3BWVA

Crystal structure of deoxyribonucleotidase-like protein (np_764060.1) from staphylococcus epidermidis atcc 12228 at 1.55 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
177
structure length
167
Chain Sequence
TRQRIAIDMDEVLADTLGAVVKAVNERADLNIKMESLNGKKLGLVMDILKEPGFFRNLDVMPHAQEVVKQLNEHYDIYIATAAVPTSFHDKYEWLLEYFPFLDPQHFVFCGRKNIILADYLIDDNPKQLEIFEGKSIMFTASHNVYEHRFERVSGWRDVKNYFNSIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative 5'(3')-deoxyribonucleotidase
publication title Crystal structure of deoxyribonucleotidase-like protein (NP_764060.1) from Staphylococcus epidermidis ATCC 12228 at 1.55 A resolution
rcsb
source organism Staphylococcus epidermidis
total genus 49
structure length 167
sequence length 177
chains with identical sequence B
ec nomenclature ec 3.1.3.-:
pdb deposition date 2008-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 3bwvA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3bwvA01
3FPSA 3L7YA 1CR6A 1YDFA 1L7PA 4UAVA 3RFUA 3WKDA 1NF2A 4L6AA 3NALA 3E58A 2FDRA 3FPBA 3NAMA 3W5CA 4Y2RA 2X4DA 4DW8A 3ZX4A 4CF4A 4GXTA 5AM3A 4JDPA 1TA0A 3B9RA 3L5KA 2ZG6A 1PW5A 5AVXA 3WGVA 1RMTA 5AW8A 4UU1A 4RESA 1WVIA 4BX2A 4UMEA 1RPZA 4Y2UA 2HX1A 3EWIA 4J03A 2OYCA 3ED5A 3W5BA 1ZD2P 5AW1A 2PQ0A 4HAIA 3UMBA 4C4SA 4Y2SA 1ZRMA 1J97A 2G09A 2ZXEA 3U13A 4EENA 1QYIA 1ZRNA 4H1WA 1Y8AA 5AM0A 2MU1A 1RKQA 3ZVNA 3TLMA 4I9GA 4I9FA 3QU5A 1TJ3A 3KOOA 3QUBA 5AKEA 3M1YA 2HF7A 4AP9A 4CF3A 5AW7A 1ZJJA 4YH1A 5AKKA 5IS2A 5AKJA 3SD7A 3QX7A 3D6JA 3N8GA 3AR7A 3QXGA 5AM2A 4KYTA 5ALHA 5AI4A 3ESRA 3ZVMA 4L57A 5AVUA 1O03A 1N9KA 3WKEA 1O08A 1ZOLA 1WPGA 4MWOA 4KNWA 2G0AA 4QJBA 5ALQA 5ALLA 1FEZA 3ET4A 3ZU6A 3WGUA 2GHTA 1F5SA 5ALIA 1RKVA 4FE3A 1VJRA 2O2XA 1VFPA 3MMZA 2OM6A 1IWOA 2AUTA 4ZEWA 4AS3A 3ZVLA 1Z4KA 5AK6A 4Y2YA 4B6JA 2IYEA 2GHQA 4UMDA 2C8KA 2NO5A 1U02A 3L8GA 3U7HB 3QU4A 5IT4A 3NANA 2YY6A 1K1EA 1ZD5A 4IFTA 1XPJA 3I76A 2OA0A 1NNLA 3PGVA 5AKGA 5ALPA 3DAOA 3BWVA 5ALTA 2ODAA 3AR9A 5AM5A 2B1QA 4NWIA 3IB6A 2BDEA 3M9LA 3FM9A 3UMCA 2B8EA 2JAUA 2G80A 2HO4A 2P27A 2I34A 3L0BA 5ALXA 3F9RA 4F71A 4KN8A 2EAUA 1XVIA 5AK4A 4YCNA 2WFAA 4YGYA 5AKHA 5AW6A 2FPXA 1RC8A 2G1AA 2W43A 4HGNA 3WK4A 3OPXA 3ZTYA 2B30A 3QU7A 3P96A 3IJ5A 5ALOA 3R9KA 5AVRA 2PKEA 5IT0A 2P9JA 4OD0A 5T41A 1ZS9A 3ZWDA 3CZ4A 2YBDA 5AIAA 5AVYA 5AW2A 2FPSA 1EK2A 1Z4IA 5AW4A 3FGOA 5ALVA 3QUCA 4Y2PA 5AK5A 4E88A 2ZBFA 2FUCA 1Z4LA 3UM9A 2HSZA 4UARA 3HLTA 3R09A 2BDUA 2C88A 1RDFA 1RQLA 2YJ3A 3N07A 1X42A 3U26A 2AMYA 4ZEVA 5AM4A 3ESQA 3B9BA 2ZBDA 3OCYA 2JAOA 4NFLA 4ZEXA 4HGOA 3W5AA 2YMPA 4UATA 3DV9A 1Q92A 4YCMA 4L6CA 2QYHA 4UASA 2YJ6A 4Y2QA 1AQ6A 2DQSA 2C4NA 5AKXA 3AR4A 3L8EA 1RMQA 2R8YA 3KZXA 1RLTA 4XQ0A 3KBBA 2Q5EA 3ZTWA 4OFZA 3PDWA 2HOQA 4DWOA 2FEAA 1U2TA 2RAVA 1YMQA 1S2OA 5AI5A 2RARA 4YIHA 3RF6A 3KDPA 2PR7A 2B1RA 1JUDA 3HYCA 3I6BA 4KX5A 3FVVA 5AVTA 1J8DA 1L7MA 3BA6A 2ZBEA 3EF1A 2B0CA 5AHXA 5AICA 4YCLA 2YJ4A 1U7PA 5ALFA 3AR2A 5ALKA 4BEWA 2D2VA 3L1UA 4EELA 3NRJA 3MPOA 4BX0A 2MSNA 2I7DA 3U7FB 1WR8A 4NAVA 5E0OA 5ALWA 5AW3A 3FZQA 4AS2A 4G63A 4BKMA 1L7NA 2WM8A 2O9JA 4G9BA 1TJ4A 3ONNA 3MC1A 2OBBA 2JAWA 4MUMA 5ALUA 1L7OA 3ET5A 2CFTA 3K1ZA 1SWVA 3NIWA 5AI6A 2R8EA 3MN1A 2CFSA 3J7TA 3U19A 2EARA 1YS9A 4UAUA 2W11A 1SWWA 1CQZA 1Z4OA 5AK3A 4YIKA 3SKXA 5ALSA 4C4TA 1RLOA 3EPRA 2WF6A 4RETA 2HDOA 3AR5A 1Z4QA 2IA5A 2CFRA 2G07A 1XP5A 2YMLA 5AKYA 1QQ7A 3WK5A 3QUTA 4EEKA 5ALNA 1L8LA 1SU4A 4XOUA 3E84A 1RRCA 5ALDA 2I55A 3NUQA 2B82A 2AGVA 2GMWA 2NO4A 5AVQA 2CN1A 3OTQA 3WKCA 3A3YA 4BNDB 2AH5A 2ZOSA 4Y2TA 3QGMA 3SKYA 5A3QA 1L8OA 2P69A 5AW9A 1RKUA 1QQ5A 4NABA 4HYTA 2YMMA 2IOFK 5JJBA 1ZD3A 4QQFA 3QUQA 3OCXA 3A1EA 5ALYA 1VJ5A 2B8JA 4BBJA 3AR8A 1EK1A 2Q4RA 4CF5A 3N1UA 2WF5A 2G06A 3KD3A 3L0CA 4BYGA 4Y2XA 4UU0A 1Z4JA 2FPWA 3EF0A 3GYGA 5A3RA 2I6XA 4Y2JA 5AKZA 1MH9A 1Q91A 3L1VA 5AI0A 2JARA 4DCCA 2WHEA 3ZWKA 4NV0A 5ALJA 5ALGA 3QU9A 2GFHA 3E8MA 3ZI4A 2YN4A 4Y3UA 5ALEA 3WK9A 1N8NA 1Z4MA 4KX3A 4UM7A 3WK6A 5AM1A 4UMVA 4BEVA 4EZEA 1RLMA 3OCZA 1NRWA 1Z5GA 2HI0A 3E81A 2Q4TA 3DDHA 3OCWA 1TE2A 5AVWA 2HF2A 1U7OA 2RB5A 2GO7A 5ALZA 1L6RA 1QH9A 2WF9A 3WKAA 5A3SA 3AR6A 3I28A 2C8LA 1Z4PX 1YNSA 4J2TA 3I1YA 5AIBA 2YMQA 3SMVA 4XPZA 1Z88A 1RQNA 3R4CA 4C4RA 4CE6A 2IOHA 5AVVA 5ALRA 2RBKA 3A1CA 5AW0A 3UMGA 3AR3A 2NYVA 3WKBA 2G08A 5AVSA 2VKQA 1LVHA 4HGRA 5AW5A 1QQ6A 2C9MA 2WF7A 2YFYA 4FYPA 4UM5A 4FFDA 5AKIA 3NASA 4IG4A 1Z4NA 1ZD4A 4PNHA 3ZX5A 3VAYA 2ZBGA 3WK7A 4EX6A 3N5KA 3W5DA 3CNHA 2W4MA 4CNQA 1S8OA 3PCTA 3U7GA 5AKLA 4DFDA 3SLRA 5AVZA 2JGAA 3IRUA 3L8HA 1U2SA 2I54A 3ZW7A 1YJ5A 2HHLA 3S6JA 2FPRA 2QLTA 5AI8A 3SF0A 3N28A 3ZUPA 4XE5A 2P11A 3KC2A 5FP0A 3U7EB 4BX3A 2I33A 3QNMA 3A1DA 4JB3A 4Y2VA 1Z5UA 1LTQA 4F72A 1T5SA 4KNVA 2HEGA 2YJ5A 3OCUA 2R8XA 4O8CA 3OCVA 3L0YA 1WZCA 2EATA 4EX7A 5ALMA 1KYTA 5AI9A 2R8ZA 4HGPA 3QU2A 1T9ZA 3QYPA 4BNDA 3PGLA 1T5TA 4OCZA 2IOFA 2BY4A 1TJ5A 4UW9A 2WF8A 3SHQA 4HGQA 2FUEA 3WK8A 4UMFA 3L8FA 1YV9A 2FPUA 1RMYA 2HCFA 3QLEA 4GIBA 2FI1A 3B8EA 3DNPA 4OHFA 5AESA
chains in the Genus database with same CATH superfamily
