1Z4KA

Structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with thymidine 3'-monophosphate
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
194
structure length
194
Chain Sequence
RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase
publication title Structural basis for substrate specificity of the human mitochondrial deoxyribonucleotidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 65
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1z4kA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4kA01
1L8LA 1EK1A 4UMFA 2OM6A 1NNLA 4KX5A 5AI6A 2IOHA 5AVVA 1T9ZA 3I6BA 4HGQA 1Z4PX 3QUTA 4FYPA 4OHFA 1Z4OA 1IWOA 1SWVA 1VJRA 2EATA 1RKQA 1QQ5A 1S8OA 2ZBFA 3W5BA 1O03A 5AI5A 4NWIA 2Q5EA 4L57A 2IOFK 1Q91A 3B9BA 5AM4A 1WVIA 3CNHA 2JAUA 2FPXA 5ALQA 1YJ5A 5ALWA 2YJ5A 3IRUA 2WF9A 1L7OA 3U7FB 2I6XA 1WPGA 1RC8A 1ZS9A 5AM0A 3AR5A 2WFAA 3OCVA 3E58A 5ALVA 4UMDA 2ZBGA 4BX0A 2I54A 2YMMA 3E81A 3L8GA 5AIAA 1S2OA 2YMLA 3QX7A 2YJ6A 2JAWA 2W43A 4G9BA 4JDPA 1SWWA 1ZOLA 2P11A 4CF5A 1MH9A 5ALLA 4J03A 2JARA 1RMQA 4OD0A 4UMEA 1JUDA 3DDHA 1WR8A 2HHLA 1ZD5A 4UM5A 3W5CA 2FPRA 3SKXA 5ALTA 2HCFA 1QQ6A 1RKVA 1TJ4A 2YJ3A 4NAVA 3IB6A 3J7TA 1Z4NA 1ZJJA 5ALDA 3A1DA 1YMQA 3QYPA 2HO4A 3GYGA 2G0AA 2HDOA 3U7GA 1RQNA 2GHQA 1CQZA 4Y2VA 4HGPA 4UU1A 4C4TA 4CF3A 1T5TA 3KBBA 5AK6A 1Z4LA 4BKMA 1SU4A 3KOOA 3OCZA 1RQLA 4NV0A 3L1VA 3OPXA 2JGAA 2O2XA 3F9RA 2FPSA 1Z4QA 1NF2A 3L8FA 3ZX4A 4YIKA 1WZCA 4XQ0A 4BX2A 5A3QA 4UW9A 5AM2A 2FPUA 1F5SA 1EK2A 4CF4A 3L5KA 2AMYA 5A3RA 3NAMA 1XP5A 3I28A 5AW4A 5AVSA 4E88A 2CFRA 3WK9A 3BWVA 1Z4KA 4XOUA 3ZTWA 1XVIA 5IT0A 4NFLA 2WF8A 4UAVA 3NUQA 4B6JA 5AW9A 4L6AA 3D6JA 2HSZA 2X4DA 3R09A 3AR6A 2FPWA 3OTQA 2PKEA 1XPJA 4I9GA 1QH9A 3MN1A 3A1EA 3M1YA 5AKXA 5AK3A 5AKEA 4MWOA 2AUTA 2I55A 2P27A 5ALKA 5AW1A 3DAOA 5AW3A 2R8YA 4XE5A 3U26A 3PCTA 2YMPA 4JB3A 3OCXA 3R4CA 2AH5A 3AR4A 1L7NA 3OCUA 5AKIA 2GFHA 1TJ5A 5AK5A 3ZVLA 1ZRMA 2ZOSA 2FI1A 2G06A 3QXGA 4UMVA 4ZEXA 4H1WA 3UMBA 3VAYA 1L7MA 1KYTA 3A1CA 1Y8AA 3MMZA 5AM5A 4Y2UA 1U7OA 3QUQA 3ET5A 5T41A 2YY6A 2B1RA 2C8LA 3MC1A 3B8EA 2YMQA 3U19A 4Y2QA 2W4MA 5AKJA 2BDUA 2HF2A 2IA5A 1RLOA 3WK5A 5AKYA 1ZD2P 5AVWA 5AW2A 1YS9A 1Z4IA 5AESA 2C4NA 2C9MA 3N8GA 5AKHA 5ALGA 5ALSA 1J8DA 2WF6A 3WGVA 1Z88A 2GO7A 1RLMA 2NYVA 3E8MA 3WK6A 3WGUA 5AVTA 3PDWA 3EF0A 3ZWDA 2FDRA 4DWOA 3EPRA 1J97A 4RETA 4KX3A 3QLEA 4BEVA 5AW0A 2OYCA 3ZTYA 4ZEVA 5AI8A 3UM9A 2EARA 5ALOA 1Z4JA 1QYIA 5ALHA 3AR9A 1YDFA 5AKLA 1NRWA 1U2TA 3SF0A 2B30A 2DQSA 2WM8A 3ESRA 4Y2YA 5ALFA 3ZVMA 5ALUA 4YCMA 2RAVA 3W5DA 3ZUPA 3ZVNA 4HYTA 4YCLA 3L8EA 3QU4A 4EENA 5ALMA 4MUMA 1LVHA 2P69A 4XPZA 5AVQA 3WK4A 3QUBA 5AKKA 4BNDB 5IT4A 2I33A 4Y3UA 3UMGA 3U7EB 1RMTA 2CN1A 3CZ4A 4YH1A 3L0CA 4L6CA 2G09A 2FUCA 3NRJA 3NANA 4GIBA 3N28A 5AI0A 3SKYA 4DW8A 3WK8A 3M9LA 3EWIA 4Y2XA 2Q4TA 1ZD3A 2NO5A 2I34A 3EF1A 3QU5A 4BNDA 3KD3A 4PNHA 2O9JA 3A3YA 2BY4A 5AIBA 1QQ7A 3ONNA 4EX6A 4C4SA 2WHEA 5ALNA 1T5SA 2FUEA 2HI0A 4UARA 3N07A 3FGOA 4KNVA 3AR2A 3R9KA 2YJ4A 2CFTA 3WKAA 4HAIA 4BEWA 1L6RA 3WK7A 1RLTA 2GHTA 4UM7A 2ZBDA 3WKCA 2HOQA 3L1UA 5A3SA 4DFDA 1PW5A 3L0BA 4F72A 2RB5A 4AS2A 4QJBA 5ALPA 4EZEA 2PQ0A 5JJBA 4BX3A 3OCYA 3N1UA 3I76A 4AS3A 1TJ3A 2MU1A 3WKDA 3TLMA 3WKEA 3ZI4A 1RDFA 4J2TA 4AP9A 3W5AA 5ALEA 3QUCA 1ZRNA 4UU0A 2OA0A 2QLTA 5AVYA 2QYHA 4EELA 4EX7A 3BA6A 4BYGA 3AR7A 3SHQA 3ZW7A 5AK4A 5AICA 4I9FA 2HX1A 2R8XA 3N5KA 2AGVA 3SMVA 4O8CA 2R8EA 3QU2A 5AKGA 5AW7A 1VJ5A 2NO4A 1YV9A 3SD7A 3AR8A 2ZBEA 2C88A 3L8HA 3I1YA 4KNWA 5ALJA 3IJ5A 2I7DA 5AKZA 3HLTA 1RPZA 4KYTA 5ALZA 2B8JA 1Z5GA 3RFUA 4IG4A 2RBKA 3FM9A 2WF5A 3QU7A 4F71A 2R8ZA 1X42A 3ZWKA 1Z4MA 4ZEWA 1K1EA 5IS2A 3E84A 3S6JA 3FPBA 2B1QA 2YBDA 3OCWA 4FFDA 2Q4RA 5AI4A 4YCNA 3QNMA 2WF7A 3QGMA 4C4RA 3DNPA 3ZX5A 2B8EA 5ALRA 2G07A 4NABA 2B82A 4DCCA 3MPOA 4OFZA 4UAUA 3SLRA 3AR3A 4Y2TA 3L7YA 4BBJA 2HEGA 1FEZA 2G08A 4Y2PA 4GXTA 1LTQA 5AHXA 2ZG6A 3ESQA 3KDPA 3L0YA 3PGVA 1Z5UA 3P96A 1O08A 3DV9A 3KZXA 4IFTA 1YNSA 2P9JA 4Y2JA 2ODAA 2VKQA 4Y2RA 3UMCA 5AW8A 5AW5A 4HGRA 4UATA 3WKBA 4YGYA 2GMWA 3PGLA 2JAOA 2D2VA 5FP0A 5AI9A 1RRCA 2G1AA 2YFYA 4CE6A 5AVZA 3RF6A 3NASA 1U7PA 2OBBA 1RMYA 4HGNA 5ALXA 3NIWA 3FPSA 3B9RA 4KN8A 2RARA 5E0OA 2BDEA 2G80A 4OCZA 2IYEA 4Y2SA 5AM1A 1U02A 3ZU6A 2HF7A 2MSNA 3QU9A 4FE3A 1TA0A 4G63A 1L8OA 5AVUA 3ET4A 1AQ6A 5ALIA 4CNQA 1CR6A 3FVVA 1U2SA 5AVXA 3ED5A 1N9KA 1TE2A 2B0CA 5AW6A 4RESA 1L7PA 4QQFA 1Q92A 2EAUA 1N8NA 1RKUA 5AM3A 3U13A 2PR7A 2YN4A 4HGOA 5ALYA 3FZQA 4EEKA 3K1ZA 2IOFA 2W11A 2ZXEA 4YIHA 1ZD4A 3HYCA 3KC2A 4UASA 2FEAA 5AVRA 3U7HB 2CFSA 3NALA 2C8KA 1VFPA
chains in the Genus database with same CATH superfamily
