3BWVA

Crystal structure of deoxyribonucleotidase-like protein (np_764060.1) from staphylococcus epidermidis atcc 12228 at 1.55 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
177
structure length
167
Chain Sequence
TRQRIAIDMDEVLADTLGAVVKAVNERADLNIKMESLNGKKLGLVMDILKEPGFFRNLDVMPHAQEVVKQLNEHYDIYIATAAVPTSFHDKYEWLLEYFPFLDPQHFVFCGRKNIILADYLIDDNPKQLEIFEGKSIMFTASHNVYEHRFERVSGWRDVKNYFNSIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of deoxyribonucleotidase-like protein (NP_764060.1) from Staphylococcus epidermidis ATCC 12228 at 1.55 A resolution
rcsb
source organism Staphylococcus epidermidis
molecule tags Hydrolase
molecule keywords Putative 5'(3')-deoxyribonucleotidase
total genus 49
structure length 167
sequence length 177
chains with identical sequence B
ec nomenclature ec 3.1.3.-:
pdb deposition date 2008-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 3bwvA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3bwvA01
2Q4TA 2AH5A 3W5CA 4UMFA 3L8HA 3SD7A 3W5BA 2JAOA 3L5KA 1T5SA 3WK8A 4L57A 1RQLA 3M9LA 3R09A 5AI4A 5AVYA 2WF5A 4CE6A 5ALNA 2NYVA 1ZD5A 2AGVA 5AIAA 2W43A 4MUMA 3QU4A 5AI6A 4ZEVA 3OCXA 1Q92A 4BNDA 1IWOA 4I9FA 3IB6A 4Y2JA 1EK1A 1FEZA 3SMVA 2YBDA 1KYTA 5ALXA 3QGMA 2IYEA 4YCLA 1YS9A 5ALKA 2HI0A 3E8MA 4DFDA 5A3SA 4NABA 5AM0A 3DAOA 2YJ4A 1ZS9A 4HGPA 2O9JA 2WHEA 3NAMA 3HLTA 2YY6A 1RC8A 2ZBGA 4GIBA 2MU1A 2JGAA 1U7PA 2C8LA 2G06A 1QYIA 1ZD4A 1TJ3A 2HSZA 4XE5A 3D6JA 2RAVA 1WPGA 3QUQA 3A1CA 4J2TA 4KNWA 1NRWA 3WKDA 2Q4RA 2FPRA 5AM2A 4KN8A 4ZEXA 2AUTA 4UW9A 2ZXEA 3QU5A 4Y2XA 4YCNA 3SF0A 2FI1A 5AVRA 3QU2A 3RFUA 1YMQA 1TE2A 3VAYA 3WKCA 1QQ6A 2R8YA 2P11A 5ALWA 2B1RA 3OCZA 4IG4A 3L1VA 3WGUA 4EX6A 1RPZA 2HO4A 4OHFA 5AK6A 5AK4A 3MPOA 1YNSA 1QQ7A 4YH1A 1Z5GA 5AVZA 3N8GA 4MWOA 2HCFA 4YIKA 3N07A 1Z4KA 1XPJA 4Y2PA 2B8EA 1T5TA 1CR6A 2RARA 4HYTA 5ALOA 1O08A 4EZEA 2C9MA 2WM8A 1CQZA 5T41A 5AIBA 1Z4LA 3K1ZA 3QU9A 2O2XA 3KOOA 3KDPA 5AM4A 2X4DA 1U2SA 5AM1A 3SHQA 4JDPA 4GXTA 3WKAA 3J7TA 1SWWA 3L8EA 1Z4PX 3OCUA 2IOFK 3WK5A 3DNPA 2OYCA 5ALPA 2FPXA 3GYGA 5A3QA 5AKXA 3I1YA 4BX3A 3NUQA 5AW8A 4B6JA 1NF2A 2G09A 4G9BA 3L1UA 3U7GA 1ZJJA 3SKYA 2YJ3A 1RMTA 2YMMA 2EAUA 2G80A 3UMCA 3QX7A 5AK5A 2IOFA 2MSNA 5ALDA 5ALYA 2B0CA 3OPXA 3EWIA 4CF5A 3KZXA 4OCZA 4L6AA 3DDHA 2GFHA 4BEWA 4HGRA 4Y2QA 1WZCA 2C8KA 4FYPA 3ZTYA 2W4MA 3KC2A 2BDUA 3FPSA 4AS2A 1L8LA 4BKMA 1X42A 5AM5A 2FPWA 4HAIA 3QUBA 2PKEA 2FDRA 5JJBA 2DQSA 3MN1A 3AR7A 4EELA 3N28A 3ZWKA 3AR4A 3U19A 2AMYA 1WVIA 4CNQA 3ZVMA 4HGQA 4BNDB 1Z4NA 3WK6A 5ALVA 5AW0A 4I9GA 2BDEA 2GHQA 3BA6A 3NALA 4UAUA 4G63A 4JB3A 4BX2A 2I7DA 1Z5UA 1L7MA 5AW2A 1NNLA 2PQ0A 4L6CA 4QJBA 3MC1A 1RMQA 4Y2YA 5AW7A 3R4CA 2FPSA 2YMPA 4UARA 5AKZA 2ZG6A 3N5KA 2C4NA 5AVTA 5ALMA 3ZX4A 2P9JA 2FUEA 3ET4A 4UATA 3I6BA 1VJ5A 4UAVA 5IS2A 5ALRA 1J8DA 3ED5A 3WKBA 2W11A 5AHXA 4KX3A 1AQ6A 1RMYA 1S8OA 4DCCA 4F71A 2ZBFA 3L8FA 4C4RA 3DV9A 1Z4IA 3W5DA 4BEVA 1ZOLA 3ZUPA 1U7OA 5AKJA 2YN4A 3UMGA 4HGOA 2CN1A 1WR8A 3U13A 3FPBA 2D2VA 4UMVA 5ALSA 2WF8A 2R8EA 1U02A 2I54A 1L7NA 2C88A 2P69A 2JARA 2CFRA 4AP9A 4UM7A 1YV9A 3NANA 3ESRA 5AKLA 3L8GA 5AW9A 4RETA 3AR5A 5AKGA 2FUCA 5ALIA 3ZVLA 4DW8A 5AICA 3PDWA 3B8EA 3WK7A 3I76A 1QQ5A 3PGVA 3PCTA 3M1YA 5AESA 3QYPA 2RB5A 1S2OA 4OD0A 3A1EA 5AVWA 4F72A 3KD3A 3F9RA 1N9KA 3CNHA 3P96A 5AW1A 4NFLA 1SU4A 4UASA 2BY4A 3OCVA 3FGOA 2ZBDA 4XPZA 4XOUA 3L7YA 1Z4MA 5ALQA 3NRJA 2QLTA 2Q5EA 4YGYA 1PW5A 3I28A 1F5SA 5ALGA 2EATA 2YMQA 5AW4A 3U7EB 4Y2VA 3E58A 4NAVA 5FP0A 4UMEA 4YIHA 1EK2A 2I55A 2CFSA 1ZRNA 3RF6A 3S6JA 4HGNA 1RKVA 3AR9A 5ALZA 3ZI4A 1Q91A 2I6XA 5AVUA 1RRCA 1ZD2P 1Z4OA 1L6RA 1RQNA 2YJ5A 4UU1A 4J03A 3CZ4A 5AKEA 3WKEA 3QU7A 5AKKA 5AVQA 1RLOA 3ESQA 1RDFA 3IJ5A 3W5AA 1XP5A 2HHLA 1U2TA 3QUTA 2JAUA 4FE3A 1Y8AA 2WFAA 5AK3A 5AKYA 3WGVA 4EX7A 1O03A 5ALLA 4AS3A 2ODAA 5AVSA 1RLTA 4FFDA 1N8NA 2HF2A 5ALEA 3QXGA 3HYCA 1SWVA 5AI8A 2OA0A 4KNVA 5AW6A 4BYGA 5AKHA 2NO5A 5AI0A 4BBJA 1RKQA 1VJRA 4CF4A 4UM5A 3PGLA 2ZOSA 2PR7A 1L7OA 2R8ZA 4C4SA 3BWVA 2I34A 2WF7A 1ZRMA 1T9ZA 3L0CA 1VFPA 3QNMA 4BX0A 3NASA 2G1AA 3AR2A 1LVHA 3AR3A 3ONNA 3QLEA 2HF7A 2HOQA 4UMDA 4Y2SA 4DWOA 3ZW7A 2WF9A 2HDOA 2R8XA 3NIWA 3WK9A 3EF1A 2YMLA 3ZTWA 2FPUA 3IRUA 5AI5A 1K1EA 4QQFA 1L7PA 2EARA 4NV0A 3U7HB 5ALHA 3SLRA 1Z88A 3FZQA 3L0YA 3UMBA 2IA5A 1XVIA 2G08A 3FVVA 5AW5A 4UU0A 1Z4QA 2ZBEA 1TJ4A 3OTQA 3AR6A 5ALFA 1TJ5A 1MH9A 3ZU6A 3FM9A 3OCWA 5A3RA 4KYTA 4XQ0A 2B30A 1TA0A 4Y2TA 5AKIA 2IOHA 1YDFA 1J97A 3U26A 1QH9A 3KBBA 3EF0A 1Z4JA 2JAWA 1ZD3A 2GO7A 1RLMA 4ZEWA 5ALJA 5AVXA 3E81A 3SKXA 2B1QA 4C4TA 2WF6A 2G07A 2VKQA 4EEKA 2HEGA 2OBBA 3A3YA 3R9KA 3B9RA 3TLMA 5IT4A 4RESA 5ALUA 5ALTA 4H1WA 3EPRA 5AM3A 2G0AA 3AR8A 1RKUA 4CF3A 2NO4A 5IT0A 3QUCA 1YJ5A 1L8OA 2B82A 4OFZA 3OCYA 4O8CA 2QYHA 3B9BA 3UM9A 3ZX5A 2OM6A 3MMZA 2I33A 1JUDA 4PNHA 2CFTA 2B8JA 4NWIA 3A1DA 4Y3UA 3E84A 4EENA 3U7FB 2YJ6A 4KX5A 3WK4A 3ZVNA 4Y2RA 2FEAA 2GHTA 2RBKA 3N1UA 1LTQA 3L0BA 5E0OA 2P27A 4E88A 2YFYA 5AW3A 5AVVA 4YCMA 3ET5A 4IFTA 4Y2UA 2GMWA 5AI9A 2HX1A 3ZWDA
