3BWVA

Crystal structure of deoxyribonucleotidase-like protein (np_764060.1) from staphylococcus epidermidis atcc 12228 at 1.55 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
177
structure length
167
Chain Sequence
b'TRQRIAIDMDEVLADTLGAVVKAVNERADLNIKMESLNGKKLGLVMDILKEPGFFRNLDVMPHAQEVVKQLNEHYDIYIATAAVPTSFHDKYEWLLEYFPFLDPQHFVFCGRKNIILADYLIDDNPKQLEIFEGKSIMFTASHNVYEHRFERVSGWRDVKNYFNSIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative 5'(3')-deoxyribonucleotidase
publication title Crystal structure of deoxyribonucleotidase-like protein (NP_764060.1) from Staphylococcus epidermidis ATCC 12228 at 1.55 A resolution
rcsb
source organism Staphylococcus epidermidis
molecule tags Hydrolase
total genus 49
structure length 167
sequence length 177
chains with identical sequence B
ec nomenclature ec 3.1.3.-:
pdb deposition date 2008-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 3bwvA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3bwvA01
2X4DA 4PNHA 4G9BA 4BNDB 3FM9A 2FEAA 5AM4A 3AR8A 2I54A 3WK9A 4HGOA 3NRJA 3A1DA 1X42A 2FI1A 5ALYA 5AW5A 2HEGA 4CF4A 2ZBFA 1QH9A 1VFPA 2G08A 5AVRA 3WKBA 2HSZA 3RF6A 5ALPA 3NIWA 4G63A 3KDPA 4CF3A 1RKUA 5AW6A 2AGVA 5E0OA 4HGPA 4BX2A 1Z5UA 1CQZA 1ZJJA 1N8NA 4MUMA 4HGQA 2CFTA 5AK4A 3OCVA 5AKJA 3PDWA 4YCNA 3L8GA 4DWOA 5AVUA 5ALHA 3ZU6A 1ZD4A 4HGRA 1T5SA 3UM9A 2HHLA 4BEWA 2YMLA 5ALWA 4Y2UA 1AQ6A 4UM7A 5JJBA 3SKYA 1L7OA 3M1YA 4UAUA 4BNDA 3B9BA 5AW4A 2G1AA 1J97A 2B8JA 2R8EA 5ALTA 2RAVA 5AM1A 4UMEA 3TLMA 3ZTWA 3I28A 2HF7A 4YIHA 3WK5A 3IJ5A 2HX1A 5AM0A 3AR2A 4XQ0A 2Q5EA 1YS9A 4KNWA 2WF9A 2B1QA 4BBJA 5AVTA 1WR8A 2CFRA 4C4TA 2ZBGA 4EEKA 4I9FA 2FPXA 3BWVA 2AH5A 4AS3A 4H1WA 1L7NA 2EAUA 2FUCA 1T5TA 3FZQA 3WKDA 3U19A 4UU1A 4YGYA 4J03A 5ALEA 4E88A 3A1CA 1MH9A 5AVWA 3AR5A 2NO5A 4UMDA 5AK5A 1ZD5A 2B30A 3DV9A 2R8ZA 4DFDA 3R9KA 2G07A 4DCCA 3PCTA 3WGUA 3OCUA 4BEVA 5ALUA 2OA0A 2IOFA 3K1ZA 4GIBA 4NWIA 5ALQA 5A3QA 2BY4A 3WK8A 3ZI4A 1K1EA 3DDHA 3QXGA 3OCXA 4XE5A 3E58A 2QYHA 1ZRMA 2FPSA 5AHXA 5AW3A 3QLEA 3A1EA 4EX6A 2IA5A 1JUDA 3FVVA 4YH1A 2HI0A 3NALA 3B8EA 5ALIA 3E8MA 4L6AA 2YJ4A 5ALFA 2MSNA 3SHQA 3KC2A 3ET5A 1QQ5A 3CZ4A 2B0CA 2I33A 2YJ5A 1T9ZA 3QYPA 4HGNA 3AR9A 3HLTA 5AI4A 3N1UA 1ZD2P 2RB5A 2PR7A 3QU7A 3WK7A 4RETA 2CFSA 1U2TA 3KD3A 4OCZA 2C8LA 2D2VA 3ZW7A 1FEZA 2W4MA 3N8GA 1ZS9A 1RC8A 4AP9A 3QNMA 2JAOA 4OD0A 1SU4A 3W5DA 4FYPA 5AI0A 3N5KA 3OCZA 1WVIA 1YV9A 2I7DA 2AMYA 2GHQA 4BKMA 4O8CA 5AVQA 2YMMA 2FDRA 3FGOA 5AVYA 4UASA 5AM2A 3AR4A 4UAVA 1U7OA 5A3SA 2RBKA 3SMVA 5AI5A 1SWWA 3AR3A 4DW8A 2HOQA 3HYCA 2YY6A 3R4CA 4CNQA 3QUCA 4JB3A 1Z4IA 2ODAA 1TA0A 3GYGA 3L8FA 2P27A 5IT4A 5ALMA 1S8OA 2B1RA 1Q92A 2R8XA 2YBDA 4GXTA 3WGVA 4ZEVA 3L8EA 3KOOA 1Z5GA 5ALKA 4QJBA 1O03A 3L7YA 5ALRA 1Z4KA 4OFZA 1RMYA 2GFHA 2G0AA 3EF1A 1ZRNA 4F71A 2GO7A 1Z4OA 3SLRA 1L7MA 3F9RA 1U02A 2C8KA 2I55A 1Q91A 5AM3A 2IOHA 3WKEA 3DNPA 3W5CA 2YJ3A 1RKQA 2C9MA 2PQ0A 2MU1A 4NFLA 3ED5A 3OPXA 5ALDA 5AI8A 1IWOA 2DQSA 2I6XA 4ZEXA 3UMGA 2HCFA 2O2XA 5ALLA 4KNVA 3ZVLA 2B8EA 2WF6A 3ESQA 5AI9A 1RDFA 4ZEWA 1WPGA 3EPRA 2JAUA 2WM8A 3W5AA 1QQ7A 5AKGA 4CE6A 1YNSA 2WF8A 2YN4A 5AESA 4UMFA 5AKEA 4C4RA 2WHEA 5AK3A 2P11A 5T41A 2BDUA 2Q4TA 5AVZA 2YJ6A 1Z4PX 5A3RA 3ZVMA 3MPOA 2FPRA 2YFYA 5ALGA 1N9KA 3I6BA 2B82A 3BA6A 5AI6A 4Y2YA 3B9RA 3ONNA 5AKYA 3W5BA 5AKXA 1O08A 4Y2PA 1U2SA 4NAVA 5ALNA 3KZXA 5AM5A 4NABA 4UU0A 2FPWA 1Z4JA 3NASA 1RQLA 5AICA 5AW0A 3QUBA 3R09A 5AW8A 1EK1A 1Z4NA 4FFDA 5FP0A 4BYGA 3ZX5A 3QU5A 5IS2A 4KYTA 3E81A 1NRWA 2C88A 1L8OA 2GHTA 3QU4A 2IOFK 2ZXEA 3KBBA 3L0CA 4BX3A 4YCMA 4MWOA 4UATA 1Y8AA 3QGMA 1J8DA 2HF2A 4EELA 4CF5A 5AW1A 5ALZA 2FPUA 5AKKA 2YMQA 1RMTA 1KYTA 1EK2A 3PGLA 3DAOA 2OM6A 3U7FB 1NF2A 4F72A 3QX7A 1YDFA 2EATA 2OYCA 1LVHA 3E84A 4Y2XA 3ZTYA 1VJ5A 4YIKA 2EARA 2G09A 2GMWA 1L8LA 2QLTA 4Y2QA 4Y2TA 1RRCA 1XPJA 3ZWDA 1U7PA 3AR6A 4YCLA 4XOUA 1QQ6A 4FE3A 1RLOA 3WKAA 4IG4A 2R8YA 5IT0A 2W43A 3RFUA 5AVXA 5AIAA 2HO4A 2W11A 2P9JA 3MN1A 3OTQA 5ALJA 4Y2SA 4Y2JA 5AW2A 1RPZA 2JAWA 1L6RA 2O9JA 4XPZA 3QU2A 4Y3UA 5ALVA 3U7HB 1RKVA 1RLMA 1CR6A 1QYIA 3ZVNA 3IB6A 3QUQA 1Z88A 2NO4A 4L57A 2AUTA 3ET4A 3CNHA 4Y2RA 1TE2A 3N28A 2G80A 2VKQA 3AR7A 3IRUA 3NUQA 2G06A 3U7EB 3L5KA 2P69A 3EF0A 2BDEA 1SWVA 4IFTA 5ALOA 3P96A 4BX0A 3WK4A 2C4NA 1PW5A 3L0YA 3L8HA 3NAMA 3M9LA 3NANA 4KX5A 2NYVA 1VJRA 2PKEA 4NV0A 3FPSA 5AKLA 3WK6A 3U7GA 1TJ3A 4Y2VA 3U13A 2I34A 2ZOSA 4UMVA 2JGAA 2CN1A 4KX3A 4UM5A 1TJ5A 1ZD3A 5AVVA 3PGVA 3L1UA 2ZG6A 3L0BA 2OBBA 1RQNA 5AKHA 3D6JA 3QU9A 5AKIA 4EENA 4C4SA 1RMQA 3FPBA 1L7PA 3ZUPA 1Z4MA 4JDPA 1YJ5A 5ALSA 1RLTA 4HYTA 5AW9A 3A3YA 1ZOLA 4I9GA 4UW9A 1Z4LA 3I76A 2YMPA 4UARA 1WZCA 1TJ4A 3MC1A 3L1VA 3SF0A 5ALXA 4QQFA 3ESRA 2ZBDA 2ZBEA 1S2OA 2Q4RA 4RESA 4J2TA 3WKCA 3UMCA 1Z4QA 3OCWA 4B6JA 3S6JA 3OCYA 5AKZA 2WF5A 3UMBA 4EZEA 4HAIA 4AS2A 2WFAA 3ZWKA 3ZX4A 5AIBA 3QUTA 1F5SA 3I1YA 3VAYA 4L6CA 2IYEA 1NNLA 1LTQA 3EWIA 5AVSA 1YMQA 3SKXA 2FUEA 4EX7A 5AK6A 1XP5A 2HDOA 5AW7A 2WF7A 4OHFA 3MMZA 2JARA 3N07A 3SD7A 3U26A 2RARA 1XVIA 4KN8A 3J7TA
chains in the Genus database with same CATH superfamily
