA 1KFJB 3ONWA 4I6EA 4EARA 3LCJA 3PXAA 1EJ6A 2F1RA 4B4DA 3ZGLA 1I6WA 1OLSA 2HQOA 4PONA 3VI3B 2G06A 3H0EA 4YX9A 1IUKA 1D2CA 1F0PA 2FUCA 1GUAA 2LZ0A 1KJNA 4XQCA 2A1TS 2QWXA 5AJUA 4ZU6X 5I9MA 5BW4A 3JWPA 3AP1A 5I48A 1KPHA 1JU9A 4I5IA 3RH0A 3S1AA 3P4UA 2O7SA 3G0DA 4QYWA 1SVOA 1P4HA 1GQQA 4ZZ1A 3GPBA 3ECCA 3CZ5A 1VFPA 4HUJA 2ZUDA 4BUZA 4MRNA 1PG2A 2EHJA 2XUKA 3K0AB 1GQSA 3ZE9A 4FGJA 1H22A 5H4GA 4B3RB 3OCFA 1JX6A 3FLEA 5F78A 5GPBA 2ZM6B 1TF2A 1SHJA 1VKNA 4K6FA 5CEEA 4BFLA 5KQRA 3HLTA 5CLGA 2XZLA 1O54A 5EESA 3CGGA 3G49A 4C9BA 3GFBA 1NTOA 5LKAA 2FMIA 1JQ3A 5KCZA 3GW8A 3IEKA 2WW8A 1IWBB 1KVSA 3KLBA 1V26A 1M5UA 4AJEA 3PGMA 1EM6A 1R15A 2LIPA 3UMSA 2IYFA 3UGKA 4IZHA 1KVQA 2XE6A 2YC2C 2WAAA 2QI9F 1XZQA 2WIDA 4Q24A 4DB4A 3NHKA 3FFXA 1P74A 3KPJA 5CFMA 4Y7DA 4UZEA 3FGZA 2C2YA 2EKPA 3SU8A 1L4MA 3B3FA 2Q4BA 3R9XB 4QHTA 3CX8A 1U2RA 4Q9IA 3MOGA 4C0LA 1IEWA 2GO7A 4ZVLA 5L95A 3DZHA 1KE1A 1KY3A 4BX2A 4RA9A 1UFRA 1VE9A 4Z8YA 5JARA 2F3PA 2D0IA 4GYKA 1KXZA 4BMZA 1QHNA 1REQA 2QORA 5LN1A 5B1YA 1YKFA 3QVGB 4BMPB 2COKA 2SKCA 2BM0A 2ZYSA 3QVSA 5T57A 1PWXA 1GNQA 3AXTA 4M9UA 1CRQA 1OA1A 2R6FA 1WMDA 2PQ2A 2QTFA 3FVVA 3OPVA 4BEBA 3PRYA 4EPYA 5CNJA 3UV3A 3HRHA 2H51A 3O7MA 3QPWA 2VF2A 4K1LA 3O8BA 1GL6A 5LA6F 5BV7A 2A5GA 4GRAA 4RK6A 1ZWLA 3RAFC 4XCXA 3IHLA 4XFKA 1A5TA 1JHRA 1GGEA 1GTVA 3CLTD 4L5IA 1X7XB 3SZOA 3U62A 4ZHQA 1N7JA 3E5RA 2RHOA 1JUDA 3EA4A 3RHSA 2N9UA 4LDNA 1BIFA 1GFIA 3K92A 2PD3A 4TSFA 3WGQA 3P4XA 2Z9BA 4N3GA 1N5LA 1VLHA 1D9XA 4IFTA 3HXOA 2Y27A 2D27A 1QGAA 1SQ0A 2IH2A 3ROTA 1X8XA 4JBWA 3LDHA 3FBGA 3LCVB 1HY1A 1YR6A 1LPPA 2ZJ7A 3LHDA 1O94D 4YRQA 3VH1A 3PUWA 1K5PA 3FOEC 3UN1A 3UAGA 2JGDB 1U8FO 4PHFA 1PR6A 4DCCA 3JQAD 1JLRA 3KWMA 5I7SA 5T41A 2IZ7A 4C22A 5KPJA 2MSKA 1UBNA 4HQOA 2F43B 1IHDA 3ND5A 3P2YA 2EQAA 3WYGA 5FWYA 2GZ2A 1CUUA 2VXYA 5C1DA 1GDHA 2DUNA 2H4ZA 5KVSA 2PCLA 1E2JA 1ULTA 4NYIR 3S1SA 3AW8A 4JBXA 4DT1B 5GVSA 3OMWA 3VNSA 3LIIA 5EFOA 2IXFA 5M7EA 2UU9B 4L74A 1N6LA 4IIGA 2ESRA 2P41A 3PDUA 1ZESA 3WWDA 1EUQA 1YQQA 2EZUA 3Q7RA 1SUIA 3W05A 1AA9A 2X5NA 5IMSA 3UFBA 1MJGA 1ZP6A 2VTEA 4B33A 3CNBA 3QV2A 4EX6A 4JLKA 5HTOA 1CVIA 2WYVA 1H2EA 3F8WA 2XOKD 1O6FA 3NBAA 4QEDA 3TLCA 1TK2A 3ZHYA 4E4YA 4FB5A 5K8JB 3O93A 1E7MA 5LJLA 4D8XA 2BFDB 1YQXA 3M6LA 3PEUA 1S9DA 2RGNC 3JQ7A 1MR3F 4II3A 4KPEC 3DTNA 4JOCA 1NLUA 2F48A 4OQPA 3UAVA 5FTLA 4WK0B 1LC0A 5LZ2A 1IN4A 3ETJA 1VIDA 3GFTA 3TTSA 1S3IA 1MB0A 3T1OA 1FSGA 1GTJ1 3L3BA 4TM8A 4OQNA 3K73O 3KHKA 4M9RA 2HEIA 4PIPA 1FMLA 3W4IA 4H2DA 2FFAA 4O2BB 1TJ3A 1VJCA 1YS6A 3K0CA 3DT8A 1PHRA 4R7GA 3WLSA 2I9KA 3DOCA 4X91A 4XVRA 1OV4A 3OEWA 3PXBA 2WSBA 1JWAB 3R8FA 3C8UA 2VF4X 4H0CA 2P9BA 2QDKA 3JYNA 4PYKA 1TJ5A 2CDNA 3AU9A 5ICSA 3B2NA 1LD3A 4LRTB 5I5GA 4J3NA 5LIPA 3RPEA 2BPOA 1P7ZA 4V0NA 2VZ0A 4NOKA 5IKOA 5DXFA 3UFXB 2YHUA 4HGZA 4CZ2A 3IHTA 1TIBA 2QX7A 3BMCA 3E9NA 5B6PA 3DTVD 1N5IA 1K2WA 2XUOA 1EYZA 3A10A 3MWYW 1WHTB 3ENNA 2ZIXA 3IP7A 2IV7A 5JCXA 1W48A 2AFIB 2YV4A 1YNOA 4R40A 2CMDA 5EOVA 3A3KA 3R3XA 3EASA 3ZKAA 2JGRA 3UHJA 1TIKA 1PD0A 1IFXA 1Z2EA 1VL2A 1NY5A 1E79A 3PNKA 4RANA 3R5FA 4RPLA 4BL5A 4C21A 3EDYA 6Q21A 4LFBB 3QWAA 2X0JA 1CQWA 4FMBB 3A1VA 3H18A 3INYA 2ZJ2A 2WV9A 3DLPX 1Z0FA 3PR1A 5AK6A 2VBIA 3ZC3A 4EQ6A 3FWKA 5HX7A 2QW0X 2WWTA 1ZOLA 1UFVA 3ZZ1A 5HMLA 5JZSA 4MYRA 1EA5A 4JI5B 5KX5A 1NFQA 1FTWA 3MM4A 1RKXA 4W1QA 3DEAA 4N9WA 3G0CA 5KYWA 5KSWB 4BYGA 1X86B 4LEIA 1GXSB 5B6JA 2SICE 2W2NA 5BNIA 3KT3A 3FUUA 1RCFA 4AUNA 4RDIA 4BO3A 1OC2A 5I9IA 1CZOA 1CQIB 1JXMA 4ZPJA 1CBUA 4Z9BA 2GQ0A 3ZW8A 2FP4B 3K15A 2ZBUA 3WA6A 5JPDA 1MMFB 1NASA 5A3VA 4XDZA 2J3LA 3UWPA 4ZAWA 3CWCA 4AL4A 2QBYB 3LQKA 2ABWA 1L4FA 3GUVA 3BTVA 1QBKC 4J1NA 2X42A 4OD0A 4JJ6A 5DX1A 4J03A 3UJCA 1C3CA 2Q3LA 3H11A 2GPAA 3Q88A 4BO5A 4DXHA 2K7FA 1NF9A 3G8CA 5JHHB 3BJRA 1J8YF 1IM5A 3BQMB 1RT9A 1OI4A 1EVQA 2E87A 1NXTA 1X1QA 3JR7A 4IOKA 2Y6UA 4J4TA 1DGQA 2QV0A 1LLCA 3BCRA 3DS8A 4H7JA 2HB6A 3MQ2A 2GARA 3PU6A 1HFKA 2XADA 1ZK0A 5AI9A 3DC7A 5FA6A 1M34A 2E1RA 3QUAA 4GI2A 2RH9B 2JL1A 3N2KA 2HUNA 3TDKA 5IFLA 1PJRA 2QL5A 4P0TA 2PCJA 5B5SA 5KMGA 4HJRA 4HNTA 1MO6A 1DDIA 2E37A 2E85A 4OJKA 2XYPA 1GPMA 3O4RA 