1KL7A 2IYVA 1EFCA 2GDZA 2Z57A 3GT4A 1Q7GA 1ZOSA 2OM6A 4KGZA 3L9WA 4M1ZA 3I5AA 2BGGA 3B6KA 2I7TA 1J49A 1XTTA 2ALJA 1TYCA 4WLFA 2Q2WA 1DBWA 4DXDA 2J8ZA 5K05A 1AMNA 2HGZA 1DSSG 1M3SA 2W2PA 2A0YA 3JQ8A 3COWA 3REFA 2ZT7A 3CEHA 3QWBA 1CK4A 1W8DA 2R6AA 4K1XA 4RMIA 2HJ9A 1KMMA 3ZV3A 4B4WA 4F4FA 1WCV1 3OLYA 1WW2A 4ER6A 4HPXB 4EMSA 4QQKA 4F46A 1IIBA 3G89A 3DMFA 1IWOA 4FHFA 1CLEA 3TZ6A 2BDTA 2OAQ1 3WLOA 5TIIA 4JBXA 2YRWA 2D3TA 3G8CA 1RXUA 1SCIA 4TLAA 3KSMA 1ZGHA 4DMMA 4B44A 4LHXA 5HQTA 4FHEA 1CETA 1ZC4A 4MI9A 3VR2A 1I01A 1AF4A 2QMYA 4L57A 1I24A 1Q91A 1E96A 2PY6A 3FMFA 4KQCA 3B9BA 4M76B 3RVRA 3T0IA 1IJBA 3HA2A 4Z2AA 4H1UA 4B79A 3GLIA 2IITA 1UBFA 5E3JA 4GRAA 1EFKA 3G8BA 1WW3A 3AEUA 5ALQA 3R9XA 1UIMA 3PDIA 4DN6A 3VJRA 5G1PA 2GBCA 1GQYA 3IRUA 1RRGA 1DO0A 3IP6A 3O38A 4R0VA 4WACA 1DNPA 2OE2A 4M87A 1MH1A 4IIJA 2W2VA 4NYMR 2W83A 3ED1A 3OP1A 1I0AA 5LKRA 2V5VA 1FUEA 4MTLA 1Z5NA 4Q4DA 2I7CA 2F2TA 2J5KA 2V5UA 2J3KA 2W6MA 3VTAA 2C3MA 3FMVA 3X1MA 3VYUB 2OHOA 1SIWA 5G0SA 1U0NA 5K0JA 2QM3A 3NHAA 4QUKA 3W78A 5E6RA 4YRPA 4BX0A 2JA2A 4AK9A 2L2QA 3BGOS 1DADA 3EXHC 4BASA 3LKDA 4IH1A 1F6BA 3H3FA 3HMQA 1D5WA 1VG1A 3P5BA 4HQNA 2WZBA 4TQGA 3HWRA 1N8SA 3WWEA 4ALMA 4KO1S 4ZCSA 2GB4A 3WRWA 1VL2A 1U6JA 2PSDA 3ZU5A 2JGDA 1TU3A 1RMQA 1RCTE 2AC2A 2DH5A 2NNLD 3I6QA 3SC6A 3PEVA 3W3ZB 2VSYA 2ODTX 1PU2A 1XBTA 3KX2A 2W2LA 4OQXA 3V8BA 3CNNA 1T2VA 1X7YA 4PLHA 2QEQA 4U2DA 4J4TA 4CHGA 1C8BA 4FCVA 1DMRA 5LP6C 3E3LA 4JGGA 1P61B 1E5QA 3DLTA 4MRMB 2QORA 4QXRA 5EP3A 3RHZA 2AVNA 2XCOA 4RTKA 1E2MA 3LFUA 3W5HA 1E4YA 2ZPAA 4RAOA 2QRMA 3RSFA 1CR2A 4J0FA 1QP8A 3AF5A 4D2IA 5JZBA 1D6NA 2QMZA 3D3NA 5DSZA 3A6JA 5G0TA 3GN1A 1NZDA 1I14A 4JJ7A 3MTAA 1N5LA 1JG6A 1CQZA 4L6IA 3KAJA 3VH3A 1YKFA 3TB4A 1J20A 5AK6A 3V9PA 3AUXA 4HGZA 1DQRA 3OCZA 5LA6B 4C14A 4NKRA 5AYVA 3K8ZA 2KW5A 5BNZA 4GQBA 2NACA 2Q6LA 5EXEA 2FEKA 5K3OA 2WWYA 1DINA 4FT2A 5JTUA 3BDVA 3D6HA 3IO5A 1PLKA 1SG9A 3T9FA 4P92A 1ECPA 2QB5A 4H16A 3BMCA 3PT5A 1G3UA 1GQOA 4O4HF 4Q3LA 4E4TA 4B2PA 5AM2A 4BVFA 2FWAA 1FXWF 2HY7A 3WRYA 4CF4A 4DGSA 1KOGA 3BSSA 3T5CA 5L7YA 3WMEA 1L4MA 3EDQA 5A3RA 1R4NA 2AYZA 2ZUUA 2ZR9A 3WYFA 1DCNA 4ZZIA 3JD3A 3BWVA 2OAEA 1UKZA 1MT3A 4EJ6A 3H9QA 2ATCA 4LE2A 2CNBA 5K1ZA 4BNZA 3FCUB 2AN9A 4DNPA 4PN3A 1XMOB 2QBYA 2MHCA 1D9ZA 1OW3B 2ZXFA 3LWDA 4KFSA 4WKPA 1ZKMA 4ID3A 3BIOA 3HK2A 3N8DA 3DT9A 2C4HA 3DLHA 3GEGA 1F2TB 3BJRA 2OV3A 5CVEA 5GGYA 3ZK8A 5C32A 1C7ZA 2D62A 2P3LA 1Q3KA 2Q1XA 2WVGA 4EUNA 4IGAA 4FYJA 3WYCA 2KBEA 1XCLA 2O1WA 4H0CA 1MG5A 2P4UA 2V0GA 1XHLA 4M46A 1XDSA 3WMRA 5LXTF 3OCXA 1Z6PA 1W581 1R9NA 4DR7B 1PEYA 1JB1A 4LE1A 1JE1A 5CA0A 4ESOA 2Y68A 1Q14A 1AKRA 1BO6A 3DG9A 5F73A 3TAHA 3QY0A 2V7WA 3T1QA 3T3HA 5CVTA 5JC8A 5TLSA 1N6LA 4R16A 3WBJA 5B53A 1UMKA 4UQOA 2Z0MA 1F5NA 4U7HA 3WZLA 1FVXA 1TJ5A 2JAQA 3CC8A 3AYZB 3RGGA 4B33A 3GQBA 3PFNA 5REQB 3ZJUA 3JQAA 4P7FA 1WIWA 3KQMA 4QPNA 2R6JA 3M2PA 1Z8NA 5ENZA 4QUHA 3R76A 2GN9A 4Y2GA 1LSJA 4X94A 5ARCA 2H92A 4C29A 1VI2A 4EO4A 3VKUA 1XMQB 4GP6A 3OCFA 1DAGA 1U65A 3EIXA 2BGTA 4IKOA 1P1HA 2RGRA 1PS8A 2W4MA 4I4CA 5LPNA 3LT0A 3K96A 3TX2A 3ZV5A 1KFCB 3MOIA 3RYFB 2HA7A 3LSTA 3EXG1 3KFLA 3GPLA 1UKAA 4QU8A 2PGXA 4Q4LA 5KAMA 4I99A 4NEGA 2YNMC 2FSFA 3A05A 2CDNA 2FW7A 3B1YA 3HP7A 3K1AB 1J7JA 1M34E 4MWGA 2WF6A 4AU1A 4DF3A 4R1LA 1NM5C 2VZEA 4CCSA 5J4KA 2MCFA 1PX2A 4FYKA 2VP2A 3NGLA 1BJRE 2E87A 3LKZA 3OT5A 3ZHCA 4BUJA 2X77A 4BO0A 3HUTA 4MCHA 2VZLA 1BW9B 4OHBA 3DOEA 4BEVA 4FYWA 4YVFA 3O47A 2KLHA 1VC2A 3ZHRA 1AB5A 1I2ZA 5AJWA 5ERYA 1JWAB 1I36A 1WV0A 2YVUA 5DWVA 5FYDA 3U7QB 1DI0A 4ZI7F 3LBFA 3UN1A 4J1TA 1D4ZA 3DNFA 4ZT6A 1TAQA 1TFRA 1XD9A 3FJYA 5E1MA 1SXJE 2FE1A 2UYCA 4FILA 3DEAA 3DR3A 2YVAA 2QLNA 3EIEA 2H1WA 1YB7A 2G7ZA 2OO5A 1UEJA 1RWMA 1BMFA 1XZCA 3DDWA 1MR3F 3EEQA 4JJEA 3RSSA 4MS1A 3CH4B 4W82A 1VKOA 4NMWA 5IM4F 2P6UA 5A1JA 4IV8A 4RZIA 5FXMA 1CY0A 3O3MB 5JG7A 4DJFC 4JS0A 1AQUA 3BSWA 1ZP6A 1Z5ZA 4F5WA 1LDNA 1V26A 4X62B 2QT1A 1OBHA 2CL6X 5KNCH 2XNDA 4Y3UA 1YB6A 2WYOA 3UMGA 2HIMA 3ECCA 5EQTA 4W7SA 1Q0UA 1T9DA 1OBVA 2BM1A 3ZGYA 3D0RA 1LB1B 1PL8A 3K71B 4PPQA 4CTKA 2VJLA 2GF9A 3G0CA 5BYKA 5LDHA 1YFEA 1FYXA 2AQHA 1DBRA 2G09A 4R01A 2PSFA 1KP3A 1YZYA 2DSTA 3ZWVA 3BREA 3N28A 4RTQA 1F2UB 4CEHA 2QAGA 4BMXA 1LK0A 4Y2XA 3EYWA 3INNA 3T38A 2QMQA 3IO3A 3AZPA 1LW7A 3EF1A 1IFXA 2XV1A 4A10A 3W2IA 3V8RA 3U7IA 2BY4A 1L3BA 1H5QA 1KZHA 3ONVA 3ONNA 1U3DA 5BMVF 2RHLA 2IF2A 4TRMA 4OVKA 2Q7OE 3ZHUA 1OUMA 3UUGA 1GV1A 3SQXA 1K2VN 3OF3A 4PWZA 4Y1FA 1HF3A 2ZRBA 3DTVA 3I92A 13PKA 1S4MA 1YCFA 3L4KA 3AVXA 4UUAA 3BXGA 3OX3A 2B9EA 4ARAA 3OQMA 1L3CA 3AL0C 2IPNA 3IH5A 3WNCA 4CYMA 1H22A 3PZBA 5FOQA 3S8EA 3P4XA 4Y0VA 2IH5A 4WLVA 3UAXA 2PD6A 1T3SA 2V45A 4I1VA 3JWPA 3L1KA 3JZFA 2C5LA 3ONFA 1CUEA 1QKKA 1YAJA 2XD9A 4F72A 1ACLA 2X8AA 2E5LB 2FLVA 3KOMA 4AS2A 3AUUA 3QUSA 5ALPA 2F00A 1NBEA 1NXPA 5B58T 3HTXA 4BX3A 1L6IA 2BRUA 3DFZA 4HQFA 4OBEA 5EJAA 2DPYA 3GNTA 4LYFA 4PE5B 2HK9A 4KK4A 1O9GA 2WG0A 2QW1A 1TJ3A 3ICWA 3TLKA 4ARSA 3OKPA 1R6BX 4BB0A 4KODA 4CG2A 1TGYA 3ACDA 1TMKA 3NM5A 1GPMA 2HF9A 2XRYA 2B9VA 1JI3A 2F1OA 1POWA 4OHXA 1T5DX 1C3LA 2I87A 2PNFA 1JHOA 1JPUA 1NVWQ 1QGAA 2GEVA 1Z22A 2VEOA 2XH8A 4D3FA 3MAAC 3EZYA 4F91B 4FI3C 4O5OA 4TRRA 3Q7SA 3I1JA 2YFHA 3I23A 4K7JA 1E79A 3HHPA 2V6IA 4J8PA 3AR7A 4DV2B 1SD2A 1JB9A 1NDHA 2HEIA 2ISQA 3JARA 5FWXA 1MO2A 1O8CA 1PDVA 1WHSA 2IUFA 5COAA 3PUKA 2V74B 4RFSB 4YCAA 1AKUA 2FZWA 4G5RA 2RHHA 3C43A 2RI1A 1JQLB 1E3TA 1TF7A 1O94D 4WJZA 4OXQA 3ZE0B 1ECGA 3WWYA 4QTZA 2MYNA 1Q6ZA 3QU2A 5HS6A 4FMBB 2QYOA 2PEYA 1BXKA 5FNVF 4CMEA 3LT1A 