5FD8A 3U3MA 2E21A 4PNHA 2OCDA 4Q3EA 1CVIA 2NV0A 2WICA 3TMAA 1I94B 3CRZA 2ZGVA 1COWA 5LDDC 4MVJP 2YDXA 1VBMA 2I54A 1GQOA 2YIVX 3VSCA 2V96A 2B61A 5CK5A 1NVVQ 4YJ2B 2BD0A 1WSAA 1XRLA 3SOPA 1H2AS 3V42A 2X4LA 4EFNA 1BE0A 2C2WA 2WNHA 4HWTA 1PUIA 2A94A 2JA1A 2B4KA 4WDRA 1FUOA 2HSZA 1WDTA 1DCKA 4HBGA 2BONA 3KLPX 2Z8XA 4JI3B 3H4MA 4H1TA 3KDPA 1GUAA 1UOOA 1GQFA 1LSSA 2OHHA 4EYQA 3W5JA 1YKGA 3IDOA 3MLEA 4RC9A 1TECE 4H3HB 2G0NA 5BSFA 2RGXA 4RA9A 1WDMA 4RSMA 4WLVA 1NVMB 1JJIA 1U11A 2NUPA 1UT5A 3OWXA 3LPDA 3TZLA 1SBHA 1D0SA 1AGPA 4BQFA 9LDTA 1MU0A 3PYMA 4DV4B 2IZ1A 1TX4B 3KRTA 4L2IA 1P1CA 3GA7A 3MXOA 5IDWA 3F8TA 1F0NA 2V6BA 4MEBA 4ZVRA 4Z4IA 5FORA 5I7EA 3NNSA 2WA2A 2EKLA 2JI7A 3L05A 1QMGA 2OD7A 1RWQA 2MSEB 1DPGA 2VRNA 2W8ZA 5LLSA 3FHLA 3HBMA 4UPDA 1RHJA 4ENWA 2FZWA 4ZJPA 4LRXA 5GJBA 1BU8A 1U04A 2IGTA 4WOCA 4MVYA 5CD1A 5CFRA 4DKXA 4RXUA 4GXNA 5JHGB 3AVUA 2P62A 4J3FA 4KC0A 4JLBA 1KAQA 1DCTA 4FBMA 3MTBA 2JGDB 2BKUA 1P4HA 4FGKA 3PUJA 2QL5A 2I1WA 2ZUBA 2GXAA 5H3CA 4YI5A 1H3NA 3AERA 3GH1A 5HFAA 2SHKA 3CVYA 1T8YA 2QZ4A 4RKQA 3NHJA 2H18A 2HMWA 2UZ0A 4MWGA 4C7XA 2D4HA 4AS1A 3N3BC 4M2LA 1E4YA 3JYLA 4PXAA 1BXRB 2UZ1B 3C3XA 3R76A 2WYIA 4ASUD 4BL5A 1G41A 2O2DA 3AZOA 1MC4A 4YRPA 4INJA 5EYPB 1LK5A 4EHNA 3PUHA 3BWVA 3KVNA 5JY1A 4YGXB 2QTRA 2CXPA 4AWAA 1LC0A 3GGDA 1GZUA 5F9HA 4DVJA 3RSFA 2O19A 3FPAA 4J0DA 3GU3A 1KOLA 3EXG2 3CI0K 1M34B 4QHSA 3HJFA 5TARA 2N1MA 2X4IA 5KYUA 3TJMA 3QLJA 4C3ZA 1VI6A 4DLRA 1DADA 3P2EA 1KARA 1TMKA 2YHUA 4L5JA 4YLEA 5KQSA 3CX7A 4GX2A 5KAPA 1JR6A 1LBEA 3F96A 3U1VA 2WIGA 4Z0PA 2Q29A 2JGDA 5FFMA 5CDYA 3NS7A 4A8JC 1KF0A 3QEKA 3A37A 3RD8A 2PWAA 4TMZA 3WGUA 4QOJA 1QQTA 3T3IA 1P5RA 4BEVA 1QYRA 2ZYUX 4D5EA 6AT1A 2C7PA 5L45A 4DARA 4LK3A 1Y5LA 1HY0A 1JQLB 4BGEA 2XEXA 3ZV7A 1SHTX 2EGUA 4LHSA 4U8HA 4XZ3A 1BXRA 2UZ1A 4EHLA 4ZK2A 2AG1A 2FG7C 1PJ2A 3OEED 4I4TF 2AMLA 1K7WA 1CKEA 2GZ1A 3FTFA 2FSSA 1E4EA 1ZRMA 2QF7A 5AW3A 5I7HA 1B6RA 2DERA 5ADWA 4OJKA 3EZGA 3GJZA 1C3XA 3ZDXB 2Q1SA 3KDSE 1XVLA 3NALA 4R5MA 2I4IA 2VCEA 1I24A 2QOEA 4O5OA 4X20A 3RNOA 1U7TA 2FKNA 4LE0A 5CLIA 4EYEA 3EVFA 4HLDA 3WAKA 4CLXA 3HEBA 4UDNA 2QLMA 2WE8A 3BWEA 3V4RA 2PEZA 1JA1A 4HNQA 4LSMA 4MI9A 2AG5A 2VF7A 2PTRA 3LLVA 4X93A 5HKBA 1FZTA 3A2MA 1N5KA 4O8ZA 5H82A 1D7OA 4QREA 3KLBA 2EX4A 2H4JA 4V0KA 1PX0A 1QNFA 3D1VA 1YR2A 2B78A 4OCZA 4UEWA 3ZY4A 3AEQA 2IYSA 2FEKA 3UTDA 5GPBA 1VE1A 4AP9A 5KNDH 2YOGA 1U1CA 5C4MA 2C5BA 2OFFA 2R1TB 3LGAA 1RC1A 2QX6A 4W7HA 5AI0A 5DV9A 1ISPA 5JAQA 5JNTA 1DLIA 4EPVA 1J1ZA 2YJTD 2NVWA 3LPLA 2WNSA 3TZHA 3FYUC 2P3QA 4ICIA 1Z0UA 1C7EA 1SHUX 3NOQA 4KPGA 2FDXA 4IKPA 2ZKLA 4IVQA 1HQKA 3HY3A 2V5AA 1O5IA 5CW1A 5FYQA 4LCJA 4NR0A 3BE6A 2BFEA 1KJJA 2QW1A 2PWPA 3DDNA 4C88A 3N58A 4OUDA 4Z0TA 5A3SA 3BRQA 1MAUA 1IOZA 2ZS8A 5TQ2A 3IP1A 1KI3A 3TFQA 3UAXA 3FUWA 2ZUSA 5ELMA 2FQWA 5AI5A 2OZEA 4NBWA 4BQPA 2HOQA 4US0R 1WCIA 3LVRE 1IVYA 2ZJ6A 5F7XA 1H2HA 2Q3JA 2P75A 5GIPE 3I30X 2CXNA 1YDWA 4FFPA 4TYNA 2HBRA 4M98A 1VCMA 5FAXA 1DI0A 3VPGA 2ZXFA 4GXTA 3FIJA 3FOEC 3T7CA 1W6RA 3HHEA 4QJBA 3ZNOA 4COOA 4HTAA 3ZIAA 2HJ9A 3KR9A 1R6XA 2KX7A 3C6BA 3PHBE 4JC5A 2VJBA 1EGAA 3KJFA 3QV2A 4KXMA 2G0AA 3FTQA 3HLYA 4LBWA 4K9OA 3L6UA 2E48A 4QUEA 1Z5PA 3I12A 3RRFA 1ZOIA 2ETXA 4RH3A 4YRTA 4EG3A 1RPJA 1XRPA 5CM8B 2I55A 3CZ5A 1G9SA 1L0BA 2WVAA 3PHLA 2E87A 1C2TA 2VN8A 1A9XB 2WAXA 2V1UA 1SCNE 5IVKA 5ITZB 3GUYA 5CT4A 4ZOCA 2P3LA 2P6RA 4O08A 2HPZA 2JZNA 4WRRA 2EWMA 4AU1A 1NVVR 2JJMA 4CLEA 3MJVA 1FVFA 2O2XA 4E5YA 5B30A 2LD4A 3PVSA 3H6KA 1ODLA 4K9QA 4REOA 5EP1A 2Q8NA 4AQYB 1WWKA 1RJ9A 2XCUA 4IW3B 4BE9A 4U2FA 4LDNA 1GUDA 1O3YA 4CMIA 3NYWA 4RJTA 5I9BA 4ND6A 5A62A 1VRCA 2ZK7A 4B7XA 4UMFA 3C97A 3PE3A 4Q9NA 3UC9A 2EZTA 1U0RA 4AM8A 4IZOA 4K9NA 3IP3A 3L7KA 1D6MA 1TIKA 4MR7A 4CL2A 1JDTA 3IRVA 3OE5A 2NZXA 1IXZA 2GEFA 2K2QB 2XV1A 4MCHA 5FQNA 2LIVA 2ZRPA 7AT1A 4NCIA 4OGKA 5J1SB 1YBVA 6ABPA 1D2GA 1NRJB 1U1EA 3TL6A 1S2GA 3PQ2A 1HL7A 3ENKA 4MUGA 1FQWA 3F2VA 4JJAA 3IH5A 3FMGA 4KIWA 3A04A 1QRTA 1C0IA 1EGVB 3NHPA 4OAQA 4NE7A 4PYKA 4QOHA 4MHOA 5DH9A 4QO8A 3N86A 3AKEA 3W6UA 4OHPA 4HL6A 5I9MA 4CQJA 1Z4JA 4J1TC 3U39A 3B89A 4KP7A 2VPWA 2W2TA 4UJ5A 3C6ZA 1JI0A 1QRUA 3FFTA 3PC7A 1MC1A 1YRLA 1R66A 1ZKDA 2J6HA 4JP1A 3U09A 1CJKC 3D8TA 2A0UA 1NU6A 1Q57A 5J58A 4BRSA 3ADCA 4MQUA 2OY0A 2LCQA 4D74A 5AMXA 1XCJA 4UTRA 1YKFA 1TL7C 4JC0A 4IRUB 4QGGA 2AK2A 5B57C 1ZJ6A 3HU2A 4E46A 5IKPA 1F5NA 2BZSA 5JYEA 1AA6A 1PCXA 4HP8A 1C0EA 3UGTA 2QE7A 5KNDA 1NUQA 1EIZA 4QHYA 3A70A 1VE3A 3E1GA 1ADGA 4MRRA 1IJBA 1U7WA 2Q0QA 3AVPA 3WRVA 3EVNA 2P4SA 4DIEA 3JAWB 1EE2A 3VPAA 2P90A 3BK7A 3G2KA 1YQ9A 1KYTA 3N87A 4HB2A 1EK2A 1E3TA 3PGLA 5FNVB 4ZAWA 3W2HA 1OROA 3VH3A 4F97A 5BYAA 1JMYA 1PVVA 3LE8A 3QX7A 4NXNB 1RC0A 1VKOA 3AG5A 2NIPA 1JU9A 2AHOA 4BMDA 1M1UA 3TRFA 3OHMA 2AD5A 1RKXA 2G36A 2PRZA 2WQZA 1C2YA 2WZDA 3HXTA 4IIJF 4WFKA 4KIGA 3AF4A 4Y2QA 5DEIA 1ISRA 2GZ2A 2NO9A 1XPJA 2C8JA 4KFSA 1GKUB 4P80A 2A5GA 4YCLA 2BKAA 3HO8A 3UMMA 4B3GA 1E2BA 3BFKA 1UWKA 5JO9A 4I2VA 3SC2B 1ZN2A 4ALNA 4QDKA 3WKAA 4LAFA 1AE1A 4QASA 5SY4A 4FIDA 4EW2A 4BNNA 3WMEA 2Q6VA 4XYEA 1X7WB 3ANXA 5EZQA 3RUCA 4M7OA 3O4IA 3F6PA 4PPGA 3WWZA 4CQNA 4KLNA 4Y1RB 4M8IA 1N6NA 1TUBA 2G25A 4JL5A 3TL3A 1K98A 