4JP3A 3DYIA 1HE4A 2OFWA 4NYJQ 4N48A 2GN4A 2HF2A 1V0JA 3UYLA 3MWJA 3QVTA 1Z4NA 3PDJA 4IEIA 1KBZA 1W87A 5IRCD 1H8HA 3R3SA 2XE8A 4F9FA 1X7WB 4B3FX 2P78A 3G6WA 3LBIA 4Q19A 5EXXA 1QOZA 3R7SA 4L1KA 3QEJA 1GCUA 2JC3A 5C80A 3PFKA 4FS8A 2X6QA 1Z4JA 5D84A 3CI0K 4EG8A 2NZJA 5L3VA 1P17A 5A6SA 3NFRA 4G5RA 2NIPA 2HQRA 2KBFA 1VZ3A 2Z83A 4CEIA 3O8RA 1NW8A 2YMQA 3R09A 4JP2A 5E4JA 2JJ2A 3CJQA 4S1WA 2CLLB 2HL6A 5DO9A 4LXGA 3RSZA 1G5RA 5TPWA 3PKZA 5A3RA 4APBA 1N4DA 4MQ6A 3M34A 4LC9A 1VCHA 3INNA 1QF6A 3E7PA 5GGYA 4ENRA 2VT2A 1G2PA 2JIQA 3VPGA 5KWJA 3OA2A 4IHAA 5AW6A 3JAKB 5HJ5A 3NUGA 2NTVA 1UXOA 2W22A 5T4FA 4R9UC 4W1PA 4GC5A 4MVJG 4NP6A 3GUHA 4FSDA 4Q4JA 1OI2A 1R5NA 2PPVA 1BHSA 4YY3B 2Q28A 2V98A 2DFPA 1ZD8A 2W2KB 1Q44A 4D82A 2GKSA 1UJBA 4HAOA 1JHVA 1NJFA 1CJSA 1XXHE 1GT91 3DM5A 3RODA 4B46A 4JMLA 4BIIA 3RHFA 3KQQA 4LTNA 5LC1A 3RRBA 1R74A 2WYUA 3I5AA 5AXCA 1T2AA 1MH9A 4KWIA 4NOLA 4UPVA 1XN1A 3P9YA 3VDNB 2WM9B 5AKLA 4FJ0A 5IH3A 2IYPA 2BOVA 1FX0B 2D1SA 2JJYA 3L0YA 3O75A 4FMCF 4H1UA 4INAA 4PG4A 4IGAA 2H7YA 1YB4A 2VHEA 5CA0B 4G86A 4OHRA 2DR2A 1UQRA 1F1JA 3GJQA 3QBJA 4OQZA 4TXNA 5DTJA 1Z6YA 5ALQA 4YXWD 3YASA 4HS9A 4YT4A 2G8LA 4KFRA 3D1LA 2XW6A 2WUFA 2QZJA 3IVGA 5U1PA 1UOQA 3U7HB 4WLEA 4HJXA 5GM1A 1JSRA 1C1XB 1N9ZA 1Q7TA 1UBMS 3L8FA 4LRQA 4DMLA 3AIOA 3N5CA 3CG0A 2DQ4A 1GEEA 1E3IA 1X1RA 2JPDA 3NBMA 1ZGJA 1BO6A 3STWA 4E5PA 1P61B 4F11A 3MJCA 3WB2A 3I6MA 1T34A 3UC5A 1XD2A 2ID8A 4WNAA 2ZU0C 4AZWA 4GX5A 5LCXA 1LDGA 2I22A 3JQFC 3MTAA 1U65A 2I4MA 5EIXA 2J08A 1XFAA 3BRCA 1IOWA 1SAYA 2O8CA 3EGXB 4NX2A 1EWQA 3I4CA 3D6FA 1I4OA 1ZGCA 4LJKA 4L7VA 1MF7A 2YZGA 1ZDMA 4P7KA 5WRFA 4BZXA 4TTSA 1JNXX 4R2IA 4AS1A 1XEFA 2NXJA 4IF6A 5K0JA 1UKEA 1YBFA 3QP9A 1O03A 1JP7A 2ZBDA 4MR9A 1KPGA 2FPKA 4UHKA 4WJLA 2GJAA 1KI3A 4KX3A 5AXBA 2BR4A 1PDOA 4UXIA 3DAFA 4B2YA 4Y8VA 3FMIA 3N6RA 2PM8A 4FZRA 3CY6A 3BICA 1C3OA 3KVRA 4NMMA 4P3OA 4C7OB 1P5ZB 1QE3A 1SG0A 1BKDR 1V8ZA 1XR3A 1ZD1A 3AY3A 3PHJA 4KGXA 3C1TA 3BTUA 2O4CA 2X5XA 3RT7A 1NBWB 3L0OA 4EHLA 3ESQA 5DMHA 3VR5D 1F2DA 4BVBA 1RYFA 1WAMA 3AY7A 3EQ8A 1R7RA 2AN3A 2J0UA 2WFLB 1XRNA 2BP7B 2OBLA 1F38A 2ZTVA 3MB5A 1K68A 4KBFA 4UPDA 5HILA 3T9DA 3CW8X 3ODPA 2MYNA 3TQOA 1X9IA 4NOMA 3E9YA 2VNHA 3GGSA 3JV7A 3EXAA 4BGEA 3RI3A 1E3MA 4DF3A 1TKAA 2GS9A 3MTGA 1NNUA 2ZUTA 5CVEA 1VHLA 3I72A 1A27A 4LDQA 2XDYA 2X6RA 4NI5A 3FOFC 1HLGA 3UT6A 1Z73A 2X0EA 1ZR4A 4JLSA 2MSDB 1IQUA 1LUAA 1XCLA 3B1WA 3OJWA 4KXFB 3CZQA 1U0EA 1M8FA 5BMVA 1P6QA 1SBCA 2JAPA 4NEQA 4EHHA 2F3UA 4YR9A 4LJ6A 5BN3A 2PYIA 5BSEA 5MN6A 3QOYA 2IDMA 2EL7A 3EAFA 3IT0A 2AHRA 4DANA 3CUYA 1VLZA 2PL9A 3DSRA 4LRSB 4MQFA 3ZWWA 4CQJA 2BSXA 2DC1A 1XTUA 1DJPA 5KOIA 2BEWB 1C29B 1FRNA 5EA2A 1XB2A 4XYGA 4DMKA 1JFFB 4WT7A 1C0KA 4R83A 2YZNA 1JHZA 3LXXA 3D6NB 3M5CA 3PUJA 4U02A 3ZHTA 1BXGA 1DMRA 3JARB 1F6DA 1ZH2A 2BGLA 2DR3A 3MBOA 2EGGA 1FNSA 3QMPA 5AHOA 3EB9A 4DG5A 1P1IA 2M98A 4EWLA 4D5GA 5K8IA 3U3ZA 4FDLA 2WMOB 5L6MB 2HBYA 3IE2A 3VU9A 4YAOA 1SQ6A 2BZ1A 4MGIR 2VRNA 1GG5A 5KHOC 1CY6A 2INGX 4BQEA 4R05A 1J8FA 2X1MA 3ANMA 5TJ9A 1KI9A 2QR5A 4GMKA 4QT0A 3SVTA 3N53A 2V74B 3H5VA 3WOVA 3CX3A 5LZ5A 4YJ3F 4P3XA 4Q66C 3GLKA 4XUCA 5JYBA 3ORSA 4XIFA 5C5IA 3JSXA 3R5XA 5TLSA 1PT5A 1W85B 5G0UA 5CDGA 1EA7A 3MD0A 3S2GA 1WZ2A 1W52X 2XGJA 1PVDA 2J07A 3SMVA 3HB4X 2DB3A 1PR0A 2VPTA 1GG9A 2ISSD 4ZTUB 3SDBA 5IG2A 2BYTA 1G18A 5IX8A 3BFKA 1ISFA 3FDXA 3C48A 3A14A 2WJ6A 3ED5A 5EZ6B 1NJ6A 1P19A 2G5GX 2WF6A 2QZPA 4LYHA 4N49A 3I58A 4F92B 3HH8A 2GZSA 1JG2A 1JILA 1TCVA 2BTOA 5AYVA 1QUFA 3E9QA 4NABA 1YAJA 4OYRA 3W6ZA 3NDPA 4AQYB 1S01A 1V45E 1F14A 4O59O 4BB5A 1ACJA 1YFZA 2CVOA 1XGKA 4IQ8A 4UE3S 4YJ2F 2DSTA 3P2IA 5H02A 1UPTA 4Z1OA 2XCIA 3RASA 1YS2X 1AU9A 2PZFA 1NVEA 3F6PA 3QBTA 5A06A 5K0FA 3H1BA 2O2DA 1EVYA 1S8NA 1UKZA 2B69A 4FHGA 4MQBA 1PJLA 2KJQA 2FGKA 3BYZA 2X7HA 3CKKA 1GGHA 3E9EA 3AJDA 5SY6A 1QU3A 5IN5A 3H17A 5BVHA 4QM6A 1TAUA 1KAEA 1XRRA 1OJLA 2N42A 1THTA 4KYUA 3DZIA 5FI1B 1GVHA 1FP1D 3EPJA 1JIUA 5E0OA 1CUWA 4IHKA 4ITVA 5GQSA 5K51A 2XA2A 1EMDA 1DG3A 1M9NA 2I3GA 1O95D 3K94A 3RCBA 1UKBA 2IZ1A 4J2HA 3WQSB 5KNDD 4OH7A 1DOZA 2WJJA 3BCSA 4IHQA 1C0PA 3I76A 