3S70A 3GJYA 4PPGA 4INOA 3COZA 3GV0A 3ZH9B 1L7XA 1PJ8A 1GPUA 3AR8A 2H4HA 3N2GB 5KNLA 1YCGA 1G1MA 2IS1A 1AX9A 1I3LA 2OZEA 3M6LA 4HWTA 1GL7A 3VJMA 1DAKA 2PKRA 3IJRA 3HC7A 2IBSA 3N75A 1T2EA 4NYIR 2PKWA 2YOHA 3SZGA 4KYTA 5CLQA 4C7JA 3MINA 1IOVA 4LJRA 5AOCA 1XC7A 2FX5A 3MILA 1M2KA 3QLVA 3V7NA 2H54A 2Q99A 4L0QA 4QVIA 2JIZA 4OQQA 1BKDR 1DG9A 2W98A 5AUPB 1YHZA 4B31A 2HF8A 2XYGA 5EP2A 2IXDA 1CZLA 2HMTA 2VJQA 1X42A 1ARZA 5F52A 3UMRA 3H2BA 4D9CA 3GVXA 4KXYA 2H4XA 2LDXA 3LBYA 4P2GA 3B3JA 4NV1A 1FTYA 1K1EA 5AT1A 1GG9A 3WQSB 2QGZA 1RZRD 1DDIA 1FCJA 2E37A 2FPIB 2V6MA 1V39A 1X77A 5G1OA 4A0SA 2GK7A 3F4RA 4O29A 2COUA 4BMZA 4CUZA 2OVFA 3T7KA 4B73A 2B8EA 2VHZA 4WLNA 1N5DA 2Q9AA 3KKOA 2IPAB 4BN5A 1MQ9A 4DSUA 3OCCA 2H07A 4QUGA 2B7LA 1WVMA 3I6ZA 3QW4B 3MNFA 4B6FA 2FUSA 3CVJA 2TYSB 2J87A 2FFRA 4QAQA 5CBPB 1OLOA 3G1WA 5FX2A 3ROMA 1E7MA 1I2DA 1D6JA 2POCA 4GXTA 1HTBA 1XK6A 2ZR7A 1HRKA 3G9XA 1HDCA 3ZW9A 1KKMA 1NAHA 3D59A 1BFKA 2WHPB 3L4JA 3FHLA 4TVKA 1QIHA 2BEVA 2QTAA 3K5PA 1QOQB 1XMVA 1YNSA 4L9WA 4PQYA 5K45A 1C30B 2OQIA 3CWCA 3RC8A 1SPXA 3SDZA 1MQAA 2VRWA 2YICA 3BWDD 3DQZA 3NBZC 3NIGB 1D2CA 4GP9A 4MZDA 4V0ME 1WX1A 1DEHA 1Q95A 3TLCA 4X20B 4CWAA 2OZVA 3NBUA 4UCFA 3R3ZA 1I51A 5DLDA 1GTZA 4K46A 5EERA 1EQ2A 4A6PA 2IZ1A 2OTCA 5KBYA 3QVLA 4CLHA 1UBJS 2HXSA 4MKGA 1NT2A 3OJLA 1HY3A 1THMA 3E0QA 2PMEA 3GEMA 4ZVRA 3U4GA 3WNQA 4D0SA 4YGXB 1RJ9B 2BDEA 5FL3A 3P2MA 1G2PA 3QM1A 1LW6E 4JBNA 1QIMA 1QH8A 1NN1A 2H4JA 5LVAA 3D7MA 1ODIA 1U4SA 2YHSA 3K72B 1H93A 2CK3A 4XA8A 3ADCA 4FWTA 4PYQA 4S2EA 3CX4A 2EQAA 1OE0A 3P7MA 2BH9A 4GQAA 3ZQ4A 3PS9A 1E2LA 3M49A 4MR7B 1ZMOA 1SOUA 3IOYA 4PICA 1XAJA 2WJIA 1SBZA 3V42A 4BV8A 5JR3A 4WCFA 1C2YA 1GYPA 1I4LD 1MIOA 2EAUA 1WETA 4FS8A 1XFDA 2XJ4A 3DOIA 2C5GA 4DT1A 4RL4A 3S2YA 1BVUA 3MGAA 4YBZA 1UBLS 2MR6A 3D8BA 1G4UR 4YIHA 2BKLA 2ENUA 1MB3A 4TTRA 1U98A 3I04M 3ABSB 3WYDA 2Q1WA 2FFAA 4C6RA 1L4LA 5FA8A 4UTNA 1W4ZA 1WZUA 3DB2A 3L8ZA 1T1EA 4R1QA 1XRSB 2LNDA 3CKKA 3ZH2A 1HWYA 3WG9A 3O4FA 2J6IA 3ASVA 4RIHA 2C5AA 3NV7A 1NI4A 4HOYA 4BKRA 2C2WA 4QT4A 1I7PA 3B12A 1L8LA 3GZNB 1DQZA 3NRBA 2WMNB 3V8VA 1VJTA 4JH0A 5EKDA 5SYMA 3X3HA 5BXYA 2A58A 2GCGA 1MDBA 1E6KA 3K0HA 1A5SB 3CLSC 1K08A 4NE7A 1QG4A 3JWJA 1SKMA 1K98A 3DBLB 3IEMA 1GSHA 4QPDA 4WZAB 1SC3A 3OPYB 5B55A 4XPIA 4ZU6X 4RENA 1E0KA 3D3KA 5TPZA 1FFEA 2BMWA 5FADA 4LOIA 1ISMA 2AJ8A 2J0VA 4U3JB 5FULA 3FSGD 1RXIA 3R0JA 1LPMA 3EDRA 5TMBA 1IWBB 4M9SA 3SJBA 1TAGA 4HAUA 4LZNA 2CMHA 3V7YA 2UYQA 1I1OA 3LL7A 4YFVA 5DLPA 3A06A 1BYIA 3RYIB 3TTTA 2AQIA 3TX6A 1J1IA 3QWHA 2DYKA 5KHOC 2X9GA 1XLTC 2Y71A 4BNGA 2BGNA 2RK6A 3PHLA 4KFCA 4OXRA 4AP5A 5KWEA 5IJ0B 1E7WA 3IKMB 1OLXB 1TIKA 1CERA 2F4NA 4PVDA 1ETHA 2PH1A 1VLMA 4XYGA 1KARA 3BTVA 1GZ6A 1EFPA 5CTJA 3OF5A 3PRJA 1NRXA 3R6TA 1P0FA 1F6DA 1HDOA 4MYRA 3Q85A 3IMCA 4GKAA 4OLBA 5L4LA 3I2IA 1PJ3A 1G2OA 4G24A 5B1HA 1X3LA 5A9RA 1AZSC 2EDAA 2ZU6A 3NO9A 2PS1A 1GRRA 2QSYA 1RE5A 1KSGA 1J2YA 2DTEA 1ZA2A 3I73A 2BFDA 4UEJA 3A28A 1G8GA 2GJ8A 3ZXSA 4ZMBA 1ONNA 4MYHA 5HMLA 3ZNOA 3BSYA 5AIAA 2QY9A 4XIGS 1FFXB 4J2OA 5BORA 2W6JD 2HCBA 1CG6A 1V5EA 2BUBA 4OK6A 4BJHB 3MLBA 3EQ9A 1V48A 3HZHA 4PV7A 1Q7BA 2PZMA 1YS7A 4OD0A 4BFLA 4HH1A 2CMFA 4WKBA 1E7SA 4MVJA 4X7BA 1PQ4A 4BNYA 4QPPA 4COKA 4YP9A 4KKXB 1SBTA 2VF2A 2OL4A 1PR9A 3DDHA 3HBNA 4HDNA 4UTVA 2RGWA 4M9XA 1JDNA 2GZ3A 1Z8HA 2WMDA 3EEOA 1B8UA 1T4CB 2RFLA 3M9XA 1A5TA 5EP4A 1E58A 2QPLA 3GLSA 5FV7A 1GGMA 2FGKA 3VKVA 1UF9A 4IH4A 3ZIAD 1ZOOA 1TCVA 3U44A 1XNJA 3IUYA 1JGTA 2J7PA 3DV0A 4X1IB 4ZO8A 1CTQA 4B6PA 3PR3A 3WADA 3JV7A 5L51A 1TYEB 3PX2A 3DD5A 1JHAA 1QLJA 2G9UA 1ZUHA 5LZ8A 3QF7A 2GHQA 1JKXA 3Q7TA 5A0FA 1YZTA 3FPCA 4C4TA 1Z35A 3LP6A 3P9YA 2GXUA 3K6SB 2EC5A 5BR4A 5IJ9B 1IEQA 1W25A 5P8WA 3OQ1A 1VPTA 1RQLA 2QZSA 3KT3A 3DP9A 3VX4A 3NUGA 2AF3C 5CIWA 3RBVA 4MLCA 1M6EX 1B0AA 3H1TA 2R60A 1E2GA 3TMKA 4BLPA 1WQ4A 1EVYA 4X93A 5C35A 1RXCA 1M8GA 1FQKA 5LZ9A 4BX2A 3TD2A 3JALA 3ZCQA 2FSSA 2ZE5A 4Q9NA 2JCGA 4OFBA 3TJZA 3T94A 1J0AA 1CT9A 4F5ZA 2GAOA 5IPFA 3F98A 4DR6B 4EPWA 1BXRA 4A2PA 2HQRA 3OX2A 1OXSC 3B48A 3ISJA 1ODFA 1ACMA 1ZSNA 4Z7OB 2HBQA 1M6NA 3I2KA 2WJWA 4H7EA 2NVUB 4O4LA 5EHQA 3U5ZB 4D9BA 2HQOA 5IBCA 1HDGO 5K3FA 1B8VA 1DBIA 1ID1A 4NOMA 4XFDA 2E4WA 1KEUA 2W6QA 4KFRA 4YJHB 3AOGA 2IEYA 3ZQUA 4D4HA 3G0GA 2W2KA 2BI4A 1F0KA 1M1YA 1Q57A 3SHWA 1QRUA 1HYHA 4WADA 2I66A 2QTVB 3WHIA 1DKNA 4ENPA 1Z2EA 3CNQS 2CE2X 2ZEJA 3JAWA 4EFMA 2R11A 2GVZC 2GEJA 4GYYA 1KK0A 4D3XA 2HHAA 3DAOA 3RRMA 1MX5A 4BNVA 1U6IA 3VR5A 1BAPA 3ELDA 2X8LA 3EFOB 2BFAA 1VKHA 5KTSA 3AJRA 2W6OA 4MKIA 4AY2A 1DJQA 1D09A 1GFSA 1XN1A 1LZKA 1FVOA 4O4HB 4N3GA 4Q47A 3UJ9A 4AXBA 1KTIA 1IEVA 1W0JD 3FE2A 4FOSA 4K1LA 5CDYA 5GPBA 4JLAA 4RVUA 1KK2A 4XXHA 2JFHA 1YZFA 3L7MA 3GMTA 1XB2A 5T64A 2QUIA 1BD3A 4I14A 4ZT4A 3V1TC 4J7AA 3D3EA 2XMDA 1RE0A 4NICA 3TTVA 1B76A 5E0KB 3HZOA 3KBOA 2ZOSA 2A1IA 4NI5A 4BJ6A 5BT8A 7REQB 3K0EA 4XDHA 3UMBA 5M3BA 3AQIA 3L04A 4XWTA 3OEEA 1L7EA 3VV2A 4KPYA 3E3NA 4ENVA 4PXSA 1QDEA 3SPXA 1WY7A 1XOIA 2IA5A 2J48A 3WRXA 2QJWA 1QMPA 3RR2A 1ADJA 4K9LA 1ZDMA 2QL6A 4X6LA 4E4YA 3CVUA 5C8YF 5DN9A 5I4CA 3VPCA 