chains in the Genus database with same CATH superfamily
3CUWA 5F78A 2XQKA 1VECA 4WHMA 4ZI3A 4D1YA 5DASA 2FHPA 4ZANA 3NPAA 1DBIA 2Z0MA 1C3UA 1M8PA 4OQEA 1KK3A 2WWXA 4QUGA 3G2QA 5AXCA 2NTVA 3DV0B 3Q2OA 3N8KA 3W3AH 5BR8B 4BFSA 2H1OA 1WQ1R 1X9HA 2FSUA 3TD2A 3OQOA 1GITA 2JFVA 2IZZA 2EKZA 5T6MA 1QU3A 3A6LA 3F5DA 4L76A 4BX9A 4Q01A 4UVGA 3PWTA 4JN6B 5JBQA 2REBA 1GADO 1HDCA 1I5OA 1TAHA 3GMSA 5KU1A 1BQ3A 3ESAA 5ITWA 1REQB 4GNRA 4FZ5A 4Z3OA 3ZD9A 6ABPA 1X1DA 3A37A 3OJOA 1J22A 1ZAKA 1IBRA 2R8PA 2P5YA 1HA3A 4IGKA 2B1GA 3BMOA 2PX0A 3QVMA 2XWQA 4V0RA 2X9QA 3MW8A 3RS2A 1WUIS 1LTKA 3USZA 3JQ7A 3DEIA 3TNDA 4BBZA 5ALXA 3V32A 2NW6A 4CCWA 4G0PA 3WLFA 4R4JA 4XTRA 4S1OA 4PX2A 3MSCA 5DHPA 1TZKA 1JIXA 2JDID 4YBZA 4Q05A 2XCQA 3SNKA 3C45A 3FFWA 3VU0A 1WMFA 2QGAB 2O9JA 3E70C 1M7BA 3P4YA 1FNBA 1VA5A 1U81A 3BCHA 4DMFA 4L0MA 4G8JA 3D6UA 2XA1A 4MRNA 5LZ8A 1CK4A 4M8NE 2VH5R 1CNMA 2YRWA 1ZISA 2CV0A 2XRZA 4OHUA 2QRVA 2P5SA 3HCNA 3TSWA 4RTOA 4U2BA 2KPOA 4BASA 5J2TA 1N0HA 2XOKD 2XZPA 2QP9X 2VP6A 3H1FA 3I9LA 3W2IA 1Y5LA 1AM4D 1PV2A 1Z07A 1KPGA 2ODBA 4PR0A 1TYZA 3COPA 4NARA 5SY4A 4ZZ2A 1P2UA 3LBYA 1T0UA 5EIBC 3RJ9A 4G1CA 4MI3A 3PGKA 5FWDA 4LY0A 2CDBA 3S7TA 3KR1A 2AHRA 1EYZA 3KXDA 3NW9A 4HWOA 3LQFA 3GL9A 1QLWA 2DUNA 2N75A 1WPQA 1OXXK 3GLTA 3LBFA 3RFUA 4GPD1 3IKLA 1YMQA 1JT2A 2AZMA 2O8VA 4UUOA 4X1IB 3QLTA 1R9NA 2Z5VA 1RHJA 1YAHA 2ZIGA 3S2GA 1GNVA 3BN3A 1VLMA 3DFIA 5BOVA 4O02B 4WK4B 5ALWA 3RSCA 5J2TB 4IHJA 1SA0A 1Q1BA 3DH0A 4CR8A 4AKIA 5B5SA 3S2IA 1IHPA 4Q1DA 2V5AA 2DZDA 4RUKA 5IANA 3V7YA 2P8SA 4G1VA 4CEHA 1GCIA 4KWCA 3ZU2A 1KOLA 3C5HA 4D9KA 2PVSA 1DZ3A 2H6EA 2ZRHA 2GZAA 4FLMA 5KVCA 3TZHA 1JJIA 2HQBA 4YECA 2J0QA 3K70C 3N5CA 3OT5A 3DONA 2FWNA 3FNHA 2W2NA 1JI3A 1KEEB 1D1TA 2XUPA 3VFDA 3ZBQA 3ZOKA 2J07A 3FX2A 4LJKA 1DBQA 4CLEA 1SH7A 4RDCA 3FHOA 1Y5RA 1IDN1 4L72A 1THGA 1ZIOA 3LYUA 5TR9A 1NI5A 1U16A 3RI3A 1HEYA 2FR8A 1Z6YA 3MRSA 1OT3A 2FR8C 5FJIA 1RAIA 3T3EA 3V1TC 1WKBA 1G64A 4CW7A 2EKPA 3PEEA 4GXTA 5HDQA 1LFDB 3KQHA 2QTTA 1ILWA 2VL7A 4D0RA 1QQAA 1B0AA 3MBKA 3RK0A 4P5EA 3WVNA 2RG1A 3PEYA 1JB9A 1V3TA 3BS4A 4L0QA 4XCXA 2NQ8A 2QVGA 1U2GC 3LY9A 3VR6D 3OF5A 1TYEB 1FUUA 2VUSA 4RSRA 5H3LA 2ETXA 1NF9A 1A97A 1JAHA 3I1YA 3KL2A 2QN1A 2ZB8A 3SZUA 3ZCPA 5ADWA 5MFPA 1JR3E 3FSGD 3GDHA 3F9CA 4KDCA 3ZXSA 2Z1DA 3T1HB 2VXOA 2PEZA 2RAUA 3QKSB 4OMUA 3U5TA 3KZVA 1R3DA 4JV5B 1OYOA 1HV8A 1USIA 2QE6A 3FNIA 3E35A 3C85A 4HMPA 3TTXA 4E33A 5JHGB 3IL2A 1E7RA 1OWPA 2WB2A 4MR8A 4RS3A 5FBZA 4M0LA 1PJ2A 4BFXA 1LRJA 1OTXA 1ZUNA 3IB3A 4JLNA 4MDYA 2QZSA 1KARA 4ZZ0A 2B0CA 1A4XA 4JOQA 1T3LA 5HF6A 1PG5A 3GVXA 2H2IA 1NXXA 1HYQA 1QR6A 4NYMR 1RKBA 4AD8A 4BN5A 4F96A 4LDNA 4PLTA 3RS9A 5JXJA 4DIDA 4U2FA 3FYSA 1OKKA 5ESWA 1A9XB 3G9TA 3EGEA 1I6KA 4NK5A 2TMDA 2CYBA 1MXFA 5CLFA 2UVQA 5HJ7A 1E1CB 1N2CE 3P32A 4EO7A 3EY4A 1UBNA 4CLDA 3SCZA 2YJGA 4AP6A 2FEPA 3KCNA 1N6IA 4O0LA 4WLNA 3WL3A 3VRHA 2P90A 2Z5GA 3RT1A 1VMKA 1YI1A 3Q7IA 1H3EA 1D1SA 2GPNA 1GZ7A 1KDPA 3KJXA 3O1IC 2NXNA 5ICEA 4MUGA 4OG2A 4PYOA 5EXDA 2Q49A 2A35A 2AN3A 3A8TA 4U5QA 4X20B 4WLUA 4WXHA 1QAMA 1DJLA 4NF2A 3GLIB 4B31A 4DSTA 3CV3A 2ZIXA 2XE4A 2GO1A 4ACBA 1T4MA 2V3WA 3QUSA 3D5QA 1R64A 4UQOA 4W8HA 4DKXA 3JW8A 1MRZA 4K9OA 4R6XA 4BIIA 5HZGA 5JSUA 2ZRPA 2O3TA 3IDSA 3JAKB 2GZ2A 4K9RA 4A5OA 4OA5A 4DC9A 3EAFA 2VP9A 4OU4A 4WZZA 3KPYA 2X2OA 3RK1A 3REQA 2GJ9A 1ELOA 1JHXA 4HH3C 1LS6A 2C2HA 3WWCA 4U0KA 1P73A 3OT1B 4K9QA 4N41A 1OLXB 1K6IA 3ANLA 1AQYA 3SBXA 3MXTA 3IUBA 1JEAA 1JLHA 1PWHA 1M1YA 2C5LA 4DNOA 5J5AA 2BYTA 5L3SB 3C6XA 2ZWOA 4RM2A 2QRLA 1U0RA 3IUJA 3KB1A 1TD1A 3EIWA 4N49A 4RFSA 2QR3A 4RCVA 4IQFA 4M89A 4PAOA 1BEZA 3A14A 3VDQA 2E87A 2YUIA 4PHHA 2ESRA 5TT0A 2P9JA 2OFPA 4HY3A 1IE3A 1YRWA 4BMNA 3CG4A 4CDNA 2YFHA 3TJMA 1WCYA 1X7YB 2ILVA 4WKPA 5TV2A 3GLIA 5LMNB 3L7MA 4KFSA 4RZHA 1VE1A 4KX3A 4D9MA 3LT4A 3C8TA 4Y1EA 1KEWA 1NA5A 5CHYA 1XTTA 2IBMA 1PNRA 2PKWA 4FFPA 1R0LA 