2WD9A 4L5YA 2QX6A 2PKRA 1TPZA 1IXYA 1WG8A 3AF5A 5TF0A 1LW7A 5I4CA 1TOAA 3LS2A 4L76A 3BD6A 4NONA 1DDOA 4R6XA 2GYVA 1IXKA 1I10A 2IHNA 3G85A 3UJ7A 1MRZA 3NEPX 1SVIA 4PE5B 4TYPA 5EVCA 2FJUA 2J7KA 5FF9A 3KUKA 1SUPA 3L1HA 4M36A 4NRDA 4XOIA 4AY6A 4XRGA 1E2QA 3ITDA 3AVUA 4Q18A 2PFMA 2HJHA 3LX8A 3GVCA 1L7BA 2QG4A 3A6LA 3VDXA 2HSWA 4FFLA 5K99A 3RS7A 1GNSA 1RHRA 2VP6A 1DP4A 3U9SA 4G97A 1SU6A 5KNCH 4X92A 1IEVA 2ZCJA 4AZ0B 4WZAB 1PWHA 5C8XA 4FDTA 4H1HA 3FHTA 4PZEA 1ZL0A 2JHCA 3Q5EA 3HKCA 3A4MA 1EEHA 1YVRA 2IZ6A 2C5HA 2XVXA 3AERA 1MJHA 4INPA 4KOEC 5KEIA 4G0UA 1U6IA 2AC4A 4IGKA 2AG0A 4FT2A 4U00A 3CF4A 1H2HA 4TWJA 1GPDG 2D7CA 1G19A 3P9KA 3RVRA 3ZWYA 4ZGWA 1QMPA 2A94A 4BLTA 1JN0A 2VR1A 3GEGA 5DLEA 4MR8B 3RGWS 6NULA 5E38A 2WB2A 3MJVA 5K4AA 5REQB 3QPDA 3OX2A 2OQVA 3EEOA 4CEJA 3MJHA 3PFWO 4R3WA 1V35A 1XROA 1OB5A 4M0LA 4MP6A 5T6BA 1YK1A 4B3JA 1ZUNA 1TJPB 5I6DA 4JX8A 2FG5A 4RV5A 2DY1A 4Y2PA 5I9NA 3BMQA 1HTBA 1HRKA 3ZDFA 5CDHA 3A8TA 521PA 3QVWA 5BWCA 4KR7A 1G38A 3R4CA 3IMGA 1IBKB 2OD7A 1YGYA 4D3SA 1S8AA 4ZYUA 4JLDA 5AVSA 5DF1A 4URFA 4DPLA 1W6UA 5IJ9A 3O3OB 3G2OA 4DR3B 5IXSA 5E1BA 5ILOA 1OXXK 3SQDA 4W7SA 3NDBB 3R0IA 5HS6A 1A5SB 3JQ8B 1V8BA 4BFUA 1YK0A 3C43A 1PNQA 2GXUA 3A4LA 1LK7A 1ODLA 3HR7A 4TSRA 2H7CA 2O2ZA 2AYYA 1TAGA 3PSHA 1MX1A 3T1YB 3ROKA 1CJVC 1EE2A 3OJCA 3PCRB 5AM1A 1RYEA 4IQGA 3SYLA 1BOFA 4MJLA 1IHXA 3VR2A 1LA2A 3GRKA 4MLZA 3KWLA 1L7XA 4DIFA 3MUNA 2PH7A 5IYZB 4Y9SA 4OB6A 3V8PA 4V0OA 1UBLS 2V4MA 3NNNA 3ZHVA 4YIKA 1YUBA 2B0JA 2ZJ3A 2X3FA 3PD0A 3K8OE 4QGAA 3B36A 2J4CA 3BHGA 1XVIA 1ILEA 4DHEA 3B1KA 1MW9X 5D00A 1QYDA 2BKEA 3LDUA 2FN3A 3LTEA 4A36A 3V9PA 1EVLA 2C8VA 2HBRA 4UHBA 4FHEA 1N3IA 2WJWA 1S1MA 1Z34A 2VAWA 4WOJA 4ZXFA 2XBMA 4UTZA 4W5HA 4YQFA 1BWSA 2C3UA 2QLJA 2MJLA 1KO5A 3UHFA 1BQ4A 4UBJA 3T5PA 3CSUA 4LZWA 3DHEA 3CVJA 2QYHA 3OE4A 3THXB 3HUEA 2ZU6A 3UA4A 5EYPB 3UWKA 3T7AA 4UMFA 4GSKA 4D02A 4XYEA 3H97A 5IABA 3Q0IA 2Q5FA 2ZROA 3WQRA 1J8QA 2IU4A 2WIJA 2W90A 5I4IA 3U7QA 4BMSA 2WLSA 3DD5A 3T5CA 4D9HA 4M0PA 1Z2CA 1DOHA 2Q07A 3HDHA 4N0EA 4EJSA 4DKJA 4LQDA 3L8GA 3OQPA 3EXIA 3OZSA 4GQAA 4Y98A 2FPIA 2Z1NA 1M1UA 3K9CA 4HOYA 3EZ2A 1SUFA 1PHPA 2FE4A 4Q3KA 3V8MA 3WAKA 4DMCA 2FR8C 3E9DA 2G1PA 4EB0A 3CLRD 3H5AA 4GMDA 4R98A 4P2BA 2WJVA 2UUAB 3AR6A 1UMBB 4MWGA 3UQYS 4GO1A 4RAQA 2GN8A 1ECPA 3AX6A 3O9VA 1LDEA 1PFVA 5BN5A 5L3QB 1N78A 2Y0DA 1NKTA 1SC4A 4LDZA 3K6SB 3UH0A 2ZDHA 1Y89A 1KJWA 1UFKA 3KV1A 4GZ6A 5ALUA 1B76A 3PQFA 3U4QB 2Y4NA 3UOAB 1TPYA 5CFRA 1KXJA 5EPUA 4QOHA 4V2UA 1WVGA 2IXTA 4FZJA 3NUQA 3ANNA 1I01A 5DHUA 2ZWMA 1QFSA 4XUGB 1YRAA 5EJ5A 1H6BA 5I8WA 2BIFA 4O4LA 1WTAA 2P3QA 1CUBA 4FTWA 1U0SY 4KRXA 4AJJA 4F2WA 1XXLA 1BQEA 3J81k 4YRFA 4IEEA 5CITA 2R8OA 4ADMA 2YDYA 1OX4B 2OCBA 4RXTA 3OQ6A 4XPZA 3CNQS 2GAAA 4DLBA 1Q57A 4NY1A 3F2IA 5DCUA 4B3DA 1I5RA 3URMA 1QFZA 2NZVG 3QWHA 1XXHA 3ZV3A 3CUKA 4PNHA 4DC0A 4O0LA 3DW1X 4Z4IA 4AICA 5A04A 1BMFD 3FMPB 1HKHA 2E55A 3AG6A 3HV2A 4C6SA 4QGSA 2QVYX 3HGMA 4FGKA 4R16A 1Y63A 3KR0A 4EJFA 1G7SA 1P1RA 3EGOA 3C3XA 1U4SA 4GYJA 1EFVA 4OXYA 3UMVA 4B5LA 3NP9A 2OM6A 4EL0A 1Q1AA 2JANA 5CK5A 2DHDA 4OHUA 1A8IA 4FSXA 2HYIC 1E9SA 5BUZA 1FUUA 3IS3A 2VC2B 4PYQA 1XPOA 3EK2A 3PP8A 5F4ZA 5CVTA 3G17A 2NSYA 3LDFA 3M2TA 3AVOA 1DBRA 1VP9A 5KVVA 4DV4B 1YZYA 1ODSA 4G5OA 3DFUA 4IJKA 1DLJA 5BQPA 5LLSA 3LZCA 4ND8B 1PFWA 2XSZA 3IJEB 4GHWA 3ZX4A 4B7XA 1ONOA 1D2HA 1V43A 2R9VA 2JI6A 4KXVA 4F06A 2VZEA 2JCGA 1PX2A 4HGQA 2OAGA 2X4GA 1KTVA 1ZIXA 3E1SA 4S1OA 4UEWA 4Y6PA 1JSXA 4WL0A 3D2BA 1LV8A 1D2EA 2WIGA 3ICEA 1J70A 1ULBA 3TE6A 3M4XA 2JLSA 1E6MA 4QELA 4JYAB 1C1HA 1M75A 3S40A 2ZIFA 2IHZA 2BCJQ 3TUIC 2QAGB 3HP7A 1RPZA 3WX0A 1ULSA 3PNLA 2GEBA 4K03A 3LMKA 4I1SA 1W1UA 5L53A 4WKBA 3DZFA 1CR6A 5K3AA 2B0CA 1FP4B 1SVUA 1YCDA 2JD0A 3O94A 5ALIA 1PS8A 4ZT7A 5MFZA 3L0BA 4MO2A 3DAYA 4NV3A 3TINA 5AM2A 3QBEA 4MGHA 3I01M 4O4HF 5E0KB 3HO6A 5K3DA 4P86A 3CKLA 4UTRA 1GIAA 1MJFA 3SE0A 1OZAA 3RWBA 2HJVA 2RBKA 1RLJA 2G72A 2A1UA 2HJRA 3EQZA 5T8KC 3UK1A 1NG9A 3IFSA 1BGVA 4F5EA 4OXNA 4R54A 1KKLA 1VLJA 2P90A 3DE0X 3V7FA 1MVOA 2ZVDA 4MCAA 3W1WA 3BJIC 3ZY5A 3AYXB 3EXFA 5KTYA 1V39A 4BRUA 1ECLA 1D5CA 