3UV3A 1ULTA 4XEHA 1EWYA 2ZT5A 4UAVA 4AT1A 2AJDA 3A14A 4C29A 2Q2OA 7REQB 2HLPA 1BHSA 5CDTA 5JANA 1REQA 3EIFA 1SZJG 2HBQA 3Q10A 3HR4A 2O23A 2JG3A 1IRXA 3TMYA 2LVBA 5GY7A 4F5WA 2PKWA 3CF0A 1ECFA 3HMKA 3PPWA 1VIDA 1WMSA 2CXNA 3T94A 4AQ7A 4FYHA 5BQ5A 2FDCA 1ULUA 1NVVR 4ARAA 2EZ9A 4J1QA 1WM1A 1R5BA 4JJ7A 4HAVA 2I80A 3DZFA 3T95A 4R1MA 4NV1A 4U3JB 1ESZA 3IFSA 3MJHA 3C8HA 3JWEA 1V1JA 3AIIA 4ZHQB 4R71A 1JU4A 1A9YA 1E3JA 1H3EA 3QYAA 3OCJA 7GPBA 5LQUA 3U3JA 4JFRA 1J6UA 4RD0A 2XZPA 3LHDA 1MOPA 4DMMA 3BFXA 4PSAA 2ZQ5A 5GVSA 3U6BA 2HX1A 2ZYVX 4JLSA 3AHEA 1U0NA 3L4KA 1D8TA 1UJNA 1U0FA 3W04A 4M1KA 2JIZA 2OEPA 4GM1A 4IDCA 4BJ1A 1RXWA 3KKMA 3EZ6A 3JQFC 3S2UA 4ND5A 4NPAA 1YTUA 5F7JA 3ANLA 3U13A 4HB0A 1KIFA 2VUHB 3QJ5A 2VK2A 4GM4A 4Y6LA 1KDPA 5P21A 1EFUA 4E3WA 2QD5A 1OROA 2UYYA 3KZMA 4WLFA 4C7BA 2JIZD 4ZQCB 1H2EA 5LQNA 3P9QA 3TLMA 4TV9B 1VP3A 4J1TA 4B6RA 5EQDA 1AHIA 1BGVA 1EWKA 2WUVA 3DPSA 4NCNA 3C3PA 4ZYYA 3L7DA 1KHTA 3IUQA 1R9JA 4F84A 2VDPB 4DBLE 3SS9X 1J8MF 2IHKA 4HOYA 1Q14A 5HF8A 1PR4A 1NT4A 3C14C 4J75A 4HQ0A 1FTWA 4JT4A 1AUWA 3EODA 4X90A 3VR5D 3GK3A 4BC1A 2AQIA 4IGAA 4UEKA 2OTCA 3GJXC 1IY2A 4R01A 5B58T 4EGCB 1JHZA 1Z13A 4Z3OA 2R8OA 3IA2A 2DVMA 5C9ZA 4PG4A 4ALIA 2GBGA 2FRVA 3JZAA 3WKEA 4MV5A 3IKTA 4G0PA 4OEHA 1PS0A 2A9QA 2VNJA 3L06A 5KTOA 3TXAA 1JFRA 3OQNA 4GW3A 2VH1A 3LWNA 5AHOA 4CT0A 1B73A 3ESCA 3DHEA 3OFNA 3PUJA 4NVRA 2C31A 3QLTA 2DQ4A 3DQPA 3H5VA 1VSQA 1CLUA 3KB1A 5JQGB 4L5IA 2G1UA 5A5VA 3I34X 5LLSA 3HL4A 1VFPA 5FA6A 2VSFA 4I4TF 3WLEA 5A4MS 1RWBA 1YQTA 2AUTA 1YU9A 2RJOA 3GFFA 4G5HA 3G9QA 4WKNA 1ZOOA 2QMUA 3OFND 1FDWA 1V1RB 3R0ZA 1EK6A 1CFZA 4B3JA 4BFUA 2VN8A 4KN6A 5B5SA 5IC5A 4BO1A 1X14A 4KQKA 4MNTA 4TMTA 2XOKA 4PE5B 4S0ZA 2Z0MA 3SPXA 3OQPA 3AVUA 3F8SA 2HGZA 2MYTA 5A4FS 1R12A 3NDPA 5HQJA 3U4GA 5LYJF 3C6XA 2OA0A 1MVNA 3LLSA 3LP5A 4TN1A 5CX1A 3ROZA 4BNXA 1JG6A 2ATXA 4Q4AB 3U31A 5ICFA 4DV6B 2QVZX 1Q11A 1LDMA 3T35A 1XJ0A 1DG9A 4JR1A 4YHHB 2C9BA 2JLXA 2DAPA 5ENZA 2B8NA 2P5TB 4URHA 3RUEA 2J48A 4HPJB 3NONA 3UMCA 1SUBA 2BUBA 1C0LA 2CNKA 3IMCA 4IDOA 4TVBA 5HE9A 5LP6C 3KT3A 5BWLA 3ZV3A 3HCBA 3LIPA 1I9CA 1CHNA 3STXA 5ALXA 4LF8B 4RZSA 2PZFA 3PXEA 5CLQA 3RIYA 3C7TA 1WXDA 3QPVA 4MUNA 3UW1A 3QBJA 3B6IA 5K4HA 3DOEA 3FDXA 1PWYE 1W96A 2PVSA 2QZ4A 3UGJA 4EEIA 1KI9A 1PI3A 3AUXA 2C3YA 2B30A 2ISSD 1PKXA 2P2SA 3E9MA 3WNZA 1EFAA 4R84A 3R9KA 2Q99A 2RHDA 2VHYA 3QWHA 3LWZA 4NYJR 3HJBA 4QGHA 3P7MA 4MJ3A 2D8MA 4OL0A 5TMDA 5B4VA 1RHJA 4PR3A 3F71A 4XI9A 5ESXA 1HDOA 2XE4A 1UEIA 3L4SO 3FGOA 4Q3AA 5L45A 5FFMA 4Y2PA 5AK5A 5BNFA 3AYXB 1RR6A 1FP2A 2V4ZA 1YB4A 1XR3A 1CR4A 4C5AA 1ANKA 3HBJA 4MPPA 4BJ6A 1CG6A 5JCJA 2X0EA 3E5MA 2JAPA 1Z5NA 1E8NA 1EFKA 3LSYA 2QTAA 4XGIA 1XCPA 2P3QA 5DHQA 2GAFA 1I1NA 1JBKA 2CZCA 4IXNA 4I66A 1O1YA 5AJYA 3ZE8A 4RDXA 2P0YA 3OP1A 5JCJD 4DDUA 1AKUA 4ZPJA 4N7JA 3P71T 4F5DA 2YMPA 4UNNA 4KVFA 4MR7B 1PCXA 4LQCA 2JHCA 3IXMA 3TIVA 5JPDA 4AN0A 3F1KA 4TXMA 4BNNA 1D2NA 2XTAA 4OAPA 3HS3A 2QYHA 2SCUB 3I6IA 3MLEA 4AY2A 1NNSA 3HCWA 1Q44A 1I1OA 2C9DA 4RQAA 1Z26A 4KPEC 3ISJA 1R9NA 5K8TA 1ETUA 4DBLC 1XXHE 4G4IA 5ITVA 2BE7A 2HJRA 3PV0A 4KYUA 5FWDA 1GNTA 1GT6A 2GZAA 2BVNA 3S1AB 1ZYUA 1JXAA 2DPYA 3VZQA 2NP7A 1UXKA 3PEYA 2RH4A 1GAEO 3FCYA 1PD0A 1GZ6A 1J0XO 1SQ5A 5IZCC 4IYJA 3D1JA 5AVTA 3ZD6A 3NGLA 1DBRA 1PT9A 3HY3A 1D1TA 3OOHA 4LYDA 4Y9DA 1ISHA 3TTUA 1IMOA 1PP4A 3ZV6A 3UB3A 2I65A 5F35A 1BJRE 2YIMA 5AJXA 3RJZA 1H23A 3D59A 2B2XA 2C1EA 3PF8A 2JCSA 2QMOA 1AKTA 3DBIA 4HRXA 1ZHFA 5REQB 1FMJA 2CNNA 4NR0A 4RYDA 3T61A 3UJDA 1OWLA 3W8FA 5JECA 1M10A 1UP7A 3LDHA 5KYTA 4CM9A 1E6KA 1GG9A 3G2MA 3JALA 4YPFA 1WAMA 1N4DA 3ED1A 2PBZA 4INJA 2WHPB 4NAVA 1A7KA 3NZEA 1U1GA 1MB2A 2XUJA 2D1QA 3RS9A 4CM9D 1NLFA 4FOSA 3V00A 1RAHA 2KMLA 4TKMA 3DVSX 2A84A 1NRXA 4MDFA 1ZNXA 3TO5A 4IY1A 1VG9B 2P75A 4MUEA 2XGGA 3ET5A 1N2BA 2OB1A 3LHSA 3PHIA 3IDSA 3K9BA 1M8JA 4R2WA 4CLEA 2IHYA 3EEBA 4W5JA 1SG0A 4GMDA 3KV3O 3KJIA 1AMNA 3WLLA 3ZG6A 2P9HA 4D4IA 5EZYA 5AT1A 2ZZNA 5HNKA 1KDOA 1M2KA 2JFUA 2P8SA 4W8HA 3ZKWB 4PLVA 1Z4OA 1Z6ZA 3HZRA 3MD0A 2ZT7A 3N75A 4M49A 5BQOA 1QPZA 1FIUA 3KVVA 2QP4A 4IIDA 4XSGA 4K40A 1Y4DE 2R4UA 3CRZA 5CVJA 2HSWA 4OJTA 4QGBA 4X6UA 3G1TA 4KPGA 2FMIA 4AKGA 3VPSA 1MGPA 4B3HA 3A11A 4QKQA 1UZUA 2GAOA 4PO9A 1F4PA 2BMFA 2PT9A 1MC1A 3FMOB 2J08A 3ZW9A 2RI6A 4N3GA 2RKBA 4CQLB 3ENZA 1E5LA 4D9HA 2JIDA 3G7SA 3I23A 1XSEA 5DYYA 1EG2A 4P0PB 3LF1A 1DQRA 2XUHA 5AQEA 5CCEA 4D4JA 1SBNE 4QDJA 1NLUA 1X0XA 1NULA 1YS1X 4BASA 3LT4A 2SICE 1T6ZA 4YJHB 5GPBA 4ZTUB 2EC5A 3AM1A 1C8BA 4MWGA 3FAKA 3RHTA 2JFQA 4G07A 4B32A 2ZEJA 1NT2A 5IAGA 4C78A 1ZH4A 1OASA 4C4PA 3HP1A 1GA4A 3NBQA 2MDTA 4IIBA 2D5CA 4JHLA 4OQQA 1QDLB 3KKLA 5FTNA 4GOXA 4FC7A 2Q4BA 3R8XA 2E4YA 3IPRA 4EGQA 2PN1A 3GEHA 3K8QA 3OQIB 5J5AA 1ZQ1A 4EMSA 4ZGGA 1FYEA 3PXDA 1PFGA 3E04A 2V3WA 4UKDA 4APBA 2QN8A 5H16A 3TAUA 4NARA 3BHGA 4D9IA 1V8OA 3L8CA 4ZDWA 1CT9A 3TJMA 4HNAA 1K4MA 4RPIA 2QTMA 1A9OA 2UUPA 3ZWXA 2MINB 1S01A 3T9EA 1F2DA 3GDWA 1YZLA 1TEVA 1N1GA 7ABPA 2PAAA 3F6CA 2WF5A 4KFUA 4MXDA 4LPSA 5A05A 4EOGA 1E3MA 4E03A 3L0IB 3QVVA 3K9GA 3NB0A 4JWTA 4P3YA 4QYTA 3M9WA 4RMIA 3M3PA 4BEJA 5LD2B 1M1ZA 3J80A 4R8LA 1K5PA 4OLHA 2Z6QA 3C1TA 1A9QA 1EJ2A 3OPQA 4BNFA 5A3JA 3BMCA 3ORRA 2BLNA 4NBWA 