3NKLA 4F56A 4IOKA 4P53A 2I2WA 4QU0A 2HLDD 3SFVA 4C4RA 1FCJA 1FB5A 3IVGA 3OFVA 3PFHA 4C5CA 3BMCA 4PG4A 3EPJA 2E89A 4BVEA 3ZY5A 1GZ6A 2AOXA 3T15A 2BW0A 4QL3A 4RIEA 5C2JB 5EYPB 4UAJA 5FPSA 1ODKA 5K8JB 3HB9A 4R1OA 4U2EA 5ELXA 4ZJYA 3L7JA 2O2IA 2VH2A 4B46A 4XUEA 1DAMA 1VCNA 3OTIA 3JZDA 1F1JA 1ZC3A 2D0DA 1S89A 3QVTA 4UM7A 3WIBA 3BIWA 4L4ZA 4C87A 4G2TA 1NU8A 1NTOA 3EWAA 3NHLA 3SDBA 5AW9A 4QFCA 1B23P 1WEHA 4TMWA 1AK1A 1GAEO 3URMA 3FIUA 3N2IA 3MT8A 3NIGB 1GQRA 1NSTA 5LIRA 1NJ2A 1PD1A 3SYNA 4E09A 1QQ5A 3UATA 3GXOA 4EWLA 4N03A 3HCAA 4KYVA 5HP4A 4B48A 3LM8A 1GYRA 4MINA 2F9LA 2RHCA 2WYUA 3I9V6 2MSWA 2CXPA 2NU6B 3H0CA 2X86A 5EE1A 4C01A 1U0BB 3F9RA 1DU4A 1N9KA 3H18A 1WZUA 4EJSC 5CB6A 4QDOA 4DMMA 4XX0B 3ZWVA 5SICE 2HA2A 8OHMA 5K8TA 3UT0A 2PWPA 1M75A 4BLOA 2HSJA 3T5PA 3GVIA 3QVSA 1XMPA 3ZDRA 3A4LA 1EVZA 3FWNA 1N7IA 5B7PA 2XXAA 1VYTA 3ZYZA 3FFBA 3LKBA 3NBAA 2H4ZA 2QX8A 1S2NA 1ISIA 1EJ6A 4ESVA 2JFGA 4A27A 1Y4DE 4PICA 3VU1A 2NZXA 4YJ2A 3UV3A 1FU4A 4Y67A 4V0MA 1RWVA 4D9FA 3KQLA 4H0CA 1JHZA 1T2NA 2PRYA 4IXMA 3BXGA 2AR9A 1R8XA 3AR9A 4JUIA 3NDRA 1Z06A 2DQ4A 5SYAA 3ZNOA 4DPMA 4DWJA 4OI0A 3C8ZA 5BSVA 1UKCA 3PGJA 5FQOA 4NXNB 1QH1B 1F06A 3RRJA 1RRCA 2ZTUA 4QBKA 2BFDA 4RMHA 1K8YB 2JJ2D 4JSYA 4MDFA 4KHPB 4Q1VA 1L6RA 1WLSA 2XIJA 1GZ4A 3O1HB 1ZNZA 4YS6A 5IW8A 4YMTA 2BGGA 2OAGA 4RJKA 2JEYA 1ZMBA 2YWGA 3R3WA 4IJ5A 5AKKA 1IK6A 2LKDA 1USGA 3ETHA 4MKZA 1NMSA 4HRVA 1NBWB 3L79A 4BNJA 1Q1QA 2PZ8A 2QUAA 3AOGA 2OAQ1 4G8CA 1EXVA 4Q5IA 3JQ7B 5KSOA 4UTVA 5IX8A 1BYUA 2BONA 3T7KA 1VHLA 1M6VB 1FYFA 2QJOA 3IAM1 4C88A 4O4JB 5AKYA 3WTCA 4DM7A 3RSHA 4G0ZA 4HADA 2O0LA 2REXB 4IDFA 4X7MA 2YXLA 1BCSA 4P1ZA 1BGWA 1W8DA 3E9CA 1U4SA 1YB1A 2J3IA 1FFSA 2MSDB 4QJ5A 4XARA 5E6RB 5ENDA 4CN9A 2IXFA 1SOWA 4NU0A 1WXEA 5FI0B 4B9AA 1NT4A 4KNVA 9MHTA 2JIMA 4YALA 1XNRB 3WYBA 1QF6A 1VB5A 3STTA 2IZOA 4GMFA 1A8SA 2ALJA 4XB2A 5F33A 3QOFA 3E1KA 4ND8A 3PGLA 3DO8A 2VHVA 3FMPB 5THKA 5GZ3A 4P3PA 1EXMA 1VBMA 1DOHA 3JYPA 3O4HA 3PTAA 4ZA2A 2I4RA 1UR5A 4WZAE 3W9YA 2OD2A 4OM7A 5EGNA 2Y6UA 5KX5F 2ZUDA 4YJFB 1ISRA 2RBEA 1Y8ZA 1TEXA 3MRTA 3PUJA 4DQLA 1LVHA 1YJQA 1GN9A 1UMBA 2QR5A 2QVZX 5EMKA 5CCEA 4MO9A 2SICE 2C4VA 1U2RA 2WI8A 4EJ0A 2ODEA 3MAJA 4PYRA 4BECA 4F7WA 5IVHA 4ER0A 3PSAA 3UGTA 3WMXA 4G5GA 2NP7A 1RU3A 2BI7A 3NH6A 3CN9A 2WAAA 2YNMD 2YMLA 2WSSA 5BV1A 2H2GA 4NIMA 2MYTA 2FUKA 4JDUA 4PLCA 4CM8A 2J32A 2FQYA 3PPXA 3LDUA 3FD8A 4LYJA 3W2FA 3S1SA 2YQ5A 4PVCA 1RYEA 3A6JA 3EEFA 3GIDA 4JLKA 4NE7A 3R5JA 6AT1A 1IOZA 2YYAA 4EB3A 5C7OO 3BE5A 3V6LA 3W79A 4FXPA 1O6ZA 1T8RA 4URYR 1R8SA 2ISQA 3O8OA 4AN0A 1EBUA 4B7CA 3KD2A 1A8QA 3U39A 1P0QA 3U9LA 1NP3A 4L9SA 3G1UA 2GBPA 2NMVA 3ECAA 5MGNA 3TRDA 5IARA 1J8MF 2ZB4A 3AFOA 1YRAA 5C1OA 4X6XA 4MZXA 4ON9A 1RM5A 5G4LA 4FYVA 4XASA 4NZPA 4UOZA 5I4KA 1G5IA 4AK9A 4QQRA 4UPDA 5JAIA 5C8YF 4PBSA 4OF4A 3VC2A 4OO3A 3BMOB 2IOHA 2FG7C 1YDGA 3MA0A 4B6GA 5BSWA 3FLAA 2C03A 4L02A 1WUTA 3ASUA 2H17A 2GF2A 3EBLA 2ZSUA 3DMFA 3SBDA 4NEHB 3HNRA 4LV8B 4R40A 1WBBA 4UNRA 2A2ZA 3HYNA 5CUQA 2PUBA 2XWPA 5CFMA 5JXIA 2CXTA 2G07A 1PR2A 3IEMA 4ZALA 2FEKA 4ETNA 3B9RA 2BL4A 4C03A 3CEHA 3MQFA 2G4VA 3QVOA 4MX8A 3V1MA 5AM3A 4WFKA 1B6GA 1UFRA 4Q9JA 3ND8A 5EJ2A 1ZGJA 4Q3OA 3L7KA 1R7RA 3EDMA 3MWYW 4HR7A 2FOIA 3CT6A 5CXXA 3I37X 5IT0A 2BGRA 4M99A 2FKNA 3PPWA 4KBYA 3K2QA 4PZ9A 5I4CA 1YB7A 4BJ6A 1H9BA 2FZGA 3AQIA 2A3RA 5L7WA 4F7DA 3KM0A 1VXRA 5HCNA 3CPSA 4FB5A 2R1UA 2LW7A 1BE6A 4LNUB 5FOVA 2NUTB 2BH9A 3N6VA 1GTVA 1R5OA 3L01A 4N01A 3SU8A 4DQXA 1QO9A 2PSDA 1E1MA 5LC1A 4N65A 4V0SA 1U9ZA 4YLEA 2R7LA 2NQTA 1QYXA 1SMKA 3ERCA 5BN5B 2P27A 2WKSA 3ZIUA 3GZHA 2O07A 5I9MA 4DCNA 4KQEA 4BJHB 3E9QA 4CIBA 4LWPA 1XLVA 3OZFA 3S4YA 1B41A 2ZRIA 2AYYA 3K6JA 4ALKA 4KB5A 3LPNA 4L4SA 1ZIXA 2XKBA 5AI9A 1ZOIA 2G5CA 3RVBA 3TE6A 1K9SA 3ZWDA 4I5GA 3ZHTA 2JFWA 4FFNA 3COVA 3C6QA 4Y6OA 3TPZA 5KNBH 4JT4A 3D1VA 3F46A 1MC5A 1X2EA 1W19A 2AH5A 5L3QA 2XXBA 3QLVA 5EZ5A 3LHDA 2HA6A 1YJAA 3KR9A 3RGGA 2ODNA 2QYSA 4P33A 3KXKA 3L4KA 3VNUA 4A8HA 4AY5A 1O54A 1X2BA 3ZJUA 3H3FA 4PPGA 4RC9A 5EP3A 4ZDKA 4COOA 1F60A 1H6DA 3IOCA 5CXSA 4N3BA 2R7NA 5B1EA 4QVIA 4XXHA 4D74A 2J4DA 4GUDA 1Z29A 1Q50A 3KSMA 2QU8A 5DULA 2OXRA 1K06A 2FPGA 3DVRX 4PZEA 3ELBA 2R96A 1D6SA 1MDBA 3F7NA 3VM6A 1H4TA 4K88A 5KTSA 4Y6RA 3WYCA 2QY9A 4DWWA 2ZPAA 4FGWA 5F5XA 1FF9A 3VTAA 2K87A 3H9CA 5FWXA 1FLAA 3GHYA 2XB9A 3IDZA 4G5FA 4X6YA 1LNZA 3S5JA 4JQCA 4QLBA 3IUNA 1JP7A 2X9LA 3E7DA 2DQKA 3ABRB 4PXYA 4FSHA 2G9NA 4GM0A 4QXAA 