1U9IC 4TTPA 4RIHA 1X9IA 4OI2A 4DQUA 3KXIA 5A04A 3VSBA 3LBIA 2XYHA 4I5GA 3TGLA 1WHTB 1XRSB 2QJFA 3FETA 3BIWA 3JAWA 2JAWA 1IPHA 4QWMA 2ZW9A 3JAKB 3QXCA 4Y8VA 4KV9A 3QU2A 4GZ5A 1D4AA 621PA 3M7IA 2OAEA 4I46A 5FPQA 4F4DA 5ALVA 3LGSA 4OXXA 5K8LA 1ZW6A 3CMMA 1I14A 3LQ2A 1Q95A 3AXSA 4RJLA 5J59A 2J9FB 1BKDR 4NOJA 3BWXA 2H29A 2JIBA 3GLFB 4JUCA 3RIEA 4AMGA 2Q5QA 1H1TA 1YBFA 4TKUA 3O1HB 2Q1UA 1PYGA 2QYTA 4G5FA 3ET4A 5ITWA 3PQ7A 1O6BA 2YY5A 5I5EA 4X91A 4GBJA 3SC2A 2VS1A 5B7GA 1VL2A 4R83A 2JHPA 4J1QA 1U0LA 4PGMA 2GBIA 1DKMA 4OXIA 5AHWA 3G89A 1DL5A 2QGFA 2W0SA 1X7WA 2HA3A 3EF0A 3ORQA 2GI4A 1HK7A 2C99A 2GILA 1PWXA 4MULA 1QAMA 4Y1RA 4FYMA 1HMPA 2W93A 1DUVG 2I6TA 4P3NA 4WK4B 1OILA 5G02A 2B94A 5KDOA 10MHA 5IUJC 1B1AA 1XDDA 1SVUA 3CGGA 4OHMA 4O0MA 4NCAA 1QVZA 3NANA 4TMVA 2ZJ3A 2Q0HA 2RE8A 1T36B 3LQYA 4P5PA 1I0LA 4GPIB 1N2GA 4W82A 3THOA 3GJQA 3GVXA 1OF1A 1E8MA 2QD1A 1I9CA 4PTYA 1JEOA 1FSGA 3OIFA 1V96A 3GX1A 2NV2B 4IIGA 4ETIA 1RXVA 1PDOA 3PENA 1JG4A 1Z63A 4MQBA 2JGAA 4TT8A 3ZCVA 1DBWA 3AL2A 2PT6A 4BO0A 1Q19A 1P5ZB 1TJ5A 3ND9A 1COWD 1JQ5A 5LA6F 4QUKA 3RGGA 2PN1A 4PHTA 4A15A 3EGCA 4JSTA 4L50A 2D5CA 4R40A 3ZK7A 3IQGX 4U7JA 1PEDA 4BCBA 3Q7SA 5D5HA 4PZZA 3UXYA 2BEWB 1KJZA 1SUFA 1ZD8A 2P91A 5HIIA 4WY8A 3L7AA 1HE2A 1FXWA 3AU9A 3GDHA 4TRJA 1D5CA 2OCKA 1WXGA 3DLTA 1VGQA 1JKFA 2WUWE 3GEEA 1X92A 4W8OA 2Q3FA 1ZUD1 3M1IA 4I9GA 1JJ7A 5DM4A 3JWEA 3BC1A 3EZLA 3GJTA 4UE3S 4CKXA 5KTKA 5ISMA 3WL6A 2JLWA 3MWEB 3EXFB 3ZHOA 2REBA 5DN9A 3WYDA 5TEWA 4EFCA 1G6Q1 1T36A 1YC5A 2AFIB 4CRWB 8OHMA 1U28C 3RHFA 5BQ5A 3WQQA 5AOAA 2P2GA 3DZBA 1UJMA 3VVCA 3UMCA 3TM5A 3ZWVA 5H3HA 4D9BA 1FS6A 1J23A 2VBGA 3KQKA 1L8QA 1ZCZA 1CEQA 3ZBUA 4E5SA 3FVTA 5LYYA 5BT8A 1HFWA 4OBBA 3DOUA 3D6MA 4GOXA 4OSOA 1W46A 3FDIA 4PC6A 3ZWKA 1N2EA 2A2ZA 1UC5B 3HSKA 4J0HA 4DXDA 3OUUA 1PL7A 2BEWA 3P9ZA 1YSCA 3AYZB 4LRUA 5DNVA 1SCAA 4LDZA 1OBCA 2WPNA 3A6JA 1XN1A 4CG1A 5CLGA 3BERA 3I1YA 5KNBH 2XF2A 1ZLXA 1ILWA 3QPBA 4JFRA 3PXEA 1YGPA 1K86A 4WNYA 4FDLA 4FT2A 4HEA1 3IUPA 3VDNB 1DPFA 1FPQA 1UANA 4LCEA 3TNDA 1IAQA 1GSAA 4KQCA 4TV9B 3PDIA 1KETA 3AP3A 3PC8C 3TL2A 5BW6B 2DVMA 5DI3A 5L7WA 2HMVA 3MWEA 3EXFA 4P3PA 4QPPA 1HNZB 2MMCA 4I9UA 4HEQA 1B2RA 2JARA 2NNLD 4IXMA 4P4TA 2GTHA 4CVNA 4B3RB 1U0JA 3VOAA 4B1FA 2AFIA 3QG1A 3RS2A 1E3LA 4XFDA 5F2NA 3MWFA 1AK2A 4DA4A 3HNRA 2GKOA 1MGPA 4LJSA 5JI2E 4O02B 1E64A 4GWLA 4FMDB 4IICA 4RLSA 1GHTA 2JLBA 2OMKA 3L6OO 4LV6A 4ZARA 2JIZA 521PA 2BKVA 1X1RA 3F7TA 3G02A 8MHTA 1X7XA 1R8JA 2XVAA 3IAHA 2OQ2A 4JMPA 1VXOA 3I0MA 4ZAYA 5BN3B 2C9BA 2PVSA 2ANBA 2V9CA 2O7VA 2W2OA 4QDOA 2ADMA 2ZBFA 3C1AA 3HB7A 3K1AA 3QBVA 4DBLE 2OHJA 3ZHCA 1CULC 3MCWA 1JZQA 1PV1A 1J49A 1F2UB 3IT1A 3DYBA 1YASA 2X8AA 5CAEB 1UMCA 3DNFA 3FMFA 4G63A 1B0PA 1XZLA 2IYZA 4D9FA 4ZRDA 2I0FA 1W4BA 2X1MA 3PT5A 4AP6A 1QU2A 5E0OA 3G85A 4MA5A 4BLTA 3V4VB 2XRYA 5IXSA 1DT5A 2D2IA 2FSHA 2ZVQX 3LT4A 4RS3A 3UT0A 5BUQA 1EX6A 3REFA 4TV9A 3STYA 3JD2A 1TB4A 5GZ3A 2D0IA 1ZNZA 5FOQA 3GLGB 2AVDA 3QVMA 5A4FS 1ZCBA 2P9TA 4U9UA 1V45E 3GP3A 4FM9A 4IHJB 1Y8ZA 2NYRA 1A04A 1XEXB 3NM6B 1JMKC 5ALWA 1YZYA 4PANA 1W1WA 4EVRA 2VSXA 1KYXA 1AG9A 5AJYA 2C2MA 3NWJA 5JMOA 2DFPA 3GVHA 4CLDA 5T8KC 2H5IA 4XSHA 1GL6A 3C4JA 2HCRA 1DJLA 3MT7A 1XCOA 5FBWB 2RAVA 4MKIA 1TCCA 2QPLA 1QHEA 4EBBA 3Q15C 5JO0A 5TXGA 3QBEA 5BN3A 2R8PA 5KOJB 5KPDA 4FE7A 5A05A 3H87A 4RVOA 4MO2A 2H57A 3DM9B 4PZYA 5CDFE 1CY4A 3COJA 1JJBA 1CCWA 1FVOA 1Q1BA 1AKUA 4L08A 1PG5A 3ND5A 4QEDA 1GN8A 2YYZA 4Z4CA 1JF8A 3I0ZA 2VQEB 5D2CA 2CDAA 1Z7BA 1NV8A 1P8JA 3K9QO 3USES 3C3JA 4ZGWA 5BSUA 3EISA 4WOJA 3SHWA 1L7NA 1TXGA 4ARZB 2II6A 4Q15A 1ZXXA 3PPIA 1SBYA 1U0GA 3GLGA 1MENA 2VAMA 2DUUA 3ZY6A 5EJ6A 3L4BA 1PR6A 5EQTA 4RYDA 3RSSA 3LCUA 4J0CA 4C30A 3FZQA 4UAGA 1TM7E 4O4LF 2DBQA 2I4TA 2ON6A 4I6EA 4TL6A 3TWOA 4DAEA 2GTPA 4DLKA 4B6RA 3SFTA 2ID8A 3UHJA 1SUDA 3QW2A 1UFKA 4PX5A 2XGGA 4IDCA 4FNOA 4NK5A 5E2AA 4KHZA 1OAAA 2VO1A 3S2GA 3KZVA 3VNRA 4E31A 4NNJA 5IXJA 1ORRA 3LPCA 3B52X 1T15A 3Q8XB 3MD9A 5DJ5A 1A8SA 1I36A 2JZCA 4BGVA 4CV1A 5JC8A 1VKZA 1V9SA 1Q0PA 4IIBA 2QYSA 5CB4A 5KOJA 2QI9C 1TT7A 4IWXA 2ZRHA 3F4BA 2HIAA 2A9RA 2OHGA 5D1HA 3H1FA 3RC1A 2VPIA 1OXTA 3KQQA 3KV3O 1G6OA 3KKMA 3O8NA 2D27A 1ECJA 1TYCA 2I1QA 4KR0A 3ZIAD 3E1SA 5FX2A 1ZVJA 4X41A 4ARSA 2R62A 3E9DA 4ZOAA 4QU9A 2AI2A 2VZ8A 1WTCA 2DKOA 3E22B 3E58A 1N3BA 4QYXA 1PAUA 3RT1A 1GYQA 4TQUS 2X5OA 5KNBA 3ZUGA 2IUEA 2QRMA 3PC4A 1TKAA 1Z39A 4UU7A 2VDPB 1Z45A 1V5EA 2IA5A 1XTBA 3LVQE 5SZKB 3U9LA 2W2KB 4MV9A 5ALIA 4EKDA 3T0FA 4XWGA 4L1KA 3DV2A 1AH2A 1R6BX 2IYFA 2H16A 3NBZC 2BR5A 5BNWA 2BBOA 2B0CA 2I33A 3ONDA 4M8KA 1RYFA 5CMLA 4Z8YA 2VA8A 7MHTA 4PFKA 4YT2A 3OFNA 1FJHA 3FOCA 3WK7A 5DXJA 5KYKA 1XG5A 2ZU6A 1UEXC 5EQDA 1GGFA 3FR8A 4RTRA 5EL0A 3OEWA 2PRSA 4D82A 1BH2A 1EG2A 4NOLA 4OD0A 1SU4A 1PVOA 2VIIA 3LD9A 5KCZA 2JK0A 1QCZA 4H4CA 2Z95A 1QYDA 1QHSA 4FXOA 5CB8A 2Y0PA 4BN5A 1NKSA 4LI3X 1URPA 4XI9A 1V37A 2GHQA 4O8CA 1SQSA 1U98A 2TYSB 2FCAA 2HWYA 2R1ZA 3RT7A 1CFZA 2J4DA 3GD5A 2HSJA 3P0IA 4L4ZA 4C4OA 3AR4A 2BFWA 3LL4A 2ZRAA 3FAKA 1BAPA 3MWJA 4RMHA 4D4GA 3L79A 3N0RA 1FRFS 1T2DA 2HIGA 2QTHA 4ZZIA 1G98A 2GR9A 2JASA 3ZDCA 4DRYA 1DJMA 4PSVA 1NFQA 4EB8A 