3SF8B 5A7GA 1NUPA 3C85A 2DPXA 3JYNA 3KLMX 4YMWA 3A6FA 4IOMA 4BQQA 1PJ2A 2G4LA 1H0RA 1W85A 2V4MA 2HYDA 3NBXX 4KAJA 3PTLA 5J5VA 4XJVA 1C9EA 1OXTA 3K92A 2IEIA 2PTGA 2C97A 2OV8A 2A9OA 1KYIA 3DLIA 1D0IA 1IATA 4GE0A 1QVZA 4B0PA 1L1EA 1C3OA 2AFHE 3EG9A 2Y0CA 1GRRA 3IAS6 4WXHA 4XLTA 2GSWA 3QEMA 1M6NA 3PK0A 1HY1A 1OX4A 4WACA 3S44A 5EJMA 5B53A 4CU2A 5TY0A 3NVDA 2VTEA 3TH5A 5IT9A 5KTKA 1U3TA 1SG9A 2X58A 4RJ2A 2Q5CA 4FHFA 1L4FA 4QYSA 1NMSA 1XDGA 4URWR 3OC6A 1B6TA 1KY3A 2C5EA 2FTKE 1JA0A 1P5JA 1BMFD 2GO7A 3ADPA 3NEYA 3MUNA 1XLTC 4KZPA 5TB5A 4Q12A 3I28A 5L6LB 4ER0A 2Q3BA 1VLZA 3GMSA 2BFBA 5DZSA 3WWDA 1JVBA 4PS1A 4O5AA 4DCSA 4ZMSA 1R0YA 3BRCA 3TZBA 4BNWA 2VATA 3ZD9A 4QM6A 2IYFA 2ZRBA 4KYIB 1NI4A 1OGIA 4IKOA 3CKMA 4JLDA 2JGIA 3UMGA 2OAQ1 1CJUC 3BH7A 4PPNA 2ZJ7A 1TTHA 4ZVRA 3WHPA 5A2QA 4FNMA 2GBFA 4AULA 1H4QA 1MHPA 3MSCA 1QQ6A 2WD9A 1H2XA 1NVVQ 2VT7A 1S1CA 2HA6A 3E22A 3NASA 2QZSA 4C3ZA 1JI0A 1BXRB 1CUFA 2YFHA 1E1LA 2JLVA 1DXQA 1P77A 1A9ZA 2RCYA 5KCZA 1U3UA 4V0SA 2AC2A 1DEAA 1EUDA 1BN6A 1E98A 3IULA 4NHOA 3VPHA 4NENA 2Q41A 3GZNA 2R66A 5BOSB 1BDBA 2ACEA 1F06A 3GWZA 3S2GA 2W71A 2BELA 4FR5A 1AKQA 2XH8A 4MLDA 4ZDKA 1BHO1 4G01B 4Z1MA 4ZFNA 3NW9A 3ZW7A 1JR6A 1HT0A 2IY7A 5A7FA 5TT0A 1I8TA 6ADHA 3BRQA 3MWDB 2P77A 2Z8ZA 1NR5A 2EKLA 4UPEA 5LKAA 2PMWB 3QW2A 2J3QA 1T9GR 3QHAA 3VPCA 3AP2A 5AI8A 3FMVA 2JBAB 5IK2D 4Z1MD 1DRVA 2D3TA 2GN0A 1Q7TA 1OH7A 3CX8A 2GEDA 1A97A 4AO8A 4YR9A 4XIJA 2XECA 5FPKA 1CDZA 4ZWNA 4BVJA 3HB5X 4DYVA 3GUYA 5MFPA 5DO9A 1GCIA 2XYGA 3OIWA 3RLFA 1JEYA 2IHNA 1FDUA 3DR3A 1MFZA 1QHEA 4PEVA 4X0EA 4J0CA 1I7SB 4V0ME 1UWVA 4CR8A 4AVYA 1CRPA 1UODA 2XWQA 4M38A 4WUVA 2IBTA 1FRZA 3IGFA 1NASA 2C8JA 3OCUA 4ENWA 3OCVA 3K70B 4R1TA 4RDIA 2ZCVA 4DMKA 3O3CA 4JT2A 4WZAE 6CHYA 4NOKA 4A0SA 1JLKA 3OIVA 3GHYA 1U0SY 1ZISA 5FPHA 3V3TA 2GCNA 5AI9A 2R8ZA 2R6FA 3DBOB 2FXVA 4KO2S 4GX0A 3LLMA 4OHRA 5HX7A 1DKMA 5E8JA 2RI0A 2WMNB 1VTKA 4N5DA 4JJFA 2WAOA 1PHPA 3AUJB 4QGAA 1A5ZA 2PH5A 2ZIGA 3DPIA 1V26A 4HDMA 1YR1A 5DW0A 2PRKA 4W7SA 3T06B 4B2IA 1JI3A 1NMZA 5EAIA 3TSZA 3N9IA 3UA3A 4IINA 2ZYHA 3LCJA 3NTRA 1NMQA 1TEZA 5DVZA 3CMCO 1UAAA 1E94E 5KYYA 4MVJG 2YS6A 2Q4DA 5BVGB 1UPFA 2BT4A 5JHHB 3DE3X 1U5BB 4XRGA 2ZI6A 3MT9A 2N9UA 1USGA 3K5HA 4BYMA 1NNEA 3EYAA 4TMZA 1KI1A 2BFMA 1VI2A 3BQ9A 3UJ7A 3K53A 2NUTB 1KMNA 3W5VA 4OHMA 3O82A 4ZODA 1WUIS 1AQLA 1UJBA 5CHEA 4MQMA 1GPAA 1VHDA 1HE1C 4O4LA 3QE3A 3KWLA 4QYIA 1U2DA 2AOTA 4XAQA 2K2QB 2WI8A 3TCNA 1I0LA 3QBDA 1OYVA 3P4YA 5FWYA 1GPMA 1T1IA 4TT8A 4EHFA 3WL4A 3LYUA 2C1ZA 3PNVA 4CF4A 2NSJA 1CHDA 3DT8A 3HGMA 4N0EA 4EHKA 2Y4OA 7MHTA 4GKJB 3UAZA 2HU8A 2XKJE 2V1UA 1P4RA 2O7NA 4KQ9A 2Q5HA 1QZ3A 4XARA 4BDTA 5LMUB 1HZZC 3BULA 4U7JA 2ZG6A 1W0JA 2QXTA 1OY1A 4ZIRB 4XDZA 2FMFA 3SG0A 1MO2A 5LSAA 2HW8A 4KAFA 4XQGA 2F3RA 1JIJA 1ZM3A 1H2ZA 4JP8A 3QEKA 2CFCA 4G3XA 1K89A 3ED5A 5ESRA 3GLSA 1W0JD 2XCIA 5AW1A 4XJSA 5KMGA 1JJIA 2F43A 5J1SB 1CUZA 1T3GA 4F6CA 1L7DA 3NIDB 4YONB 3JQGB 4YRTA 2PANA 2J6HA 3NWOA 4RMJA 1KH3A 3W3AD 5CXSA 4YRQA 4TS3A 2XCUA 3GEPA 4MI1A 1D4OA 2Z1DA 3HA5A 4TUYB 2ZRJA 4RMGA 1WMDA 4BTVA 2WZQA 2V58A 5F3DA 1C9YA 1W35A 2HKIA 2IPNA 2Y71A 2PGOA 3VR0A 2EGGA 2BUCA 3MSXA 4FU0A 1YCDA 1J49A 1Y4AE 4I9FA 1IBLB 2P78A 2LCIA 2VHUA 3E35A 1A9XB 1PJZA 1TJ3A 3HVIA 1S5PA 2IQIA 2ZI4A 2R7KA 2FPIB 3AILA 3OPMA 1W36D 1NM5A 3HVJA 3NTXA 4P54A 5CW1A 1NVEA 3SD7A 3SDZA 2OMEA 1X1BA 5FD8A 2VJBA 1ISMA 3OO0A 3WBBA 3PFGA 4XXHA 5C1OA 2FFJA 5AI4A 5AXBA 2JANA 5H02A 4WY8A 4Y9SA 2IHJA 3ZVMA 1H69A 3BB3A 2VDJA 4RF2A 1VIMA 3UAWA 3EWAA 3KNZA 4DIFA 4E5UA 1A7AA 2XKKA 5A9TA 4TYPA 3JZMA 5KTSA 3ZW8A 1AD2A 2G0AA 3F7OA 5ALQA 4LJKA 2HHJA 2I99A 3IQGX 3VUEA 3ZU6A 2E4WA 3IIJA 2TMGA 2QE6A 3PA8A 3I9MA 1NVMB 1TK9A 3BIOA 1XYGA 3IERA 4P4LA 2O0MA 2PG3A 4MUKA 4DYDA 5DTQA 1TJPB 3TSOA 5KNBD 3HRKA 3BJEA 3K0HA 5J5CA 3ZVLA 1G3MA 2IYOA 4OU4A 1QIDA 3I9V1 1ZD1A 1JJFA 3PQFA 5DTEA 3GUHA 4L28A 2IZZA 3KAQA 2B4QA 4PQYA 3LVQE 5L3ZA 4URFA 3VM6A 1NJ2A 1VE7A 3GJ6A 1MO6A 2WTNA 4FZRA 4ZVPA 5FLKA 4DGSA 5IJ9A 2ZVQX 2Y9PB 2Z6AA 3SJUA 2AEEA 4OMUA 1VPTA 5GOZA 2Y2UA 3EPPA 1FU7A 4ZOQI 1FUIA 1ZR2A 4MJXA 4ALJA 2V0GA 1NNLA 4K6OA 2IKQA 3PCXA 4XTRA 5G0WA 5LB4A 3UJ8A 2JCYA 1Q7CA 4M0FA 4DDVA 3AY7A 3BL6A 4F96A 5JNWA 3A2KA 5C8DA 1OAOA 4CODB 4F4FA 5GM1A 1JFFB 1XD9A 5FA8A 3SC2B 3BWVA 3C3BA 4FBMA 4J9VA 2XYHA 1E2PA 2WDZA 5G53C 3P32A 3TRHA 1MG5A 4EO7A 3MT7A 4GX1A 2GD6A 1G5FA 5DNYB 1O89A 3P9RA 4YYEA 2AVNA 6NULA 5JZBA 2JAUA 2P1RA 1EP3B 4P4SB 1EGQA 1AXRA 2FSUA 2VH2A 3MT0A 3O1IC 4HFJA 5JRJA 1JVNA 3U3XA 1SXJB 3S8EA 4DS3A 2R1ZA 1N1EA 2OFXA 1L4YA 2OFPA 2IP4A 4G0YA 3N8KA 4JJIA 2RH5A 4CMBA 2FPXA 5AW6A 1KOGA 2DH6A 3JV7A 2JFFA 2I0FA 4RTNA 3CW9A 3HCPA 1FF9A 3QYJA 2XB4A 3FTFA 2GXQA 2E4ZA 4QHSA 1T35A 1T1EA 1MUUA 2WSMA 4HWPA 3IP6A 1GR0A 1Q50A 2R6DA 2CHFA 1U2EA 3FIUA 3QVUA 3R9IA 2ETXA 2GBIA 4ITVA 1W5SA 4YAFA 4K86A 5ICMA 4EFLA 5AIAA 5KX5B 1WXIA 2C2YA 1NQTA 4QAJA 4U7HA 3H7AA 4YFVA 5U1PA 4E12A 3ZVKA 4MS1B 5E2AA 5DU2A 3SHTA 5M34A 4R7TA 1OXBB 3HO6A 3OZCA 4MDYA 3OZBA 4YGXB 2O5CA 4YR7A 1Z4LA 2NN3C 3MUFA 4N8DA 1XTTA 4U02A 1PO7A 2JLAA 2WJPA 2ZB2A 2A30A 3AP3A 1E6MA 2X2OA 3B1ZA 3W6OA 4ETIA 2O1SA 1HTWA 3PE6A 1BMQA 