1T3LA 4F38A 2MMGA 4IQ0A 4FDTA 2B35A 5EE9A 1J8DA 2N1MA 1D2AA 3BWMA 4I9UA 1OHHD 3HN6A 4JLUA 1RCUA 4GLFA 2QLJA 3GWGA 4OI1A 4QJ3A 5B64A 3EEYA 1GJRA 2Q2QA 4JJGA 1MC5A 3HB9A 4BNHA 3PQ5A 3EPRA 4WESB 1ZRHA 3U48A 4Z4QA 1NT4A 3STXA 1XCMA 3S2GA 3A32A 2FN3A 3G9UA 1J8VA 2NVWA 4BQRA 1EFVA 2MSKA 3JQGA 1ORWA 2ACVA 2IZ7A 2ZIUB 1E2PA 3EIFA 4KE7A 1RFLA 1HYGA 3C3EA 1WMAA 5D1NA 5IAGA 3RREA 3TRJA 4AM8A 2Y93A 3H5TA 4C4XA 3TK1A 1N5RA 1AXRA 1X7ZB 3IKVA 3QXXA 4OH1A 1J0XO 4HCJA 1QYIA 4L8FA 3PTZA 3LQ2A 1MN6A 3X1ZA 4IRXA 2V54A 4NCIA 1Y3FE 5FPYA 2HJVA 1P1FA 4AJEA 2DQSA 3G2QA 1TUGA 1YQ9A 4D41A 4DG5A 2Z9CA 1JJ7A 1QF7A 3SF8A 3ZXXA 4EAAA 3ROGA 2IPXA 4R1TA 1M2OA 1N6PA 3HCEA 4RKEA 4TLCA 5FJIA 1JG3A 4I2NA 4MPPA 2A9RA 1TO1E 4JC8A 3T61A 2PMDA 3GRPA 1WMEA 1ZA1A 3HFSA 3AKYA 1RJWA 4H6WA 2PKQP 2W2MA 4V3CA 3S1AA 4XPZA 3H1GA 1E4OA 4V1CA 3T9BA 1XIVA 5H4HA 4JLDA 3SEFA 1EJ6A 5I8PA 4EATA 1QPZA 5K8IA 2J5RA 4C4AA 3B1FA 5JCPA 1NKTA 4P0PB 4V24A 2O19A 1BDBA 3T1TA 2X9NA 4OA8A 2FUCA 2XDWA 3FMIA 3QJGA 4IDQA 2GS9A 3VO9A 4G5FA 4ZI7B 5AI0A 4TTAA 3I9JA 5JNWA 2GCEA 2ZDHA 1ZYUA 3V7FA 2M6KA 4P3OA 3A6EA 3FCSB 3HCBA 5JBQA 1W36D 2W4IA 2EG9A 2XB8A 3F0TA 1QGUB 1SM4A 1E20A 1P3DA 3WDSA 1YZLA 3LNTA 2N9UA 4I36A 4DIUA 621PA 2A33A 4MLPA 2P4QA 4WBNA 5A4AA 1WP9A 4G5QA 2GM9A 2HFKA 4HH4A 5L4NA 4C7KA 4XGIA 1H8HA 1ZBQA 4EKGA 1EDOA 5JWOA 1U04A 4EA9A 3ITNA 4JP3A 4EG8A 4LRYA 2ZM6B 3ND7A 1USUA 3AZQA 3GGPA 2DM6A 1TO6A 3MSCA 2D8MA 3MD0A 4F5YA 3QEJA 1LS1A 3UT5A 1W94A 3MEQA 1A2KC 2ZWOA 5SZJA 1OH5A 1NJ1A 3AF2A 4G0ZA 3ZPXA 5L6MB 1U8AA 4TS4A 4UJ3A 1JHUA 1ADFA 1FFHA 2NU8B 4G9GA 4R2HA 3RSOA 3TQIA 2PLNA 3OO1A 3IPRA 3UHJA 2XQGA 1E7RA 2QXTA 5EE5B 3GZJA 1YOBA 2W0SA 4BU0A 3KVRA 4JVNA 4UFOA 3ZY3A 4QNNA 2M98A 4QYIB 2H8KA 3JYLA 3N1UA 4TWJA 3REQB 5BMVB 5HBRA 5A5EA 4FK8A 4J2TA 1CUXA 4X64B 5AVZA 4B3GA 1AIPA 1VSVA 4MJLA 4NYJQ 1EJBA 2NZJA 1ZWKA 1HOXA 4CM9D 3UC5A 4H6PA 1AZLA 1WDMA 2KLBA 3GAAA 3DMTA 2RH9B 3C5CA 1FUUA 1Q84A 1TW3A 5KKAA 2ZQ5A 2C42A 3H17A 3OEHD 1K3TA 1P7ZA 1XP8A 2B61A 3DJYA 2ZJ3A 4GMHA 1AURA 5J2UA 1E0JA 1GA6A 1WXQA 2NN3C 2WJZB 2YWRA 1LZLA 1NUQA 4G36A 2AKYA 2XTMA 1G3RA 4KU4A 2W00A 3V32A 3HB4X 3D8HA 4LQLA 4LJ4A 1LV8A 2P2ZA 3AO0B 1BHSA 3QEMB 2AG0A 4FJ1A 4X8HA 3HXMA 2XB4A 1K4MA 2PL9A 2W6CX 5CM9C 4O8CA 3U7RA 2QE6A 4LOKA 1PR2A 3RAFC 2IGBA 4EH1A 1EJ0A 1N2IA 4P98A 2A5JA 1N2OA 2ZDGA 4C89A 3UJCA 2P0YA 1P8AA 1QFSA 1VPEA 2Y1WA 3PE6A 3U0BA 3WFZA 4DIKA 4KL8S 1DXYA 5MN6A 3Q7RA 5KQMA 3C3WA 4EUFA 1XG5A 2PGDA 3AVVA 4ZMRA 3VNUA 4FMPA 1MCZA 2JIDA 4K87A 3PT9A 4L4RA 2VCYA 2I7DA 4PGMA 5CCDA 1EWVA 1DX4A 3FSRA 3HLTA 3L01A 2IYQA 3CINA 4YCBA 5EKSA 2R6ZA 1DG1G 4F04A 3AESB 3V1UA 4PC3A 2R4UA 1Z68A 3PEFA 1NUAA 2ZUVA 4S05A 4IG4A 4QVKA 2GVDC 5SZHB 5H16A 4ZIRB 2ADFA 2IFTA 5FUBA 1G20B 3RUEA 1T4GA 3DZBA 4ICIA 1Y9EA 3OE1A 4GOLD 5SY4A 2IIVA 3O1IC 1V8OA 1WDKA 2ECFA 2KS6A 3H65A 1NOJA 3H84A 4PC6A 1G19A 2BN4A 3NTUA 5FQOA 3HN2A 3N2LA 2E6KA 3ZKAA 1RTTA 2YWDA 1P4GA 2RJ3A 1H1LA 3G1UA 4NBSA 4HLNA 3RVBA 3FPBA 4N0PA 3IV7A 1RLIA 3PLRA 3IVXA 4KQHA 5BOVA 4BVKA 3E1SA 4LSZA 1Z7EA 2I1QA 1HTWA 1Y5NA 2VAWA 2YHAA 3IYLW 3QKRB 5FNVB 3ZWPA 2JCBA 3CPHA 3N6XA 1KXZA 1KSJA 3AV0B 2UUAB 3R3XA 2O1EA 3U4CA 2G17A 1HX7A 3ICVA 1U8YA 3KLMX 1RHKA 1H8EA 3L1IA 4J1NA 3WDLA 4CLOB 1OLSB 3VPBA 1P39A 2B2XA 4A8TA 5FUMA 1KRWA 1PFQA 1KVRA 2WLTA 4ETIA 5K5EA 4XQEA 3ULKA 4H1TA 3WLLA 1SCUB 2W2TA 2XKAA 3L0YA 3ZCRA 3G2OA 3C3PA 3FHJA 3QMPA 2GQ0A 1I7LA 1VB5A 3O91A 1MX9A 1WS6A 3X43A 2FLKA 1LX6A 2W6PA 1JDTA 3E1GA 2CCGA 4ZREA 4UD6A 5JNUA 4NZ9A 2H1RA 2EKDA 3OAAA 1PJ4A 1DWPA 3MUFA 2R5WA 4X84A 1TCUA 4A3SA 2FR8C 2H2HA 3PD7A 3OIVA 2NIPA 1QV7A 4PN7A 2NO0A 1XPUA 1E1RA 3OOSA 1NA5A 1UDAA 3EMVA 4IDFA 1N9GA 2ZS8A 5TMDA 3LQ1A 5CFZA 2HFJA 4QDKA 1UBOS 1U9IC 3PXEA 1LK7A 2E4UA 2QUZA 3NIWA 5EZQA 4X44A 3URMA 1UADA 3EJWA 5K8LA 3OZUA 1I1NA 5KYYB 3FOCA 5JWHA 1WDLA 3GUVA 4ZO6A 4S1OA 4Y2SA 1DWOA 2WHQA 3N7TA 1LSOA 3SHOA 2D59A 1E2NA 5HOEA 1KQGA 1LWNA 1Z56C 4CNQA 4C22A 2OBXA 4XYBA 3MS4A 2TMKA 4DIBA 4EFKA 1L5RA 1MAHA 4Y7DA 3FVWA 2R86A 4DYDA 1XXLA 1L5KA 5A02A 3QE9Y 1Z39A 2GFIA 2YN4A 5THQA 4LTNA 4C4ZA 2C20A 4GL4A 1UMCA 4GHWA 4QXQA 1V16A 1ZH8A 4GMDA 3RYHB 2H7VA 1CB0A 1AMUA 1C9YA 5HPYB 4AIRA 5HFAA 1O6CA 3IBFA 4OGWA 2P9BA 3SI7A 4DXHA 2PS3A 4F4UA 3IE1A 2QGNA 2G77B 1R0YA 2OQRA 2WUGA 4C2AA 3L0OA 5JYCA 1D2HA 1SBNE 1UKEA 2QRVB 1IHOA 2ORVA 3B20A 1SOVA 2WKPA 3VNSA 2FWNA 3ESCA 2IOHA 4X45A 4J29A 3LS2A 1X8XA 1XCBA 3D3WA 4HZIA 4JLNA 1H6BA 2B2NA 4UHEA 1PKEA 3EXG2 3U1VA 2QMOA 2R47A 5D87A 2QUKA 2IF0A 3L18A 3NVAA 1DTWA 4ZANA 3V3KA 1K5GA 1NL3A 5HCUA 1E0AA 5FBQB 2V6JA 2AMVA 4FHZA 4B09A 1J5EB 4D98A 1V9LA 5BOSA 4ZTUB 3ESYA 5C7OO 3WLFA 1RKQA 1BN6A 1P3JA 1CVRA 1EA5A 3GVIA 2HHCA 3QELA 2YCLA 2G3YA 2NYUA 3QXCA 4JHXA 2E21A 2YC4C 4ZQGA 4YJKA 5KJEA 1IC6A 4ZOAA 1KTVA 1VLHA 3OC6A 3LHSA 2FU5C 3T3PB 5IH7A 3VDRA 1KWGA 1KRXA 1R6UA 3VH2A 3ZE6A 3TJRA 5J59A 1GGJA 3O7MA 4A92A 5A9SB 4ETWA 2JF0A 5MN4A 1OC4A 2BCGY 2NU6A 2WHXA 2JAUA 4WVFA 3KZCA 4BC0A 3WNZA 2PANA 1ZMRA 5FBLB 5ES3A 4KGDA 4RULA 3LOUA 1U2QA 2ZIAA 4W5HA 2FZ4A 3U7FB 4EHNA 4FXPA 1YVEI 3QVXA 4IEFB 5TGDA 2BI7A 4F45A 4B3TB 1ENPA 