1P0IA 4Y6OA 4CLOB 2W2LD 2B1GA 4IQ4A 2F8LA 3L93A 2YIDA 3ZS8A 3F6BX 3DLHA 1SXGA 3EJ6A 1HFJA 5AJWA 1J0EA 1LTQA 4ZVVA 2A33A 2O3TA 1V1JA 1I0IA 3QUQA 3TR0A 1Q0HA 3UB4A 4QNMA 4G0MA 2DWPA 4JDPA 3DZDA 2NQ2C 1L7EA 2Y0BA 4IOLA 5ED4A 4JVLA 5HIMA 3RSGA 4NATA 1FU7A 3O83A 3GGOA 5IHXA 5MHTA 2NQ8A 3V34A 3BERA 3K9WA 1SCQA 4KR3A 3NRJA 5E6UA 4CMGA 4M6WA 3GR6A 1PVOA 4IILA 1UXHA 3ZUPA 3QK7A 5IBRA 3EVAA 3PJRA 4BO9A 5C8ZA 1H4QA 1Z5OA 2B2CA 4TLAA 4DE5A 5DNVA 3CNHA 1GGNA 3I1FA 3R6DA 4CUZA 2V54A 3KLPX 1RD4A 3ZG6A 3DV2A 4KE8A 3QGMA 3SHTA 4CM1A 4GKKB 4MHOA 2LUOA 3RKSA 3AUXA 1XMSA 3PL1A 3QE3A 1J6UA 4DPMA 1JAIA 2MSEB 1YVEI 4G3XA 1IMOA 4QT4A 1K6EA 3SZLA 1QG0A 4M7OA 1TEVA 4OMFG 3U40A 5AVYA 5CBKA 2WU3A 3LBHA 4O6VA 4DA8A 3UICA 3DEKA 4QNRA 2W4QA 1DDGA 1SUCA 2JAOA 1PR4A 1AHHA 3AC0A 3FSJX 3HG7A 4R2LA 4DTCA 3ZJYA 3W5DA 3VU8A 4XUEA 3U26A 4UEKA 2XTZA 4LHXA 4F04A 2IYOA 1ZVMA 4LGMA 1VB3A 5THXA 3NGXA 3IPAA 1NC1A 1TI7A 2FSUA 2QRVA 3CM0A 3LGXA 4DGQA 4CIDA 4ZEMA 2ST1A 1AF7A 4Q4HB 2NSDA 1H65A 2BLNA 1IZ0A 1LBIA 1W9MA 4UVEA 1MGPA 3FOZA 1Z2NX 4IUBS 2DXIA 4QXAA 2NUBA 5JD3A 1QYVA 1PWYE 1OBOA 1A8SA 4Y1RB 4KPUB 1YFEA 2UZ0A 3VR0A 3ZE6A 1V4BA 3IUMA 4G24A 1A9XA 3MWFA 4MIOA 2N47A 2QX8A 3T1HB 2QMEA 2X8AA 5LBIA 2LBPA 3GGGA 4XWOA 4ZJYA 1US8B 3GQBB 5KCMA 2HMVA 4E5MA 4CPDA 3QEBZ 1PNRA 4KO4S 2H9IA 3KZCA 3CJRA 1Z0DA 2XNJA 3H1PA 4B4VA 5I9LA 4Z4QA 2O48X 4ZK6A 1KI4A 1SCJA 4TL8A 4EKIA 2BBSA 2IGBA 5B3KA 2QLBA 4BNLA 1GKUB 3EIHA 3H2YA 3SFZA 4IG4A 2UYHA 3FAKA 4TZ0A 5H4HA 2WC1A 2B5VA 4AI6A 4RBNA 5MDHA 3HWRA 4J9VA 2WF5A 3VBEA 2OCPA 3OOEA 4XB6B 5FADA 3VHXA 3TG2A 2XCSB 1LEHA 1ZMTA 3D7LA 3WAGA 1BDJA 3LUHA 2ZT6A 4N3AA 1W8DA 3LC2O 1T10A 1M74A 4FX2A 1IY8A 5BW6B 3O2JA 3DOIA 1L7AA 4KDEA 1XL0A 2VL7A 2V7UA 1RQ7A 2H2WA 1UBHS 3MTEA 3C7CB 3U60B 2CUNA 4ECEA 1WZUA 4OBEA 1H69A 2VK2A 4KYIB 3PL5A 3O26A 1N3YA 4PQRA 4JUAA 1USKA 3WZ2A 3VRHA 1HDZA 1XZDA 4GDFA 3NKFA 3VAAA 3CN9A 3G68A 5E8RA 4DMHA 1L5VA 2CL5A 2F17A 5E7QA 4CKBA 5L6LB 3CCBA 1BRTA 3NGMA 1RKQA 2O3SA 1J0AA 1PI3A 4G5GA 4QQNA 2DFNA 5DRTA 5JMTA 3BIWA 1K08A 1V11A 4KTVE 3N3BC 3TFWA 1ZMRA 1BH6A 3WIOA 1XZKA 3R7DA 4KR2A 1ZCBA 3K1AA 3HCFA 3WS7A 4OX9Y 3SI7A 3VYUB 1E3DA 4C2AA 2XRZA 3SXPA 5JALA 1Z0UA 2G0NA 3P9CA 4JVMA 3V46A 1VYTA 4FSHA 1NT4A 1E2MA 2Y0EA 3EX7C 2C04A 3FDFA 2NV6A 2Y1LA 5CT8A 2R84A 1KDVA 4QUEA 4MW2A 5DE3A 1LZLA 5THKA 4MEJA 4UU7A 3K30A 2NVUB 2ADMA 3OOHA 4GH5A 3FCSB 4RQBA 5KYNA 2NAPA 1TADA 3BL5A 1BNCA 4X41A 1SQSA 1PJ3A 3RB8A 4UTXA 3CRQA 4K46A 4MLDA 3V33A 4NZZA 5INTA 1YDWA 2Q5JA 3F78A 3VR1A 4YUXA 4QPCA 1Y6GA 1P81A 2C2WA 1F1BA 4ZZ2A 3QLVC 2H18A 4PLYA 4BGDA 4EFNA 1NVKA 1JMVA 4E14A 3K70C 1XMIA 3LHIA 4HQFA 2B4TO 4A8JB 5LKRA 1RMQA 2ZIVB 5IKXA 2WOOA 3OKPA 1T4DA 2C7VA 3GJXC 5HFJA 2XA9A 3FNQA 1M6EX 5HJ2A 5CYGA 1QH1A 1HKUA 1QIEA 2EP8A 3ZD6A 1EFHA 1ZSYA 2XAUA 1ZKDA 2OHIA 4FFBB 2QU7A 1L6RA 4CL8A 4KLNA 4MDHA 1PF7E 3KYJB 4KFSA 1FDVA 1L5SA 1U1IA 1C81A 2Z5VA 4Y6QA 3TLGA 1D4ZA 1IUPA 1YMUA 3BRQA 3KQTA 2FAXA 4EY4A 3G0OA 1Z6ZA 4H4DA 1W59A 3DVLA 3IP8A 4L9AA 4Q1DA 1PCXA 4TQUS 1PIWA 2VP0A 2OY0A 3IT1A 2OORA 4DLRA 3W4KA 1IPHA 2OKGA 4FCWA 5AHXA 4D0GA 5ALMA 3Q8MA 5F1YA 3OECA 3TW8B 1UKCA 4CQLB 3EWNA 1GO2A 1VKHA 1ZU4A 1EVIA 5T5QA 1HZZC 1Y7IA 4DS3A 4E5YA 4EG6A 5HQ3B 2AHOA 3LKVA 1EVJA 1UFQA 2W2PA 1YL6A 5BYKA 3AFGA 4BNMA 1T5HX 4QD3A 1FRVA 4LJRA 1YQGA 2KM1A 3B6EA 2UZ1B 3HRIA 5D3MB 1F9EA 3OZRA 3C3PA 3GRFA 5JNUA 2J7PA 2AUNA 3P9RA 4JGBA 4RCVA 4CM5A 3ELUA 4DNOA 1UBJS 2VJLA 1NP6A 4CT5A 3AP3A 4QGFA 1Z7GA 1AMOA 1SU7A 3CX7A 4CVNA 4M8IA 1PNOA 2QN7A 1DINA 1CU1A 1AQYA 1A9ZA 3EQ6A 1DVRA 4XTRA 1DO0A 4P32A 3PVCA 1CY0A 1E2FA 3SIWA 4D9IA 1U8CB 3E61A 3GOHA 1QGED 1Y7PA 3KT6A 4TMXA 4KNYA 3I6IA 2IYEA 3L8ZA 5JI3E 2EKZA 3PUXA 4CKEB 8LDHA 4OLHA 3B85A 2VLIA 3DEZA 1I7DA 1I1HA 2OLEA 3G2IA 4Q7MB 4G4GA 4DRYA 1HDIA 1TQHA 4CLRB 2IPAB 5EUBA 4A2WA 1ORHA 3M3DA 1B8UA 4O3MA 4HKTA 1E1CB 1QIHA 2CWWA 3Q7QA 4BKUA 2PMBA 2HADA 3KZ1E 5CVUA 2WJYA 1N25A 5JG7A 4MW9A 2XIJA 3SS7X 1R0SA 1QQAA 2E4XA 4WXEA 4CG2A 3GFFA 2BISA 2Q8PA 1KI8A 2PKEA 3EHEA 5DK6A 4AC9A 2O1SA 4G5SA 3OU2A 1WU7A 4MO9A 1PN3A 1P73A 4RF4A 4RPHA 2XNKA 1Y1TA 3ZNNA 3I45A 2G8NA 5D5PA 1VHQA 