1H6DA 1W87A 2PY6A 1Z0JA 4KWIA 3RRYA 3ZK9A 5K0BA 4DKXA 4CKEB 1AKRA 4RIIA 2P62A 1L7EA 3LDGA 1LC0A 2H9AA 4CYMA 3F4LA 3IUMA 4BUCA 2ILTA 2H4XA 2ZBDA 1WNFA 5CT6A 5L4NA 4ZEXA 2C94A 3RAFC 3IHTA 4YUZA 4IJQA 3E82A 3BJZA 3RVLA 2K87A 4GMFA 2F3PA 1CZKA 1NXQA 5EERA 1XDDA 4J2HA 1JKFA 3BL8A 1ZHOA 2QQFA 2ZBQA 4KXUA 2DUNA 2V5AA 4AZVA 1VL6A 4JMPA 2BLLA 3H7IA 3SX2A 4BJ5A 3OQBA 5HK8A 3DCIA 3CWCA 3ICOA 3STYA 1Y9AA 3GR6A 5HUHA 2KBEA 3O7MA 4D02A 6LDHA 1RMQA 3KZXA 3UC5A 3ZIUA 3IR5A 4TTQA 1JMVA 3D3KA 4YCJA 5TRTA 3CGWA 1E1YA 3R9XA 1NXOA 3PDWA 5IRCD 2FSVA 1Y37A 3VH4A 1MO5A 1Z83A 1ZMOA 2ZP1A 5K0ZA 1NXSA 3UJNA 1FW6A 4GP6A 3J81A 2HA0A 3S29A 2QQGA 4FWIB 4MV0A 3TMAA 3DD1A 2R25B 4AWAA 4ZYXA 5JS8A 5LQDA 1YRQA 2CGEA 2DX7A 4JUBA 3JCZA 4QXAA 5E6UB 5E1BA 2X0KA 5EPEA 4LZZA 2ZB8A 1J8DA 1Y1RA 1X7XB 3PLNA 5A1JA 1A72A 1IBCA 3BIWA 3N8HA 1C2YA 1P4GA 4LHVA 4WXRA 2JJMA 4D25A 4YCLA 4Q1EA 4RVGA 3FWZA 3FNEA 3PIIA 3H11A 2M6KA 1V39A 1DT5A 1NI3A 3LOPA 2R8PA 5BNZA 2MSCB 3BDAA 4BV2A 1CJTC 3IMKA 2P6OA 3TR6A 4YN3A 4C08A 1SUDA 2GBLC 1YRBA 2IE8A 2XF2A 3A2MA 3GXOA 1XPUA 1ZMTA 2GXUA 2O8NA 3QOYA 5EWJB 5JR3A 1LY1A 4N48A 3EXHC 2RGNC 3KR9A 2VTKA 1I6MA 4XSHA 1M76A 3QSGA 1GFZA 5B6PA 5IUKC 1TJ7A 1A8UA 2F3UA 4JCOA 4TLEA 1ONNA 5HCNA 4EKYA 1R8XA 5JU6A 1TZMA 3D31A 3S99A 1TJ4A 1P5HA 4XASA 4NPHA 1J7KA 2OBBA 4NBVA 4OJNA 1EXNA 1I36A 1PGPA 5ECDA 1Z8DA 1LLFA 4LMAA 1A8QA 4M60A 1Q12A 2A5FA 3I53A 4XPIB 3SIXA 2IEBA 5LVAA 2PYZA 1N2CB 4UNQA 4G8CA 5D7BA 4L74A 1DEHA 1MNQA 2B34A 3ANNA 3MBKA 4J29A 3ZDFA 2BTOA 5C53B 3OFKA 3IMEA 4HZIA 3NAZA 3GLUA 2NPFA 1VG8A 5ADHA 3AQ4A 2HRRA 3VOBA 4EATA 4NFYA 5BWMA 4LYEA 3LXRA 5SZHB 3DBHB 2PX2A 3OETA 4MIOA 4FFSA 2A0FA 4F9EA 1DPGA 4F3KA 3PHJA 1Z75A 4G89A 3ICQB 3OBIA 5KWSA 4P4GA 4X00A 2Z4RA 2VH5R 2IA5A 3OFVA 4QXPA 2H2WA 3D7NA 2NXJA 4CM3A 2AG6A 4MRMB 2CL0X 3R74A 4BVEA 1CQPA 3IUPA 1ULSA 2VPXA 3FHTA 4IPTA 4PRZA 1L8LA 3WL7A 3UJAA 4IKEA 3DVLA 4PC6A 1CZLA 1S7GA 5CB4F 2RHLA 3T52A 3WZ2A 2FFRA 3ZKAA 3NGXA 1KO7A 1O6ZA 3O4JA 2YJTD 4BZZA 1AXGA 1CD5A 2WZBA 3PGKA 2IP2A 4UFOA 5DBIA 3U9SA 1E3QA 1K6EA 2LDXA 5LIPA 1OXUA 2GEFA 3GDGA 3JQ9C 5FOSA 2ONCA 3FFWA 2Q5IA 3INRA 4EHJA 1R5OA 3VO9A 3WAKA 5LU8A 1FFXB 3A1TA 3KQUA 5DI9A 4ZANA 1X7WA 5F5XA 2FG5A 3PVZA 4TV8B 5JD4A 1V6CA 3NTLA 1T26A 4O2BB 4S0XA 4REQB 4EB6B 3EGDA 3KE9A 3RIHA 2ZOSA 5LUBA 3SAJA 1IYZA 1YHNA 1R4AA 3EGIA 3GO4A 4WLEA 5E3JA 3O84A 3RYIB 4R9UC 1ADGA 2BEWB 4I1YA 4LDPA 1NF8A 2Z58A 3P45A 3D4OA 1C4KA 3TSYA 1EFPA 5B7PA 4GDFA 2XUZA 5TVGA 1G59A 3A4MA 3QUQA 1V4NA 1OZHA 1WXEA 1Y4UA 1YZFA 4DJJA 1PGNA 3ZIAD 2JLSA 5LLTA 3TLAA 1EK1A 3DJYA 3L02A 4UXIA 2WZDA 3WJ2A 3DZKA 3N1UA 2P9YA 4FC6A 2X3FA 1TQ6A 1YOVA 3CUWA 3MJFA 4H7FA 4LQ4A 4Q82A 4RPJA 1REQB 4G8DA 3GWGA 5EIXA 1KJJA 5IBQA 2RGGA 1F5NA 3SICE 1RZRD 1QHYA 3E15A 1WPXA 3EF0A 3GN2A 3WNBA 4DLRA 3MWYW 1R3UA 1Y8ZA 4HLCA 1YFEA 5IABA 3V1MA 1PRYA 3OCFA 5CYOA 1VC2A 2JCGA 4LKRA 3AT1A 2MSDB 3WGTA 1T91A 3TR5A 4FILA 3ZWKA 1E3IA 3GTDA 3WGGA 4B2LA 4FCVA 5FKJA 4D6YA 3L7AA 1N8NA 1RWXA 1T1SA 2UV8A 1X7DA 1AUXA 1HFJA 4ZMBA 2R48A 1RWWA 4UE6A 4DQVA 1BFDA 4EZEA 3I1JA 2QMYA 1GVNB 5B3KA 1NWCA 5HF6A 1G8GA 1BX0A 4I5EA 3FZGA 5LWHA 1O58A 1UZMA 1E92A 3WYCA 1P2VA 1JQEA 4XCQA 3DMHA 2I6SA 1J3UA 4H7PA 3KHKA 2WF9A 3R75A 1G7SA 2ONYA 1JFVA 2IYYA 2NYUA 5CT4A 3GAMA 4B44A 4MGYR 1JAIA 1YE5A 1KMHA 2XLCA 4IG9A 2DH5A 2NQ2C 3BTOA 3L05A 3OJOA 4YRSA 1I1QB 3PQ4A 4RHFA 3ZS8A 3ST7A 1XQWA 3LBFA 5KWVA 2IOHA 2OQRA 4G65A 4JB2A 5DNAA 3ZJ5A 2RHWA 1F4VA 1JWLA 1NBIA 3PPVA 1QB7A 3A1CA 3L9WA 1K92A 1VYHA 3RJTA 2QSJA 3BICA 3PC4A 2CLIB 5EFOA 3H1BA 4L85A 3D8BA 1MF7A 5LQKA 2A5JA 2VQ3A 4ECAA 1FSGA 1ZIDA 4QPNA 1JEQA 1J21A 1VYTA 4UC0A 3OZVA 4WJKB 4XSVA 1B43A 4IG4A 3EPJA 4BFSA 1U94A 2G1KA 5ED0A 2GJ4A 1LQ2A 4G36A 1OYOA 3CNLA 3A05A 3ZHVA 2J7PA 2R1UA 2WT9A 2HEIA 1QV6A 4X6YA 5CJPA 1RRGA 1SC9A 3MTDA 1KKLA 2Z8YM 1FNSA 2JGAA 1ZGJA 1UZNA 3GA7A 2YNMC 4O2AA 1BWPA 5JYEA 5KSOA 1VLLA 1AZTA 3TM4A 1IQUA 3G8CA 4QDXA 3QVKA 5KYVA 1M8FA 2PL3A 2G76A 2YOFA 2IV7A 2IVFA 5E3IA 1CE8A 4O5OA 5CIYA 3RC8A 1XDZA 2YDYA 5FP0A 3HEMA 1QUFA 1NNUA 2ZM6B 1GT91 4J2OA 2WVHA 4Z0TA 4BWFB 2BFDA 1WV0A 2G40A 1WPRA 2VYVD 3PPYA 3PXXA 3N2IA 3OZFA 2NXNA 4UBNA 9LDTA 4J49A 5CX1B 2HWUA 4IKPA 1R4MA 4LN1A 1T5HX 3JWJA 5DHRA 4KQMA 2XKAA 1X3SA 2A58A 1R4NA 5FFFA 5LMNB 4IH4A 3CYFA 3RHSA 5AR1A 1UOPA 3ADOA 5KNCD 1F8UA 3ZDYB 1N7GA 1VA4A 1HPLA 4RPLA 2QAGA 4DNXA 3HYSA 3C7CB 2ECPA 1XDUA 3FTEA 4MB0A 3C98A 2QTBA 4CWAA 3OE7A 3DEYX 1Y4ZA 3BIJA 1FRVA 1LPPA 3AIMA 2WU0A 3HPRA 3QU2A 3TYXA 1XZCA 3VNVA 1DAKA 2PSFA 2Y6UA 1XLUA 3JY6A 4QEDA 4XTCS 1W4BA 3OTGA 1QWSA 4IFIA 4DBVO 3OE7D 4YRCA 1MX1A 2VJOA 2X4IA 4TT3A 2IYRA 4UQOA 3TEMA 5IF3A 5JXGA 4N0DA 3JPYA 1J2TA 4BRUA 1U90A 3VISA 4F93B 3MUOA 1FPQA 2D27A 2RGXA 1YBAA 2XWSA 3KZKA 5A0FA 4FM9A 1RQXA 4NDZA 3LSTA 1S3IA 4TT3D 4UUOA 3NBFA 3L7YA 1HE3A 2WAYA 3QXCA 1NUAA 4I36A 5J9FA 1T8WA 4HLUC 2FG7C 3OX2A 3H1TA 1FXWA 4XWYA 2EVWX 1FFHA 3Q9NA 3QELA 1J0BA 5EPOA 1E6LA 4Y30A 3SDBA 5HZGA 1VQ1A 4ZV9A 1MOSA 4S1WA 1DXYA 3RUFA 1HOXA 5BN5A 5C1BA 1P5FA 3HMQA 3IAHA 2REQA 3STVA 2EIHA 3DDUA 3N3BC 4FHDA 1YB1A 4ANFA 3TRKA 2A57A 4CEIA 3Q0TA 2CXOA 3T4PA 1C1YA 3W7BA 2Q6LA 4R81A 4TZKA 4B9EA 