5J2TA 2VCHA 4A2CA 3GJTA 1MU0A 2Y67A 3L06A 4QU5A 4M7PA 2H1LA 2FWJA 4KK3A 2YUTA 2NUAA 2V4ZA 1O0SA 1MG0A 3MBIA 3A4TA 1XZFA 2VQDA 2WR8A 3ORHA 2DULA 2J9FB 4RPLA 5B3JC 3PNQA 4I5DA 4LYAA 3HKEB 3EPKA 4HQ0A 3O8BA 4AKGA 4P82A 1OJ7A 2EP8A 3DZFA 2BTEA 1MOSA 4I19A 2YJ6A 1W5BA 4I1RA 1A5AB 4EVIA 1KJWA 5AWFC 2UZ1B 1XJWA 3HNPA 1DO8A 3G13A 4LE0A 2QYTA 1N36B 2PXAA 3DAFA 5JXWA 3C8MA 2UZ4A 1X74A 2CC2A 2QW8A 2BHRA 3EUAA 4MCJA 3EVFA 4IDNA 5IC6A 5JO0A 2JFNA 1U3UA 2QMEA 4LVNA 3UK2A 3PNBA 3F6PA 5JDIC 2HIHA 1JMYA 2BR5A 4YUYA 3ZV4A 2ATVA 4FNGA 2ZROA 1VIDA 1TUBB 1ZL2A 2QN7A 3I6MA 1TVMA 3D4NA 1SQGA 1JKJA 1X7WA 1U11A 2PL1A 1ODLA 2BOVA 1E1CB 4LI3X 5EWLB 1NQOA 4C0XA 2JVIA 4KXLA 2Q5JA 2Q0HA 2X6RA 3FNFA 3SX4A 4BCCA 4UVEA 1IL0A 4GFDA 1NVXQ 2V7GA 5JI3E 4JHLA 3T1OA 4DZRA 1HO3A 4YYEA 2IEIA 4CF3A 2XRZA 1B3BA 3IIJA 3P94A 4K3UA 3KBBA 2X6TA 3DM5A 4ZYXA 2QMUA 1C3JA 2QN3A 3T0GA 3WP0A 4K0RA 3U1BA 3KSRA 2O2ZA 3O0TA 3VZCA 2BI8A 2GN4A 5DHAA 3WGOA 2CXNA 3IDOA 1CRWG 2VN8A 4G2NA 1ZONA 1AD2A 1ZH4A 4GKVA 4HWSA 1FPMA 2DRIA 3LRXA 2C4TA 3R0IA 4J1QA 4C43A 4ZT7A 3ER9A 1PI3A 1BMTA 3UXHA 2L17A 4BP1A 1VMKA 1MBZA 3FNRA 4QRHA 3MT7A 4YMUA 2NZ2A 3LVFO 4Y9SA 3I28A 1I4DD 1SVWA 1E0DA 1PGOA 2RHBA 3GFSA 4NH4A 2H00A 1JSRA 3E7XA 3V97A 3ZTWA 1KAEA 1AGRA 3T06B 3TLEA 3MUNA 4ZEOA 2X40A 1RIIA 2C5HA 1QG0A 3IS3A 4HC4A 4KXUA 3VHLB 4DPLA 1ND5A 3JQ7B 4IV0A 3EISA 5IHXA 1W48A 3AR6A 3GMSA 4EWLA 2GD1O 1BEZA 3D0OA 4F3NA 4QGSA 1QONA 5C1BA 3L82B 2C0PA 2A4MA 4URXR 5B30A 3P26A 3CUUA 1YC2A 4TMTA 4FFMA 4DLWA 3FZGA 1KI4A 4GOND 1ZUD1 4F21A 4L3WA 2AW3A 1T0JB 2BGIA 4W8HA 4ASUA 2GDJA 1FDUA 2H3EA 4MRPA 2AZDA 3UG7A 1A1SA 3PCTA 3EVTA 4DCNA 4N82A 1SBHA 3IPLA 3L40A 3SQNA 4OP2A 2QF7A 5ITZB 2FJ0A 2GTIA 1YR8A 3JQBA 3N0TA 1M5TA 2I78A 1XKXA 3EAGA 2Z2ZA 3AW9A 2FQWA 4QEZA 3GRUA 3LWNA 4KH0A 3EH2A 1GSOA 1Y7IA 2GBIA 2CVZA 5LC1A 3RK1A 5CG1A 3KK0A 4NCBA 4D3YA 3JQDA 4UUOA 5HWSA 1KQFA 3S2ZA 4ED9A 3IVAA 5KNDH 4DLRA 2CXHA 2FI1A 2G06A 4WE3A 2CCJA 1WY5A 2G0NA 4IHQA 5C4IA 1QIFA 4B6OA 2IY8A 3THYA 2CXTA 3QVUA 2GN8A 2J3MA 3C1TA 1EFRA 4ZT5A 1QP7A 4DA7A 2HF2A 3MUEA 5JOQA 1M2VB 4LZPA 2PS0A 4F9EA 1YDGA 1GZ3A 4WZAE 1CUFA 2CB9A 3BSFA 1YS9A 2BKAA 3NU1A 3UJNA 3AF4A 1XZQA 1N3YA 4LNHA 4F11A 1YI0A 2CLDX 2OSVA 1Z7YA 2RSLA 3T9AA 4J16C 3H05A 3E7FA 3HI6A 1GTG1 1XRPA 1DLIA 3H9JA 2H9AA 2AI2A 2VNSA 3H87A 3WTCA 2C2HA 1Z5PA 3SLGA 2D1QA 2I22A 3CKYA 3GRKA 4GP7A 4CT4B 4WQMA 2MYTA 1YULA 3IMFA 5BW6B 1IOZA 2WPDD 3KTAA 4M7WA 1H66A 4HMOA 3GRVA 3KKLA 2OVBA 2BTQA 3G5LA 3ND8A 2BKXA 4NYJR 2VRCD 2XCTB 3BE8A 4LBYA 2AN3A 3EZXA 3OF2A 4XASA 1X7XA 1XQVA 1UANA 3G2LA 5FQNA 1TQ2A 1UWKA 3U4AA 2X0IA 1ID8A 1ENZA 1S7GA 2XOKA 2Q28A 1TVKB 5AI8A 5TQ2A 1E3QA 4UPVA 2WTXA 4KV7A 4R9RA 4G8JA 3UM9A 4H1HA 2MINB 8AT1A 1WKCA 3K9FC 2VYND 4K28A 3MW8A 3NETA 1M76A 2R1VA 4JITA 4FDAA 1CUIA 2VNKA 4A8JA 2X5XA 4KRGA 4LF7B 2QN9A 3C5EA 1W35A 4N03A 3ZI0A 4G0VA 2XLCA 3RC2A 3HRIA 3P9KA 1K2WA 4DIFA 4ZAYA 5F1KA 3FLMA 5C8YB 4YDHB 2GM5A 4TTSA 4YCMA 1FJHA 1ZVMA 2PX4A 1GCGA 3L49A 2C9ZA 3MAJA 4E2FA 2EW1A 4TKVA 1OH8A 1D6SA 1YBMA 3CNLA 1V6AA 2XUGA 4OHZA 4DBVO 2ZRPA 5C51B 3L0ZA 4MUMA 3FVRA 3EC7A 4KMSA 1SXIA 4BZWA 1NRJB 1Y3HA 3ZG6A 2YXLA 4G1FA 5SV2A 2I33A 2ZYTX 2CD7A 1TK2A 3UYKA 1RMTA 4OSPA 3TOZA 3OIFA 2IVZA 4YPFA 1HYBA 2XXJA 3U3XA 2O50A 4PLFA 1QVVA 3VPFA 1QH1B 1VSTA 1ZFNA 1EM8B 2GKOA 1BKYA 4DW8A 5KQSA 1L7RA 3UB4A 3CT6A 5JSFA 2VNIA 3EZLA 4W99A 4GU5A 4FFSA 2NP6A 3ETDA 1UPBA 2G4LA 3PIDA 1DPFA 2IDKA 3KD3A 4ZRMA 4Q3DA 2BM0A 4G2TA 4ENRA 4G0WA 2YV1A 3SSMA 3ZLVA 3O83A 3NWPA 2VCEA 4M6WA 1FUKA 4JI0B 1ZW1A 3OPQA 3HJFA 4E07A 4K6MA 5K3BA 1NGSA 5B36A 3FRHA 1K62A 2J3EA 1WUHS 1YBVA 3HR7A 3TLYA 1Z6TA 1CW2B 3RFXA 1T91A 3FGOA 5K9ZA 3BKXA 5HIIA 2HXGA 1Q1QA 2VKTA 3OFKA 4QTXA 2B1JA 4ZAZA 5EMHA 3MAGA 2PZFA 4QJIA 2IELA 3TW8A 4N6NA 2A1TS 5EJEA 2PZLA 4DMKA 5JCZA 2GPAA 4MGKR 6Q21A 3NJRA 4DDVA 2JHGA 3WKCA 4UDOA 2QTLA 3ADBA 1O95C 4M88A 3N70A 3OE4A 2WTAA 1BHO1 2FK7A 2HLDD 2F48A 2OC9A 1GUYA 1TT5B 2PV0A 3A10A 3ELBA 3O8OA 1UP4A 5IAOA 2XE4A 4U8GA 4TL9A 1TYBE 1TA9A 2VH1A 4X1YA 3OZFA 4AJ1A 4Z3DA 4F7WA 5C7LO 5K4AA 2Y1GA 4CKEA 1KMQA 2PFKA 2VWQA 4MLZA 1EX7A 3PJRA 4L3OA 1IONA 1WUYA 4H31A 1O8BA 1M6YA 4G81A 2AMJA 4OQYA 2BISA 1NJGA 2HL6A 4KUEA 4WK4B 2KQUA 3BVPA 5EIBD 2MJLA 4H27A 4M1KA 2O0JA 2B3DA 2SBTA 2O4CA 3Q0IA 2QVBA 4GRIA 3CCBA 4PX3A 3UPTA 2F3SA 3DKKA 4HWPA 5EJGA 4ARZA 1MAWA 2PRKA 4F1JA 1OBFO 5DRTA 1E3JA 3GR6A 3CLTD 2O1SA 4B3RB 4KAJA 3KZVA 2V55B 4FN5A 3RABA 2QT9A 1ECFA 1TTPB 5IFKA 4RSRA 2JFQA 3HPQA 3VHRA 3A1UA 1TJYA 3MELA 2FJUA 3NS7A 3LRTA 4IVRA 2YV2A 5CNIA 1E99A 3OI7A 2OG2A 1Z17A 2VPYA 3ANTA 3H4TA 2XNCA 3QI7A 1QJCA 4ZO9A 1WNTA 4PHGA 4DC1A 2B92A 4RVNA 3L4BA 1PX0A 3KE9A 1BCSA 1ISHA 3SJAA 1XX6A 4D5GA 2C7VA 2BGMA 2XKBA 4JFAA 3HS3A 3JSXA 4R7TA 3WGKA 2XXAB 2G76A 1NNSA 1WSDA 2IP1A 3AT1A 3VGPA 1AO3A 3ESXA 5CT6A 3HUUA 4LF5B 1UM9B 2RJOA 2WG1A 2O8EA 2VPPA 5E6SB 1SNYA 3ICOA 1T8UA 1ITZA 2V7QD 3E23A 3FNEA 4DLTA 3AVTA 2QYSA 2CVHA 4HN4B 4M86A 2Z2XA 3BC1A 3H5VA 1ILWA 1E92A 5AOBA 4CKBA 2BCEA 1TJNA 1XRJA 3N53A 1XR3A 3M6AA 1GPLA 1LTKA 1ZVJA 4P22A 3E15A 1CY4A 1K3UB 1XTIA 1JHVA 3HYRA 