2X23A 1NJGA 3N7AA 3V8BA 2CD7A 1FQJA 4DMUB 3LTNC 4RZ2A 1EP1B 3VJRA 3OE7A 3RR2A 3WK4A 4A3SA 4LRWA 4XOUA 2PL3A 3KSUA 2AI2A 1LWNA 2ZBEA 3C6MA 3PZRA 3OQOA 5HIIA 3RBZA 2GPTA 1ZMXA 1SHUX 4G1MB 4E30A 3HFRA 4DRXB 4HNHA 3SLGA 5JAMA 1L7PA 2IC5A 1PNVA 3DHNA 4E7PA 3NPAA 2GERA 4P8RA 5B3AA 5ICFA 4RIEA 3NVAA 1B1AA 5DYTA 3WTBA 5KC8A 4HDNA 1ZK4A 5KTOA 1P2BA 2X15A 3J7TA 1IZZA 4CG3A 1G55A 4TLEA 1HT2E 1DT3A 2YWCA 1YOVB 1YZLA 4KIWA 2G4CA 1E5VA 4J0GA 4Q1CA 4IIJF 4X5OA 3WA7A 4DA6A 1U6JA 2NXCA 3U56A 3CGWA 5E2BA 1K2VN 4PLCA 1GLVA 4CM8B 3WJ7A 4DTIA 3A25A 3BD8A 4Q15A 3OESA 4ARIA 4MAAA 2R0QC 2XJ9A 2V3CC 3FGNA 1GGKA 3O74A 2VHYA 2OQ2A 1R4MA 3G0GA 4BLPA 3R75A 1G42A 2PZBA 2JASA 4BFWA 2P2LA 2Q7XA 4GS5A 2PZGA 4R71A 4CF5A 4J43A 3COZA 5ITWA 2RGXA 1YHNA 4FLMA 2HRCA 1O7JA 4YEDA 1F7VA 4YBRA 2BHTA 3VC7A 2E9SA 1MXHA 3B60A 1N0IA 3D5EA 3R3WA 4G5YA 4JFAA 4WW0A 3TM5A 4CMEC 4NMHA 3UCEA 2FG7C 4M1MA 4WXPA 3ADKA 2W71A 2G1AA 3IULA 3NM4A 4BO6A 4RHEA 2DT5A 1II9A 1IXSB 2Q5IA 3NYWA 4K3VA 2J09A 4N5IX 5COAA 1Y8QA 3BMNB 3C45A 2QENA 1IM2A 1BGWA 3HYLA 1UKYA 3PFCA 4MUBA 5FUMA 5LNK6 2QLMA 3HC7A 4KO8A 4ZVNA 1PFKA 4NBLA 3K1ZA 4DLWA 4ZO7A 3VAYA 5IVPA 1L7NA 4DDTA 2QNBA 3VGJA 2ZI5A 1R0KA 4TKVB 4YP1A 4ZVTA 4I3HA 1BDHA 3FI9A 3R9KA 3MS4A 2Q3HA 4K40A 1X9HA 3EMKA 3L06A 3OQIA 2C3MA 2QAIA 4L73A 1ORVA 1IY2A 1XMJA 4XWAA 3WIVA 4AW9A 1T1RA 1HYHA 1YRYE 2NLOA 2EX1A 3MJDA 3RAGA 3EWSA 3AKZA 5BT9A 4ZVPA 2B36A 1QCZA 3KL4A 3LY8A 4QHYA 5AICA 3M9LA 4G26A 4PS1A 4TZTA 1RXUA 2BGMA 3W8NA 5KS2A 1YB1A 3R3YA 4YJFA 2ISQA 2OV1A 4DARA 4OSOA 4M0DA 2VJMB 3JQGB 1NLFA 1J23A 1B42A 2OV3A 4HBZA 4H6XA 4IH4A 1PL8A 1XAJA 1PQYA 3LOUA 3AU8A 1U5CA 4ZN6A 3QYAA 4DR5B 2P6OA 4MKIA 2Z8YA 3NASA 4AJ4A 1OBFO 3LBAA 3M81A 3FSGD 4X6UA 3ZK7A 3WZLA 4KQ2A 1SN7A 4F4JA 3GZNA 3P8ZA 4TRRA 3BH7A 2JAUA 1XRLA 2GVZC 3LNTA 1N6NA 1YRLA 5D7NA 2QRGA 1UQUA 1W94A 4BBPA 5HS4A 2PSJA 3IIIA 3GFOA 1PLKA 3ITEA 1G3UA 4YCAA 1M0EA 3RRJA 1ENZA 3ZDRA 4H4EA 4XB1A 1BVHA 5KHAA 1ZNZA 1YZGA 1SCAA 3DHYA 5KAMA 4UUQA 4U8HA 2H2IA 3IQHX 2HIGA 5KNBD 2RH8A 1JEQA 1IH8A 1OLUB 2AWNA 5J5VA 3RU7A 3VMFA 1VCIA 1OIWA 5FUWA 3ZQUA 2QTTA 2WWHA 1Y6JA 2P5UA 4KQHA 2QQEA 3JATB 1EUCB 2Q3MA 4KAXA 4F4DA 5F64A 1W36C 1AKWA 2QD2A 4UFOA 5EZYA 3EDQA 3UW3A 2Q27A 1Q83A 4PFQA 2IK8A 2Z43A 4TKUB 4PAMA 5JDIA 5JZBA 2ODQA 1F8YA 2K2QB 4UATA 5JVDB 1C7ZA 4MV9A 3RFTA 4IRMA 3AGQA 1LCIA 8ABPA 1JAZA 3R6WA 3I2IA 3R7WA 4B9EA 3VKVA 4ZDIA 1UPXA 1TNDA 1TL7C 5A9SA 1Y80A 2FUKA 2QVGA 3QRWA 1QAQA 5HJEA 5ICGA 1IJEA 1YDHA 2ECPA 4MRSA 5I7AA 1T6NA 1Y1QA 3MXOA 4Z1MD 4Q4CA 2BFPA 1CIJA 1S89A 2ERCA 5GJWC 1Z06A 1L7RA 5LR6A 2A3RA 3HL4A 2HMUA 2MMGA 5B3JA 4NSNA 2QGZA 1B4DA 3HA7A 2IV3A 3UJHA 1Z0SA 3JWIA 3EIUA 4JLBA 2J59A 2DFTA 3AETB 3HB7A 3U2QA 3UTCA 4C0KA 1ZCAA 4JFRA 4RK7A 4L85A 4OFXA 1KZ1A 4GL4A 5ALHA 1IBRA 5JAZA 2GXAA 1SOWA 1IBLB 4W5TA 2P6MA 3MMXA 3OD5A 2QRZA 1WXWA 1DADA 5JAQA 3K53A 5DU2A 2OBBA 1KJJA 2OSVA 1GTZA 2PNJA 1QDUA 1QR2A 2LNDA 1NVFA 3VMMA 1BMQA 3NHFA 1MO2A 4IDDA 1VXOA 4RTQA 3E70C 4CHTA 3ZWPA 3IQZA 3ZKWA 4AP9A 3FPEA 5EZQA 2JFPA 1WX1A 3HCAA 4H3VA 4BGVA 3F6RA 4HDMB 5GTDA 3P9SA 4NQZA 4UBOA 5CLQA 2FB9A 1U8YA 4G9EA 3JYQA 1P0PA 4I1IA 4UMEA 3RTAA 1JR3E 3C4QA 3WE7A 4E1VA 3OZIA 3VTFA 5HE9A 5K0LA 4QYIA 1R88A 4NMLA 4MS4B 2H1SA 3MPUA 4IPTA 1ONPA 4G0XA 4TWZA 1RC1A 1W2GA 2RI1A 4RZUA 1NBME 1T9BA 4NNJA 3LCCA 2I5PO 5FKJA 4B2IA 4KL8S 4EK9A 2O8FB 3K0CC 3OETA 1FVOA 4IDNA 5EEGA 1IDOA 2ASEA 2QNIA 3PPWA 4LYEA 4O2RA 1EXWA 5DWQA 5LB4A 2C5GA 1RSZA 3DMTA 5FL7A 3QOXA 2EQ5A 1JQKA 4BBJA 3GDOA 4GSLA 3BJEA 3TLBA 1Q17A 5EWLB 4BVJA 2ROQA 1B2LA 1VBKA 3DCJA 5FUQA 3AKDA 3GJ5A 4J0CA 1QX4A 4D9JA 4DNFA 1BGXT 1TZJA 2NUAB 4QSMA 3KYDB 1EFPB 3FBTA 2DLCX 1WZCA 2WFZA 5DGCA 1RTKA 1U2ZA 4DV6B 1JHXA 1I2DA 2D7JA 2DBQA 3FB4A 1DXHA 3M89A 1NDUA 1YB6A 4UCWA 4CKXA 1K3UB 2VOEA 4Q6BA 4E46A 5MN4A 1LNZA 3IUPA 5EEHA 4MP3A 3ZY6A 8ATCA 2QGFA 2QPOA 1KJIA 2WMNB 5C8YA 3AR3A 1BAPA 4K9RA 1NU6A 4X00A 4D4JA 5A4FS 3W3ZB 2EBUA 3A9UA 1RFGE 5ALDA 3IB6A 5I7RA 4BZZA 1LLUA 3HEAA 5FEMA 3OF2A 4HEHA 1M2KA 1JDNA 1Q7GA 4ZOAA 1ZD3A 1XC7A 2DH5A 2HBQA 5AOCA 1EP9A 2IY7A 4TTRA 4LQ4A 1D2AA 3OTGA 5HBRA 4DAEA 5CEJA 1R2QA 1Z08A 