3V2GA 1B26A 1P4SA 1SKQA 3A4YA 3K8OE 2H48A 3PITA 4PE5B 4H6VA 3PNKA 4TLCA 5EN4A 2XMPA 4RJKA 4EFMA 4EP1A 1Z0SA 4U7DA 3HEMA 5KOYA 1RI3A 1T25A 2XE4A 3UHAA 1ELOA 4X60A 2VJCA 1S8OA 5CD9A 2GLTA 4FMCB 4EMUA 3PJFA 1JNYA 3WJ1A 5DM0A 3OU6A 3OOEA 4HNHA 3OF5A 3CH7A 5B53A 4D4JA 3A1WA 3H3JA 1C0KA 3A4IA 4KFTA 4R2IA 3W1VA 3EQ8A 3SE7A 3V7UA 4HDMA 3OG9A 3ZV3A 4RY9A 4OQMA 1Z4OA 4QVKA 3W4KA 1L7MA 4LYYA 5DO9A 3E53A 5BPHA 1UXIA 3P0JA 1NP7A 2VBIA 2UKDA 1QVAA 4ZI2A 3LC7O 1YS4A 2F1KA 4QLBA 4RDXA 1UKAA 2QE7D 3CZCA 2W8BB 3Q1LA 1U8AA 4GQIA 5KNDD 4HGVA 1RQPA 4HS4A 2Z98A 4U9HS 4YRRA 2ZBRA 3IO5A 4NATA 5K8CA 1Q7CA 2BMDA 4D4HA 3EVGA 4UTVA 4DMFA 4F2GA 4APAA 1BFDA 4IXWA 1MXHA 1RE1A 1T8PA 4MR9B 1M2FA 5TGTA 3HA2A 3UTCA 2UXDB 1YK0A 3IPAA 2ZRGA 4MXDA 4BTLA 1EVIA 2REQB 4FN4A 3G7NA 4KB5A 3D0KA 5EHGA 4DUYB 2B8EA 2P5YA 2WF6A 1P2TA 1XMPA 4QGSA 2X58A 1II0A 2X8BA 4GC5A 1GGKA 1KBQA 1BA2A 2NXNA 3DAGA 5SZIA 1GPH1 1F48A 2WG2A 3QFHA 1QQ7A 2A30A 3GF4A 3B8HA 4AJ1A 4ECEA 4B83A 1Y3IA 3M3DA 3SY8A 1HT0A 1VLZA 3RVMA 3AFMA 3KSUA 3BCSA 3OKAA 2C2ZA 2O3TA 4KQXA 4MARA 5AHOA 3E9MA 5B1EA 5LBUA 5JXHA 3AUAA 3DOOA 5CGZA 1O89A 2V6FA 4UHBA 4AF8A 1V6SA 5I7AA 2O1SA 4U6NA 4B74A 1E9EA 3DZKA 2VK1A 3EQ7A 4HLNA 4DT1B 2W8BA 4FFLA 2BF4A 4JEMA 3KFVA 2I2DA 1BS1A 1G5TA 2YQ4A 3E5HA 5IWAB 5K5EA 2YVLA 1X70A 2F00A 3T0IA 4EBFA 4DIBA 1OZFA 2DUMA 3IVCA 3STVA 4MR9A 4Z9BA 4K2AA 2HYDA 1GV0A 2ZQ5A 3QF7A 1JPNA 1XRNA 3SQLA 4LMPA 1WXDA 2DWPA 4ONEA 3B82A 4N6GA 4FEYA 1JLMA 2ETVA 1SVNA 3AUKA 3P71T 3WNBA 2WYWA 1G291 1XU9A 2YN2A 3DOCA 4R0VA 5AICA 2YCLA 1Y5MA 4FSDA 1QXSA 2QLBA 3EBOA 2VRCA 4OF4A 3PIRA 5ER6A 5ELXA 2R68A 2VDLB 3RIMA 3DP7A 3HP1A 3WG9A 4HT3B 4P5DA 2XIJA 4YYEA 1KC3A 2WFMA 2DPHA 3ZNQA 3UG7A 1HLDA 2A4KA 1QGYA 2YWRA 3CUUA 3PFKA 4GQBA 1NRWA 4RO0A 2G9NA 3FRHA 4I1SA 2QN8A 5BP7A 2WOOA 3W6ZA 3CB4A 3T7KA 4YMGA 3F7NA 4AZ3A 5LSAA 5FWAA 1KQOA 2XRFA 4PPFA 1TDJA 3L1HA 3AF6A 3H9QA 4JBLA 5JSFA 4WJKB 1KOFA 1R8YA 4GHWA 3H8JA 4GPZA 5JNSA 1J8DA 1U0SY 4DT1A 2XTMA 4RHYA 5AW1A 2W2LA 3P7MA 5CB0A 2ZRQA 5ALZA 1D0VA 3CZAA 3JD1A 4PO9A 4ND8A 3GRZA 4A0GA 1N1EA 1M83A 4QPZA 4ZMBA 4NNPA 3PPYA 3FCXA 4RK4A 3A9RA 1Y6FA 3ICOA 4LPSA 3DZDA 3BWBA 1ZRSA 1DC8A 4IIUA 1I4LD 2O2EA 2EARA 2FRDA 2PO7A 1PFWA 2XXJA 1AV6A 5M2QA 5KU1A 3ZGZA 2NUTA 1ID8A 3CR8A 3AR6A 2RK3A 1K9SA 3KPJA 4EDFA 5HJEA 2Q2OA 1M8GA 3P19A 1MB9A 2PLWA 3H5NA 3MWGA 5DTJA 3SC3A 4P4LA 4CKBA 2FGKA 2QVBA 1Y8CA 3O21A 4KQIA 1GD1O 3GBPA 1QIIA 2FEWB 2R87A 3PF9A 3PQ4A 1BTOA 1FF9A 3B3JA 2SCUA 3KUXA 4HYYA 2ILTA 4ZTUB 1KTIA 1JAXA 4W5HA 1T1GA 3ZZ1A 1E2LA 2IYQA 2CXHA 3D8NA 3R77A 5LXTB 4NFYA 2VT6A 5AJVB 2J3MA 1Y1RA 3IQIX 3SEZA 1ODFA 5L6MB 1RPZA 3CA8A 4C20A 1FCJA 3UAOA 4XPZA 1Y1QA 3K0CA 1XFDA 2B2CA 3NVDA 4Y3UA 1LWNA 4RKRA 5KYVA 1C1XB 3Q72A 3W4IA 4PPNA 2IVFA 2B1IA 2OHXA 4O2LA 5EJFA 1CR6A 5I4BA 4TX1A 2VJKA 3H5WA 4RIEA 1UZNA 4ZC8A 4YJGA 2R6DA 4UDYX 3G88A 4F92B 1PG0A 3CO5A 3IHTA 4AXXA 5A4AA 5JBQA 2P2CA 4G5OA 4NSNA 5J4KA 2G4LA 3HCNA 3WFZA 4DR5B 3AF2A 1TE2A 4FE4A 3ESXA 1LBHA 4KUGA 1Q0SA 2EQ5A 3HKDA 5CG2A 3HUDA 2FLKA 3ZH9B 4E2FA 1RQXA 1Z5VA 3GCDA 5EJGA 4NYJQ 1IM2A 1U0OC 3NBQA 3L5KA 2XLBA 4HADA 2P69A 3WRXA 2WU8A 4PGAA 4E5VA 2XE6A 3IILA 5FO1A 3NU1A 2PLRA 4V0LA 4IG9A 5KSOA 5CJ2A 4EKIA 2MYNA 3IMFA 3FXAA 3AUSA 3UH0A 3RVRA 4URXR 4IJMA 2BYTA 1L6IA 1SY7A 3GXBA 1MABB 1I0ZA 3PG5A 4IV8A 4LGYA 1LDYA 3EG9A 3IDSA 1NIJA 3LXMA 1JXAA 3NWBA 4MAFA 1P0QA 4MV8A 3G8YA 2D3TA 2APJA 3FB1A 4GSKA 4HNSA 4TXJA 5AKLA 3F49S 1RRKA 2EGGA 1X8LA 1TJ3A 2R5NA 3MT9A 1HNNA 1XN4A 4OLJA 4YAOA 5J5AA 4B84A 5D6BA 4KE8A 1FTYA 2V7WA 2IXBA 5CJJA 2R2GA 4LY9A 1PS8A 3TQIA 1E8NA 2GZHA 2PD3A 1JIXA 3PUWA 3K32A 3WZLA 4XWKA 1PI3A 5AVVA 5HPYB 4URUR 4WOKA 2JIZD 1FXUA 1IY9A 2QZ9A 1MOPA 1E2GA 3RBAA 2X9QA 3VR5D 4EHHA 5FLXA 4XVHA 4I5IA 4RZQA 2XIQA 1MN6A 3NO9A 3RVNA 2LDXA 4ZO8A 3MTJA 4OREX 3STWA 3WGKA 4WOBA 3TSWA 4NYIQ 4JXKA 1TYBE 3FYHA 4HQ6A 1E96A 3DE2X 3K1JA 3U3XA 3V1UA 4TMTA 3P4XA 3CMCO 3TI7A 5ER9A 1DZ3A 2IPOA 3SDZA 1CY8A 4YRSA 5AW9A 1W88A 2XCSB 2R96A 3EPJA 3OZIA 3ZWOA 4EI8A 2VNJA 3WDMA 2JCBA 3SIPA 2CHEA 1Z4LA 2EJBA 4Y6PA 3RUPA 3FOZA 4M1ZA 4UVIA 4C1BA 1G60A 1NQXA 3G2LA 1NBOA 1HYEA 4RXTA 5ALXA 3NDBB 2H52A 1MABA 2PX6A 3M49A 5F4BA 1KEEA 2C2GA 3I1IA 3K2EA 3WKCA 3M6VA 1OGYA 2VOEA 5DULA 5CYPA 2IE8A 4R51A 1TEXA 3UUEA 2P6NA 3RBXA 3OCYA 2FP4B 4DV7B 4HDSA 1Y3AA 2IHJA 4FYHA 3EMKA 3OTGA 2WVJA 3MERA 4K46A 4YFVA 3UMBA 4FZRA 3W3ZB 4BP3A 2BMEA 2Q4BA 2QTFA 3P2MA 4PU0A 4A9AA 2XDQA 2QTAA 3HCAA 1Z12A 1H5QA 2RHHA 3TRIA 3KYCB 5GGXA 3U16A 2PKWA 4EGJA 4LZPA 4MO9A 4N01A 2MSLA 4RAOA 1BC5A 4PN3A 1WNTA 1NNLA 4FNMA 2WSLA 3TKLA 2J9GA 5JPCA 1G5HA 1BU5A 3R6TA 4OH7A 3FTCA 4TUYF 2Z2YA 4WVLA 2M6RA 2B5VA 5HF8A 5ICSA 3F6RA 3I83A 4ABYA 4YQFA 4Z49A 1VLJA 2ZAGA 4RGBA 1FUEA 4QXQA 4RNDB 2HDOA 4B3XA 2X0JA 3DDUA 4F9GA 3PJRA 4ZDKA 5LP1A 2OOSA 4KH0A 3A1NA 3HQ4O 2IH2A 3P9QA 4ITRC 1U2GA 4PLGA 4KN8A 5T64A 3S2IA 4D96A 3UJNA 1VHDA 2B7CA 4MB0A 1GPMA 3AKDA 4FYXA 5IC4A 1G8AA 1VIVA 4BZWA 3ORRA 2UYCA 1JE0A 3IAEA 1ZU5A 3EIXA 4WNCA 1TUIA 1IN1A 3MVEA 3ZJTA 2A5FA 4MRAA 3CTPA 3WGGA 2A0XA 3L07A 8AT1A 3OLQA 1YHNA 4RVFA 4DLLA 5P21A 3PX3A 3S3TA 2X1HA 1X8JA 3V55A 1UM8A 1YONA 4V0OA 3KYCA 3EEFA 