4KE6A 2Q8PA 4KH0A 4D56A 1S9DA 3U16A 2QL9A 2ENWA 4Y6GB 3FNGA 3ZZ1A 1OV4A 3C5VA 2W4QA 4Q02A 2VAPA 1FJ2A 3RSHA 2QIPA 4BNLA 3TK1A 4WL0A 3V7YA 1L3CA 3QP9A 1TYAE 2VJLA 2I4NA 3IURA 3RROA 4B73A 4Y2UA 3CPEA 4FS8A 3RHZA 5TPZA 1IY0A 3QMMA 5HKOA 2ZETA 3F7NA 3NEJA 1UK6A 4OLJA 3OEWA 4KWHA 4E13A 1K7XB 1LS1A 2PSJA 3E5RA 4LI0A 1NF3A 4CV0A 1U7TA 5FYDA 3OEYA 3B85A 4ID3A 3NHJA 1KZ9A 2AN1A 5TPZD 4IMRA 4R0MA 3E27A 3LCMA 4XR9A 1Z6GA 3JQ8A 4KXVA 1EJBA 1L4KA 1HE5A 1WUTA 4S1VA 2X0DA 4PNEA 1MJFA 2X3UA 2ZRDA 1H0KA 3E53A 4JI7B 5FUYA 3IEVA 3OLXA 4WDQA 5I9NA 4O3FA 4FR0A 3TTXA 2UXBB 5JS1A 1OGYA 3VV3A 4E2YA 3DEIA 2V9PA 3ZZ0A 1XZIA 1IJKA 1SBTA 1YA8A 2WWVD 2VP4A 5EN4A 1N3YA 2QUZA 2O8EA 1ZVQA 3KALA 4NBKA 3E0XA 1PV2A 1YT5A 3D8RA 3IXLA 4GOMD 4DY4A 1WUHS 1LI4A 3BAZA 4MRNA 3CPHA 4GQIA 1BDIA 1NE2A 1RS0A 5CTJA 5K8IA 2YQ4A 1XAGA 1CCWA 2Y1FA 1XYYA 4O3MA 1L5LA 3P4UA 5B1HA 4B4VA 2PLFA 2H11A 3IHLA 4TSRA 2HHCA 2VA9A 1EP1B 3UZUA 5JJ5A 2HIGA 3JALB 4H59A 5AVUA 4E30A 4DV7B 1CY4A 1ZOLA 4HP8A 3AI1A 2W2TA 3N0VA 1WPGA 5T8KC 4S05A 2ZIVB 3B1KA 4KWTA 1K62A 1DIBA 5FBKA 3WJAA 1FFEA 4OP2A 3E1GA 3WGUA 3O4FA 2H4WA 3NTVA 3I58A 1XPRA 2XTNA 1GNLA 4GG1A 2C42A 3GFPA 3QKRA 1GL7A 5MGNA 1TTTA 3BPSA 1IWOA 3M6XA 4XLLA 1YJXA 2B20A 2Q5JA 5THQA 4Y2YA 3ZBUA 1VZ2A 2B9EA 2ZRGA 1PR6A 3TI7A 3O83A 3O8QA 4RV9A 1I4WA 2NO5A 4ESOA 1K6IA 1CSEE 3U7HB 2AOUA 4EJ2A 1E9RA 4Z5XA 3RM3A 1M1YA 3TRJA 1JPNA 4WOBA 5EZYB 3ELYA 1VL5A 1ZGAA 3LO8A 2VJYA 3QF4A 4NX2A 4E5PA 5GM2A 3FFTA 5LIRA 3K20A 1CY7A 3KX2A 3VH3A 4F3CA 3DAOA 4Q3OA 4RZ2A 5CT9A 3N39C 5FEMA 2ZBUA 4CN9A 1OGJA 3RI3A 4X60A 1C3EA 1DC7A 4RKYA 4MAAA 2Z30A 1DUVG 2X6QA 5KC8A 4PZPA 2PFSA 3C87A 3K7EA 2C29D 3I37X 2E3JA 3GLVA 4KACA 1Y6FA 5HMMA 2D00A 1GCOA 4L9SA 5JH7F 4H35A 4S1NA 2Z09A 3EBPA 1AMOA 4JL8A 2P9CA 4G0OA 1PYGA 3GP3A 2E6UX 3ETDA 4KN8A 4ZVKA 1GTRA 3KFXA 2EBHX 1UXOA 5TVKA 4NJMA 4DIKA 1ZK1A 4IIGA 4UEWA 1AC5A 3QFRA 2A92A 3E9CA 3OZTA 1KWGA 1Z5WA 4TL9A 2BSXA 1UJCA 2YJGA 4AJHA 1JFTA 3JQ6A 4WK2B 2PGDA 4OD0A 4X63A 4ZA2A 5GZ6A 3ZGNA 4L07A 1I2ZA 3IEPA 5TPWA 3ADDA 5AW2A 4PTYA 3QHQA 1NAHA 4E5MA 4GVPA 1ZJ6A 2GTPA 2E9SA 3NBKA 3HBFA 4HNAB 5C31A 4Q6WA 3UM9A 2OCLA 5EJ6A 1A76A 4ZVMA 5ELXA 3GGJA 5KJ6A 4R2LA 4C88A 2NO0A 2F9FA 1LFAA 4P58A 1CWUA 2ZSKA 3BRSA 2NGRA 2C3PA 3HL0A 3N70A 2ZIXA 4LOHA 4PZ0A 3I5UA 4QNMA 4Z99A 3WXBA 1O9HA 3WX0A 1AB5A 1D5CA 1FMLA 1W52X 5DNVA 1VRCA 2CDAA 2R9VA 1U8UA 5LOVF 2IIQA 3MELA 1IWBB 4JC8A 3H1EA 4Y0NA 4BLPA 3W5AA 5E9WA 2DFLA 3BMCB 3D5TA 1Z6YA 2Z1NA 4NPCA 4L5YA 3VHXA 4D5GA 4FJ1A 1EYZA 4U5XA 5JXWA 2ZI5A 1VIVA 1W85B 4RK0A 4CBVA 4X24A 4P7JA 2FW8A 4JVNA 5J58A 1EVYA 4C2UA 1O8BA 2C4NA 4KQ2A 2M32A 1EVQA 2H92A 2M1XA 5J4YA 1C3OB 4W5HA 4BVGA 3EG9B 4NYMR 1DV1A 4DPKA 3VMMA 3QEMB 3GB9A 1OX4B 1DZ3A 4GQAA 1PJRA 4LIPD 2B9VA 1WWKA 2AE2A 1VDKA 3B13B 3VKFA 1UKCA 2QZZA 3ZNNA 3KB6A 1XRNA 1KMIY 2EJBA 4LOAA 3R0JA 4P4NA 4RZHA 6REQA 3GLFE 3VSEA 2KJQA 2AX3A 5ANRB 2PFKA 2DERA 1M0TA 1VKRA 2ZBEA 1ZD9A 4J1SA 1JLSA 3IKMB 1BHQ1 2HRDA 2CKDA 2GTIA 3EQ8A 3SZUA 3ZPXA 2P2LA 1LK7A 4ZT4A 3PTZA 3WXMA 5DM1A 2PH3A 2BFBB 4QNNA 4EKEA 4L08A 8LDHA 3WGKA 1W5AA 4FDUA 3D64A 1YDEA 4EPWA 4JBGA 3BILA 2WHYA 1RYFA 4CIWA 4WNIA 3T41A 2JAQA 4FEAA 2JGJA 4PGGA 5K4AA 4KVAA 3AINA 1H6AA 1NI4B 4N3CA 4R83A 4ZVSA 3WHIA 2PJDA 4AMYA 5JY1A 1Z36A 2YWXA 1DKLA 4ZOCA 1PWHA 3UANA 3CR7A 1M7HA 3GJQA 3QG5A 4UDOA 4PZLA 4RF4A 4RF3A 5T67A 4YXFA 4V1CI 4YC7A 2C3MA 4M7RA 1JR3E 2QENA 2NUBA 2WYVA 3E22B 3BGDA 4PRYA 2W6PA 3ONNA 1FDIA 3WV5A 4D97A 5JNVA 5TLSA 3RRJA 3HCFA 3T3EA 1ONOA 1IB0A 4KFTA 1EUDB 3EGXB 1F51E 2C0QA 1R0LA 4NENB 3FOFC 3GZNB 5D84A 1H8EA 1BDMA 3M4JA 3MN1A 4G2NA 2WOOA 3DKKA 4K9QA 3V8VA 1EDZA 2JJYA 2EARA 4FEYA 4HEA1 3HXOA 1CQIA 2HMWA 1T29A 2C8VA 2P3LA 2QRJA 3EVDA 3P0JA 1F3OA 4RLFA 4D0LB 4EJSC 1Q6YA 4PX3A 5BWCA 1CQZA 1P4HA 4ND4A 1EMDA 2BEUA 2P2NA 1A4UA 3WQBA 3DUWA 1Y1TA 3FWPA 4WFQA 2WFMA 1M54A 1NFQA 3KOXA 5H3LA 1J5XA 2OCYC 3OMLA 1P31A 4BO2A 3D1VA 1ISGA 3K70C 2G9ZA 4KDRA 4PX9A 5LYYA 5C52B 1JEYB 5LKRA 1XT6A 5ALNA 3L7CA 1JJVA 3EH2A 1FXSA 1F8GA 4UULA 3ZWNA 2XB2A 1SXGA 1EWQA 1GADO 1UPUA 2O0JA 4R9VA 5EE9A 5FHQA 5CEFA 3SM3A 3IBFA 4KBYA 2EV9A 1RRCA 1K5GA 1NOIA 4IQFA 2BBTA 3RGWS 3IESA 3NOXA 4YJ3F 4IUYA 2P4HX 1L5SA 4WAUA 2I03A 1MQ8B 2A35A 4GVXA 4ZALA 4DV5B 2VSYA 1N6IA 4D9MA 2WYIA 3QNUA 5EEHA 4PHHA 3AM3A 1H2RS 5B3JC 4Z8XA 3TNLA 5E7QA 2B3DA 1DTEA 1EFLA 5H9WA 4HDRA 1DHTA 3OUZA 4HDMB 2XMGA 3GROA 1SHZA 2JGMA 1EGHA 1NL3A 1P39A 4KQGA 1A88A 3KSUA 4IFEA 3UBMA 4ZVUA 3SZRA 1PJ3A 2V98A 2YMMA 3FFAA 4FSDA 4D8XA 1J99A 3OTHA 1LJLA 2NUPA 3PEEA 1R64A 4QGFA 5KYYB 3BXOA 1EVZA 4G97A 3OCXA 2B7LA 2W70A 4CVNA 1K2WA 3AR8A 3FSRA 4YRJA 4DAEA 1Z7WA 2BRUA 3SFZA 5A5GA 3IE0A 1E3EA 1SZPA 3RFXA 4C0WA 1T9GS 2X86A 4BO4A 4QYIB 4BYGA 4O4LB 4QTZA 2AW3A 4O0MA 2AOTB 2BDTA 1D0VA 4N5NA 1YQ9A 2Q0SA 3WDSA 3R7AA 3GYGA 3V2UA 2I6XA 2N1BA 1AE1A 3PD7A 4C7JA 1W6RA 3GY0A 3LPDA 2PMCA 5FWYB 1K27A 1M2WA 2QRZA 4BE7B 2Q9AA 3ELUA 2AQ8A 1MMFB 3Q0EA 2FXIA 4ZO9A 4UD6A 1Q0PA 3O8OA 3TE6A 5C4MA 4DCCA 1QRTA 4C5BA 4B5KA 1AG9A 5JQGA 3DXZA 4EG0A 3OEED 3S7ZA 1YE3A 1SVOA 1WVGA 1UBEA 1YKGA 1UJMA 3LOQA 3UHPA 2HCTA 1D8AA 4CDNA 5SYMA 3WK6A 1AV6A 1I3CA 4I5GA 1XXLA 3WFIA 