3HMQA 3NKVA 4IIHA 3CRW1 4EYOA 1HE1C 3NIFB 4XX0B 1RQPA 3W90A 4HNUA 1RABA 2YYZA 4KZPA 2JCYA 4EW6A 2XBLA 1PV1A 1YE3A 4YJHB 1NNSA 3LUAA 1LJ8A 5FWNA 1L5NA 4FB4A 2WIFA 1TQ6A 1U2QA 2VH1A 2E5FA 2I99A 1LF5A 5DK4A 2I7TA 2Q6KA 4N12A 4KHPB 3L6OO 4NENA 2ZRIA 5HWSA 1HC7A 2WG0A 1A2QA 4HH3C 2WILA 1Z28A 2WE8A 3E53A 3PNBA 2R6HA 4MVWA 4RGBA 4KWEA 1H2RS 5IAKA 2PUTA 2ZJAA 4K9MA 2IYYA 3LYHA 3IAUA 4L5CA 2X22A 5D01A 4H59A 4RSMA 3MWEA 2DBZA 3MTQA 5HK9A 1ETUA 3PUKA 3B1VA 2PUCA 3ENWA 1OBVA 2CXHA 1ZAKA 3ZCXA 5IC4A 1Q14A 2GK4A 2D5IA 3DMRA 2QJFA 2IODA 1RAIA 1HGXA 3T5AA 1MIOA 5KB3A 1YB5A 4YMIA 1D9ZA 4ETWA 4PYRA 2ZTSA 5BR7A 4XIGS 1SMKA 2FN4A 5F3DA 3W5BA 1QK5A 1DNPA 1MC4A 4GKJB 2PKQO 3RLFA 5AKYA 3PA8A 1CLUA 2AMYA 5H16A 3FNIA 5LQJA 1IVYA 3S44A 3N74A 2O50A 5LYJB 4BGUA 3AILA 1J9GA 4A91A 1QYIA 1D4FA 1ND5A 1EFCA 4BNKA 5I45A 1COWA 3A32A 4Q9DA 3FTFA 1NI4B 2TMKA 4P84A 4WBNF 1RNLA 5DT2A 5AOVA 3L7MA 5TIIA 5KSOA 4OHFA 3RHTA 1ODJA 2JF0A 3PGKA 1X7ZB 2CW5A 3KTAB 3CBGA 4Z3OA 2IE0A 3S2SA 3DFMA 3FPGA 1SPXA 4TS4A 2OP0A 3F5QA 4FBLA 2WSSD 3KBOA 3LM8A 2NG1A 4D3ZA 3CVUA 3PC2A 2BFBB 1CY7A 3WYEA 4LPSA 4BMYA 3IA7A 1KDRA 3E0XA 4HPJB 1T8YA 2XUIA 2CXUA 4KDFA 5G1NA 2VK4A 3FLMA 2XXAA 1G9SA 4I50B 1C7RA 2AE1A 1F9AA 4X90A 4MTCA 4B4WA 3L40A 1ABBA 2O54A 3TB6A 4HF7A 5I47A 5I4BA 4DLSA 4PYMA 4AYWA 4PCVA 2AMFA 1V3UA 2G88A 5AVQA 2JK1A 2UYQA 3K32A 3KSDO 4Q1FA 1KEKA 721PA 3HB1A 4HI0E 2ZS7A 1OFUX 1FBNA 1LLDA 1XLVA 5DP1A 1SRQA 3LLSA 4IJVA 1Q22A 3JZAA 1Z18A 4MJ7A 2FY8A 2YWRA 2DUWA 3VO8A 5ADVA 5K0SA 1JQ5A 2EJCA 1ESDA 1H2BA 1OUMA 2FQWA 1EM8B 3L7AA 5IVDA 3TCXB 4ARBA 1NUHA 1QVZA 2B3DA 1Y5RA 2QP3A 3AWDA 5FTNA 3AIKA 2FEOA 2VPYA 1LI5A 1QP7A 4X71A 2H0QA 5E1OA 2GAFA 3D6TB 3OPQA 2D28C 2P8JA 2AIRA 4PYNA 4UFNA 1T8SA 2BMJA 1XQ9A 1XQWA 3JWEA 1H94A 1QLWA 4DHWA 4J2OA 1CQXA 2P8SA 1XZGA 4GZMA 3LX6A 2P2SA 1JLLB 2OA0A 2ZYIA 3BL8A 3LW7A 4IMIB 4IJMA 2IV2X 3SXUA 421PA 3DBLB 3ZHRA 3TBKA 5LXTA 1BS1A 1DIOB 2HLPA 4YRPA 3ZNOA 5F9HA 5IUNC 1BVUA 1C14A 4ID3A 5TGDA 1MAUA 1QS0B 4IS3A 3L4SO 1DAHA 4ACBA 2FSPA 4F6CA 3FW1A 2KLBA 4ZVOA 2CZQA 2VP9A 4IM7A 3DE1X 1V1MA 5HUJA 2DTDA 1XTKA 2Q9CA 1RBQA 4CMKA 3NIBA 3OKCA 5DXAA 1USVA 3DFZA 2WWGA 3GMTA 2HIAA 4LTMA 4ZODA 5L45A 2O05A 2YYSA 4L08A 5EHXA 3E03A 1CJTC 4EFCA 1WCV1 2UVQA 3I2KA 1TC1A 4KSCA 5H68A 1ZLXA 2V6BA 5LP6B 2HC9A 4C7JA 4FDUA 4E0BA 1CY2A 4N18A 1GUFA 3WWCA 4QBTA 3SXJA 1USGA 3DZKA 2P7IA 3CRZA 3WHLA 1BEZA 2EFEB 1O8CA 4H27A 4D96A 1LX7A 2DU8A 4DR1B 1EWRA 5D1HA 4BQFA 3Q9NA 3UANA 4BRWA 1HT1E 3DO8A 2O5CA 1EJ2A 2IHYA 5DIZA 3CKMA 1XUOA 5CBPA 3THYB 1U2PA 1YO6A 2C2XA 4YAUA 4CM7A 2HW8A 2QRJA 3A6FA 3T9CA 2PUWA 4IEFB 3TKLA 2F3SA 4RJIA 5IJ0A 3HU2A 4O1HA 2EX0A 4FU0A 5AI0A 2QM7A 1SCIA 2H4XA 4MGKR 5G1PA 3T1VA 4OHZA 1LSSA 1QOQB 3OJFA 1OWLA 4OI0A 1IJKA 3CZRA 3PPYA 4NE2A 1VB5A 4DQLA 1GSHA 1IN8A 2G04A 1L4HA 2Z4TA 4M9CA 4OU5A 1IVNA 4NFHA 5CPBA 2YWJA 3WNDA 2FWJA 4OM7A 1MX9A 1GA6A 3ZVLA 2ZRCA 1TM1E 5IKEA 2VCHA 2QTBA 2YS6A 3UK6A 1T9CA 4QUHA 3U37A 5CH3A 4IHJB 2BFEB 2IDJA 2OHOA 2VWHA 3DJYA 2PD4A 2ZUCA 3AFNA 2HDHA 3GI1A 5HCNA 1JEYA 2IJGX 3SSOA 3ZCVA 5BV2P 4XDHA 2EV9A 4BQNA 2YY6A 4RK1A 2P9GA 2Q0QA 2WU8A 3ZZTA 4EPTA 1UZLA 3MN1A 4YRGA 1EBFA 1DAPA 4C6TA 3UUFA 3ZBPA 5D6BA 4BNTA 3JALA 1EEXB 5TSDA 1XZMA 2HA5A 3C0KA 4I6JA 3FF4A 2A14A 3VX3A 3BGOS 3TS1A 1COZA 1BMDA 1XNHA 5IEJA 4DC9A 1F8UA 1QO0D 2QMOA 2ZTHA 2L2QA 4R8LA 4R8MA 3VFDA 1W76A 1KFKB 1W4ZA 2C9BA 3L04A 1UBEA 1Q0QA 2JGIA 3GGJA 4XCQA 5JRDS 4P4NA 1PFQA 2G6TA 1JAYA 4A0QA 3RSLA 4PC6A 1NXPA 3EGIA 2PKQP 3PNPA 2O0HA 2HVGA 1H5UA 3RT1A 4X3OA 2VYFA 1U15A 2YMPA 2YXPX 4H1VA 3NONA 2YOFA 1CNFA 1YI1A 2FWAA 2NOAA 1SZJG 3VHRA 1XBTA 2KBEA 3KQVA 1Z2DA 2IYNA 3OLQA 4OL9A 4QO8A 2E4WA 5CJJA 3SZGA 4QEZA 3VKHA 2DUUA 2YYAA 1PJ8A 2AF4C 4O02B 4B3TB 3VSDA 1XPUA 1AUXA 1C0IA 1YDGA 2RBGA 1FDTA 2ZWAA 1WSDA 1YZKA 2IELA 2W8ZA 2Y1XA 3C74A 3GJYA 2JW5A 4AXXA 3RVQA 3RS5A 1YONA 2JHGA 3A06A 2HJSA 3V55A 3WGOA 1TVKA 1QYWA 3EOZA 2W0SA 4DMFA 2VQEB 1W4RA 4DV2B 1KJ9A 1D5WA 4J2TA 1R3DA 2AC2A 2ZJ6A 5GZ1A 2L18A 5LFAA 2RHHA 3K0FA 1T5BA 1QKKA 1L8OA 4H6PA 4N9QA 4AO8A 4DADA 1M6NA 2WJPA 4DPKA 1NQTA 1VFNA 1YMVA 1OLXB 3T3EA 5DOVA 3QVKA 