1W35A 4DREA 4MEAA 3SHVA 3DE6X 3H3XA 3DO5A 3WRWA 3VKHA 5FWNA 3UAGA 3IPYA 3KT0A 5DHUA 3LYLA 2PK3A 3Q41A 5HHTA 1WCV1 2VXOA 1PJBA 4OX9Y 1DIRA 1P0CA 1E3EA 4E08A 2L17A 5I7FA 2VWGA 1W52X 2REXB 5FUQA 2GRAA 5K4GA 1LFAA 2JHGA 2O8NA 5KNBD 4RCVA 1TFUA 1AN0A 2GK3A 3NOVA 3RF7A 4JLAA 1SXGA 1E1DA 4LXUA 3OKCA 4Z0HO 3UHPA 4D3YA 1KK0A 3EE6A 3LBYA 3UNXA 1KXJA 4FFNA 2PNFA 3EGDB 2D5AA 5FULA 1VYUA 4BO7A 4KH1A 4M22A 2SKDA 4MQ6A 4S1WA 2PIAA 4WLEA 2R8EA 1T5LA 4I1YA 3P0HA 3DMTA 5FOSA 4YCCA 2WT4A 4TKMA 4U2BA 3IDAA 4BB9A 4LBZA 1EESA 3BGIA 2ZAMA 1KZ6A 4LTMA 3GDWA 3AF1A 3AHIA 2RGBA 2Z4SA 3IJ5A 1G8FA 1PV2A 3R6GA 4FR5A 3F97A 5AM0A 3PYLA 4U5QA 3IEUA 5E1OA 2DHCA 4CT4B 2R47A 4LYEA 1YS9A 1SUSA 1DXHA 1KMMA 1V3TA 1M6VB 1Z3CA 5FTKA 2B8WA 3R7AA 2YYSA 3LUHA 3IR7A 2QLNA 3OUZA 2FSIA 3GMTA 4TWIA 1SVKA 4LWZA 4YAGA 3D2AA 1EDOA 3GFQA 5F7OA 5J4LA 5DTQA 5JROA 5ESDA 5TX7A 5LQKA 4MHTA 3H8SA 3HGQA 3WSWA 1HLFA 2R44A 4QU8A 1NOIA 3NUGA 3CUYA 1VYVA 3EGIA 4GSLA 3LS2A 5EE5B 1J0XO 2J6IA 1OU4A 2EAUA 3D9QX 3GCZA 3KB1A 3KOYA 1JYSA 2BH9A 3KXDA 4X00A 3WV4A 3LL7A 3K5PA 2HLPA 3SHOA 4JBHA 1Y1LA 3PUIA 4LUCA 2ZJ8A 4HN4B 1I5EA 2VYCA 3F6EX 4YHBA 4GPD1 1QIMA 2DFVA 3O26A 4RS4A 1Y4DE 5DYIA 2AJTA 3HJNA 4CTMA 3AI3A 1N75A 3FRIA 3VR4A 4G0OA 3G2HA 1C41A 1NXQA 1KS9A 1WPRA 3Q4GA 5K2OA 4B3MB 5IRCD 4NYJR 1T8SA 5AJXA 3M6LA 3RV3A 1R0ZA 1DKQA 1K89A 2FLWA 4B33A 2V7EA 2X14A 3HABA 4ESHA 4HN2A 3PCTA 2W6ZA 2O8BB 4LC0A 1KVUA 2ZB3A 1JFFB 2R7LA 1I7NA 4ESEA 3SEQA 1YRHA 1M6VA 2JH3A 1NVTA 5LYJB 3GEIA 4CM8B 3FG9A 3JU3A 3LOUA 4J2OA 4LZOA 3WK8A 3ZI4A 3F1KA 4QTZA 5HE8A 2WNIA 4G1EB 4YUVA 5IDYA 3BICA 3ZY5A 2O8FB 1PSWA 5CXXA 3DNMA 3BHJA 3WMGA 2XA1A 4ALIA 5IJ0A 2IYWA 5T3UA 4CXMA 3VO8A 4B4KA 3DBVO 1TGVA 2C4UA 2V0NA 5E4FA 3QKSB 2JFFA 2JGIA 1T3ZA 4WMLA 2H63A 2P8SA 3DAFA 1Q12A 1PJSA 4H17A 4Q34A 1YA6A 1RXEA 4M0MA 4ANFA 4K05A 1OBVA 3SHQA 5I47A 1R7RA 5CXSA 3EZ2A 1ETUA 4FZJA 1E1RA 4ZJZA 3CZ4A 3AHCA 4NYIR 2GZSA 3ANNA 3PNMA 3FWYA 5GZ6A 2VVTA 2B4YA 3UWMA 1BGVA 3ANMA 2IITA 1U2TA 5CEEA 1T5IA 1ZK0A 4G0ZA 3TTTA 2D2VA 3ZW7A 4YRBA 4U3JA 4S1TA 3SGLA 1XMQB 2BGKA 4INAA 5EPOA 3GRAA 2QR2A 3EH1A 3RS5A 5LYJA 1CQXA 1K92A 3DWEX 4CM8A 1UPFA 3WHPA 4JLJA 1PNTA 4M1TA 2UDPA 1VHWA 3W7AA 1YZKA 4Q00A 2XRMA 1WQ4A 4AX4A 5EMNA 4ACBA 2CC2A 3ES9A 4PC2A 1GG2A 3KT3A 8LDHA 3OCEA 1GQRA 2Q2WA 4UAVA 1ZIPA 3Q3EA 2CWDA 2A84A 3BH6A 3DTNA 2JAPA 4KYIB 4O2BF 4YMIA 1VJGA 2FCRA 1JEAA 2QN2A 1U3WA 1DQYA 3DLIA 1EMDA 4DM3A 3T1OA 2DBYA 2CNBA 1MW9X 4L02A 5L9AA 3OQNA 5FUVA 5JNLA 3VQTA 3AHGA 2AJBA 4HAUA 1U15A 4NULA 4ZCSA 4JIGA 5C4IA 4GBGA 4IH1A 1I1NA 2VRCD 4WA7A 3IUMA 3NEPX 3WOVA 1G3RA 2GM5A 1GZ4A 2AQ8A 4JI0B 4S35A 2HDHA 5F64A 5IHPA 3QNWA 2XUOA 4XEUA 6Q21A 3PX7A 2WC1A 3JQ9C 2J33A 2FW6A 2C2BA 1M6NA 3QJ5A 4L7QA 2GD1O 3HE3A 5EXDA 3WDSA 1GRRA 1TJVA 1IQRA 2F9MA 1KXZA 3AK4A 4HXFB 3CUVA 3SBEA 4LYGA 3HCWA 2B4QA 1XD9A 1A5SB 1W93A 2P9YA 4OY3A 1TPYA 1TTHA 3L0IB 1JJFA 2QR5A 2WMDA 3N0TA 1U3CA 3JYPA 4L5IA 1N6IA 2HGZA 1AQYA 3SI7A 1C0PA 2I6XA 2GRUA 1M2KA 4FFVA 5DBHX 3T6KA 2M1XA 1TCAA 3D0QA 3QY9A 3EGWA 5E3HA 4IOLA 1TZJA 2XVYA 1CEEA 4CIYA 1V4NA 4BP9A 2WJWA 4Q1AA 4NENB 5A3JA 4CDNA 4IHQA 3KQNA 5FWXB 1W0JA 4F46A 5CB6A 4NMWA 1E4OA 2GXSA 3WYCA 5AKGA 4L0CA 4XFJA 3UGKA 3L1KA 1R37A 2DAPA 2VAXA 3JVDA 4ZAGA 3IEVA 1H0KA 5CDFA 3V6MA 3HKCB 3KO8A 3IESA 2HSDA 4S1VA 1J7JA 3EHEA 3C39A 4HO1X 5ELLA 1VPWA 3IQWA 3CLUD 4TWZA 1UFQA 5AK3A 4HSEA 2A9QA 2HPVA 2GKSA 4JUFA 1Y80A 4P38A 2DWUA 2FUSA 4N12A 2PGJA 5GJVC 2AFVA 4P2GA 1AKRA 1Y6ZA 4FI3C 4CTJA 1E99A 2J5RA 1GM5A 2VWQA 4NZZA 4PYLA 3LT0A 1U8TA 3BB3A 3CT4A 4KVGA 4LZWA 1SXQA 4DWJA 1SHZA 2WYHA 4JB0A 4RPJA 3B6IA 4TROA 3C70A 4WZAE 4CR7A 3MMPA 1Q15A 4IP0A 5JZVA 1NWHA 4BV2A 1WL8A 2ISCA 3RSLA 4R71A 4BB5A 5HWSA 3OBBA 1A96A 3NV9A 4XWYA 3ZW8A 2XMSA 5D5PA 1P9WA 1UODA 1TI7A 1XTPA 2ONYA 2QLLA 2W2MA 3GMDA 4NENA 2ERYA 1E2KA 2RSLA 3CONA 3D3QA 3FY4A 1GZ3A 2VAWA 3RS8A 2BUBA 1SQFA 2HHHB 3CVUA 4YX9A 3VVMA 3TPCA 1OAOA 4A3SA 5LQDA 1WHSA 4XUGB 5GIOE 1MHTA 2TMDA 1EKXA 1HOTA 1NXOA 1TQ6A 4QAJA 4QJ5A 3BYZA 2O2ZA 4ZRNA 1IDN1 1T2UA 2W7TA 1N6OA 2OT3B 5IARA 3UFBA 2VK8A 2WJHA 1WEHA 4N6OA 3H5TA 3RUFA 3DLAA 1SVMA 2XAUA 4ML3A 3L7BA 3O31A 3MRVA 5KOHB 3OZXA 1PJLA 2JPDA 5T3YA 5D1NA 3U56A 4JNKA 1Z37A 5KNCH 1SIUA 4NV3A 4ECAA 1B73A 1G17A 2HRRA 3G6WA 3G9XA 3TZKA 4C6RA 4UHEA 1J25A 3B1XA 5GQSA 4JSYA 1NNI1 3CRRA 4YUYA 3A9UA 4J7AA 3AJ9A 2QL7A 3RU3A 2B1GA 1ZCJA 3U7QA 4NY1A 1A7AA 4TM8A 3U7FB 1UQRA 1IUPA 3FA2A 5BVGB 5I9TA 1M72A 1XTUA 1AKNA 1H6CA 4X6LA 2IH4A 3A36A 3VPSA 3BF8A 2OZKA 4C0LA 1C4OA 3CEAA 3KUDA 4MPPA 3THXA 2C7BA 1DINA 1KORA 1X13A 3FLAA 1XWIA 3NNNA 4JR2A 4K8RB 5FOTA 3MBOA 5KHOC 3A9SA 2NZYA 2AZTA 2ONJA 4RTQA 2VBFA 4XOUA 3HMQA 3O4FA 4C4PA 2DBZA 3ZVKA 1FFHA 2XTNA 2YV2A 3DT9A 1TTQB 1DQRA 1QB7A 1RI2A 1XO1A 2ALJA 1RXYA 2EG9A 2OCGA 4QD3A 5IAGA 2ST1A 1V2HE 2NU6B 3V1NA 1X77A 2ROQA 3RK0A 3SYKA 2EFHB 4OXKA 5KOHA 4B47A 4PZ0A 4YNBA 2FW8A 2P9JA 2NSHA 3I9JA 3QENA 4RKWA 4AF6A 3KEOA 3ZCUA 1R9MA 4F3YA 3RYCB 2UYHA 3W9UA 4MQFB 1NI4A 1UWLA 2ZDQA 4WXPA 4Y2JA 2M9MA 5EOVA 3TUIC 3LA8A 3F8WA 1HLGA 1XLUA 4ZVSA 3TG8A 1RU3A 2P0AA 2VQSA 3ZCRA 1YOVB 4KO3S 2DHQA 4PX9A 2JI6A 5DFAA 5TQJA 4LBVA 3CG4A 3H13A 