2CLMB 4HQKA 3KWFA 4B9AA 3EEFA 1O7JA 4MCHA 2PXXA 1XTKA 5KMGB 1GHTA 2ZSEA 3B52X 1DI0A 2F43B 2I4OA 3L6DA 3MWFA 3OCWA 3DO5A 4ODIA 1TE2A 2PGNA 5AVWA 2ZYDA 4WSOA 3EAQA 1R27A 5LJLA 4LFAB 3GJTA 1FUOA 2JFHA 3OJFA 1M1YE 3DGFC 4PW0A 1SNYA 1Y1KE 3MLAA 2JFGA 3QPUA 2DFDA 4JZKA 3O2JA 4Q03A 4ZZIA 1E0SA 3U49A 1EM6A 3TPZA 5IX8A 1KKUA 2R2AA 3TCKA 2WUWE 1W36B 1WETA 1C3CA 4MMZB 2ZRMA 3AUKA 3R4CA 4I9NA 4E1AA 2K7FA 5JAMA 4LF5B 2DYKA 2X15A 4MUGA 3AL2A 4OUDA 4URZR 4JC4A 1F0PA 3Q9SA 3FPLA 4M6WA 3KJEA 4ABTA 4IIHA 3HDTA 4M1SA 2PPLA 1J39A 4S04A 2PUFA 2ZTHA 4HGRA 4ER6A 4P3OA 5DHUA 3VVLA 2YXDA 4N01A 3CCCA 1LPBB 4MUHA 3PFBA 4UM5A 4YAIA 3ENWA 2Y76A 3S70A 3GVIA 1LB1B 3AB3A 4NC9A 3QRWA 4UQPA 2CHVA 5D6OA 4A1FA 4CEJA 3NOQA 1YB5A 1ZUIA 2VXYA 1GU0A 1FSPA 3JU3A 5HR5A 3K71B 4EF6A 2G70A 4RQTA 3WMGA 1S8OA 5KVSA 3PR1A 4JL6A 3MILA 5JDIA 2XT0A 3PEFA 5IT5A 1VOTA 2FEWB 2J6IA 3A1VA 1SBZA 3RU2A 3V97A 1Y7LA 4BO0A 4ZYWA 5K6TA 1W94A 1DP4A 3NT4A 4JJZA 3BXPA 2RK4A 2ZQZA 3F4BA 2I6GA 3CWQA 3H99A 4L5CA 4RAOA 2EP7A 1NVFA 3I5YA 3OBBA 1WVMA 4ALNA 3KYDA 3ZWPA 1XAIA 5CB8A 3O8DA 3C45A 2YYYA 2D2IA 1T6XA 4INPA 4XE5A 4HZGA 4K6MA 4OGWA 4CQJA 2DPHA 4L16A 5JSKA 5EZSA 2LD4A 5IJ9B 1OA1A 2NM0A 2NSDA 3NCTA 4Q37A 3TWOA 3GEEA 2JEZA 2AF3C 1D07A 2Q5OA 4OP3A 3WRXC 2ZDGA 1NJ5A 5ESDA 3G0IA 1J0CA 2XIQA 1Q7EA 4GICA 2IS4A 3LY7A 1ZP6A 1U15A 4KNVA 4LKOA 4X3PA 3PLAE 1V48A 4K9RA 1P8JA 2D1TA 3IVXA 4EM6A 1GZSA 3N6XA 4JQSA 3U40A 1G21E 4FZVA 4KQWA 4KIGA 4Z86A 4YVFA 4C05A 1PFWA 2H3EA 2P4UA 1FRQA 3RODA 4HB3A 3TBKA 4EX7A 3SJBA 4FGZA 1WKVA 2JD2A 5DM0A 4E4YA 1E8MA 3EZ9A 4BNDA 4BVAA 2G71A 4F85A 2HQBA 3PGLA 5KPJA 1QH0A 2PPVA 5KQSA 4OBBA 1PGJA 3MRSA 3V32A 2MWMA 3NTOA 4UHHA 5G02A 1PJLA 1G6KA 1K06A 1OREA 2GZ1A 4OBWA 3ZZTA 1G5TA 4LE1A 3OKFA 4TN5A 1Z08A 1KEUA 2F9LA 2XZDA 5IEBA 1OFTA 2CVPA 2QGNA 1TTQB 1LBIA 4ZGBA 3NDJA 2FN7A 2J0UA 1F9AA 2ODBA 4J7XA 1IHUA 4HPWA 4ILEA 5EYPA 3RAPR 3RFTA 5HRAA 3RT7A 2QY9A 3KZOA 2OGSA 1XQ9A 3VYVA 2UUCB 3IUEA 2ZATA 1T5BA 3FYCA 3H6GA 4X8MA 1AUVA 4X94A 1DCTA 3S2ZA 3RAEC 1UC8A 4XQ9A 4JI4B 4OQLA 3PFFA 3ANYB 1PF7E 3ZIAA 1TMGE 2O57A 4L4RA 4EYKA 1WU8A 4MI9A 5FBVB 3OHSX 1UP6A 4HAOA 3E1SA 2Q3MA 4AYTA 5C7LO 5I9MA 1HL3A 1CY8A 3H3JA 2Z57A 5KU1A 3KKNA 3UHJA 3C3WA 2AYXA 5HFNA 5IU6A 1JSLA 1MR3F 1FTQA 2O05A 2Z8YA 3GJ3A 3I0MA 3LNCA 3R41A 5LJIA 5AVOA 2A8YA 2F4NA 1Q5NA 2ORIA 3EIHA 3ASVA 3U1TA 1C7JA 1WO8A 2JLCA 2QVLA 1J00A 3OIDA 4V2UA 4RXMA 4WBNF 3WGVA 1NW7A 1JTVA 2G8NA 4Q4JA 4JUAA 1HH4A 1V8DA 2GF9A 3P9KA 3ECSA 4H1UA 3X2EA 3L82B 1HSOA 3EMKA 4LTDA 1T9AA 3MXOA 3IR7A 4QYXA 2B36A 3X1KA 5KJFA 1V47A 2I2WA 2XUDA 1K7WA 1A98A 3OSUA 1RIIA 4YUWA 5K6AA 1IDN1 5IBCA 1ZMRA 3UV6A 3QVTA 3S3TA 1E6CA 3F3SA 1VSVA 3FYUA 3G2JA 4OG2A 4Z9AA 5DYTA 4EG1A 4TYNA 1LBQA 2HA3A 3MPUA 4L8FA 5EUBA 5KDLA 2BIFA 2WINI 3R9XB 1XHFA 2G09A 2AG8A 2J4FA 2ZXEA 3BSYA 3BCSA 3DHWC 3A6EA 3AF0A 3FNBA 5IC6A 3ZK7A 4FQ7A 3IE2A 2GJSA 5AM0A 1U1EA 4CM5A 5BRJA 2QUBA 2QU8A 1P6QA 1M5UA 2ZTSA 3PDCA 4FSHA 3ZHYA 1FX1A 1UUFA 3LPMA 3H5LA 3LY9A 3HV0A 3NXSA 1N4AA 4KGXA 3IV7A 1G6HA 3O9MA 1PNVA 4QJ5A 2V7BA 3ELDA 1SIUA 3I92A 4PLTA 4JP5A 3SHVA 3RBVA 2QTGA 1C4WA 2X22A 5AKEA 2I1WA 5DF1A 1I32A 4AJPA 3A6PC 5GONF 3H11B 3LLCA 3GGGA 5JVDA 1TNDA 3LY8A 4B6QA 5AM2A 4P35A 2BMJA 3ISVA 4MAMA 2YVUA 2CLKB 4NU6A 3AHFA 2ODPA 1WKBA 5FDFA 1FYXA 3IKVA 3PGA1 3M82A 4YP5A 4DDWA 1W6UA 1EI9A 3A36A 4ZOBA 1EESA 4AUMA 3CX3A 3R6DA 2H1FA 4UNRA 1NW4A 4LPKA 4YAEA 2QL5A 4PQFA 1YUMA 2O3JA 1SZDA 1ZH0A 1RXEA 3DWFA 3IT2A 2PMKA 4G84A 3EVZA 3KV1A 3VPAA 1DWUA 4JU9A 3FNIA 2VT3A 3BQNB 1SUPA 2YHBA 3A31A 4WKGA 3FOEC 4NYMQ 4YPOA 5FWXA 4W9NC 5ARCA 4DLKA 4HVAA 1VMDA 4U7DA 1EBBA 3O1HB 2YZGA 5LU9A 4AQYB 1TVCA 4LJ6A 3ND5A 1BU5A 2H8KA 1W34A 3EW9A 2YY6A 1BX3A 4RFSA 5JLJA 2BGWA 4GSYA 2GM3A 2C9YA 4RHCA 4WBXC 3T15A 4EYEA 2BCEA 2HWYA 1D6MA 4OQZA 1Z18A 2Q0XA 3WY9A 1BO6A 5ALPA 3AKCA 3CG0A 5CXXA 1Z16A 3I09A 3IVGA 4IIJA 4C01A 5MN4A 1J9ZA 3BMXA 1CNMA 1PBTA 4RZ3A 5KYUA 4BHTA 2FUG6 3NBMA 4BVBA 1CS0A 2I66A 2YV2A 1LWNA 3DWEX 3SEZA 1O97D 3NEPX 1M0SA 4KG7A 4IHJF 5AM5A 3RVDA 3IEXA 3L93A 4D3DA 4D82A 2YL2A 4ZVNA 5DK4A 1JG2A 1RXIA 2J41A 4EEZA 5B55A 4ZHSA 3JYPA 3V34A 3M1AA 2AR9A 4GP7A 2D5AA 7MDHA 4GS5A 3T5DA 4HUQA 3DYIA 4E08A 4YMVA 1NIPA 8AT1A 2QN1A 3WK4A 1X7WB 2QSUA 1BFUA 2HK6A 2PX6A 3AWDA 4E09A 1NMYA 2AOXA 3HWRA 3COYA 3V42A 3CG4A 1LNZA 3EGDB 5AVRA 4EK9A 4PGHA 1XMQB 3C1UA 1JIKA 3C2QA 3GRYA 4JYAB 2YJNA 3EDRA 4HADA 3W8NA 1ADJA 1PJAA 1T2VA 1Q15A 1Z0DA 5TS2A 4TL6A 4E0BA 3FOZA 4HDQB 1Z4IA 5AW4A 1FBNA 3GGCA 3NYIA 1EFPB 1TADA 3DHNA 1GZDA 4N8SA 4E88A 2X13A 3W5IA 3B1JA 5LP1A 1MKYA 1NR1A 1CF4A 2C7GA 1GN9A 3O91A 3HLTA 4B79A 4Z7QB 5JXHA 2I2XB 3D3WA 3KSAC 1XRMA 3HUTA 1GL9B 2C88A 3CEMA 1MNAA 2RSLA 2ZWVA 1HE2A 1JIXA 3LRTA 4M0PA 1YOVB 4IWNA 4DC1A 2O5VA 4ROTA 4ZT6A 5BV8A 2YUIA 3CBQA 1FJGB 4X71A 1WNTA 2YS7A 4ZARA 4DJTA 3RKUA 2YC4C 2ZR8A 3KDAA 1LS6A 4FHZA 1SURA 4FMBB 2R60A 3K31A 4H1TA 3W2GA 3K9HA 4QD3A 1WL8A 5CVDA 4LTMA 1Z06A 2H7XA 5A4KA 2NMVA 3ZE1B 1A7UA 1FS4A 2ASEA 5KTYA 2DKNA 1N0WA 2ATCA 4QLBA 4L4UA 4ZQBA 1XMPA 3G5MA 1N7IA 5ENDA 4Q16A 4C87A 4TTRA 2EDCA 1CR0A 2RGYA 3T9CA 3CNEA 1O6BA 3UHOA 3CSSA 1TAUA 4RVHA 4MV8A 2H52A 