4MUBA 3LT0A 4R69A 5C7YA 2GCIA 3ND7A 5JJKA 1ZINA 1NNI1 2WTAA 1PTJA 1XI2A 3DBHB 4RV5A 1CJSA 3RLIA 1OBOA 1VRCA 2IF0A 3RC9A 2G1UA 3LW8A 2HJRA 4HAYA 4EUEA 1J5EB 1IMOA 1UJ4A 1BMFD 3HLTA 3UHFA 1TXGA 4B8YA 4CKEB 1DJMA 3FRIA 3G7UA 5BVHA 1JKJA 5D1HA 4ZC8A 3AERA 3U3JA 4E94A 4LVOA 3L0IB 2Y66A 1YXMA 4JBIA 1JSCA 3AHGA 4EZIA 1MIHA 1OLXA 3D02A 1LEHA 5EUCA 4ZTUB 1F5NA 2A5LA 1JIVA 4QD3A 1N5OX 1JG2A 2BWJA 1PU2A 3GTDA 2BT4A 2ZAYA 3D4PA 4IZ6A 4KNWA 1TX4B 3EAQA 4M88A 3P9SA 4LFCB 3PFGA 1RP7A 1XVLA 3QEAZ 4C0QC 1BG6A 3TB4A 3ABSB 4OK6A 2GEUA 4EPVA 3LXUX 1TZJA 4KLZA 1A82A 2B5VA 2JKYA 2OWEA 3C6BA 1RWOA 4OQZA 1SVKA 1HDZA 1TE2A 2AE2A 2ZJBA 3A05A 4TTPA 1ZKMA 2QMZA 5E4TA 1JSLA 5BSRA 1QKIA 1XMOB 1CQJB 2XCOA 3VPHA 1ADFA 1EVIA 2PMWB 3ZU5A 2DP4E 3RC2A 1HPLA 2D27A 5G0TA 4CI9A 1EVEA 1HG0A 1NZFA 3BDVA 3IILA 1D2MA 2IQ5A 3PFBA 4J75A 3CO5A 3ZQ6A 1VLHA 4CR6A 1WUHS 3H2JA 2ZZMA 1GVNB 1U0GA 1CY8A 4NR0A 4B1FA 3CB2A 1N0UA 3H5WA 4RE6A 4UHJA 5ENVA 4MWOA 1PYOA 1RI2A 3E8SA 4KVAA 5C1IA 5FI1B 3H2YA 1GNTA 4X9XA 1YB5A 4F38A 4HDSA 4I08A 2K6GA 1E63A 1WMBA 1TC2A 3DD1A 4IIJA 5I5GA 121PA 3GOQA 1O08A 5ICFA 2E7ZA 3G5LA 3H5LA 1KAQA 5DKFA 1DL5A 4DSZA 3D54D 1T9BA 5JYBA 1LW6E 1TNDA 2V6GA 4HDRB 2XIQA 4RKYA 5SZKB 3GJRA 4KRYA 3I2KA 4MV0A 3P9YA 2YWXA 3UO8B 2CVZA 4FT4A 3ADBA 4HNAA 2XGJA 5I8ZA 3JS5A 2FSGA 2NZVG 1Z5NA 1XBTA 1GGHA 4UEWA 2H5IA 2ZS9A 3JAKA 3KG2A 3HMKA 1QS0A 3S5UA 3UTCA 1FTGA 2I6QA 5C18A 1F51E 5D6OA 1SCQA 3PEWA 1T8WA 2BRUA 4I1VA 4MQBA 3OCUA 3QBVA 3G6KA 5GV7A 4LCJA 5FPQA 1E3LA 1F2UA 1COZA 3QA9A 3ZTTA 2OYCA 4XJVA 1RHQA 3A6DA 1O94A 3Q3CA 1MH1A 5HF5A 2ZIEA 4MRPA 4GYYA 4LYEA 2RGGA 1EXDA 2PKQO 1V26A 5CG2A 5CH5A 2ZKIA 1NFRA 1ZGAA 3T1QA 2X4IA 4KE6A 4X8MA 3EVFA 3U7GA 1UBKS 4N5LA 3GARA 5F73A 5TY0A 3U4MA 2RKBA 2CUTA 3H87A 2JD1A 3OKCA 4OXQA 4Y6PA 5G0VA 2B3TA 2CNWA 1RMTA 4C7JA 3PDCA 3AVWA 3RW9A 3LC2O 4NYJR 4YRQA 1I4EB 4V1CI 5I7VA 3F7TA 3BK1A 4BVFA 5IWAB 1W581 5FEMA 1CUYA 2A86A 4NZNA 4OI1A 3RS3A 3TZCA 2F3RA 2HKIA 4P7BA 3LD9A 1D6MA 2A9OA 1YFKA 1EMDA 2FPPB 1U9IA 2BTOA 4O4HA 3NONA 4DLUA 4RHFA 4TWJA 1FMCA 5HDBB 5K5EA 4ASUA 4HGVA 3EEYA 1SBTA 4AECA 2QMEA 4A3SA 4NMXB 4RABA 2GFHA 1K7SN 1IJEA 3FOAA 5AJXA 3SXUB 4C20A 1CRLA 4HGRA 1GLVA 2JI4A 4LYAA 5C5IA 2E4WA 2LCFA 3A7DA 2JL1A 4AZ3B 3T4XA 1IZ9A 1EFKA 2P2DA 1XAJA 4YP0A 4YYZA 4KO1S 1F8XA 5CB0A 2ZYVX 2F8SA 4R05A 3C2QA 4CDGA 5J4KA 1P5ZB 4XGRA 3NKVA 1ND6A 1EE2A 2C96A 4LRQA 2TSYB 4DANA 1K5HA 2E55A 1DBPA 4JEMA 5AM5A 2VJKA 3LO8A 1K4YA 5HM8A 3RS0A 3E22B 2HVGA 4DRYA 3AP2A 4ZRDA 3RC3A 2XUOA 1ODSA 1R74A 4ZVSA 3CFYA 4MHTA 3AMVA 2IXEA 3ZLVA 1JH9A 4GP7A 5K6AC 1FMLA 5K0TA 1LX6A 3TLGA 2X0EA 3AR4A 3OEEA 1BEEA 1OKKD 2YN0A 4CNQA 1QUFA 4GE0A 4E07A 3EDQA 2WMDA 4TN5A 5D5QA 2E37A 1UXIA 4G6ZA 1KYYA 2RSLA 3JXEA 2J7PA 2FZ5A 1OWLA 1TPZA 1XR3A 2HIGA 1T9KA 4ICIA 4LDPA 1OOEA 3GUHA 2Z5FA 1IPEA 2B7CA 2EJVA 3A31A 4GUAA 4HNQA 1AF4A 4OQ4A 4YV0A 1YQXA 4OTZA 3E82A 1FNDA 4R68A 2DQZA 5K0NA 4F06A 1N7GA 1M1YE 1BVYF 4EUFA 1Z63A 3NB0A 3K31A 3HB1A 3MAGA 5IK2D 4OV6B 2WWTA 2PU7A 5FNVA 2W5UA 2H1SA 1NULA 3BORA 1QAQA 5J9FA 2X1HA 1C3EA 1CPYA 2FPSA 3WB2A 1I10A 1K7YA 1VIMA 3EJWA 4ZHQB 1GRNA 1KPIA 2GN0A 4KPUB 5C3MA 4ZGGA 3MCWA 1H85A 3KSDO 1R2QA 1T24A 4C0JA 4B40A 3HR8A 3MILA 2OPHA 4R1QA 1J9EA 1HDOA 3FSEA 4LZZA 1SBQA 4EMSA 2P9ZA 3TS1A 5HE8A 2G36A 4R9RA 5LKAA 1U15A 2ZSIA 2WNSA 3ZWPA 1P74A 1TM5E 2ONYA 3H9BA 2KX7A 4K6KA 4F1WA 1FFEA 2CVPA 3EB9A 2WLTA 1Q2XA 2E5WA 4Q1BA 3SG0A 4B4DA 5IUJC 1ZJWA 4Y1FA 4EO9A 4Y9RA 3L02A 5K3FB 2QRZA 3NEAA 5IDXA 1C8BA 1FURA 3CSDA 3TLBA 4OK5A 4RSMA 5F5LA 3DOIA 2R0QC 1OC2A 1RXSA 4XEUA 4Z99A 3UMGA 2XNCA 3HA3A 3NI2A 3JZFA 4A2QA 3AUTA 3DL0A 3PBKA 2DPYA 5EXEA 3QE4A 3ZHCA 4RZIA 4CLHA 2D1FA 2GZ3A 1WR8A 3U13A 1H1LB 3KKPA 5IZ4A 3OQNA 2DGDA 1A88A 2YFKA 3LA6A 4D7AA 1CRZA 821PA 2QTVB 2YZNA 4PQYA 2G1KA 1FS4A 2J3HA 1GNQA 2UVDA 4BMVA 4PR3A 1D5CA 4QGSA 1DT3A 1GJRA 3BDAA 3IE2A 3NANA 5B7QA 2XUFA 3ROFA 4R2LA 5JIBA 3OZDA 4CDMA 4DUYB 4TS1A 1FNNA 3GVPA 2HXSA 3C8HA 3EHDA 3MT7A 4UD2A 5JH7B 4TVKA 2FPIB 4ZVVA 3DNFA 4JAVC 4FCTA 2GN8A 1IQUA 1OGIA 1WDLA 4PZUA 1W5SA 3RVQA 3HFGA 2WJGA 4Y2GA 4CTJA 3CVWA 3PCTA 3M1YA 4IIBA 4KGVA 4WUTA 2IDKA 2V6IA 3B6IA 4GMDA 4IVPA 1XTKA 3T0IA 1R0BA 4GNKA 1IY2A 1QX3A 3ZZUA 5JS1A 4H15A 1DAIA 1ZXXA 1BVRA 2R6CA 4PLVA 1D0SA 1U5BB 2EKQA 4NY1A 4HQ0A 4NFLA 2R6FA 3FDIA 5HGXA 3M9XA 5DFAA 1UBSB 2H2FA 3DPIA 2XZLA 3EZNA 3VMFA 4Y6GB 4AG5A 2Q8NA 5HKBA 3FA2A 4XPZA 2PBZA 4JI3B 1Z4MA 3JYOA 5FLYA 2QLTA 1EDDA 1RIIA 3K3PA 1F14A 