4M37A 4TV8F 2VJNA 2WTMA 4XIYA 2IODA 3R7DA 3O8LA 1SD5A 2DH6A 4PAGA 4Y6LA 3U7HB 4LDRA 4MWZA 1ZW1A 4I36A 4B6QA 2CJYA 4DLZA 1QUEA 2AD1A 5BNIA 4GOLD 3QPDA 2Z09A 4UEJA 5BVGA 1P7ZA 1XAJA 3W05A 1T6XA 4R6WA 3CLRC 1PRYA 5F2OA 3TV2A 1XK7A 4J1NA 4WZZA 3NPMA 3CBQA 4XW2A 1H2YA 3GG9A 1MX5A 3HVKA 4AVYA 1KGDA 2D8MA 5KDLA 2BI7A 4UD2A 3O0TA 3ZH2A 3KJEA 3SDBA 5F1PA 4IXNA 1AMUA 2J3HA 2XYGA 4EMTA 3NUQA 2ZRJA 5DGHA 3MA0A 5JASA 5IC6A 1CB0A 3VR6H 1UBCA 4ND3A 2PANA 3ND7A 4TWRA 5DOZA 5J9FA 1XPOA 3CY6A 1SU6A 4BDTA 4YPVA 4P58A 1NPDA 4URWR 3I4FA 1WABA 3KSZO 1ZD1A 3I32A 4R8SA 4BB0A 5DNCA 1PW5A 5IT9A 2XECA 4F1WA 2XMDA 3DFKA 2O5VA 4MQFA 1O5TA 3V2UA 2OSVA 4GNKA 4GRIA 3AMVA 3WYAA 4GZLA 5T6BA 1Q1GA 2BTOA 4JVLA 1IMOA 3FUVA 3FPJA 2FDCA 2JIQA 4BC0A 1G8GA 5CXQA 4RPGA 2GAFA 4EO7A 1ZIDA 1PQYA 1C4XA 3N8IA 4IMIB 5FV4A 3OICA 1KPHA 4TYWA 4PZEA 4D79A 3THWB 4LOHA 4Z53A 2YTZA 4FBGA 4MP3A 4C6HA 3FJYA 3NIGB 4H2DA 3B13B 3MTIA 1UKVY 3DV0B 4JGIA 1NQ5A 2LTAA 2Q5JA 3NT2A 4HGYA 4N7BA 3TR0A 2R79A 1UJ5A 3BMNB 2EKQA 2G5TA 1C7ZA 2V4UA 3CGWA 4PBSA 1PKEA 1RWXA 2MTBA 2QNIA 3CT6A 4HQLA 4TYMA 4XVQA 5BYJA 3JVVA 4NH4A 3RRJA 1RMQA 1VC2A 2WJIA 4DTCA 2WQ7A 5I9SA 1EINA 4N0PA 1E62A 2IZZA 3P9XA 1SMKA 2GPAA 2BMAA 5ALSA 1NW3A 2XUGA 2D1SA 2HWUA 1X87A 3EWAA 4XQEA 2B5OA 2WU1A 4Q3KA 3ZU3A 4ZPJA 4M60A 4FUTA 5EJ9A 4WJZA 5HQTA 5CFZA 1S02A 2DQ4A 4HFRA 1FLVA 4B8YA 4TXHA 1DAIA 2ZI9A 4B35A 1XR3A 4G0UA 3ZS9A 3TBKA 1TZKA 1Z6TA 3ORSA 4FCWA 4IQGA 5COBA 1V1JA 4IDEA 2IX3A 2RGYA 7ABPA 1UKEA 1JX6A 5KNCA 1T4CB 4XB2A 2VPYA 5BOSB 1R8XA 4S05A 2CSXA 2FE4A 1NNUA 4V0RA 1QFYA 2QPAA 3FD8A 2Q3CA 1D2AA 3THWA 3OI7A 1B3BA 2PXHA 2OWEA 3C7AA 3ITDA 3MIIA 1OH7A 4MJXA 1J2EA 2AYXA 5E9AA 3H83A 3DV0A 4TRRA 4APBA 1MO2A 1P4RA 3BMNA 1JR2A 4PQYA 3TLEA 3R0QA 4D5GA 2QTWB 1I0AA 1RLIA 1WBBA 1HG0A 4Q9KA 3C8HA 1U81A 3BUSA 3DFIA 4L6CA 3TPZA 4CT0A 1L4YA 4TLAA 2P79A 4OFBA 2P5TB 2NTVA 1PQPA 1LI5A 1F9EA 4LX8A 3FPHA 2YUTA 2H9IA 2P1DA 1XZJA 1DUIA 2VHUA 2C96A 3AJEA 3PVZA 2VDJA 4J0IA 3SBXA 2AT1A 2XWJI 3WQRA 4F6LA 4D3FA 4FS8A 4AMUA 2GERA 1XIVA 4D1YA 3HTXA 2C5AA 4OHFA 1FW6A 1WX1A 5EE0A 3IA2A 1IB0A 3HXLA 3VZQA 1B6SA 1MP0A 2IHYA 2FMXA 3EXHB 3OQBA 1V2GA 3TAUA 1ESMA 2O2HA 4J90A 4JSRA 2AWNA 1AS2A 2FQQA 1RM4A 3C3KA 4H77A 5CPBA 2Q9BA 1J8FA 4NEQA 1YBMA 4DG8A 3GG2A 2FWBA 4KR6A 3A4LA 3GZNB 3VR4D 3UT5B 1A8QA 1U3FA 2B37A 5G2OA 3FX2A 4POOA 1BNCA 2J59A 2RONA 3PD0A 3RTBA 3WBFA 1A77A 1ECPA 2HEGA 5J43A 5HOQA 4CN9A 1QH9A 2WB4A 3PYXA 2ZR9A 5IDVA 2R8RA 4JROA 3M6UA 4FJ2A 4PONA 1QQBA 2SECE 1VZ3A 2VH5R 3NX4A 1HG1A 1E3QA 2VHYA 3UYLA 1N0WA 1TVMA 4ISBA 3ML1A 2BSQA 5FQOA 4LSGA 4AKHA 4UNQA 3ORFA 1OXMA 4B4WA 4BUJA 4E09A 3U37A 3VU9B 4JEUA 4BUZA 5I4CA 3BCRA 3TQRA 1BA3A 1UDBA 3AL3A 1L5HB 4YFYA 3TQHA 4E2WA 1A0OA 1OTXA 221PA 3L8GA 1LTKA 1FRNA 1FRVA 5DBGA 4N47A 4M8SA 3RS7A 3VR6A 1PR1A 3WL8A 1OI2A 3GRKA 1BG6A 5EXPA 2VF2A 1GARA 4X24A 1FIUA 3HDJA 2MSDB 1YQQA 1D2NA 1H6DA 1YU6A 4PC1A 1T2NA 2FSUA 2OO5A 4OGFA 4S24A 3BKXA 1CVRA 1IXSB 1OX5A 2CLKB 2Y6UA 4H16A 4Q7LA 4MYCA 5AW4A 2PL9A 1J97A 4B80A 4IL5A 1G64A 2AMVA 3KZ1E 2NXWA 2O7RA 2Y1OA 1UC4B 3A4TA 3UT5A 1QV6A 3U7RA 2QUHA 2AMJA 1GILA 1J70A 5B2ZA 5IWCA 4AZ0B 5E7MA 4PZAA 1IUOA 2BC9A 2J9RA 3GLKA 5I7RA 3B20A 3ZWWA 3KVYA 2V3CC 3QBJA 3PHIA 4NPAA 1YB2A 1G0OA 1FDWA 2DR2A 1S7CA 1XZQA 4DC9A 4FKBA 1WR8A 2Y1KA 3Q7RA 2AW5A 2CL6X 2OP0A 4OKSA 4R7ZA 3VYVA 4ZU3A 4C6TB 4OLBA 3HL0A 1E2FA 5DCWA 3S27A 4HEJA 4W99A 4F85A 4MCJA 3GAFA 3KKLA 4MJ7A 4RF3A 2ZRNA 1NVXQ 2WVHA 3TCXB 1CZNA 5B7PA 3M6WA 1M8JA 3PKJA 2JF0A 4UC0A 2C7VA 3UATA 5KQRA 1DJQA 3T0GA 2PSFA 5DNWA 5TJHA 3LK6A 3HXOA 4JK3A 1GPUA 1GU7A 1ZG3A 2HK6A 2PX5A 2BFDB 5HJ2A 1MKYA 5ITVA 3C6QA 2GGSA 4F2WA 1FC0A 3D8SA 4UQOA 5HQJA 3SQDA 1KIFA 3LBFA 1E20A 2VPQA 1MH9A 1YR3A 1ATIA 1LCIA 1YL7A 1SCUA 3FNHA 2OFWA 5KX5B 4DFDA 1CS0B 2ZU0C 3R9KA 1WIWA 4M87A 1O4WA 2VCHA 3CW8X 1RQ7A 1P7CA 3GP5A 1N2BA 4G3XA 4NJEB 1BKYA 2M2IA 4TL9A 1HL3A 5JXGA 1ZHFA 1V43A 1HTTA 4AQDA 1PLJA 2OOKA 3VO9A 2G9UA 1NG9A 4XB1A 5AQ1A 4MLCA 4C6TA 4CJXA 1Y8RB 2L42A 5GP1A 3TBFA 1NQVA 2XWSA 3ZWMA 4XSGA 2C3UA 1U8ZA 5HRUA 2YKGA 3B51X 4KV7A 3KLMX 2ZWAA 4KRFA 4ZDIA 1W4CA 4TOIA 1RW4A 2PT7A 3A1EA 4UFNA 3LHFA 4G81A 1QPGA 1OXBB 1ZKMA 4M9QA 3VV3A 5D86A 2IWRA 3QVSA 5CA1F 4R9SA 4JOBA 4JI4B 2QRHA 4L22A 3STHA 3WLNA 1VGRA 1P2DA 1LPOA 3L41A 5F2KA 3M4YA 2VXCA 2WP0A 3OD1A 3QVGA 4F12A 4YDQA 1FUPA 1LXCA 5FOVA 2GF2A 5BYBA 4Q6WA 3TXYA 5BYKA 4V38A 5AI4A 3MB8A 4CL3A 2TECE 2O14A 1EYZA 2REOA 3OMLA 5DSTA 5JSQA 5G0SA 3TLZA 2VHXA 3L92A 4LXQA 5DN6A 1W0JD 3LUCA 4KPEC 5KX5A 2AE1A 1WD5A 1CS0A 1YUMA 1PHPA 3RSQA 1Z16A 4K9LA 5JHHB 2CMGA 1KQPA 2QZSA 1F4LA 1M74A 2AN3A 2W6IA 3D1LA 3D7RA 3L7JA 3TTSA 1J1UA 4YPFA 3E18A 3MM4A 1AHIA 1YCHA 2H1LA 4TS9A 1TC2A 2JFQA 3X0DA 4U39A 2D62A 1J8QA 1M54A 2HA6A 5JT1A 3TTVA 4FINA 1S3SA 4KYUA 4BO1A 2BJWA 5AVQA 2WWFA 1WPXA 2VTVA 2F1IA 2ZB2A 4KYVA 2E4UA 4KGXA 4D8YA 4FCCA 4UASA 3KJXA 3NP7A 3PEUA 4Q3AA 3HSYA 2EBUA 1E0DA 1YUBA 3WV5A 2WTEA 2X15A 5K8VA 1TAUA 3WYBA 1LWOA 1S89A 3MLBA 1YOBA 5B3AA 3RU9A 3MD0A 1GUFA 2GN1A 1PTJC 3BCHA 3PC2A 4YR9A 1XZKA 1H8HD 3GLQA 3HYCA 3R1IA 4GC9A 1NVWQ 1QK4A 4XLZA 4MJ3A 4CNQA 3H2GA 2D1FA 5KYTA 2FK8A 2R65A 4JYBA 