1F6WA 2C97A 4P4UA 2X2FA 2H63A 5CEEA 1NJ5A 1ZH0A 3ICCA 4J7UA 4MYUA 4GGMX 3RFUA 3DMNA 3UT6A 5HXAA 2PFSA 4FYVA 4MIOA 3UUEA 1Q15A 1JKFA 3KVNA 3BMOB 2WJJA 1U31A 4F6LA 2CDBA 2JGKA 4JENA 5DBFA 1DKPA 3LXMA 3H6HA 5ICSA 3Q9SA 2Q3CA 1MO4A 1V8ZA 4KWCA 3PQCA 1J90A 4NEQA 2NPOA 4RXUA 4B4UA 2GK6A 3S6JA 3A2KA 4RPHA 2W6IA 1XNRB 1VJCA 2VT6A 1BKSB 3QGMA 4YI3A 5ELLA 3TIIA 3LQYA 4ERNA 2CE7A 2FY8A 1TKAA 1UC5B 1UMBA 2JGNA 3C3AA 3CLHA 1O97C 1E3EA 4CM4B 4PC1A 3GD5A 3MPOA 4EL5A 5YASA 1JP7A 4MB2A 3HCWA 3D4OA 4AZWA 4OL0A 4R98A 2NSYA 3T9CA 2PO5A 1LDBA 3N8IA 2J0QA 2A0XA 3HO6A 2IEAA 3EBOA 3JPYA 2ZWPA 2DPHA 4KWEA 4BBJA 3G49A 3V2HA 5FR1A 3ESQA 3EZ6A 2EFJA 4J3FA 3R44A 2RE8A 2BPOA 3ZKWA 4CQJA 1LSUA 2NXCA 1QR6A 1RI1A 4GPTA 3GROA 1B2RA 3N58A 4LFCB 5F1PA 3RRJA 4C5AA 3UMCA 5J5CA 5EMKA 3TQCA 1NXSA 1MX3A 1PAUA 2OAP1 1TPZA 1IZ9A 3I9V6 3HYLA 3QOYA 2QR2A 4NDNE 5DTMA 4H60A 2JAOA 3CU5A 1EWQA 4ESVA 1S2MA 4BZXA 1D4AA 2CBZA 2H1IA 2B0JA 2IOYA 1I4WA 2ZANA 2LKCA 4HDCA 4HK4A 4KPUB 5HJEA 4CPDA 1U7WA 3ZXIA 1W29A 2HPVA 1SO8A 5K8UA 3DQPA 1DG3A 3CRMA 3PNLA 1NNEA 1KIMA 4KO8A 3QPWA 1YE3A 4E7OA 4J6FA 3E0XA 1R6AA 4JROA 4OCZA 3RK4A 3DE3X 2MR5A 4F4CA 3M3PA 3TWOA 3KSUA 1AS0A 1UOOA 2KYRA 1QHGA 3TN7A 4DLLA 5JS6A 3L7NA 2Z6VA 3TF5A 2ZT8A 5CXSA 2FMIA 4ZA2A 5F7XA 3IBYA 5DM0A 5AVUA 1SPBS 2C3OA 4R2LA 5LN1A 1YUBA 1ESCA 3EGWA 5D3MA 1U2SA 4DVJA 2QRHA 1Z75A 4PO1A 4EQZA 4YRKA 2UUBB 1XHEA 3DHEA 4FZ5A 2X3UA 3E2PA 2NUTA 1OROA 1F17A 1SVNA 2HSGA 5I7RA 3BZUA 1JU9A 1QK3A 3GEIA 3ZZMA 5IT9A 3G7UA 1DRKA 4L4ZA 3WIEA 3CKMA 4R0NA 4PY2A 3JQ8B 5HQ3A 1U1FA 5DP1A 1HDXA 3NGMA 1VKJA 3HYCA 3OG9A 4UASA 3RFCA 3RNLA 3T5TA 4WDRA 2JATA 2Q41A 4YAGA 3K9WA 4ZYTA 4RTJA 3EXEA 1BEEA 1E9SA 1ZNYA 5FTJA 2C8KA 1PVVA 4GMGA 3M6XA 4XWWA 3K31A 4S2UA 1IBCA 4BECA 5EVCA 2IHTA 3FETA 1J24A 4K81B 1SCKA 1BU5A 1NU8A 4HQ6A 5DEOA 2QRKA 2WABA 3F4SA 4N3CA 1TEVA 5F35A 1Q5PA 1T9ZA 3H2IA 3DOCA 2GTPA 3QMVA 2HPAA 3MSXA 3HU5A 3OQPA 4KAFA 1JYSA 3HDJA 2A5GA 2C2OA 4GD3Q 3MM4A 4DJJA 4FYPA 2YZ7A 5KZMB 8ADHA 4JC0A 5ILGA 1YRQA 1QCYA 5FFFA 2QR3A 4KACA 1A98A 1KC3A 4K6FA 3RAGA 1JDJA 1HE5A 4JUCA 1BYUA 4Y2HA 1YQTA 4DR2B 1S8OA 3PRYA 4PCVA 2WV7A 3HFJA 3R7FA 4TSFA 2QENA 4IS3A 1CSEE 1SUAA 5LLSA 1JSWA 3WGYA 2J09A 1GA1A 1PNTA 2C2XA 2C1ZA 2Z8YM 1DAFA 1M5UA 3OJFA 4ADLA 3F73A 1Q0RA 3AHEA 4QJ5A 1W85A 1XQ1A 2X7XA 1KAGA 4HQRA 5T57A 4TVSA 1JN0A 1AKVA 2ZSDA 4IM7A 1KEWA 2UKDA 3LVQE 3GJ0A 1X80B 3CWZA 4W8OA 5BN4A 4W63A 4E7PA 1C3OB 3EWNA 4KTTE 1WPGA 2YIJA 1MHTA 1GRCA 4Q24A 4NK5A 5I7HA 3JASA 3MCWA 4TMZA 5AM0A 3M6FA 2DWPA 5B58C 4HNRA 4XGRA 1PTKA 3WAKA 3OZCA 1XJCA 3HBFA 2PR2A 1CRZA 2DCMA 3DVAA 2O52A 2XMRA 1TUIA 1GZ5A 4PU0A 1W34A 1KZ4A 4Q02A 1GZDA 4PNPA 4DYVA 2XF8A 4MO2A 4BNNA 1OX4A 1U0HC 3D1JA 1O9HA 4PYIA 4ZZ3A 4L5IA 2HT1A 3Q8KA 3SJCA 3N0XA 3LC0A 2YMLA 1D1PA 3ETCA 3KT6A 1L1RA 2JLAA 1BMFD 1H2HA 4EZBA 1VL6A 2OFWA 4O4LF 1RAGA 5LNK6 2RGCA 4GC9A 1TLFA 1MH9A 2OENG 4XLZA 2MYUA 2PE5A 3O4JA 2F9MA 3K7EA 4OO3A 4QPCA 4B3BA 1Z06A 2D6FA 2OGSA 1QVAA 2X5NA 3PQ2A 4Q93A 2QX4A 1FDOA 3TLBA 1ZSVA 1G20E 3RIYA 1E2UA 1Y5MA 1YZKA 2F8TA 2XNDD 3JQ9C 2EKPA 1CB7A 4BMYA 1ISGA 5IANA 2G1JA 3O4HA 3VNBA 2CHEA 5J1TB 1CYEA 1L3IA 3MJFA 2CVFA 1XU7A 3AYXB 5T8KC 4C7BA 1U0EA 1U9CA 4JUBA 5DO9A 4AMYA 2ZDQA 3P71T 5D85A 2HU2A 3ID6C 3SZUA 4QHYA 4PANA 4ZZ0A 2C54A 2PRZA 3BMCB 5KOIA 1WMFA 4RMGA 4OHUA 4WXYB 4V0NA 1D2RA 2IV7A 4F0JA 2FZLA 5HFJA 3TUJC 1P2FA 1H4QA 1Z83A 4BXOB 2X6QA 4ZU1X 3ST7A 3IAXA 4OQZA 1KDTA 5AQ1A 1UJBA 3WYAA 4YUXA 2PX6A 5CBKA 3PYLA 1SUBA 3WGGA 4UEKA 1QO7A 1ZJ4A 3QNUA 4II3A 5JCJD 1M0WA 3L8FA 3PFKA 2PO7A 5DNWA 1ZQ1A 1YB2A 2H0QA 5NLLA 4EG3A 2H2IA 5LQUA 1PVOA 2FEMA 1WSAA 5HEKA 3U40A 3R40A 1WJGA 2CHVA 3G0BA 4ZOLA 1HLDA 3PCRB 4LMBA 1KBZA 4YALA 4V0LA 5AVSA 1IAVA 1SOWA 5JARA 1Y6FA 3ZHYA 4AMBA 4MK4A 3IP5A 4AN0A 3W4KA 1DB3A 1ZIPA 2FKAA 4QGAA 5H0IA 5DT2A 5BWMA 5ICEA 3VU1A 3DE6X 4DR1B 3Q7IA 1IQPA 2WRZA 3D7SA 3PWZA 4FT4A 2J08A 4UHBA 3G2HA 3L7IA 3SY8A 4BB6A 3RBXA 1H2BA 2B8WA 2GNPA 1YRWA 3F1LA 1NXQA 4TUYA 1Q22A 3DTNA 3ROEA 2PMKA 5F23A 5I9NA 4D4MA 4EOGA 4GXRA 5KTYA 3OX1A 4NCAA 1Z0IA 1SURA 1TEXA 1PZXA 2WT9A 1NE2A 2MSEB 4LAFA 5I9LA 1P1KA 2AUTA 2AZMA 3GQBB 2BKEA 1A97A 2H31A 5A3JA 3JQAB 3TECE 1H1TA 1LJLA 2CJWB 1VE7A 4HADA 2ZB2A 4L16A 3BL6A 4LEIA 4R31A 4RZ3A 4X24A 5SY9A 3K4QA 1LPBB 3AUYA 4ARVA 2ZI9A 4DDHA 3KVOA 1DOAA 4LA4A 4TV8A 4ADSG 2QTGA 2GX6A 3ANSA 3JRWA 1G7SA 3WLSA 3LX5A 3W8RA 4IXTA 1VDZA 3TOSA 4CTMA 3AR4A 1Y6ZA 1FUOA 1L7NA 5KJCA 4HSEA 1P17A 3P9RA 4YJGB 1DQYA 4FFNA 3MMPA 3UB2A 3DB1A 1GV0A 3W34A 5TY0A 2DFVA 1PWEA 3IE0A 2PJUA 2ZS9A 5F5XA 3GJ6A 4ZCQA 4IIHA 4RIGA 4D44A 4N6OA 1QFMA 4I6JA 1NU6A 5KQPA 3C87A 5IWCA 4E94A 1L7MA 1LSSA 1TMOA 2D2EA 1U0JA 3VR4A 1KC1A 2WIBA 1XSEA 2JI8A 2OV6A 2WU0A 3RSQA 1O96A 4FR2A 4FGLA 5A5GA 1L9XA 4N3AA 3E8SA 1Q83A 1PHPA 3CB4A 2O2EA 3E18A 3TZQA 3B7WA 3UCEA 3I62A 5G4KB 5DCUA 3NHWA 3FH0A 4YONB 2GBFA 4E51A 4PZZA 4QIHA 3MLEA 4ND3A 1KJZA 4LXIA 3WLNA 3ZE7A 2FW8A 3GUUA 5FTWA 5HILA 3L8YA 2BE9A 5T6MA 1RZUA 5HDQA 1NBAA 3GRFA 4QXAA 4RANA 16PKA 2XVXA 2XUJA 3ME5A 1N9ZA 1T9AA 2ZUBA 3RG8A 5ELXA 4IDOA 4IZOA 1NX6A 5GIOE 4JI2B 3ENQA 