1I3OA 4DLAA 4NCXA 5LLSA 1SCAA 3BFKA 5CD9A 3HVIA 2H4WA 3PUIA 4EVIA 1L8QA 4LZOA 1EAYA 4PYJA 3SN6A 2VAPA 8MHTA 4JSRA 1UBEA 3UH1A 2GHIA 3ZUGA 3AEKB 3NO9A 3OOHA 3ORYA 3R7BA 2F90A 1RKVA 3EXEA 5C0OE 2DETA 4B3SB 2ZJZA 2XA2A 4D4IA 1NLMA 4L4RA 5LDGA 1E5VA 1FSFA 3CLTC 4PNPA 2PX6A 3LUCA 3X1YA 3PT5A 2ZT5A 3MTBA 3HHPA 3NTUA 3HGQA 3WKEA 3EIHA 2J3KA 2XYPA 3B1VA 2D5LA 4V02A 1SGWA 4XX1A 3F7MA 2GF9A 2YY7A 3W4IA 5FNZA 4HB2A 4XDGA 4D92A 2WNIA 4A8JC 5B64A 2Z8YA 4NQRA 4LQ4A 1PTJC 3ZH2A 3Q8KA 4RF5A 1B1AA 3KDAA 3BFJA 4UBMA 3EOAI 3BF8A 2GAFA 2IP2A 2XZTA 5DTIA 4CI0B 2FJUA 1NR7A 2NVOA 3Q8WA 3SHTA 3WGQA 3UMMA 4EDFA 3TUZC 2R44A 2YV5A 1ZVKA 2YXEA 5DHRA 1DQZA 2PD4A 4RGYA 5EIOA 3WQSB 4EA6A 2OCKA 3AI2A 3EXHA 3A10A 1IY8A 5EJIA 4R1TA 3OC0A 3HYCA 4AICA 3DDUA 2GZRA 1DJOA 1QB8A 1SQ5A 2O2EA 2Q0QA 2ZJ1A 4ZXFA 4GR9A 4M37A 1L7RA 2RGYA 3D7MA 4FHFA 2ZR8A 3PDIB 2ACEA 1CE8A 4NONA 3AF3A 4O4IA 3DBHA 3W3AA 4UUNA 1E3WA 5CPBA 5JDCA 3BWVA 3KQUA 2EX0A 2NUTA 4ROTA 1Z33A 2G0NA 3GN1A 1TKCA 3MD9A 5F91A 3ROXA 4EG0A 1T2AA 3REGA 3COZA 1LWOA 2PKCA 2VQDA 3DBVO 2FB9A 4WKCA 3KJEA 5FO0A 3SZ3A 3NHWA 3HK2A 3AR2A 4ZAFA 3ZZMA 4RQTA 1RVV1 2FOLA 4CMAA 1YZFA 1NE2A 2PU5A 1N2EA 1Q0QA 3ML1A 4Q4AA 2P8JA 4W1RA 1NTRA 3ETJA 4N47A 5JV5A 4ARCA 1BH2A 4MVYA 5CYFA 1H42A 2QLFA 4HMQA 4BZPA 4Z4GA 1GSOA 2JH3A 1Z13A 4HBZA 1ZVQA 2PJUA 1NR5A 3IV7A 3JPYA 2EFGA 2Y8EA 2ZB7A 4IQJM 1DSSG 1YI0A 2ODPA 4JITA 5KJCA 1IOVA 1YR2A 4AJKA 3ZVKA 3KT8A 2WU0A 2F1RA 2R84A 3TXAA 1U31A 3I5YA 2Z6UA 1M34A 3AV3A 4KACA 4HQNA 1SAYA 5CT6A 3AKZA 2AEMA 2Q2OA 3U56A 1B7GO 1Z88A 5KTTA 3G6WA 1JDZA 1NWCA 2MYUA 1VL0A 4HZUB 2OCYC 1TJ4A 2BI8A 2LXNA 1GPKA 3A70A 2J3DA 1Z68A 1EDOA 1G98A 3ICPA 3MGKA 4GKBA 2AW3A 1F8YA 4RGQA 1F0KA 2IL1A 2AI1A 2CBZA 1J07A 1TJNA 3K94A 3V8PA 3OIVA 5FPHA 5HVNA 2JRLA 2CLFB 2ZJAA 1X70A 3QVKA 1XCMA 4OI2A 4QFBA 3RVLA 4DA7A 4TLLB 2GNPA 4QUBA 1J97A 5LBTA 1VCHA 3ZWCA 4JYBA 4FBLA 5EXXA 1EFTA 3LECA 1UC5B 4A91A 5GINE 2NV0A 1G7SA 2I8AA 1PJZA 5FPKA 1E2JA 2O7QA 2BELA 4OJMX 1L5QA 2DWPA 2GXSA 3I32A 3VDXA 4CKWA 2AR0A 5CVJA 1PJCA 1V39A 1N1DA 2R7MA 2V8BA 4IZOA 3MOSA 2DSNA 1CSEE 3WLRA 1TZ2A 1Y3IA 1PNQA 1MEJA 3DT8A 5DISB 4ZN6A 3UM9A 3CNNA 4IMIB 3OM9A 3HWWA 5P8WA 5JDIC 3EZ2A 1X8JA 3MMZA 5BY2A 4ARUA 4YFYA 3V48A 4Y3UA 3BB3A 3QOWA 5KQLA 2QZ9A 3ROKA 4LX0A 1UKEA 1KIFA 1AE1A 2W42A 1PTKA 3CC8A 1JU4A 2C0PA 2JAQA 3TLYA 4LGMA 3BILA 4YJ3B 4P38A 3ET5A 1EGAA 1FS5A 3VSAA 4US0R 1JYSA 4ZQIA 4Q48A 1YVDA 3R3UA 1BX3A 1OZHA 3CZQA 3H84A 1H2AS 3LX4A 4HF7A 4N9QA 3V46A 5EEHA 2O5RA 2QAGB 2PMKA 2R60A 3BWDD 3DF7A 3FVRA 1I7SB 1B15A 4QO7A 1UJ5A 5KDLA 1JWLA 2IV3A 1ND5A 1I5EA 2CFOA 3OQPA 2Y2VA 3I3SR 3SD7A 2NM0A 5D84A 1KMHA 1RM3A 1XZCA 3QBDA 5IC5A 2RCNA 2QTNA 3VAZA 4YT4A 4RTNA 1JRLA 2W58A 3OLWA 1I4WA 4A8JB 2BGWA 1VCIA 3OQ6A 4LZWA 1EWQA 5AVYA 1ZJ5A 1HT2E 2B2CA 4RVNA 5LZ2A 2FWMX 4NFSA 4OI4A 2QNRA 1P19A 2P4SA 4MP6A 3RVRA 2W43A 1VHDA 2BJWA 2VRCA 2M98A 3ZHYA 4JL5A 2CSUA 4M0DA 4Q4JA 4AN4A 4NCKA 4Q03A 4WWHA 2NVUB 3RBVA 3RT7A 3S1AB 3W3ZB 2VBCA 1UP6A 2XRMA 4RMNA 3G79A 3H2KA 3HJRA 1BSVA 2V7BA 1U1DA 3SMVA 3LL7A 5SY6A 1QO7A 5IM4A 1TPYA 1X7WB 3CH4B 5KI6A 4NL4H 1W88B 2IU3A 3BEOA 5ALKA 1UJCA 3FROA 1Q14A 3QA3E 1FSZA 2A59A 4YRBA 3ST7A 2AF4C 2WFMA 3KAJA 3TYXA 1TQ6A 4X0EA 2H54A 3F3KA 1G8MA 3DAOA 4ZD6A 1DEXA 5D3KA 4JBLA 3AEUA 3VOTA 3ZNNA 2NPOA 4N54A 5JFGA 1UIRA 3SQMA 1RAHA 3AX6A 2GPSA 3R5HA 3VJLA 1C7RA 4BEBA 5KNDH 3GP8A 3OAAA 3VZRA 4BDSA 5JZOA 1KAMA 3U3MA 1IULA 4EUNA 3TCXB 4XFDA 1BCRB 1H9AA 3GJ7A 4CM3A 4JT8A 1LXCA 4IAOA 1L7DA 5EHGA 4ZDIA 3ANNA 1V7PC 1C30B 1IOLA 4BQEA 5LR6A 2Z3WA 1YB2A 4LPSA 1MU0A 4BP8A 3ORHA 3IOEA 4BX8A 3CG0A 5HZHA 2VK1A 3L92A 1WPGA 2P9GA 2GAIA 3ND9A 3PICA 4J2TA 4V3BA 1G55A 3O2NA 4DLVA 5EJ6A 3TSCA 3R0IA 5A4DA 1MAAA 1I3CA 3E2PA 4PLFA 4R6WA 2BF7A 3PXUA 3WYAA 4QECA 4WXEA 4XM2A 4U00A 1KAGA 4E1VA 5CVTA 5LNK6 3CE6A 4BO8A 1WTAA 4IHKA 2QTRA 2LIVA 3OLQA 4YCNA 1XZEA 4FPXA 4EITA 2NTEA 4RHTA 2W6NA 4FC6A 5T57A 2BKUA 3WKCA 5DM60 1ACMA 3RF7A 3R9WA 4ZO4A 4HSGA 3CUVA 3HGMA 3NHPA 4UDYX 3OZXA 1P5RA 3I5MA 1EZ1A 3ASVA 4EJSA 3BL5A 4EX6A 1EK6A 5CDUA 3KUXA 3MGCA 5DDIP 2HWKA 1DOZA 2VRNA 4MS1A 4CM7A 3WL7A 5LQDA 2AD5A 4KQ2A 3W2GA 5AVZA 1PDVA 1Z45A 4Z7JA 1J20A 4BCBA 3O2QB 2C29D 2HCFA 3ZI7A 5BPHA 3ZLBA 1UPFA 4N12A 4BB9A 5KYYB 1MGPA 4I1RA 4CIVA 3D3KA 4IWYA 3CZ9A 5D51S 2BUBA 2V3VA 2B8EA 1UM8A 4UE6A 5EZYA 2FMTA 3A4NA 1G8GA 3GK3A 3JQ9A 1FVHA 3AB8A 3M49A 5IT5A 2LP4Y 3KTDA 3PNQA 3K1ZA 4RORA 3SS8A 2QQGA 2Q8QA 3CVOA 4YAGA 1EPUA 3VC1A 