2H2IA 5CPBA 3RC1A 4GE3A 1UDCA 2GR9A 2W98A 3Q9LA 4YLEA 3ZTWA 3FI9A 3SYRA 1Q1QA 5GGYA 1JRLA 2WAMA 4EG4A 1U2TA 3RC7A 3T8YA 5MN6A 3AVYA 2UVPA 5KTMA 1Y98A 4GOND 3CEPB 3D4NA 5FOXA 5BOVA 4IXDA 3WRWA 5BV7A 1Y0BA 4RULA 3E61A 3G02A 3OX3A 4KQEA 1E7MA 2VF2A 3GJRA 2W37A 3RUAA 421PA 4DKJA 2JFNA 1OVGA 2BHRA 3T34A 4D99A 5B36A 3O47A 1H0HA 2WVGA 1G7RA 2EX0A 2FMXA 4HBGA 4Q7LA 4DEYA 4DMHA 5ICGA 2I2FA 1K75A 3JQBA 1P0CA 4JGBA 4U2DA 4YJGA 1DQYA 1KMHB 2VI5A 3B6ZA 1TM2A 4YRFA 1YZKA 5CB6A 4OLFA 4O4IA 3FCCA 5F91A 3GW8A 1FUPA 3SNKA 5DLQC 1P2SA 2Y1OA 3A70A 4BQRA 4UNSA 1LK0A 4U7FA 4EELA 5CFOA 4BMSA 4EHBA 3QQPA 1RZVA 5FTKA 4YRPA 3LAWA 3ROPA 2XUFA 3UAVA 1XTUA 1DB3A 2QVGA 4NE9A 2XRMA 4HS4A 1GA1A 1N5LA 3HJRA 1KJWA 3K6KA 2R68A 3P1JA 1T9CA 3NEAA 4GP9A 4GZ5A 4MKFA 4RL4A 3SJCA 4UAJA 1F2UA 1IOVA 1JEQB 1ODJA 3T3GA 2WM9B 4B7CA 2ERCA 1Y3FE 4HEQA 5HUQA 4G0VA 4I4LA 4M36A 2CYCA 4MUMA 1EB8A 1RI2A 5EGNA 1VYVA 1N2JA 4LX8A 1L7OA 3JTMA 1J1ZA 3RD8A 3GFGA 3NRBA 1YRHA 1SWVA 2QR2A 4HDKA 2HU2A 3A9UA 5KWIA 4FXOA 2CV2A 5KJCA 4CI0B 4QPJC 1ZCAA 2VYFA 3H5TA 3CLRC 4O2AB 4HQ6A 1DO0A 4MQFA 1GUFA 4MVJE 3ROXA 4FB5A 2PUCA 2QEQA 3FNHA 5EKUA 3DLBA 3B2QA 2HDWA 4UCWA 1JHDA 4HYQA 4K87A 3PUZA 3PIDA 5J40A 4GRDA 4RZQA 1KE1A 1HYBA 1W46A 5FLXA 2ZYWX 3AF5A 4RNDB 5FNVF 3I2FA 2D62A 2YY5A 3UWDA 2Q5QA 3INNA 3VR3D 1CE8B 2WF6A 3DZBA 1Y6GA 5EE3A 3KPJA 3FH0A 3PE3A 4AQDA 1LDBA 2ZULA 2DZDA 3AK4A 4KXYA 1U7WA 4WECA 1IN6A 2QTHA 2BFDB 3HBLA 4ARBA 4DV4B 4HEHA 1YRLA 2V1XA 1GIAA 2GHIA 1R4MB 5CDGA 1QV7A 4KP7A 3ZGYA 5I45A 2CWDA 1R4NB 1W25A 4NLEA 5B2EA 3QEJA 3K72B 1P1HA 3RC2A 4PAWA 1TIPA 4MVWA 4PICA 2QAGB 1JHPA 1I9GA 2ONKA 2HY7A 2ZVJA 3D4BA 3ITNA 3JXEA 2C7PA 1TJWA 4HNVA 4R8KA 3QBPA 1Q19A 2CN1A 3G85A 4FKBA 4AAYA 4RJJA 3SC6A 4ZT3A 1Z33A 5TGZA 3PR2B 4WKBA 4JEHA 4QUBA 4D9CA 3L6CA 3C74A 2NV0A 3WMRA 3EUAA 3U5TA 3WVNA 3COJA 2PCJA 2C04A 4TKLA 1U6KA 3TQTA 3GHHA 3SQWA 4ZAGA 4FMDF 3OOSA 2J3DA 2O19A 3CFYA 4JT8A 4DPLA 3MCWA 5TV2A 1I2CA 2GNPA 2FZCA 4M9QA 4ZD6A 2AZ4A 4B7XA 4DQUA 3F3YA 2AQHA 5JNLA 2C3OA 1LF0A 2HJHA 4M37A 1TCUA 4BBJA 3NJ8A 2PA3A 2J3MA 4US1R 1XAHA 4J4HA 4ZAWA 4AC9A 2YNMD 3E1KA 5J2UA 3QELB 3HLYA 4ZU3A 1FVOA 2O7RA 4MQBA 4Q7QA 2YKGA 1N3LA 2Y9MB 2IDZA 4UHEA 1E77A 1K4YA 4TRJA 3HYLA 2NTEA 3L84A 1A5AB 2OGZA 3PPXA 5BN5B 2UYQA 3DHYA 1GZUA 2REQB 4CCSA 4GYKA 2IEZA 3VHQA 4EW6A 3IJRA 5HUJA 4CEIB 1QDEA 1XD2A 1XZPA 4CIDA 3T4XA 4ZDIA 2QTWB 5KVVA 3MK31 2OESA 4ZDJA 4ML3A 3FZNA 1FQKA 2VDNB 4L9WA 1UFRA 1GCGA 5CNIA 3H5IA 2DT5A 4LF9B 1MVLA 3UYLA 5BP7A 3DD5A 1JZQA 1BJTA 2EHDA 2LTAA 1V16A 4TWBA 1N6KA 5AM1A 2B94A 4X8OA 1QJ4A 1RRVA 1T2UA 2W7TA 4HH4A 3TW6A 4YMTA 3HXQA 2JDIA 3FUUA 5KHOC 4PN3A 2FAXA 5HXAA 4CUKA 2XOXA 4URYR 1DRWA 1IN1A 1G8KA 3HVRA 1J0AA 1KY5A 1QG4A 2VWPA 3IA7A 3T3IA 1ZCZA 2VP5A 2CXXA 1QH9A 2XE8A 3M5PA 2JDID 4ME6A 4N3AA 5D00A 2E5LB 3RRZA 1B41A 3JQ8B 3OOWA 4RGBA 4JIMA 4CMEC 4YDRA 1T5LA 4Z1OA 2GN9A 2IZ6A 4XPZA 1SCKA 1Y7PA 2I7TA 4GHWA 2ZPTX 5KQGA 3QF7A 3ZZNA 1BA2A 3D6UA 4IL5A 1RRFA 1C81A 2E49A 2GPJA 3A7DA 3MRVA 4N40A 4WKCA 4DN6A 2ZCUA 5JYDA 4YB8A 2O8EB 4ZC8A 1Y8QA 2QY6A 3PD0A 2C7RA 2PRJA 1OXVA 4MEJA 4C89A 3TW8A 4TWJA 4NH4A 3WLFA 2VR1A 4CKBA 5K05A 1K88A 1YS2X 4URVR 4ZC1A 1DZIA 1H1DA 1QLWA 1ZGBA 4DUGA 4Z54A 4LV5B 5EIBC 3BM5A 3LC7O 1KR2A 4FFDA 1ZU4A 1W4AA 2JRCA 1DQNA 1PR2A 2WR8A 2ZKLA 3DKIA 3LX8A 4IH1A 4YO8A 3OSZA 2R6CA 5G3YA 4EQ6A 4B4DA 3S40A 3TQRA 1KQFA 1C7ZA 5DIZA 4BX8A 1TUGA 3LXUX 4B40A 4Q7KA 4H17A 4MQ5A 1E0DA 2HXGA 3L0ZA 4HYYA 4JXKA 2VEDA 3DAGA 4IEFB 4N7MA 4XWAA 3ENKA 1JDVA 5K8JB 2YINC 3D3JA 4DJ5X 4MB2A 5MDHA 1DJPA 3JVIA 3ZXYA 2FPMA 1ZWLA 2I54A 1I10A 1RHQA 2CXQA 4DA0A 3QKRB 1DCNA 4JAVC 2XUQA 3AOEC 1YJ5A 2BGGA 1XZQA 3K35A 4LGMA 3UTCA 4U4AA 2JLWA 5IXSA 3TTYA 1CXZA 4YACA 3E2MA 3PDJA 2ON6A 3MYYA 2AJLI 4C14A 1IN7A 1CIPA 3O8QB 3KC2A 5EVCA 1W88A 2WV9A 1VPEA 2AOUB 3I9KA 4X62B 3JZDA 1M1YB 2OFFA 2IEYA 2EBUA 3GRFA 2PX8A 3BA1A 4A8HA 2I9KA 2NO6A 1NC3A 2PQ2A 4H77A 4IXWA 3VKWA 2IX3A 4PXAA 4TRNA 3QF4B 1AJEA 4N0MA 2XMSA 3N2YA 2OM2A 3TAXA 1PUXA 1U9CA 2PSHA 1PZXA 2RGDA 3GC6A 4H4EA 4KR9A 3H0EA 4EY7A 1Y82A 1TQHA 2AMVA 3L0PA 4GLJA 4KNYA 2GRUA 2EYUA 2A6PA 2EATA 3RNOA 4M7PA 1SKQA 2E4XA 3VSAA 1OA0A 1GG2A 1U8XX 2AR0A 2F9MA 2X2EA 4M21A 1NQXA 1JAXA 5K0LA 1RTKA 1UBTS 1Z3CA 2FPOA 3SBEA 3BXHA 2HFJA 4CV2A 1GPKA 2XGSA 2WSYB 1MRZA 3N58A 1KI8A 4M0MA 4OYLA 3OTOB 5AXAA 3CH4B 4EI2A 3LUFA 3FX2A 4NJMB 4II3A 3B5IA 3G2OA 3TQCA 1W8DA 3I6YA 1EUZA 1NXXA 4AXBA 3EVEA 3U1VA 1KJYA 3G23A 2OCAA 2WSIA 3BWDD 3AJ9A 2QT0A 4OSPA 4ECEA 3LCCA 5K0FA 3CCBA 1RP7A 5LN1A 2FW9A 3QE0A 3FTQA 1UDAA 4FHEA 1GTG1 4MLPA 5BN4A 1U9JA 1J42A 1ZCJA 1EDOA 4P86A 5TPWB 2FR1A 3F78A 1M7BA 1V1MA 2VF8A 5HSGA 2XWJI 2ZIZA 1E99A 4LOLA 4JA0A 3VU3A 3TRDA 1PE0A 5H4GA 3A9RA 2PS9A 4AK9A 1R37A 1ZUD1 3CINA 1LBEA 3NNSA 2X5XA 3E3AA 4G0MA 2G7ZA 3CE6A 4UUPA 2HIAA 2Z56A 4D46A 4B2YA 4MGIR 4EA8A 3HR7A 1UOEA 1P7PA 2A5YB 2QAJA 1IC6A 3E7DA 5ITWA 4JASB 1JDPA 2NZXA 3JQPA 5DT9A 1H2HA 1E2DA 4YT5A 1LSOA 2IYWA 2VSQA 4LK3A 4Z3DA 3KT6A 2PWZA 3VHXB 4UVEA 4KE8A 5KTNA 4EA6A 2OECA 3THXA 2CXRA 3UK2A 1OIXA 4D3ZA 3DEFA 2OE2A 3TQSA 4ZU1X 4UBIA 4RENA 1U1FA 1VYUA 2CDBA 2QJTA 1QVRA 4PYMA 3SOPA 4RGVA 3ZHTA 