1QBGA 4UNNA 4B4KA 2GEFA 2AJ8A 1UOOA 5G40A 4UBLA 4F0JA 1NBOA 4F38A 4X66B 1D0VA 1H1LA 1FUPA 2PWYA 4RA6A 3MHPA 1J42A 2P2DA 3OJLA 5M2QA 4CEHA 1RVDA 2H31A 2ODAA 4ZCMA 1Q92A 4BEJA 5LQMA 1HV8A 1M1YE 2A9RA 4FNMA 1WUHS 4FHDA 3WKDA 2WVJA 1CS0B 3A4TA 4IAOA 1SFRA 4RJJA 4E09A 4WVLA 3GLGE 3GUCA 1ZK2A 2VZLA 1QXSA 2R79A 4B34A 5A5GA 1AOXA 1GRNA 4PY2A 5FL3A 1B2RA 3UGJA 4XQEA 2GETA 4LE1A 4BU1A 5C52B 2CBXA 3KUXA 2OAP1 2IYSA 3D02A 4Y7CA 3KKNA 1ZM3A 4Z2AA 1W4LA 4IDGA 1E9DA 4U2GA 2B8NA 4FQ8A 5AUQA 2GYWA 2RG7A 3GQVA 3MMNA 3N7UA 3TOCA 2DECA 2ZE5A 3WBJA 4EEXA 5CXUA 4BNDB 1VI5A 1XLTA 4M7RA 4OP2A 4EFLA 4EPWA 1XKTA 4K81B 4X45A 2H1CA 3TI7A 4NE7A 3H4VA 3WKEA 5TPZA 4AMZA 3LC0A 5GGXA 1XHFA 2PG3A 4DLPA 1KO8A 2IQ5A 2Q2NA 5CVJA 4Z4FA 4M22A 4LECA 2QN1A 4BQOA 1J09A 4PYIA 5FB3A 1QH0A 1FLAA 4PXYA 2O3UA 3HCPA 3CEPB 4D97A 1JR3A 2Q4TA 3A1UA 2MYUA 2WR8A 3P5BA 3WL4A 4IX1A 1B0ZA 4G8CA 2OCLA 3M0EA 4QYMA 3Q3CA 4UU8A 2WOJA 3TZBA 3F9CA 4HUTA 5ITVA 5CCBA 3VNUA 2RJOA 4X7MA 4W5QA 1WO8A 4YALA 4LOJA 1NBMA 4MV4A 2JLYA 3D8BA 4F3TA 3D6JA 4PGGA 2C4NA 4LOLA 1NWCA 4HNAB 2AD5A 1IAQA 3BAZA 5B1IA 1EU1A 2YXNA 3RE1A 1CIPA 3TQTA 3AJRA 2I80A 3E3MA 4NCIA 4NBWA 3PVSA 1E0KA 1XZFA 2IBMA 2C4MA 2PTHA 5JAHA 1X1SA 3M6AA 3I62A 4OH1A 1U02A 1ZOOA 5JWOA 1U5BA 4PLTA 3OY7A 3RT9A 1EX9A 1RXIA 3WLTA 5BSGA 1YZTA 5BNFA 3NIWA 1O96B 1T0UA 1OWMA 1CDEA 1G5QA 3REQA 1URPA 3ZHCA 2C88A 2I29A 5DYYA 1BC5A 2F64A 1YZHA 3DFKA 4P4LA 4K6HA 1WDTA 3VBCA 2BJVA 5HNKA 1JIKA 1W0JD 2HGZA 3ZDBA 4IH1A 1A7JA 5E6SA 1UXJA 3I92A 3UPTA 3PK0A 3GB9A 1A7KA 1ECJA 4F4HA 2Q3EA 2AOXA 3R4VA 4W5NA 1D8TA 5LXTB 1G4AE 2PVCA 1Z37A 3LYUA 3RROA 1Y34E 3KM0A 4RO0A 4I4TF 4OATA 4S1VA 4JT8A 3CUVA 4ABYA 3WLJA 3QVVA 3SC3A 3DL4A 2QTWB 3NHWA 2GBGA 3H6KA 4N5DA 1NW5A 1EK6A 3C3EA 1H42A 1NQUA 1OLOA 2OOSA 4O5AA 3B1FA 3DVQX 1Q95A 1A4UA 1AZLA 1K88A 4UEOA 4MHSA 2WMYA 2OD2A 3HKBB 4N0PA 1NUQA 1G8HA 2L42A 2JFQA 2OPBA 2O06A 2GM4A 2JA2A 3OCVA 2Q5LA 4YXFA 4AY4A 5DOZA 3MTDA 1PGQA 4S1NA 1LC3A 1VHTA 3MCTA 2CLDX 5TVGA 5E7JA 3SVZA 1GRCA 1LRJA 2QD3A 3HYCA 4MYCA 3BE5A 1KAOA 3CZMA 4Z49A 1OIXA 2VCYA 3BE6A 3G8YA 2PWZA 4JP5A 4O3FA 4D4MA 3IIEA 3T7EA 2D0PB 4QXMA 1R8QA 2GNPA 4YRLA 5CM9C 1EFUA 2QRNA 5CPFA 1W93A 4YA6A 2GD0A 1UDRA 3EZGA 3FSGA 3N8IA 3QUCA 5DCLA 5EVJA 3W9YA 1DAFA 5ERYA 1TM2A 1EUYA 4KMRA 1DFGA 2QRUA 2KYRA 3LWNA 3UKJA 1P77A 3UMGA 4TKLA 2Z6UA 2ZQ5A 4HL6A 1A0OA 3TAHA 3WGHA 2FW9A 4FT4A 1ESEA 2IEGA 4PSAA 1HR0B 4GXQA 2G0TA 2D74A 2ICAA 3VYWA 4A5SA 3F90A 1H2AS 3JASA 4N54A 5B55A 4JXKA 5KNDA 3L6UA 5LDGA 4Q02A 1C3VA 1GZ6A 5FUXA 4LFAB 2X4IA 5L51A 1A9YA 4ASUD 2ZRBA 4C1NA 4DV1B 4OLFA 2JEZA 3DDSA 5EJ9A 3W7BA 1JPJA 4NDZA 3IKTA 4F46A 3H9EO 1K4YA 4N6NA 2O3JA 3OM1A 2ZIWB 3LWZA 5JSZA 2PSSA 2VP5A 5KSZA 3KRTA 3K7EA 2WB4A 2VHCA 4ER3A 5JQWA 4X20B 4NS4A 1P0CA 2O23A 4UXHA 1RYMA 3WQBA 4LQCA 3AJ9A 3ZQ4A 1WPQA 4PICA 4DL9A 5L7WA 1ZW6A 3REFA 2QLLA 1WL8A 4ZAYA 1KE2A 3IDQA 4BU0A 5HIAA 2X3UA 4YJGA 4EVQA 2QLTA 2YY7A 3CNEA 2GSDA 3URKA 3FIJA 3VV2A 4URHA 1GAJA 2QSZA 4KQWA 1N4AA 1ZM4A 3FWYA 5AKXA 2MU1A 4B6OA 3DAGA 4RTLA 3UH1A 3FFBA 1NHWA 3LVQE 3D54D 3BSYA 4UW9A 3O7WA 3L8HA 4ZANA 3BXPA 3ZY3A 3PWSA 4AS3A 3C87A 1R9NA 2X0KA 4I1OA 4WKGA 1E0AA 3JQQA 4C0WA 2BHLA 1G66A 1FTGA 3N9IA 1YJ5A 1LH0A 2FZ4A 2W2MA 3FOBA 2GRAA 2ZKIA 1A2KC 1TDJA 3BVPA 2JZCA 3N7TA 3NORA 4ZOBA 3TQSA 4N40A 4E12A 2ZSFA 3GLSA 4FEAA 3I9OA 1NI5A 2A4KA 3BTSA 2QM0A 4MQMA 5E1DA 3VSBA 3JQPA 3O1LA 3AOEA 3VX4A 1M6VA 5FPYA 3ELDA 1K7SN 3GFQA 4MI3A 4JI2B 1N6KA 1SVWA 2V3WA 3O4IA 1DRVA 2BMDA 4LMAA 1QH9A 1KOLA 3A4VA 1II8B 7MDHA 3UUGA 4I66A 3N2GB 2NV2B 2PIAA 2CYCA 1GZ4A 3L4JA 5LWQA 4IW3B 1DKRA 1EE1A 2ZBQA 2ZPTX 5LUAA 2D3TA 4BPBA 1OXUA 4FX5A 5DNWA 1S2NA 4Y0VA 2FW6A 3JWGA 2I1WA 4MRVA 4XSVA 3KPUA 5ALOA 5K8VA 5EKDA 1LDBA 1N75A 5IXJA 2V96A 2RBEA 4LMBA 4ZO6A 1NURA 3Q7TA 4IV8A 2E9FA 1P7VA 2Y3IA 2Q6VA 3KXPA 3BILA 4WGGA 2RHTA 4JCCA 3R8XA 4A23A 5K8LA 4ROTA 3WGNA 4CCSA 4PLHA 3L8MA 3OO0A 3VR6D 1C2TA 2HA0A 4OXIA 1SIOA 2BF7A 1FMCA 5CT6A 4RKYA 4XJSA 3FYUA 3PXUA 2IZOA 4K88A 2V6GA 3AR4A 4FOPA 3LOQA 1W1WA 3FUWA 1W581 3C8DA 2O0JA 2B37A 4I08A 3VKGA 1TRHA 3PFNA 1M0SA 5AKZA 1E96A 3E58A 2R3SA 1ZISA 5GONA 