4MS1B 4RVCA 3QENA 2UDPA 4ZEVA 2VDMB 4I0WB 2V7VA 5T3YA 2GM4A 4KREA 3KWLA 1JLSA 4US1R 1SCQA 4HZUA 4F5EA 1Z37A 3W3AA 3C7CB 5ALHA 1TD9A 3ZC3A 1NSYA 2GEDA 4Q1CA 3OTHA 4ZQFA 2ZQZA 4CCWA 4R3NA 2WM8A 4Y2YA 4AJ9A 5FLKA 2GJSA 3P5SA 4ND8B 4YT5A 5BQ5A 4FTWA 2GLTA 5GJCA 2RAVA 3DMHA 5FOTA 5GV7A 2CMDA 3SXUA 2FPPA 1FFCA 4CIYA 3H1EA 4IEEA 2QAGB 1C7FA 1L4UA 5JFGA 2FGJA 4LV8B 1W4AA 4LYGA 4DNOA 5IEBA 3TVTA 9MHTA 1PL6A 1BVYF 3QUBA 4IGFA 3PX7A 4UQPA 2I2DA 3K35A 3I83A 1AMOA 4GOJA 1ICEA 1U16A 7MDHA 4WNAA 1ESNA 4I3HA 1WMSA 3UY4A 2GOYA 1W88A 2OO3A 3NHZA 4DQDA 6ADHA 1X2BA 3BEDA 3L0CA 4IQ8A 4BO4A 2DTXA 3UXMA 1SAYA 4JJAA 4ZALA 3ANYB 2C7OA 4UE2A 5FWAA 1HFJA 5E8JA 3VPHA 3DE7X 1GQRA 3VOTA 3TTXA 3L6RA 4JUIA 3SKYA 1MIHA 2VSFA 3NEJA 3M9LA 4RMHA 5IAKA 1ODKA 4BMVA 5A6SA 2PTSA 4EG1A 2NNWB 3GVPA 2RG7A 5E7JA 2X3FA 5J2UF 2WSSA 1QHHB 5SYNA 4DMHA 1CQJA 2WINI 2W22A 4C4SA 3CR3C 2XVZA 1CR0A 1CRLA 1AH2A 1DWQA 2CFCA 1J1ZA 2FUEA 4I9HA 1WL8A 3GPBA 4Q1AA 4DLNA 4RPIA 3V9AA 3KOXA 2H85A 4HD8A 3RGWS 1JNXX 1O5TA 5CG2A 4MVJI 1FA9A 3P52A 1Q1AA 4H3SA 1SXQA 4OOFA 4FBMA 2IYSA 4U7GA 4GI3A 2CNKA 2Z5GA 5CVUA 3IIMA 3I04A 1ZXXA 2GHTA 3FMPB 4RA6A 1I9CA 3IP1A 4HVAA 5CT5A 1V7QA 1WCIA 1DXHA 2ZRGA 5FTKA 4Y98A 3VSCA 4DABA 4MVJP 5KUTA 2YQ5A 4YWHA 2RHWA 1XELA 2X75A 4BNXA 2OKCA 1Q20A 3EFEA 1PZEA 2P8SA 2RGDA 3V4SA 1UPAA 1H42A 4IO1A 1SD5A 2PQ0A 2J3DA 1QJ4A 3K0FB 3RFTA 5B2EA 2TRSB 1EDZA 1P2BA 1Y9ZA 3UXYA 4EO7A 1S2LA 4QTUB 3NBFA 4PFKA 2RGBA 4URWR 2V4MA 3JARB 4CIWA 3P27A 3DT8A 5LWQA 3CS3A 4I2VA 3CB2A 1QZUA 3KYIB 3MCTA 4MRNA 2WSMA 4QSMA 3W05A 3JAKB 1PT7A 3ZZ0A 5EJFA 5B1SA 1KQPA 3KWFA 4JX9A 5CLLA 2HK6A 1JIQA 2D2IA 1HI9A 4M0KA 1WG8A 1WPQA 4MVJG 5P21A 4NBWA 2GXAA 3X44A 2ZVPX 2WJ4A 2PX8A 3LBNA 1KAQA 3R5HA 5L7TA 4DZTA 1UKYA 1LPOA 2C95A 5LCXA 3E7DA 4ZC1A 3TBKA 2QJFA 4CBVA 4K0KB 4JUFA 4HO1X 1KOFA 1PLLA 1FPQA 2AXPA 4XH9B 3C6ZA 1R0LA 2FN4A 2AYYA 4OHRA 1C3VA 3V4RA 2BONA 3IUNA 3G9TA 1E18A 4BQFA 3T41A 2PZJA 4N9WA 1XZIA 2C7GA 1PK9A 2QRGA 2J41A 3KUXA 4OMUA 4XDGA 2VFAA 2J67A 4YQFA 5FTLA 1CBUA 4O08A 2EP5A 3E7WA 1X1EA 3ICPA 2I0FA 1U5BA 1GIAA 1P4HA 4CN8A 1YV9A 4YP1A 2AE1A 4X85A 5D3ZA 1ORTA 1WP4A 2O0LA 3OBIA 2Y2VA 2HZBA 2MDTA 1DJNA 3NBAA 4LSMA 4Q0MA 4K6OA 3P9XA 3OIYA 4RF2A 4RF5A 5ALJA 2C1EA 3THSA 1VMEA 1GNSA 1RHUA 4X8LA 2MYPA 1Y4AE 4LOJA 4OHMA 5AKZA 3SVZA 1UDBA 2VAPA 3W9SA 1NZJA 3GP5A 3MTDA 5KMGB 2N0SA 2R7NA 1N5JA 1KBOA 4BTVA 1FLAA 3KHKA 5HOQA 3U80A 3AFIA 3ZGXA 4EFNA 1JH9A 3IIIA 4G84A 3L4SO 1A9OA 1F7UA 2WK1A 3ZJ5A 1HPLA 3KEGA 3A6HA 3RS3A 4XB6B 1U1GA 3K15A 3SNKA 1NC1A 2O2IA 4CKCA 2QV7A 3I4CA 4BVEA 2O3SA 3B5JA 1HKUA 1HXHA 2QR5A 2ONYA 4UHDA 4CTOA 3GT7A 2UV8A 3SIRA 1KR5A 5GONA 1JEYA 2AFHA 4KUGA 3EULA 2V3VA 3T7SA 1ST2A 4MI6A 6PFKA 4XCQA 2X8JB 4DXAA 3WLQA 2RH5A 2BEVB 4NPAA 2JD2A 2ST1A 3INRA 4G01B 3EAFA 1JPNA 4NABA 3SYRA 4EG6A 6GPBA 5FUQA 4OFZA 4ETMA 3FHTA 3W6ZA 5BRAA 3I45A 1YR7A 2EFCB 4G07A 4GXQA 3R3JA 1NATA 2OO5C 1PLJA 2HIAA 5FOXA 2JLWA 4EGAA 1JVNA 4O0LA 2Z3ZA 3QIVA 3CZQA 2CF5A 3M82A 5EUBA 4U7DA 4DKJA 1DUSA 4DC0A 1N2XA 1JJFA 1UMDA 4AKIA 1RBQA 4ZVUA 4WOKA 3E9MA 5C46F 4R3WA 3OHMA 4QE3A 3TR5A 2XNHA 3WGIA 3NBYC 3BZWA 4IJUA 2PLRA 5KC9A 2DQZA 5EQDA 1T35A 3ZHQA 4CFZA 4O3MA 1BRMA 4U6QA 3A25A 3GG9A 1UINA 2EWMA 5E6UB 2E48A 5LYJF 5G1NA 1QH8B 4KN5A 3GFRA 5BXQC 1XDDA 3EIHA 3PNMA 2Q2VA 3FN4A 5G3YA 3EY4A 5FB3A 5KO2A 3JYHA 2RGGA 4P4SA 4UQLA 2CMGA 4CMAA 3K2EA 5EA2A 4LRSB 3CF4G 3FUCA 4KPGA 1JBKA 2QAGC 1K7SN 3DE5X 4B6GA 4YAKA 4OLAA 4J9UE 1CUUA 4CG1A 2ORIA 3O3NB 1FSZA 1M6VB 1MIOB 1P8JA 2X1MA 3I9V1 4NJEB 2HUNA 5JCXA 3D3JA 1FFSA 4CN9A 3HYNA 3L1JA 5AM1A 3GFTA 2XTAA 5JALA 2X0RA 1T36A 2H7CA 3CBGA 1L5HA 3ZU6A 4M1SA 1OAOA 4TLDA 2D54A 5MGNA 3PV0A 1MB0A 1JSCA 1RC0A 2I6TA 3KJXA 4MS4A 4F2PA 4YHHB 3H9GA 4V1CI 1TT7A 3KQOA 4DUYB 4WN9A 3OMLA 3ICQB 2VJOA 1DEOA 2JI4A 4RADA 4MHSA 2JC3A 2X5OA 1OV4A 2D1SA 1C3XA 4JYBA 3OM8A 4RESA 2EHJA 3FMOB 3L8MA 3U13A 1RI2A 5DZSA 4S3MA 1FUIA 3FVTA 1QS0A 3AEZA 1PZNA 5GM2A 5CVVA 2GSWA 2PUWA 5JI2E 2AOUA 2EKBA 2I7VA 4HEHA 5EIEA 4XPIB 4Q4HA 3SX2A 1DLJA 2B5OA 3C7AA 3TG8A 5F7JA 4LQ4A 2E4XA 2QQ0A 1EBBA 3I42A 3GJZA 3D8TA 4E32A 2CWWA 2CV2A 3FTDA 4JL6A 5EJ8A 2BRUC 4EBBA 2WYIA 1BZYA 3PGJA 3LA6A 4BDTA 3U5TA 2IY9A 1IRIA 1T8WA 3PYMA 1T2DA 4PIVA 1CRQA 1ZICA 2R6DA 3LNCA 3IBCA 3MFYA 3PPVA 4R2JA 4UBOA 2V8OA 2AR9A 2QI9C 3AL3A 4TXLA 3V80A 1Z4PX 3QUTA 1QH0A 2IX9A 4F4IA 3VTFA 1IULA 1LI4A 3WL8A 4UBLA 4MW5A 4Q7KA 1GVHA 2EL7A 3CMMA 4X95A 1AN0A 1VJRA 3SS7X 2ZBUA 4Q4CA 4CMBA 1X6VA 2E1PA 3FUWA 1ONPA 1Y1SA 4HH0A 3I9FA 3W0LB 2OLKA 4G8BA 3ZW8A 3G5TA 3EGVA 2J31A 3K94A 4FFBB 1ICIA 4NWIA 1E69A 4V2UA 3U3DA 1QP0A 2ZYDA 3UK6A 1TKRA 3L7OA 4QOHA 5BSKA 1CEYA 1P1CA 1XZDA 4KQXA 3R20A 2YWJA 4X0EA 3VPDA 3CSUA 5KCZA 1EXDA 3HM9A 2JEOA 2ZM5A 3PNSA 3TZKA 2WJ6A 3DXFA 5LZ4A 5TV2A 2GZMA 2OFFA 4CMEC 2GKGA 1H3FA 3QBTA 3AU9A 1F8XA 2FVYA 3ZBTA 4C05A 2FW1A 1YB5A 1ZUIA 2WV9A 4ZC8A 4CKXA 3VAZA 4RAQA 5JXIA 5CDSA 1KFKB 2JAHA 4XVRA 4UEWA 2GESA 2XCQA 3GN2A 3PKIA 3QFTA 4NFHA 2JAXA 4MV3A 5JQWA 4NVRA 3BQ9A 4Z0NA 6CHYA 3I5MA 4R8RA 1NUTA 3HCDA 4QULA 1VPWA 2UAGA 1QC5A 3PU6A 1PNQA 4UMDA 4BS9A 3R41A 4FD2A 