2NZJA 4EI7A 1R8JA 3D8TA 1Q21A 4C4SA 1E9FA 1QIJA 3TV2A 2LIPA 2JLQA 5EJAA 1GUBA 4O4HF 3LT2A 1S8AA 2VJKA 2ZI9A 3K0CA 1WW8A 3UENA 1ATZA 1HKUA 4N3NA 1H1LA 2O2SA 6REQB 1JQ5A 5IXJA 1YHZA 2J5BA 5HJEA 3GGOA 3KPUA 2IU0A 2B69A 3FPKA 3LC1O 4ER3A 4CKWA 1W1UA 2BFWA 4NONA 3Q2IA 4LC9A 5FUMA 2IL1A 5K0CA 2OHOA 5CVTA 3HJCA 3JAKA 2BEJA 1T4DA 4BMVA 2VPIA 4LZOA 1L5OA 3K73O 4BVFA 1OH5A 5CW2A 4YNBA 4BN5A 1F1BA 4RPCA 3M0EA 5DLYA 3DMFA 4UFNA 2H1OA 1NJ8A 5EMLA 1T8PA 2G8LA 3GNQA 3T7DA 4CUZA 2VDQB 4UTNA 1OT5A 1B00A 1E9EA 1ADBA 3KELA 4KYTA 4ND7A 2AIRA 3ESRA 3V4PB 2B5WA 1YFZA 4NSNA 1MFPA 1UK9A 1YC2A 3DJFA 3ZD8A 4F1KA 1GD1O 1N9KA 4GMKA 1E0KA 4Q3KA 1KY4A 5B7NA 3DLHA 2Q0HA 3MS4A 4BWGA 4F1WA 2Q9BA 4ZYUA 1XJQA 3OLYA 1FEZA 3C39A 4JYPA 1C29B 1DLIA 4I55F 2J8ZA 4LCBA 3ZCSA 5IMSA 3LUJA 1F5SA 1G9SA 1Q0LA 2CVOA 2W83A 2EU8A 3NBAA 4QATA 2ZAYA 4MV1A 5H82A 1N9GA 5H7XA 1GVHA 4BE4A 5EQTA 4R2IA 4OKNA 2WT4A 6AT1A 4NRDA 4WA8A 1LBTA 1FX0A 3I2HA 2WU1A 2C78A 1BEZA 2OVFA 2Z2YA 3ILVA 4B6JA 3HJTA 4Z8YA 5K3AA 2C8KA 1MN6A 4CNBA 5DX1A 2UVQA 3IJPA 4IGEA 2QR5A 3FG9A 3PNQA 3FLAA 3RVQA 4TKVA 2V3CC 5IAJA 1CQIB 5HFJA 4R69A 1KEEB 3LQRA 1UWCA 2PKRA 2I71A 4PSKA 3RVJA 1KJNA 4UHCA 1R9GA 1PJQA 2BEUB 3ABZA 5AUQA 2W8BA 1KEVA 4LJYA 1M34A 4Q00A 10MHA 2GZ3A 721PA 1MA0A 4GPD1 3PHHA 2F8MA 3GXBA 2R79A 2ODAA 2FSHA 3IOEA 3B48A 1NBME 4RTOA 3I4CA 2PVCA 4CFZA 1YR7A 3NHZA 2P6PA 3S2SA 4DBZA 2LPMA 4MPJA 3U44A 4OQDA 3BCHA 2G1JA 2HB6A 3GP8A 4BFVA 1U2QA 4H4CA 3B6KA 3UK6A 4IDFA 1QZZA 3FCXA 4DF3A 2PRSA 1I1HA 4URXR 3PNBA 1Y89A 3O4GA 1ZVJA 4I50A 2O3RA 3GFQA 2O5RA 2EX4A 1CZRA 2WIBA 2YZ7A 2ZSHA 3BK2A 3JSAA 3RBAA 3AMVA 5DGDA 1P60A 3GEGA 2QD1A 2XF8A 3DLAA 3QVWA 3LYLA 5A9RA 1CYDA 1GPLA 4XIGS 4HDRB 3BKWA 3EOZA 2NVOA 4II2A 3LBIA 1AT1A 2VIIA 4HCJA 1JX6A 5D6BA 1E9VA 1JHXA 1H2BA 1QORA 1WV1A 3DFFA 1H2AS 1VPDA 3E7PA 4L1KA 4Q9AA 4YEDA 4EZBA 1NBWB 3WWOA 1ISSA 2NUPB 3AB8A 4HRAA 1M66A 3ILHA 5BN3A 4KO8A 2ZK7A 1LVUA 2VO1A 1S9HA 3JQAA 4K5QA 4P3NA 2J0QA 2AR7A 3ABRB 4JBNA 1R5JA 1DUSA 5D6NA 3BGSA 1JALA 5I4IA 1NN3A 2HPAA 3K1JA 1HDYA 1HUQA 2XYQA 4RVDA 4TX1A 1WXHA 5IAKA 1AKEA 2HV9A 3ZY5A 4LK2A 1MO4A 2EKPA 3WZMA 3DCNA 3T12A 1X92A 1QH1A 2GO1A 3DB1A 2FB9A 1DQZA 2QRQA 3GRZA 1NVXQ 4X7MA 4QG3A 1MU0A 1OMOA 4K46A 5F5LA 4M8KA 2PX0A 2XHEA 5LP6F 3CWZA 4Y1GA 1X9HA 2DTDA 2QYOA 3O8OB 5FTWA 3LLVA 5P8WA 2KBFA 3X44A 1CY6A 2YJ6A 3R6QA 1LF5A 2ZIAA 3C8TA 1RYBA 2V3VA 3LNTA 2ZUWA 2ROQA 2BBWA 3OZAA 4L50A 1XWFA 3AR4A 4X84A 4M86A 2CNDA 2HTFA 3BBPA 3M4XA 3RTDA 1E0AA 2IQ5A 3H2ZA 4KWEA 3ROTA 1AA6A 3LKZA 3NHKA 2W58A 3ROFA 1BTOA 2G4VA 2NYAA 4Q3NA 4ARVA 4WK6A 4DV2B 1C0PA 4YIHA 1XNGA 4IDHA 4IYRA 1L7BA 5BUSA 5A0VA 4ITRC 1XF9A 1JUDA 4XUEA 4J8PA 4F5ZA 1GRNA 3HYCA 3WGOA 3ZGXA 2XA1A 4KX5A 1P7WA 2IFTA 4ZV4A 1KBZA 3A3NA 4FWTA 4D57A 2JIOA 2I9PA 1LI5A 4HRYA 1YMVA 2IYQA 1PNOA 4RS4A 2XB8A 2E0IA 4LJLA 4P2GA 5AICA 1FTNA 4PC2A 3COVA 1C2TA 4ZP1A 5IK2A 3E5NA 1L7VC 2NPIA 1HDGO 4DIEA 1E59A 2JFZA 4PAGA 2FFQA 3AVQA 5CG1A 2EW1A 4NZMA 3HXLA 4WI1A 3SZLA 1TO1E 1MG0A 4OUDB 4EAQA 1LD3A 1SMKA 1QPBA 4M6WB 4RL6A 1F38A 3RSZA 3ZHOA 4DSTA 1ZGGA 4TLLB 4EMUA 2G1PA 4FGKA 2RH9B 4WZZA 5ECGC 3BZBA 5UKDA 1JEOA 4H6XA 4PFQA 1ZDMA 1NGSA 3KHSA 1UAYA 1V4VA 3KLNA 1G8MA 2UZIR 2FEPA 4M8SA 4L5BA 2QJWA 3OZ7A 1L5NA 1CULC 3CIFA 3REQA 1KO4A 4DANA 4CEJB 4IGFA 5IDVA 4PAOA 4DLPA 2UAGA 1ORHA 1NR7A 4PQRA 1QUEA 3KTAA 3EA0A 3SC4A 4X7PA 1DBIA 3SE7A 3NIWA 5AI6A 2NO9A 4JJ4A 1AUOA 3RS3A 4CGZA 2UUOA 1CPYA 3OT1A 3J7TA 1K8ZB 3HM2A 9LDBA 5H3HA 1MRSA 1HRKA 2A0KA 2P41A 2V7EA 2X76A 5BQPA 2L82A 1EXMA 4G5RA 4RYLA 1C9MA 2W11A 3T5GA 4O63O 3WNVA 3GLGA 2WSSA 3KYDB 4XB1A 1RBMA 2CVQA 4ISBA 4QFMA 3FBWA 2WTEA 4GYJA 3AUAA 3SGLA 3V4LA 2OXEA 4I4TA 3T3HA 4KKXB 4RETA 1O77A 4RFVA 5K3SA 1ZESA 3DMDA 4L02A 2VJDA 4KXWA 1EQAA 2FHPA 4QUDA 4F21A 4ZCQA 5M04A 2WSSD 3LUDA 3JD0A 4GI1A 4QUEA 1RXVA 4TTSA 5FUWA 4Q34A 3TLYA 1CEQA 1O8CA 4V0NA 1DAEA 3LRPA 1NYLA 4ZO6A 4ZRDA 5DX0A 4QA9A 1NI5A 1DO8A 1KEWA 5EGSA 2JI7A 2XZOA 1VBKA 1U8AA 5K3FA 1PAUA 3NOOA 2GILA 4I5FA 4CTNA 2R7AA 4CGYA 2JFWA 2XGOA 1SCAA 3OTWA 4EG5A 1WZUA 3U4AA 1H1TA 3MJDA 3BORA 4JB8A 1R18A 4TXHA 2YBEA 2C07A 3IS3A 4MMYB 4PLFA 5F1YA 1JQ3A 1H2WA 3IV9A 5HDBB 3TNFA 3BF8A 4A2PA 4JKYA 2JFYA 4JBLA 4V3BA 1K08A 3NCHA 2R7LA 4KFRA 3AM5A 3WFZA 4D96A 2A9RA 2LCQA 3TIFA 4QRDA 4EHLA 3OTQA 3NBUA 2AEFA 2AZDA 4IQ4A 2O8DA 1B8VA 1T0BA 4BNDB 5JTUA 3QM1A 2NZUG 4ALKA 1AH2A 3ASUA 1SPBS 2WE7A 4DZZA 4C2AA 3QGMA 1I24A 2O2DA 3CRQA 4ESEA 5CXQA 1GP2A 1L8OA 3KAKA 4LYFA 4JOSA 1JECA 2PTQA 4NABA 1QB8A 3NU1A 5L3QA 2BGRA 3EVCA 3NETA 4MW4A 2X8BA 1MCZA 4EMTA 5EYPB 2J0UB 4TMFA 5A4DA 3QI2A 4IJVA 3D8NA 1VJ5A 3K0FA 3OTIA 1P8AA 1LBSA 1VHTA 3LLUA 3PQ8A 5EMJA 5KDOA 3MFQA 4MCJA 4K9OA 5FH9A 1M5RA 1AUPA 1GYPA 3CI0K 3RRNA 5DGCA 5HP4A 2ETVA 3SI7A 4KR6A 1PD1A 4UU0A 3M2PA 1Z4JA 2FPWA 2X9NA 3T6KA 3TM5A 2CMDA 4P92A 4BECA 1I3NA 4Y2JA 3TIIA 1O95A 1XZAA 1WOYA 3RK1A 1XRQA 1DVRA 4N41A 2CL5A 1G16A 3OM9A 1OFVA 4WASA 1KXZA 5IAEA 3JVDA 1U63A 4Y8VA 1TZKA 1PJ8A 1YZYA 4K03A 2OVBA 4A6EA 1LSSA 1L4MA 1V7PC 1O95D 2J3IA 3DFUA 4HNQA 4RW0A 4YP9A 3WLHA 4BFWA 4EFCA 2PMFA 1C3VA 4KO4S 4QEZA 4Q4JB 1POXA 4YV2A 3UMYA 3E23A 4MLZA 4KW7A 2ZE5A 4LRQA