2ODAA 3GLTA 3PLRA 3SJCA 4YDHB 4GO1A 4E51A 3GYGA 3AVOA 4F84A 1KPGA 1WW3A 3MOGA 1WZIA 5JECA 3K0BA 5CTJA 1EP9A 4MIEA 5CYFA 2B7LA 4EJMA 1JW9B 5JH7B 1M6WA 1PO7A 4OFZA 2MJLA 3NHUA 4BNTA 1ZNQO 1ZJ4A 2GFHA 3Q7QA 5FO0A 1C81A 1NN3A 2A9FA 3HNPA 4W5NA 1VSVA 3HM2A 4Q12A 3THYB 2H1WA 3G2JA 2BMFA 4RD6A 3KTAA 4NARA 5FRDA 2Q41A 1GNPA 1OX6A 2BVNA 2LZ0A 4Y6RA 4YJ2F 3TIFA 4EEZA 5AM3A 3WKEA 1PGOA 4NPCA 4I6GA 3GROA 4L4UA 4IINA 2YINC 4N18A 3UVEA 4G85A 4EZBA 1R74A 2WWWA 2KMLA 4RTMA 2PQ0A 3OPXA 5DSXA 5JATA 3RK1A 3HRIA 1FNDA 5D7BA 2LGJA 1NU8A 3FB4A 4YDRA 2A0FA 2VP6A 1N5LA 1Z25A 4ZREA 1AZTA 1AKVA 1NR7A 5D6OA 4K3VA 3KK0A 5KQMA 5EKTA 1CEXA 1YCFA 2GBLC 2ODQA 2P6MA 3NIFB 4TT3A 4WL0A 3CVJA 1P9LA 4ZEWA 3D6VA 5CEJA 5JDIA 3M70A 5IAAA 5WRFA 1QKIA 1PT6A 1LVUA 5T57A 3FZNA 1YIOA 1C1YA 4N7JA 1WUKS 5CCDA 3VOSA 4KTTE 3BFPA 1VL5A 1TTTA 1R0KA 2W70A 4LF4B 1AUWA 4YJFB 3VDMA 4HSGA 2WTUA 2X0KA 3UZUA 2ZSDA 2QQ0A 3E4CA 2B92A 4FK8A 3G2QA 3R5TA 4FGUA 3H42B 4JKIA 1Z4PX 2VJQA 3CUEF 5I8WA 1SUEA 1TYDE 1UQTA 2HJSA 1TIBA 1F9AA 1C9JA 1A27A 2VUTA 1LBSA 1H6BA 1B3RA 2XOEA 1PFVA 3KWMA 1XTIA 3D02A 4I4TB 1L4FA 2F3PA 4L72A 3Q85A 4F3KA 3ONNA 3GXOA 5DP1A 2WQ6A 1E7YA 3W5HA 3HCDA 2CLOB 2WV7A 2V7TA 2HFKA 3BXGA 1ZR4A 3RJMA 1CB7A 3BBLA 4EECA 4LY3A 4FHEA 5J1TB 4B40A 2AUNA 1OYOA 2VATA 4GKJB 2FUNB 3R09A 3JQQA 821PA 1N25A 4I3FA 2PMEA 1KOJA 4BYGA 2UUBB 5HF6A 4MQEB 5LP6B 1QIGA 3X3HA 4MWCA 4ON9A 1YIAA 4D97A 2CJWA 5CCXA 2XBMA 3VNUA 1SM4A 2QUIA 1W76A 2ZQZA 1E5DA 2IKQA 4PLCA 4YJFA 2Y27A 4W5JA 4MSUA 4J8PA 4M6WB 1G19A 5C5IA 1GCOA 4BXOA 3ETEA 3RUEA 1V8OA 2HWWA 1DKOA 4M36A 3GPBA 2VBCA 4NAHA 2WT8A 1CP2A 2GXUA 3IPLA 4A1OA 1UAAA 3K8ZA 3BWDD 3R6WA 1AD2A 1Z2OX 2FPMA 5CLHA 3QV1A 4IPTA 5F78A 1BH6A 1IULA 3JQ8A 4I4TA 3PA8A 4I1RA 1NVGA 1R0SA 5B1SA 1BN7A 2D0DA 5K09A 5E38A 3SIWA 2B4TO 1TNDA 3NHYA 3UV3A 1GKIA 1B0UA 1YGYA 4O29A 4P3YA 3HA3A 5HNKA 2NT4A 1E1YA 3HMKA 1W2WB 2V7QD 4ZVQA 3VYTB 4C7BA 1EA7A 5C3UA 1U0TA 1KO5A 3T1TA 1KP3A 1BX0A 1II8A 1QYWA 2FN7A 1MC5A 3I3SR 4WKNA 2PUEA 4Q21A 2Q4DA 1U5AA 2Y1GA 3HBNA 2G09A 5KTYA 5B7NA 2QDKA 1C3JA 1XL1A 2V4MA 2RAFA 4QDJA 4DPLA 4L16A 4PO8A 4HCJA 1ADJA 3GPDG 1YA8A 2ZIWB 2WK1A 5CPFA 4MQEA 5TT0A 3SS8A 1YZGA 3INGA 1K5GA 3UMRA 1JIKA 4KRGA 4N8EA 1XEFA 3SNKA 1XCPA 5A7HA 4WEOA 3KKZA 1NWCA 3V3KA 4H0NA 5LB4A 1WXFA 2VOJA 4YMTA 4LHXA 1CQIB 1ZUNB 4M6WA 4LWPA 2ZRLA 1NW7A 2ZJBA 1E0KA 1GCAA 2E9FA 4FCTA 3MN1A 2PTGA 2A59A 3ZS8A 5HF5A 1UP7A 4F9EA 4EG6A 1TJYA 4AN4A 1XJCA 1L6RA 3NAQA 4DLPA 4LNUB 4JVOA 1PFUA 1K9VF 1Y6RA 1JLSA 2J4FA 5K3DA 3SZUA 1R0BA 3EVZA 3VU1A 1U1FA 4FQ8A 2RHJA 5ARBA 5KNCD 4KE7A 5IW8A 3S2UA 1XU4A 2QMHA 1YJBA 5TQ0B 2PSDA 2F9FA 3LY9A 3E2IA 5DGIA 5TT1A 2Q5HA 3MK31 3S1SA 3SC6A 1H5NA 1TYAE 1FTWA 1R9NA 2R8OA 1TOAA 3AUYA 3B5JA 3EA5A 4ESOA 4UNRA 5K8UA 1UJ2A 3RR2A 3GFVA 1DC4A 3ZKWB 4NNOA 3CNHA 3K4QA 4XYGA 4XFKA 2DU8A 4TXLA 5C51B 5HCIA 5DXAA 4P82A 1NJ8A 4CWAA 3FOWA 3EVCA 3KQYA 1WMEA 3RRMA 3U48A 4AY2A 1XVUA 3X44A 3ETNA 3MMNA 4C87A 3A2LA 3RUIA 1UT6A 3EEOA 2R6ZA 2VDWA 2VLIA 3NBMA 3DUFB 1Y63A 1JQJC 2JEZA 4WZAB 2GM3A 4ZVUA 3EDMA 4YJHA 1RPAA 3OC0A 3W3AH 1QH1B 1W9MA 5DLDA 3WA6A 1HDEA 2XZLA 3D5TA 3MRSA 4LNUA 4W5WA 5K0BA 2OBYA 2WWRA 3F1LA 2I34A 1NMXA 1YNOA 1GNLA 4KO1S 4O2RA 2JH8A 4ZP1A 2BBTA 1D9ZA 2GM9A 1EFHA 4ZV4A 3TSYA 2X77A 4P4UA 2VNAA 3T7IA 3A05A 4MV1A 1RHRA 3LLUA 2ZG6A 3BTUA 1NW5A 4XTCS 1KI6B 3B5EA 2P2YA 5AKHA 2TMKA 3SS9X 3OJEA 1HV8A 2H3HA 3EC7A 3ZKWA 4C4SA 4RTPA 4JVNA 4QKQA 1R15A 3DBIA 1XZ8A 3H7IA 4EA6A 5A0VA 3VYRB 1ATZA 3BCUA 4LRYA 3L7IA 1LS1A 3KOMA 3MELA 1A9RA 1YHYA 4FEAA 2HFJA 4A10A 2F90A 2ZIXB 3ZJVA 1TCUA 2X7JA 4WT7A 3N76A 3DUFA 4WZAA 2OLJA 1ZISA 2NZJA 1CUHA 4LZJA 4DGSA 5DHAA 5KSYA 1E79A 1NKTA 3VR6D 2ZBEA 1S2OA 3WWYA 3V9PA 4ZCTA 2YICA 2C8VA 1BE8A 2VZLA 4QO7A 5I6DA 5LBTA 3MRTA 5ETJA 1YDGA 3M6XA 1WVGA 3LZ6A 4CU2A 1I9GA 2LR0A 3OZSA 3ZI7A 3A9WA 5DHTA 1BN6A 4KCGA 2FFRA 2EW2A 5JOQA 3IO3A 3FPLA 2W9XA 5GONB 1V8PA 2DF8A 4EKGA 2Q6IA 3MNFA 4IBOA 3VH1A 1Y48E 3D4BA 4H7JA 3WGIA 2O4CA 4M9RA 5AIBA 4BTVA 4IYRA 4OATA 1UJBA 4YRIA 1A7KA 2HAEA 1F5SA 5CLFA 1Z07A 2Y4NA 5JC1A 4RABA 4NFSA 4DBZA 1TT5A 4L8FA 4PX3A 2V3WA 3WP0A 2O5CA 2E5WA 2XMCA 2JVIA 1PU2A 16PKA 1SOUA 1PNOA 3WIDA 4ZI7B 4RE6A 4TTAA 4ZEMA 1VJ1A 2AZDA 3TO5A 4R41A 3TSZA 1FFBA 1Z0AA 4D0NA 2I3ZA 5AK6A 3K6RA 3T4PA 2C2OA 2ECKA 1MEOA 5IVPA 1FDIA 1G1AA 1SIOA 4A0HA 2AZMA 1G21B 4WUTA 5HA5A 2ORIA 2NAPA 2ZJYA 3LUGA 4MW9A 4EJ0A 2H1FA 1PKXA 1ORHA 2LV8A 2ERXA 3VH2A 2O3UA 3KETA 3ADKA 1GV1A 2ZBPA 3WWOA 5AM4A 3EX7C 3DJYA 4RA6B 5CVUA 4CDGA 3VI3B 1XZCA 1CDEA 2QKYA 3AM5A 3GMSA 3VHLB 3PQ5A 4YMUA 1TFRA 1NULA 1QKKA 3CV3A 1RJGA 4I9NA 4P7JA 1F6BA 3JQ7A 3ZGNA 4IIJA 2J67A 3KAPA 3L8MA 3PUKA 5FNVF 3TAXA 2G9VA 2ZAIA 3WIEA 4UBLA 5CFLA 2YQZA 3ST7A 3VZDA 1UADA 1G20E 2YJNA 2FW7A 4GZ3A 2IW3A 2CSUA 4YP6A 4ALLA 5G40A 4L4XA 1J7KA 4F06A 3SQMA 5JSUA 1EFPB 2WAYA 3AFGA 3WLQA 2Y1WA 5HTOA 4DR4B 1K7YA 2N42A 4PZLA 2HA5A 4WA8A 2W6NA 1L4UA 1ZJYA 4OSEA 4PG6A 3QMPA 4GX0A 4EPWA 4H08A 2HHLA 5CXUA 4I14A 2J5BA 1SK9A 5ESXA 3TZQA 3WLRA 3ZE2B 4LNHA 3ILSA 3F47A 4X1OA 4PFJA 2AJ8A 1KZ4A 3TE6A 2FX5A 2Y1FA 2ZSAA 4D81A 4XASA 3M1YA 5BQPA 3W3AA 4Y6SA 4A8JB 2PBFA 3ICCA 3DF7A 5EQJB 2HYIC 