4Z4FA 2B4YA 4MAMA 5EE0A 4H6VA 4KYIB 2CEKA 1SHUX 1U2SA 3SLGA 2H63A 5FOTA 4Q7MB 4GOXA 4Y30A 3MUEA 1Z4PX 4YV2A 4KCGA 1IRIA 5IAJA 1F38A 3ZR4B 4X64B 5CB4F 3KUCA 3EXIA 3G5TA 3OJWA 5ALPA 2CJWA 2WJ4A 5BQ3A 4LF8B 2GCEA 1E9DA 3C87A 5DBFA 3ZZ1A 1QDLB 4BX3A 4AIIA 1VE5A 4C76A 4OSPA 5FHRA 3JQCA 3F9IA 5EZ6B 1EXWA 2QG6A 1BWSA 2ZYAA 4MUAA 2AZXA 1EFUA 2RHRA 1U8ZA 1T5LA 2NXCA 2C3MA 3BMNA 4TKVA 1MO6A 4W5JA 3QYJA 2BMWA 4QYMA 4W6ZA 3T7SA 1V5WA 1W5EA 4TV9A 2CJPA 3UVEA 1N5JA 4FBMA 5FA8A 3AJDA 2OYRA 3LIIA 3HDHA 1OH8A 2D6FA 4XB6B 5IVPA 1YRYE 5JYCA 1T8YA 2NAPA 2OBLA 4GBGA 2WTUA 3QITA 2NPFA 1G42A 1DVRA 4AUEA 2YIDA 1LW7A 1RRKA 4FLEA 4RKFA 2AFRA 4PG7A 4A0GA 1DV1A 3U7QA 3R7LA 5LQAA 3O8BA 3QIVA 4F45A 4DPLA 1LDNA 4RELA 2BEUB 1VG0B 2GNOA 3RNOA 1L3IA 4L28A 3E9NA 2JKVA 3ZW9A 4E5NA 5BMVA 1M1NA 5I7WA 1UOQA 4M2LA 2GJSA 2MSKA 2IYFA 3FWYA 1ECJA 3OIDA 2EG9A 1P7ZA 1WLYA 4FXOA 2DYKA 2G9UA 1KMIY 1JHQA 3EUAA 3H2SA 4F8JA 1IW7D 3DYBA 3IV9A 3AUJB 4UKDA 5BSGA 3VBCA 2GOYA 1KWGA 5JD4A 5FA5A 1JWBB 1TLTA 2IU6A 3MUOA 4J07A 1KO1A 3IA2A 3L7BA 2H0AA 1XU9A 2IOQA 3OQ1A 4XPIA 2DQSA 1MN6A 2AN9A 3AR7A 4DQUA 1OJLA 2WWWA 1JXMA 5G0SA 2F59A 2REQB 1Z37A 1F9AA 5K03A 3UGKA 3ZVMA 4MDEA 4O3FA 3DXYA 1IY0A 3CEMA 2DB3A 1TM4E 3WK6A 5ALVA 2BSAA 2MR5A 1DDIA 1GZDA 3MJVA 2QTLA 1O77A 3LK6A 3QUAA 4DLSA 4G0UA 3ZK7A 3HJFA 4LEIA 4JJZA 4QYWA 3RV4A 2D8AA 2V9ZA 3HXKA 1E1QA 1G3MA 3PNVA 5AXAA 1BFDA 2HHJA 3PC8A 2OFFA 3SFTA 2I7DA 1W36C 1TKAA 1DAOA 4G4IA 1VRWA 3CPEA 1Y8QB 3MJ4A 4NBKA 1QVVA 5K3EA 2ZM5A 1FNMA 3WO0A 2VDRB 4G07A 4WVFA 1NUTA 3Q6NA 1I14A 2VXCA 4LC1A 3OJFA 4X3CA 3U81A 1FC0A 1M6EX 3R0ZA 2DY0A 1UZAA 2AVDA 2ZG6A 1OFGA 1RBMA 1W9MA 2XR1A 2R6R1 2AJBA 3FNEA 3OMWA 4IZIA 3R7NA 4RJTA 2FUEA 2GN1A 3NORA 1BTOA 1P6UA 2G9QA 3HU2A 4WCFB 5EHIA 5ER9A 5C80A 2ZYRA 4HH1A 3TCNA 4KODA 1T5HX 4MAAA 1SVNA 2P4UA 5AHXA 4QGFA 5ERXA 4DIOA 3TG8A 2A33A 5K51A 1KXJA 3URKA 2WYIA 1UK6A 1I1HA 2JBHA 2QMUA 2WSYB 4FFSA 1PR9A 3VYWA 2G7MC 5REQA 3FPAA 2ZBFA 4KR0A 2CNNA 4JC0A 3KKNA 3IUSA 3H5NA 2VPPA 4IDNA 1DXYA 2HD4A 1Z4IA 2F4NA 3UCFA 3W4JA 4LNHA 1MP0A 1QQBA 3MB8A 2P3QA 2OV8A 2R4QA 5LFAA 3KKLA 3ED1A 5JVDF 4URXR 2VDWB 1IHUA 5A05A 2CF5A 2NSDA 2YL2A 4NAHA 4P36A 2CEAA 4ZOEA 2IPLA 1N5RA 2X6QA 1BHQ1 4HPWA 1C1HA 1SUWA 3WNDA 1V1MA 1QVRA 4BVHA 5KWIA 3OZBA 3AUAA 1XU4A 3GEIA 1ZDMA 5BORA 1IEVA 2DECA 1PT7A 2JCBA 2VNJA 1J1ZA 3D6VA 4OHBA 3KTFA 1CJUC 3CUYA 2ODWA 1HYGA 4INOA 1DEOA 3LQ1A 3L8GA 4PCUA 1J90A 4RXUA 5CIYA 3EVCA 5G3YA 1DKOA 2ZFUA 2DJIA 3CKKA 4V0ME 1J0AA 1TU4A 2P9YA 3GYBA 4A82A 1XZAA 4QYXA 5LBUA 3K6SA 2QVLA 1T5BA 5CX4A 2IS4A 3NBKA 1COWD 4EFMA 1WABA 1L3CA 4P58A 1SK8A 2WB4A 1YVUA 2PTHA 1KDTA 3WRYC 5BWMA 1IMJA 5E7MA 4ND4A 2F17A 2CHGA 1G5HA 3AHIA 5GQSA 2QMHA 5ARDA 3RFXA 4AZ0A 3TPFA 3GEPA 4W8GA 2XB2A 1RWPA 1VJCA 5LOVA 1DHRA 4LYFA 5D3MA 3TQIA 3OCVA 3CURA 1C3LA 4YRIA 4WDRA 1DIAA 4ITUA 5T4FA 1KAEA 4FGJA 3Q3VA 3TECE 2YNMA 4CTOA 2OLKA 1E9EA 4M3NA 3KWFA 4UCQA 3E9MA 3ZY4A 1E3QA 2GZMA 2W2LD 4IX1A 1SC6A 2AUNA 3KOYA 1ZU4A 3OKFA 3WJ2A 4BMYA 4DPKA 2NN3C 5DTQA 4UMEA 4DNQA 3ZXUB 4OQDA 3SVTA 3LQQA 5EWJB 4XI9A 4ESOA 4L4YA 3DFFA 4RIFA 3N7UA 4HGNA 1TCAA 2JBAB 4NBTA 5DWDA 4AZ0B 2J87A 4MR8B 1L4GA 5A5FA 2WM2A 5I7FA 3EEQA 1KMQA 1UXHA 1V1RB 3LRXA 4GYJA 2DXIA 3NXSA 3ELUA 2MINB 4RD6A 2BMFA 2J45A 1R0SA 3FWZA 2O52A 4YQEA 2PS9A 1QLJA 2NXJA 3EVTA 3IERA 3UH0A 2C2OA 4JVOA 5T8KA 4AO8A 1W85A 3ESQA 1MQ8B 4IUYA 5TGTA 4EJ6A 2V03A 3KIPA 3OE1A 2WD7B 3C5WP 3DW1X 4M53A 2HHLA 4PSVA 1U2TA 4RA9B 4MGHA 3X2EA 3H2IA 4F4HA 2F55A 2BHSA 2WD9A 3BB4A 3ADPA 1INLA 1T9GR 4DJ5X 1JHUA 1V25A 2CXUA 4RK1A 1I2CA 2DG2A 2C4HA 5IJXA 3MPUA 4CHGA 1Y6FA 4X54A 3O4GA 4LJAA 1V5GA 4HGYA 1GZUA 4CMJA 5GONA 4H3HB 1NI4B 2TMKA 5BSKA 1DOFA 2WEKA 1PJSA 3BH6A 3Q98A 3T38A 2Z1NA 5C1PA 1N8NA 2P6OA 5FPYA 3SR0A 2NU8B 1I5RA 4BO1A 1XLUA 1SWVA 5GZ1A 1GYQA 4NULA 3VZDA 1E59A 3KKMA 2H1LA 2DH6A 1EJ0A 1JIJA 5CJJA 1VJRA 3KJFA 1KRXA 3A27A 2V6FA 1MC1A 4YBRA 1X80B 4MX2A 3ICVA 4ZO7A 1Z2DA 2GERA 4PGHA 3EPHA 1NVEA 1E5XA 3PKIA 3KJQA 3L0CA 4GP6A 4ZEMA 1SURA 2QM3A 4BX0A 3ANXA 2HJSA 3I0ZA 2JB9A 1WMAA 2Y1KA 1EE1A 2I65A 3GGCA 3ZGXA 1N5IA 1L4BA 3Q3GE 3DHYA 3NHYA 4YO8A 2WVJA 3BHNA 1PL0A 1FA9A 2E48A 2DHCA 3O93A 4O1HA 4QOHA 1OV4A 2ZVQX 1C30A 2I6GA 2ZRBA 1C50A 4TV8F 1HRKA 2V45A 3HVJA 4ZO9A 2B8WA 4H4CA 4Q18A 1YA8A 2I6SA 3PQ5A 5TQJA 3VO9A 3WK9A 4GZ5A 2X3UA 3VTKA 3OF3A 2FPUA 2DEUA 5BQXA 3FYUB 2GK6A 3WE7A 1K1EA 3IO5A 1HNNA 4XSVA 1RTTA 1R27A 1QIGA 1UP4A 2IHVA 2RJ3A 3CWQA 3PQCA 3U37A 5BP7A 