4G4IA 1YBHA 5G40A 4ZCPA 5CLFA 3QLVC 3LPMA 4MUYA 1Z36A 4RK7A 4RXTA 2O8VA 3N2KB 3WGZA 2JFVA 3PDCA 4NLEA 2OXEA 5EMMA 3OKAA 4RQBA 1BWSA 1UZNA 3RTBA 4EVSA 1G64A 2FFJA 3AH8A 3BRSA 2IH4A 3D2CA 3LW7A 3NCTA 1I10A 3DV0B 2PXCA 4EHKA 4KV9A 1DVRA 2VT7A 5KSYA 3B53X 4N5LA 1B0PA 4W7HA 1VCHA 1KSFX 4JJ8A 1KK3A 4RZQA 4YAIA 3VMMA 1J07A 2HA2A 3HWSA 4GECA 4TS3A 1SVLA 1ZD5A 3UHPA 1Y3BE 3R6DA 4DMRA 1JEQA 3E70C 2FP4B 2AYXA 1CP2A 2VDRB 5F2EA 3OWXA 3W6PA 3NG1A 5LNK1 3HGMA 4C4PA 3SOZA 4X66B 3OJ0A 3R6LA 3E8XA 3FF1A 3EDMA 3J7TA 3LPDA 2PQ2A 3LY5A 4N6GA 4TQ9A 1Y63A 5IDYA 2E4ZA 3GGJA 4IVQA 2Y0EA 3VYVA 3OLVA 3JALB 2R1TB 4KDCA 4QUBA 4BL5A 3S2SA 4E13A 4EYGA 3F3YA 1R15A 4LWZA 3SIWA 4P81A 2HU8A 3TTWA 3E61A 5GZ3A 2XR1A 1L7VC 3CNOA 4IICA 1BSVA 1TNDA 3BF8A 4KKVA 4QBIA 5FHRA 1BXRB 5EWJA 3UANA 1GAQA 2WQ6A 1AA9A 3COYA 3L1VA 4O4LB 1U28A 1XA0A 4EB6B 2FPSA 1F8YA 5GTDA 5FWNA 3T4UA 5FPKA 4DUGD 1QFXA 1FC0A 2WICA 4JNCA 5EXXA 1E5XA 3LOPA 3O8DA 1M1YB 2DY1A 5CUQA 5JAUA 4LYYA 1F5SA 3LPAA 2I80A 1I2MA 4E11A 5TGTA 1JVBA 1JFTA 1VJGA 1YRHA 1LVUA 1CUBA 2X13A 4AQDA 1KF0A 1YA8A 3V8MA 1G7TA 4KEAA 3ZYZA 4DSOA 2VDQB 3GCDA 3RB8A 5IBQA 1PYGA 4F6CA 4Z4IA 1R5NA 1NBHA 4ALJA 1S2NA 3IQIX 3CLRC 4ZOCA 3GU3A 3UVEA 4KIWA 4MWDA 2N47A 5C1DA 4YMIA 3RROA 2Y76A 3EASA 3NNNA 2PUHA 1JR3E 1QH9A 3AHCA 3AXSA 1F4PA 2IW1A 3M1YA 4JK3A 4MV1A 4WCFC 5FWYA 2F1HA 3WL5A 1CULC 5AW1A 2XIJA 1A1VA 1K7XB 3EGCA 1ZZGA 1ECBA 3LE8A 4KR2A 4XE5A 3SCZA 1D03A 2ZKLA 1C3EA 2A78A 5B4TA 1WPRA 3R4CA 4IP0A 1OGJA 1R0RE 3B6EA 4GC5A 4MVCA 4IZHA 2BFOA 2X0JA 4HEA6 3BAFA 1RYEA 5LLTA 1ZI9A 3EZ2A 2VDWA 1VM6A 4Q1BA 2IXGA 1SBIA 3IPYA 1FS4A 4BNKA 5IXYA 1XAGA 2R65A 4DJEC 1NURA 2WYHA 3AF0A 1WZEA 4H08A 3PEWA 1YZUA 4FPXA 1MO3A 4OK5A 3VISA 3PXXA 2JASA 3JPWA 8ATCA 1UC4B 5JZOA 2J9ZB 1NW6A 3MYRA 1VIVA 4B3XA 1KR2A 1TK9A 2PT5A 2E5WA 2HWUA 3SJUA 2I8CA 2GERA 4A36A 1P44A 1E2QA 1QOPB 1T26A 2XMBA 4UC0A 5B57C 3O9MA 1NQAO 4C0AC 2PZGA 3JWIA 4HUJA 2DUJA 3DFFA 1PJSA 3I9OA 2Q2OA 4RIFA 2FRDA 3QFSA 4RTSA 3N8NA 3P32A 4QAJA 3BJZA 1ZCZA 5L3ZA 2GYYA 1MV5A 1WDTA 3KLNA 5K3CA 1AHNA 3HH8A 1SEPA 3PENA 4AMUA 4DQVA 3IUPA 4R1MA 2GEFA 4RTLA 1HDIA 1M2EA 4ZO7A 4DV5B 4PRLA 2BE7A 2DBVO 3FTCA 4GI7A 3KZKA 3KCQA 5IJAA 4DNQA 2FDRA 1VIAA 4ALIA 1WO8A 3PITA 1EXNA 3FYUA 4JU9A 5IMBA 4CIBA 1LDEA 1IXZA 3UMJA 5JMTA 2GF2A 3HACA 1Q7RA 2XOXA 2ZYWX 1ECLA 1M2FA 1M2OB 2JGLA 4PPYA 3K70D 1R4MB 1G38A 2Z1DA 4LRQA 3FBTA 1FU7A 5KAPA 5DFAA 5ALOA 4ZCTA 3NDBB 1J9GA 1AA6A 3SICE 2C78A 3S1AB 1XYGA 4BWYA 4E0BA 1ZN7A 4QGHA 1IB6A 1SQ5A 4V1CB 4D0GA 3ENNA 5LQKA 1X87A 3RYCB 2Q45A 3QY9A 2B30A 1K88A 1ZUNB 2Q3MA 2E2WA 3DMDA 1KS9A 3IURA 3QVGB 5AXDA 2QL5A 1V8PA 1Y6RA 5TQVA 4CKYA 4DY6A 1KI6A 4BJ5A 1YO6A 3HXOA 2QRNA 1J8YF 4Z4HA 2A5YB 3M4YA 2ODPA 4MVJH 2PBZA 4K8RB 3J81A 4O2BF 1DAEA 1JXQA 1HEIA 4E1BA 2JCVA 1Q0ZA 1TECE 4HDKA 4MR9B 4TLBA 5ALMA 4F93B 1JFRA 3CUSA 5IZCA 1XTQA 2P69A 1PNOA 1SVOA 4BQQA 4C9BA 3KQLA 2B94A 3QMWA 1PJLA 3N8KA 2JDID 3DWGA 1MJFA 3FFXA 4M7OA 1FYVA 5E1BA 1T2AA 2YWEA 4U2CA 4LVOA 1L7QA 4Q12A 4AF8A 3AY3A 3VC1A 2PUBA 4PRKA 1PYOA 4JP2A 5ENVA 3E7PA 1R9MA 4NCXA 4F2DA 2JL1A 2L0XA 4H1VA 2QRLA 3OM1A 5F5NA 1QHYA 5E9AA 2HDWA 3NPAA 2ARKA 4IJVA 4D99A 3NJ8A 3IEPA 4NXNB 3V4FA 3A3KA 2ZWVA 1SUDA 2GR9A 5FA6A 2HPZA 2O54A 2HJRA 4R1UA 1NBMD 2B69A 4DM4A 1A9RA 1P2UA 4H4EA 4MW2A 2SNIE 1G42A 3QEKA 3B7GA 4MQBA 3TNFA 4RGVA 1E6CA 5I4IA 1RU3A 2P3SA 3FPEA 1CDEA 1QBGA 2Z09A 2Q62A 3RT1A 4CCYA 5JLJA 4EUHA 2DC1A 2HQBA 3OQ6A 5TNXA 2C59A 4KNVA 3R9KA 4OBBA 1A7AA 2YV3A 3C70A 2CFTA 5LOVA 2FSUA 4HDSA 2PZEA 3DH0A 2Q5HA 1V9SA 3ZJ4A 1KY4A 3M1AA 1ZUWA 3JQFA 4LDRA 1PE0A 3KQHA 2XADA 3C5HA 3FDFA 3DZHA 1KA9H 2Q0XA 4B46A 1W0KD 4KNYA 1C7JA 3K0KA 4O3FA 1MOQA 5A3SA 4TL7A 2FPOA 3JZMA 3MUOA 3KSBC 1UAGA 3GXBA 4TMWA 5ARBA 3P2EA 3PXCX 4QOJA 5EJ4A 4CEIA 4JNKA 4WLUA 2CJYA 3ASZA 3M83A 4RPJA 4HX5A 1LRJA 2CZQA 1T6YA 3R3WA 4KXWA 4O8ZA 2IUUA 1GP2A 2RIPA 4KDRA 4WPGA 3X1DA 4XFJA 3TQHA 3GD7A 4I55A 3HNOA 1ZJYA 4IAOA 5E9WA 5J2UB 3RS2A 1UXOA 3JQCA 1T4BA 3M8KA 1CHNA 1GDHA 1SUIA 3WKDA 3VR5H 3HXQA 1SZPA 4UTXA 1J3UA 4WZZA 5JH7A 1HYQA 1RBMA 2E55A 3GEPA 4TROA 3FBWA 4DV6B 1DC8A 4JOBA 4XYEA 1ZRNA 2FDXA 5A62A 3D1VA 1UKCA 3B2NA 3DULA 3WGHA 5IF9A 3JZIA 2ZT5A 2WWXA 2V9ZA 3C45A 4QYSA 3EQ6A 3SFTA 4D9NA 3ZVKA 1QHEA 2VXOA 3PUWA 2C4VA 2XE8A 5D7NA 5FOVA 3TM5A 3AP2A 1I3MA 4EA7A 4YAJA 1QP4A 2QDXA 3EHDA 2YCBA 5H68A 4JQZA 2AG6A 5FUWA 2D7DA 1JZQA 1W6RA 2PT6A 4D3DA 4IX1A 9LDTA 1JA0A 2QX6A 3ABQB 3PC6A 3H99A 4MRVA 4Q9IA 3WTBA 4AFNA 5JJKA 2R8XA 3DTTA 5HTOA 1QO9A 2ZBVA 5EJ5A 3FPJA 2LUOA 5L4SA 1JAZA 3MA0A 4AB1A 4QFMA 4Q18A 3K0AA 1N2HA 3I3SR 4IQGA 1EJ2A 3H8SA 1EYZA 3I2HA 4MQUA 4MRSA 4MV7A 2BF4A 2O8DA 2O8CB 3A2MA 4OQLA 2HU5A 2BFBB 2JJMA 4Q66C 1AUOA 2GARA 3GLRA 4YPOA 4LNUA 6REQA 5FBKA 1Q7CA 1R3DA 1WXXA 2NG1A 2G8LA 4YXWD 3WRXC 3NVKI 1O94A 1WB6A 2VBIA 3IJ5A 4ZXPA 2VJAA 5E9JA 3PJDA 4BVLA 5K7SA 4JLOA 1SQFA 1CZUA 1KFJB 4AG3A 1Y8QA 4DTIA 1LLDA 2WM2A 3VO8A 1G8MA 3WLEA 5JAZA 3LF2A 1IG0A 1MABB 4PG6A 3MTIA 1VRVA 2EZTA 4R2IA 3PC8A 2Q1SA 3PWSA 1XTRA 4TTQA 3RCBA 1EK0A 5EJ9A 5IKOA 3B52X 1Y1LA 3HU3A 1RWKA 4P2BA 3R2JA 3KG2A 2BLLA