1SA0A 4N03A 1A2OA 5AM1A 3HA5A 3Q9LA 4UMEA 4BZZA 4RULA 1H3EA 1UBOS 1H0RA 3MCUA 1KYWA 2BEKA 3C3YA 3NM5A 3PDJA 4L95C 4P4NA 1Q5NA 3SPXA 5KSZA 2PUTA 5K3BA 2WOJA 5CP8A 5DN6D 2KYRA 2IEIA 2ATVA 1YVEI 3LBHA 1BGWA 3ONWA 4JJGA 2W6ID 1MG0A 4AZTA 1XUOA 3ZE6A 5GTDA 4OHCA 2EZ4A 5D85A 1E2JA 4OHRA 3O4GA 4BFLA 5JEDA 1GR0A 1Q7GA 1RI1A 2NACA 4JQSA 4M54A 4B4DA 1N2ZA 1UDAA 4QFCA 4UPVA 2QNRA 1EFPA 4AICA 1GQYA 4PG7A 2C29D 1ENYA 4JC4A 2IV7A 1CBUA 1DRUA 1UFVA 1K5DA 2WV9A 3CCFA 4E13A 2XUQA 4BVLA 4C29A 3IUYA 1X8KA 1Z36A 3WKDA 2ZTSA 3C5VA 3P52A 2RGCA 4YGYA 3QVKA 3AHDA 4FX5A 2ZSFA 5DW0A 1USWA 5ALEA 2R1UA 3A1CA 1Z9BA 4L5YA 4TSFA 1J2RA 3CPHA 4B85A 4NBUA 4CM3A 1T8UA 1W4ZA 1MF7A 2H2IA 2H4WA 2O3QA 3SVZA 4AZVA 3P9RA 3WDLA 4G5SA 5BUSA 4HJXA 2ODEA 1EFCA 1NUHA 4LJ4A 4ZQBA 5BUCA 5JD6A 5CA0F 5LA6A 3E2MA 3H0EA 1NQOA 2ORWA 3ADOA 1PTKA 1F06A 4H6WA 4J91A 4XCXA 5E6RB 3FYUB 4G84A 1L5NA 3WFIA 5LBIA 4C2AA 1Y81A 5H83A 4RIFA 1Q1EA 3GJ8A 4DCUA 2XYRA 1JB1A 4DV1B 1NE2A 3VTAA 4D6XA 1A97A 4IO1A 3V1KA 2VP3A 3DDHA 3IP6A 3QXGA 1HZZC 4MV6A 1KDYA 1RYNA 1N2OA 2PY6A 2YIJA 2C0PA 4O1MA 3RS3A 1TU4A 3R9IA 2P4UA 4YH1A 5F7ZA 5FBHA 2GEUA 3U17A 5JFGA 3B8EA 1FFCA 1JEYA 1ZCFA 1Q7EA 1ECFA 3OA0A 5A5FA 4JAVC 5TVGA 4IIEA 3SEAA 3L82B 1M6YA 2FWPA 1ZM2A 3PXGA 3TW4A 1MAWA 2QRUA 2H92A 3U0VA 2OORC 1XKLA 1TLTA 1ZD2P 2FEOA 2R6FA 1QTNA 1UMBB 4GDFA 4OX9B 3R3JA 4TT3D 3LZDA 3KCNA 3TLXA 4B48A 2C8LA 3VVLA 4DNQA 1P9OA 1JSLA 1RTKA 2W4MA 4DCOA 4WQMA 2GEVA 3JASB 1T8WA 3K53A 3PC6A 3NGLA 1TEVA 2QMQA 3R3UA 4X3PA 5E6RA 1YZHA 2MCFA 4IGFA 2IY7A 4BO3A 4UFPA 4GLOA 4HPXB 3QNUA 1AUOA 2AMYA 5ECGC 3P94A 4ZA2A 1KE1A 3EFOA 2P7IA 5IZCA 1P1KA 4Q9JA 1MAVA 3PUXA 3UA3A 1Q0QA 3FGOA 5DZSA 3MG9A 2HBYA 5CU7A 1KI4A 3VGPA 2X8JB 3V8EA 4X66B 5HILA 3HADA 2DY1A 5AJZA 1SXJA 5C2JB 3DEIA 5IN4A 5FBKA 4QUAA 4MZXA 1NXWA 3ZV5A 4DEXA 3VDQA 2PUFA 3I9KA 4KITB 3O1JC 4NJMA 3KU1A 5IEJA 2JJ8A 2GAAA 3UJAA 1LBIA 1RD4A 3CN9A 4TV9F 1AXRA 2X5JO 4J0JA 1EQUA 3SHTA 4L8YA 1OC2A 2YW2A 3MLAA 1XQ1A 1JGTA 4EJSC 4M46A 4G0NA 5ALMA 3ZBPA 3K72B 2YBDA 2SKCA 1QRRA 3BJEA 3LHIA 3AJRA 5JNWA 1MIHA 3O38A 5ALKA 4YC7A 2DM6A 3CZRA 2AZXA 3CKLA 3T5BA 3O8BA 4ZZ3A 1DC7A 4Z86A 2Z6AA 4FMDF 1O54A 3G5AA 2C2HA 3I9LA 5IC5A 4JP8A 2W6OA 4YQEA 3ZTTA 2GWRA 2ZI7A 1BYIA 2ZJ1A 4NV1A 5F35A 1CY2A 4NSLA 5DNEA 3T3GA 3VYWA 1HSZA 3PEEA 1O95C 1ZUHA 1PL0A 4QVIA 4L75A 5K0SA 1KZ1A 2YJ3A 4FDTA 1JAIA 2WWIA 1EP2B 1RVV1 1RXIA 1KJ8A 2IUYA 3T3PB 3SQWA 4D9MA 5GJCA 1YB6A 4KFRA 1QMPA 3RAJA 1VECA 4GUAA 3BMQA 4YUAA 5HX7A 3AHFA 3H1AA 2W37A 1MOQA 4G5RA 3VC2A 1CFJA 2ZIVB 4QGBA 1NMEA 2IBTA 1NX6A 3NCTA 1E7SA 2RGNC 5JCZA 3PK0A 4CZ2A 5F5NA 3H9CA 1EX9A 2JVKA 3NAGA 3WNCA 4CLOA 5AWFC 2POQX 5J2TB 4ZVNA 1NLMA 2WM8A 3LCJA 4J6FA 5IPFA 4GKAA 4IHJF 1RWNA 5B3JC 2QWXA 3JPWA 1E63A 3COPA 1RPNA 4WN3A 1QYXA 2ACWA 1Z74A 2BBSA 2H59A 5AXAA 5B12A 4C4RA 3T7EA 4ZYTA 4H0FA 1SOMA 1I51A 2NU9B 4BKOA 3W7BA 1I33A 2ZYIA 2TSYB 4MKFA 1B6GA 3FGPA 1A8PA 4RDCA 5LN1A 1DRVA 2I91A 4WZBE 3TGWA 1U63A 5E7JA 1JTVA 1F8GA 1O87A 2Q6OA 3VX3A 3L18A 2VJDA 4WUVA 4EL5A 1NDHA 3KR1A 2CVHA 1R4AA 3PGA1 3V7YA 2PWZA 4DC1A 9LDBA 5EHNA 6GPBA 1T2EA 3RRYA 3CRW1 2NSYA 2JI8A 3EBPA 4M1OA 5MN4A 1NJFA 2VEOA 3HVUA 3E61A 3MFYA 1G4UR 3BIXA 3R7WA 3ENWA 3ISTA 4V1CI 3GEMA 4ZAVA 2WSMA 3ILYA 1TEHA 2LCFA 2QT1A 2QTVA 5DNAA 1CJTC 3DD5A 4BVEA 1U2DA 1LPNA 3QK7A 5A06A 2Q2NA 5HF9A 1WY5A 2I3DA 5H3LA 3WHLA 4A8TA 3NP9A 4BJ1A 4O4LA 1FTQA 3AYXB 3F74A 1PFQA 3B1VA 3L93A 3DMHA 1RZ3A 4PTLA 3ROFA 3RRNA 1NMZA 4DOMA 1QV7A 3SP1A 5DMHA 5E1MA 1N36B 3B36A 3ELDA 3LLSA 4XGRA 1Z29A 4MPRA 4BRZA 4DZRA 5HGXA 3FYSA 1QG6A 2XX3A 1ZM4A 3GCWA 1L8OA 3KYDA 3EXAA 3U3ZA 3GLIE 3KBBA 1UK8A 4KMRA 2BT4A 4JA2A 4BKPA 4EARA 2HWKA 5E4JA 3R5HA 3QWFA 4QU0A 1CYEA 2PS1A 4HGZA 1VXRA 1DIHA 2AQHA 5BWBA 5J3JA 2QVYX 4GBMA 4CPDA 4DLNA 1J0CA 2OXEA 3D3WA 3OESA 2QJRA 3HEAA 4AQ7A 4M88A 1Q3HA 1ULAA 4V1CB 2YWCA 3MJ4A 3GOHA 4GOND 3G2NA 5HCNA 2WHYA 1YZFA 5HMLA 3TTWA 3QI7A 1KY3A 5BXQC 5LQRA 3IAFA 5DVZA 1YI0A 4MEJA 1NF8A 2Z2ZA 5JJIA 1Q21A 2NVBA 1JQEA 3UWOA 4R8MA 3UXEA 4E33A 1G59A 4KG7A 2F3UA 3ZVRA 2FFQA 2HT6A 3DTVA 2GRJA 4HS9A 2A78A 3M83A 4Y2TA 1Z6ZA 4ZAFA 3WBJA 3EQ6A 3F3MA 1T5BA 3HWWA 1X0VA 4FE3A 2M98A 2WY2D 5FI1B 4MS1B 3WB1A 3RVDA 3F71A 2V1XA 3VKUA 2BPOA 1VKRA 4EEIA 4F3RA 2Y2UA 4TSRA 2IPXA 5AVXA 3EA4A 4JYAB 4HDCA 3ON5A 1IN5A 1OOEA 4D8TA 3CKMA 4M53A 2ZS7A 2ZT8A 3TIVA 2JGFA 1ZOPA 1GGVA 1TJUA 1OVMA 1XXHE 3DJFA 4OUKX 3TZ6A 1UDWA 2FEPA 5ALJA 1C1DA 2P3SA 2BUCA 4EG4A 1KOGA 1GAXA 4JXXA 4MDFA 1VE5A 2ACKA 5TR9A 4BO9A 3DOEA 2CNKA 1PT7A 1E0SA 4M0EA 3RRZA 5KBYA 1KBZA 1RYMA 3ZHXA 4W4TA 4YP0A 4NH0A 1E79D 1HTWA 2J0UA 3NLLA 4YJDA 4V1CA 2V55B 3JQ6A 1M5RA 1IQUA 4NDZA 4PYJA 1ZGJA 2QD3A 2YXEA 3REQA 3JWPA 4PLFA 3C7CB 3ENVA 1ZBQA 3F5QA 1NM5C 3G2OA 3NFRA 1JDVA 3TIGA 1AHNA 3UHFA 2ZYSA 5KTMA 1R3UA 1IWBB 2ZETA 3ZLTA 3K5WA 3HDQA 1E60A 1ISSA 1QIEA 5JE8A 5IF9A 4KQMA 1AGNA 2I7XA 2UAGA 1OXSC 3FWPA 1W9HA 4MUKA 2DPLA 1PGPA 3MTQA 4DYHA 1T4DA 2IOYA 3JQDA 3Q0TA 3GRYA 1A71A 4UVGA 4V0NA 4ES6A 2JCSA 2JFYA 4NQRA 4KWIA 2BP7B 2PKYX 1P4JA 3FZYA 3MHTA 5J2UB 2VAVA 3RYHB 2IPLA 2SBTA 1K8XB 3JXEA 2ORVA 3QEOA 4N8SA 1U80A 2NO6A 3ESYA 2QR3A 1FYVA 2OXFA 4Z9YA 3SAJA