5KNCA 4LK2A 3TEMA 1L7PA 1CZNA 1XKQA 1AHPA 1MAHA 1K8QA 3ZHVA 2FSPA 1C8LA 3JR3A 2EGGA 4NPCA 1PD0A 2HRZA 4Z86A 4DG9A 2L82A 1PCXA 1IEQA 2G08A 3PNKA 6CHYA 1Z4QA 2HF8A 4WZBB 1T8UA 3AR6A 2H4XA 1NNEA 3H9QA 3KQMA 4KYTA 2B36A 3IDFA 2PS0A 3OESA 2OG2A 5B53A 4C07A 3OQIB 3M6UA 2V9PA 4S24A 1N5MA 4BNGA 4YAIA 2PUAA 4KFRA 4WZ6A 2P9QA 3LUAA 4CJXA 1S8FA 3UAGA 1O3YA 4E12A 3N70A 4Q3CA 3M4YA 4QBGB 4QU5A 4QSMA 1M76A 3IP6A 1VBFA 3EF0A 4KLRA 4OSEA 1Z4JA 1S96A 4YUVA 5TIIA 2GUGA 4OLAA 1W1WA 3ZG6A 1WP9A 1ZYUA 1N0IA 3AOEC 2ZUWA 4MQUA 5ALJA 5GPBA 3P7MA 3Q6IA 1UBUS 5AVXA 1LSSA 3P9ZA 2IV7A 1OZAA 5FTWA 4JXXA 3DZDA 3BD9A 3CWZA 2HEGA 1QTIA 1L5OA 1Z0DA 2AXEA 2VDOB 3H7IA 1IBCA 4L95C 3ZWWA 3H17A 1R16A 3DMRA 3IVMA 1A9RA 2A5DA 1E5DA 1RKUA 4C0HA 4OGGA 3RTCA 4RLSA 1IY1A 3WMWA 1IWPB 3QBJA 1RLJA 4OKSA 3JR7A 5HUQA 1XCPA 1SXJD 4HLNA 4PZAA 3DLCA 3NATA 3X1XA 3ZX5A 3EK2A 4GDMA 3IBCA 1QGUA 1QKKA 5E9JA 4CMGA 2OM6A 2B2XA 4DWVA 1UDBA 4A2WA 4MRSA 4EFLA 2NT4A 4QREA 4TQUS 3B8HA 1LD3A 4PNHA 1M2HA 4EHIA 5KJ6A 4RD3A 3D0RA 3OSZA 3HSSA 5GOTA 4OGLA 4V3CA 4HB3A 1DMRA 1U9CA 4QXQA 3ZVNA 2A0UA 3AUUA 5EG5A 1YRQA 3T9DA 1GSAA 3OOEA 5H81A 3LLVA 5H59A 1MT3A 1EP2B 4UCFA 4F5DA 4FB4A 3WRXC 2WK1A 1P1RA 1U28A 2RONA 1CUSA 1REQA 1THMA 1I7PA 5I8WA 1XJQA 1EK0A 2ZTHA 2EJCA 1GRRA 1Z5ZA 2ZXFA 3AHHA 3BWYA 1L4HA 1ZSVA 2EJBA 3DUFA 1TJYA 5KNLA 4BWGA 1W5TA 1QHSA 3NETA 4MWDA 4MR9B 3OFKA 3QELB 1N2GA 2I2DA 1JKFA 4JOCA 1AZTA 3T5CA 2JGKA 1VDZA 1IAVA 2R5FA 4H6PA 4XOIA 1EK5A 1ZZGA 1M6WA 1WQ3A 3VKFA 4JY7A 1JA1A 2FUG6 1RQLA 2FZKA 3IX7A 3IUQA 2HY7A 2J9FA 3DSRA 4QU9A 3EA4A 1SUFA 5ELLA 3T35A 5K3OA 2GBLA 1GD1O 5AI4A 5KAMA 2WF5A 5HXAA 2A9JA 3LRPA 3N2EA 2C9CA 2L2QA 2NUPB 3G13A 1V8PA 4PPQA 1CDEA 2X2FA 2ZJYA 1MB0A 1GQFA 3LCRA 1AGXA 4Q12A 2XMQA 3AVQA 4CG3A 4D9JA 2HU8A 5EZYB 1DWQA 3WRVA 4E5YA 1Q0TA 2O59A 3RYTC 4INAA 1MO4A 1YOVB 1A2OA 1QYRA 1X87A 4O2AA 3QELA 4D4GA 3VPDA 4MIOA 1RXVA 2QUKA 3RUPA 2HK9A 3AKEA 3TUJC 3DKPA 3K0SA 4IIUA 1AY0A 1JDSA 2BE7A 4QUIA 3EGIA 4QVGA 5CM9C 1OFUA 1DTEA 5HRAA 1TMGE 1W4RA 1LPOA 5DYIA 5CFNA 1BKSB 2YW2A 5BNIA 4K0KB 1PFYA 2VJPA 1H4VB 1X38A 1D1PA 4QHSA 3M3HA 1FL9A 3IPAA 2GM9A 3ETGA 1R66A 1PGQA 4DMLA 4AKSA 3W05A 1I0LA 1RS0A 3WIUA 1ICEA 2JHPA 2YIJA 1J2EA 2ONJA 1ESEA 2ZETA 1VM6A 3MS4A 3NYRA 1N57A 4AU1A 1XGKA 2MU1A 4I4NA 3V97A 1P5HA 1G21E 4P9NA 3PDJA 2ENUA 2VQ6A 5CA0F 3COJA 5FD8A 3CW9A 2R65A 4TWBA 3OLCX 3ZWOA 4UPVA 1K4KA 1XOIA 1ZD4A 1NY5A 3IIJA 3JTEA 2HSZA 4HZGA 4L15A 5A9RA 4QUDA 1U5CA 2RGEA 2W6JD 2R6HA 1D6JA 2LBPA 3DMTC 3I05A 2QVBA 3KB2A 3QUQA 5BRNA 3T4PA 4EPTA 4E14A 2FPRA 1LBTA 2IEAA 4FI3F 4KK4A 3SYTA 1F0NA 3VR5D 2BUCA 4JBWA 3ZKAA 2JJ8A 1S3SA 4PLZA 4PYQA 4JBNA 4MVXA 4OL0A 5GZ6A 4HNTA 3L4JA 5JQGA 2M1ZA 4L9RA 3AM4A 3DOCA 3KALA 1BNCA 1KFBB 2ZTVA 4IIXA 4WEOA 3TLEA 3WJ7A 1QE0A 1OFIA 4Q7KA 5AOBA 1Y3DE 2YDYA 4EG6A 2VDWA 1AQUA 1KSJA 4MW0A 1RKXA 5L51A 3OPYA 2SECE 1KZ4A 1PW7A 4MYSA 5CK4A 2JFQA 2XY4A 4DR2B 3KSUA 3W0LB 3K30A 1L8XA 4X7RA 1T8TA 3NDBB 1LPPA 1OT5A 4MS4A 3QSGA 4I14A 4D0NA 1XL0A 2O3UA 3B89A 4NZMA 2IVZA 4E6PA 3DC2A 5KOIA 4HEA1 5JTUA 2E9FA 4JLBA 2CD7A 2ADFA 3UJ9A 1BS9A 2IYZA 2RGBA 1CR6A 3K0BA 2WA2A 1W4CA 1EM8A 4KAXA 4U7GA 3RANA 5IYZB 1Z36A 1CB7A 5IP5A 1XK6A 1Y8RA 4YCJA 5IPFA 1GO2A 3GRPA 4NK4A 1EM8B 3HXOA 5LMZA 1TCBA 2ZU0C 5H3HA 1LI7A 2OTCA 1OASA 1KAHA 1NOKA 4RJ2A 2ZSBA 4D41A 4MW7A 2R47A 3DV2A 2X4DA 1PUIA 3QKIA 2QTZA 1AGNA 4PU0A 5ECGC 2XMGA 3WYDA 4FGLA 3SHQA 2HL6A 1F4PA 4BMOB 3IE1A 4P7KA 1JFTA 1I2AA 1XRJA 4XIYA 3TW8A 2JA1A 4ZVUA 2OZPA 1HBJA 2B4QA 2V97A 3NT2A 1W35A 3KEQA 1LJUA 1Y8CA 1GUBA 1V3VA 1IZ8A 4U39A 5T4HA 5FWAA 4LMPA 3K71B 5I7OA 2IKSA 3A1TA 3A2MA 1I24A 1H8HD 2G82A 4NMWA 3WBBA 2C4TA 3EZ9A 4M0FA 4OHKA 1X7GA 5I4BA 3I1FA 4OKNA 4QPNA 1YZTA 1F7VA 2B35A 3GJ5A 3FN4A 4HGZA 1KK1A 1OBFO 2CKMA 2NSJA 4PLGA 4TT8A 1TMOA 3G59A 4LY6A 3BE6A 3LC0A 3NX4A 5F7ZA 3EPLA 2FDCA 2DWCA 1V35A 3CZMA 1CZHA 1V8OA 3NBMA 1GZVA 2XUGA 3O74A 3EIUA 3HC7A 2R1ZA 3L6RA 3PUWA 3QJ5A 3S28A 4WK6A 5B55A 5L4LA 5F98A 1H9CA 1CEXA 2W6MA 2GZ1A 5MDHA 2COKA 2X40A 3DDOA 1SC3A 3DTTA 1SXQA 4JJKA 5AVOA 1IK4A 1F2TA 1TT5A 2PYIA 1FUKA 4PBRA 1V16B 2OUKA 3WIEA 1P4AA 3DVQX 4A8PA 1N1MA 4Y2QA 1H4QA 5L9AA 4W4TA 2Q6VA 1N78A 2O1XA 3EQ9A 5SYMA 3UHPA 3OP1A 3MWGA 4V0LA 1T0HB 5DI3B 2IOYA 1JWAB 3DHNA 3PB3A 4R84A 5L3QB 3I64A 1Y48E 2C78A 2OMKA 4OLHA 5DBOA 1RQRA 2Q5OA 1IIRA 1E2UA 3DTVA 3D8HA 4YXWD 4QNNA 4AS2A 2H06A 4A73A 1WXXA 4BKMA 4GOMD 5CM2Z 5CPFA 4A26A 4Y6QA 4LJ9A 1Z0SA 4Y9UA 4RBNA 1VZ2A 4PIMA 