2O2HA 3CFYA 2QM8A 3GA5A 4W99A 1IK6A 3O9MA 4WESA 4WY5A 4KXLA 1AB6A 3Q0TA 3QG5A 3TRIA 4KLCA 1KEVA 1V9SA 4N5LA 1NQVA 4B32A 1UXKA 4G0WA 2GHTA 4ED9A 1ZH8A 1FFAA 2I6TA 4KH0A 3QKRB 2GNOA 3MGBA 1HNNA 1TLTA 1R8SA 2P5YA 2RGEA 4JYBA 4NBSA 4Q03A 4BYMA 2EVWX 2G1UA 3DVAA 5HKOA 1UZAA 4R2KA 3S6JA 4RKEA 5EUQB 3IR6A 3NAQA 1ZJYA 2YBDA 3ONVA 1R0RE 1NE2A 2BZSA 2CFRA 3GMIA 3RJTA 4DLXA 4CKZA 2DERA 3U4DA 3VPXA 4UC0A 4WJZA 1VP3A 4WDQA 2RJ3A 1T43A 3JYOA 4ZQIA 5BRAA 4OYYA 5A6VA 1T3ZA 2Z57A 1T5LA 4REQA 2RHMA 3VDRA 3WK5A 1KWKA 5E9AA 10MHA 4TQ9A 4ZYZA 2PUAA 3E5MA 1P6UA 2O20A 2ERYA 2V55B 4UMDA 4W8OA 1JT9A 1M8GA 3WBFA 2WSLA 1UOEA 1ML4A 1IN6A 3GUUA 4OUDB 4BQRA 3QXHA 1TQDA 2HPHA 3LYLA 1ZONA 3PD1A 4WECA 3QELA 2VZ8A 2A0FA 3LKBA 3UT0A 1YTUA 3M9XA 3TKYA 1RJEA 3I04M 2WKSA 1XU7A 3BPSA 3NHBA 1CZHA 3Q40A 1L5HA 1N2IA 1OCEA 2PX8A 4KJXA 3UT5A 3K2BA 4S04A 5JIBA 1XRJA 3PGLA 3TQIA 1YQUA 1AUWA 3EOAI 4GX0A 2DKFA 3R5SA 4RTRA 1KMHA 2F55A 1J2JA 3WKAA 2Q50A 1G1MA 2V5VA 1J2UA 2XLCA 1PZFA 3GT3A 3H5TA 4YJ3A 5G0WA 5AJVB 2MMCA 4U0KA 1E89A 3N0WA 1IZ7A 1O9GA 4EF6A 1KZ7B 2ERXA 3L8EA 3N3AC 2CN1A 2AQHA 4CUJA 1Q6YA 1M1ZA 4L8YA 4S3MA 1SC9A 4WNCA 4NZOA 2DSNA 3DDUA 2ZAOA 4AY5A 4TYWA 2C2GA 4QGGA 1ZA1A 5B6IA 2WAXA 3F5FA 1D3AA 4MKRA 4DBLC 4FZ3A 5BUQA 5AM0A 3L6DA 3PQ7A 5G0VA 3UNXA 2OCGA 1TGVA 3F1KA 4BHTA 2WTNA 3LPLA 3F5SA 1DTSA 4RE6A 3WLOA 1FSZA 4UTOA 1OF1A 1IWPB 1UPFA 5IDXA 3KEQA 3PC8A 2QZ9A 1O9HA 2R7LA 3F7OA 1J49A 3D8RA 1ZC4A 2PNFA 1Y8RB 4E33A 3WIDA 4AYXA 4J1SA 4YJ2A 4JCOA 3QLJA 3CF2A 1KI7A 1KYZA 1KP9A 3KJZA 4TXMA 3QU4A 3I28A 4M99A 1JAXA 2IOHA 4BRSA 1E1KA 1EK0A 2BV3A 4MR7B 3CONA 5FOSA 2PXCA 3Q0EA 4E22A 3A6PC 5B4UA 1WDMA 1J2TA 3BHIA 1E7WA 1JTVA 1N5DA 3NUZA 2P3OA 3AF2A 1SBHA 5G02A 4YCLA 3ZWCA 1S96A 3A6GA 3KQSA 3H87A 2JKZA 5F7ZA 1XPJA 2HLNA 3GLHB 5J59A 5IUJC 4JNKA 5A1TA 4I5EA 1B43A 1QG6A 2PX0A 4RETA 3AJ8A 5ALPA 1ZFNA 2FQYA 5JAOA 2CJPA 2XQJA 2G7MC 3T99A 3UJDA 5C3MA 1M1YA 2AXQA 2UUCB 1NTRA 3C3MA 3NWPA 3EUAA 5KX5F 2H65A 4EI2A 1U8XX 5GWXA 2J46A 3NEJA 3U7RA 2ZE6A 4FFMA 4FGUA 4V24A 1EB8A 2B5WA 5IDWA 2AQKA 3UF0A 3GLGA 2BDEA 5AJXA 4B73A 2GOYA 2C0QA 1MTOA 5IARA 1GTRA 3VC3A 1WP4A 2EW1A 3COVA 3UMFA 4KFTA 1M76A 2OECA 2OENG 5F9MA 3VJLA 3MCWA 2DBVO 2R6AA 5IK2D 4J6EA 2YY5A 3IESA 1NR1A 3P2MA 1W5FA 4WFJA 5KYYA 1A8HA 2W6NA 1ZZGA 3P27A 4NDAA 4EYEA 3E81A 3CWZA 3SN6A 1XZBA 2OYRA 3KPYA 1QHSA 1JHUA 2N75A 3ZBUA 4U6QA 1I7LA 1PWZA 4CKWA 1R6XA 1DS6A 3QKTA 4I6GA 3KYIB 4BP1A 1CUFA 1XZEA 5BXYA 1E6UA 2E4AA 1ZSVA 4CIVA 4A15A 3EGCA 3DLAA 3Q10A 1GUBA 4IFBA 3PQCA 2YHAA 4IDOA 3CUWA 4WBNB 3F73A 2R8PA 1E77A 1T0HB 1CTQA 4FKZA 1NUTA 2OWEA 3MLAA 4NU6A 4Z4EA 3FTQA 1E20A 3VXKA 3VR4A 1H9BA 4RZXA 4UE2A 1C0LA 3ETEA 3QU2A 3UJNA 4WMLA 4W1SA 3RTDA 3K1YA 3OZVA 1NW9B 2OCYC 1S2LA 2C4HA 3MYRA 3M4ZA 4J16A 4NYJR 5ELLA 1U28C 2PXAA 2JI8A 3T35A 5JH7B 5JSUA 1XPRA 4YP6A 1ZJ5A 1VYVA 3GXOA 3T06B 3VZQA 1W49A 3HA2A 3KKZA 1UBRS 4NG5A 4JVSB 3U09A 1FLNA 3IUEA 4MB2A 2WHXA 2HA3A 2BJWA 2RGBA 5EP1A 3CPEA 3CCFA 1F0NA 1YBAA 3C8MA 2DOKA 5FPSA 2ZRKA 5KKCA 2CNLA 2MYPA 4I0WB 2HSGA 5FBKA 1KP3A 1IJBA 4W9MC 3GD5A 2RK3A 1ZINA 1C7IA 2X2EA 3AEUB 1HMPA 1MA0A 3KJHA 4QPDA 3EZ9A 4R1SA 2BEVA 2VEDA 5J9FA 2QJRA 3JD3A 5JV5A 3GJTA 4WKPA 1ZAYA 3NALA 4GSYA 3TJZA 2NGRA 3CEMA 4EH1A 4F5YA 3FNEA 5BXQC 3WGJA 5KTMA 5LJIA 4MDYA 4O8CA 2Y1GA 5K3FB 2AB0A 1J56A 4LYAA 4LG1A 3GG2A 4IXDA 5SYMA 4YV2A 3WLIA 5MGNA 1W7AA 3GJRA 3N28A 5HG0A 4RADA 3EVNA 1UC4B 4FOSA 1ZG3A 1FUEA 4XH9B 1AO0A 1SQGA 4FXOA 4LVCA 4MKGA 3JVDA 2EERA 4AXBA 3DA8A 1MAVA 1L5WA 1SCNE 3P19A 4E13A 1XTJA 2AC7A 4YMHA 1MJGM 4CN9A 4C3ZA 5CFPA 3R3VA 2H1RA 1VLLA 3E4DA 3OY2A 3CTPA 4BN5A 3UAOA 1E1MA 1D7AA 2P79A 4LWZA 4J91A 4RJKA 3UG6A 5KU1A 3AESA 4JROA 3QMWA 3V4PB 5L4SA 1J5XA 2TMGA 4LCJA 1NW4A 4XM2A 1ES9A 1T3HA 1WPRA 2BFNA 2BUCA 2V5UA 4IDQA 3C1OA 1W5AA 3H2ZA 3OUTA 1ENPA 3TR5A 2VNKA 1ZIOA 1BCSB 3B3GA 5JANA 2ALJA 3E84A 3GN1A 1V9LA 5LNK1 4E51A 4HN4B 3QLUA 4EGFA 4JB0A 2UDPA 4OF4A 1OXSC 1U8UA 4ZKEA 2FVXA 1NU8A 3DZCA 3MS7A 4JT2A 4KK3A 2BEUA 2HY7A 3JY6A 2A2ZA 4AUMA 3WBBA 4DSOA 1CNEA 3V3KA 2R6ZA 1QP0A 2B2XA 3SIPA 3DNMA 3EIEA 1OREA 2DCUA 4F5WA 4G1UC 4RJTA 2DT8A 5BN1A