4HAIA 4C5AA 2X6RA 4LYGA 3O9MA 4GWKA 3KCQA 1E79D 1X8LA 2Q3CA 1XYVA 3KAPA 3NHUA 2GM3A 2QRGA 5HMMA 1NT2A 2I4IA 4ID3A 2DE0X 4ERXA 2Z2KA 3O83A 3K92A 1JAZA 1WVIA 2VYVD 5DHSA 3JWJA 2HN9A 4OQLA 4NYJQ 3KT0A 3BOSA 1XTUA 2A9RA 3U3OA 1RAGA 1J24A 2RAFA 1KO8A 1UXKA 4B45A 2CV1A 721PA 3F5QA 3N9IA 4I55B 2QDXA 2R6JA 4D4MA 1R12A 2HQRA 2QWXA 3IQEA 4MPPA 4PIPA 2A57A 3UWKA 4ZVTA 2C7PA 3IVRA 2XUKA 3BRQA 3OZ7A 2DMRA 5HKLA 4JYPA 4MROA 1K7FB 2C92A 2IQIA 3OZIA 5E8JA 3X1WA 4QBFA 1UEJA 3NVMB 3FRJA 3E3MA 4XVQA 2X0RA 2X5XA 4PX5A 1UC8A 5F2EA 1F20A 3VPFA 2OD7A 3BDIA 3GGJA 1RWQA 2H9YA 1IN8A 3JVUA 5DI9A 5AUQA 4YRPA 3TI7A 4QDUA 4C04A 4DUGA 1DGQA 2ZRAA 3Q12A 5H3CA 4D3DA 3EYWA 2EBWA 3VSCA 4BE4A 4EYSA 4HNSA 1Y4ZA 3ZQJA 4UTOA 1IONA 1V47A 4R54A 3ELWA 3WIVA 3NVKI 4UM9D 3GLSA 1RYBA 1VJ5A 1D5WA 3D3WA 1DFIA 3JATA 2CDNA 3BK2A 2ZI3A 1NQAO 1E2NA 1KKMA 2JRCA 2QXUA 2W11A 4QRIA 5AHKA 3V8QA 1XDGA 3L40A 4P31A 2DLCX 4P54A 1M54A 2WG0A 5LQSA 2G8LA 2H07A 2Y1XA 4K05A 3COWA 4BLUA 1GTZA 2XGGA 2XF2A 3OBIA 4DAOA 1UKVY 4DLRA 3MYRA 5K8UA 5AJTA 1YF3A 5ERYA 1C3VA 1ZOLA 3EISA 4HDNB 4RF2A 3E5RA 5CCBA 4NKRA 1SCIA 3ZIAD 3QKSA 1XNQB 2WU1A 2VZLA 3WGKA 3B1KA 2AIRA 2A0WA 2WICA 3LDGA 5EL0A 3R7DA 1IUOA 1W75A 3UJCA 1QRRA 3KR2A 5F51A 3AV0B 4UFOA 4KXYA 3V7NA 1L7NA 1PSZA 4KGDA 1GEGA 1X15A 1YK1A 4RY2A 4TL7A 4UNPA 3IQIX 2GAOA 3TBKA 4BCDA 4G3XA 4HKTA 4QOEA 5ILGA 5I7AA 4BRZA 3NFRA 4EGFA 4H3KB 4M6WA 1NX6A 2WYOA 2GDZA 4JSTA 4AQ7A 4OK3A 3AR5A 5AKGA 4BC1A 4YRGA 4WI1A 1C3XA 2UZ0A 3WDLA 4P84A 4A7PA 1NW7A 4QASA 4DY4A 3OIWA 3UC5A 2EEPA 4L5IA 4BJ3A 4RX1A 1FSSA 3GX1A 2O8CB 4WFQA 1XCLA 3IUEA 3ISVA 1GCGA 1ZGBA 1S2OA 4J7UA 4MJLA 4Q6WA 5B3JC 3BTOA 2FF7A 3HCBA 2BOVA 3RIMA 5ADVA 3A3PA 4C6RA 3I9NA 4ZI7F 2Q1WA 5KX5A 1E0SA 2FEMA 3NR2A 4A5SA 4Y1RA 1TK9A 2BSXA 3THWA 1IBMB 3RUIA 2YZKA 2XE7A 1Z56C 3KR0A 3L8DA 1NP6A 5A9TA 1KK2A 4AAYA 4CUZA 1QFXA 3L6DA 1ZWLA 1WV1A 1Z3IX 4P3XA 4JI5B 3C7TA 5CDFE 1PQPA 1PVVA 1RQGA 2RAPA 1U3TA 2YIVX 7YASA 3RYHB 3L7LA 1ULUA 4NS1A 4YCDA 5HYVA 1CR2A 1Y80A 1T9CA 2K2WA 2UUOA 3OUUA 3RSLA 3KETA 3RBZA 3SIRA 5LZ9A 1XPUA 4O4HB 3CCFA 3UJ8A 3DE1X 1XZKA 2HT6A 4R8RA 3SVLA 3RAGA 2I55A 1NG9A 3I9JA 3OUTA 3IODA 1UPBA 1E3TA 1CFJA 1NZDA 1M6VA 3TQHA 2VT2A 1QX4A 4F4DA 5AVUA 2XCTB 1MVNA 1HQKA 2WKWA 3PNLA 4B6QA 1NURA 4HPJB 2NP6A 3REQB 4B2IA 3O47A 4ZJPA 5J3JA 1GTRA 2WY2D 1N7JA 1ISJA 1RQNA 2C4MA 3QP9A 3CZ4A 1UOEA 1RJDA 2O0HA 2IIBA 3L0DA 4QATA 1AUOA 4I36A 4ARIA 2UYGA 5CVDA 3IQWA 1G5RA 2N1MA 3WWPA 3A4YA 4D9CA 5LCXA 3WS7A 5C8YA 4JLMA 2E6KA 5G0UA 1LS1A 1K6EA 4JQYA 4NOLA 4C14A 4F9FA 1FYWA 2C31A 4YO7A 4ALMA 1RYNA 5DHFA 2OCDA 4P92A 5IBRA 1SCKA 1P6QA 1UC4B 4WGFA 1YHZA 4NZ9A 4RYLA 4LFBB 2CK3A 3ANMA 2F8TA 1PR5A 3BK7A 5E6SB 1WZ2A 4MUHA 4AS3A 5LD2B 1JSWA 2GAJA 4RVCA 1SXJE 3S0JA 2IYWA 2PL5A 3QWAA 1FFAA 4R1MA 2R85A 2FQXA 2X7JA 3T5TA 1XL1A 2AQHA 1JFRA 2ZYWX 3WLLA 3N2LA 5KOJA 5JT1A 1E5QA 3UJBA 1FFHA 4ND8B 2PQ2A 2GTIA 2ZUSA 4WOKA 2O8FA 2GCGA 3PQ8A 2E5FA 1PBNA 1VPDA 2XVZA 3CT4A 2HBYA 1OXBB 1YR6A 1BDBA 1C14A 1W29A 2EKLA 2EV9A 3EHEA 4HQLA 5DTMA 4CF4A 1O0CA 3EVBA 3G2MA 4MHSA 2HHAA 2CXXA 2ZOSA 4JC4A 3ZD8A 1BWQA 1T36A 3PUHA 1GZHB 1O9HA 3M81A 2AQ8A 4HTFB 4EY8A 1G20B 1VFPA 4OFWA 1XRPA 4UULA 4X66B 2QJTA 4MA4A 3HJAA 1ZM9A 1VI5A 3KZ1E 2HMVA 4NCIA 4ZAYA 4H6WA 1NIPA 2C95A 1U5AA 1I2MA 3ONNA 4LRWA 4ZU6X 2MCFA 1R00A 1RXYA 5COBA 1V4BA 4DDHA 2IWRA 2I80A 4IJUA 1FJHA 2D1SA 4DLNA 4LJRA 2BIFA 5B4UA 4J4BA 1NPYA 3WGNA 4X65B 1Y0BA 3EF1A 2MMGA 4DTCA 2F00A 2CXNA 4NJOA 4DHWA 4DJDC 2JHAA 1K2WA 3L0ZA 1DELA 4PFJA 3HI6A 4PCLA 1Y5MA 1O94C 4JUAA 2Y68A 1PN3A 3ESDA 2GRUA 3HJBA 5DYYA 3RVNA 1G2QA 5A5DA 1JIKA 2VN8A 1RWMA 4HAUA 3E61A 4M38A 2OSBA 1C7IA 4WNAB 2GN4A 2AX3A 4L5AA 4FYHA 2HREA 3D81A 3FTDA 1EFVA 4QOGA 4D2IA 4O08A 5JEEA 5IU6A 1LZKA 3F1LA 4IRXA 1ZXLA 1QHXA 3NIFB 5GWXA 2ZYIA 2AX4A 3AP3A 4IPTA 1MH9A 1WMEA 2X4LA 5C9ZA 3IHWA 4NU5A 2PZAA 2VJMB 4REQA 3QMMA 2C9DA 3TOXA 2GTPA 1ODTC 4ZVKA 2AOVA 2VIIA 1EUDB 3V2HA 4ZVOA 4B7UA 1R8YA 5AQ1A 1E1RD 1WD7A 4U5XA 4M9RA 4XWGA 4ZYLA 3U26A 5HOQA 1YR9A 5JWHA 3PNPA 4CEJB 1F9EA 4FMDF 2QP4A 4HWTA 2NSHA 4I4CA 4LGVA 3LUDA 5EZYF 4B2PA 4ZEWA 4X1YB 5G1PA 3PK0A 5EA2A 3ZWAA 1W8IA 5KDOA 4JYZA 2VPIA 3CSSA 2MSCB 5EKSA 4KKVA 4EFKA 2ZP1A 3JWGA 1KH1A 1KZGB 1QV9A 4KVZA 1N4AA 4CVNA 1DC4A 3QY9A 4HV4A 3EPRA 2H92A 4JLJA 4G97A 4R8MA 4RMJA 4Z2YA 4BRWA 3QE9Y 3U3KA 1YFZA 3CIOA 3DZCA 3FNQA 4LOKA 4MQFA 2P6MA 1JPNA 1KETA 3TCKA 1CETA 3RG2A 1D03A 1YZGA 5LMCA 2PNFA 3QUCA 3SEFA 4OFZA 3GPIA 4X92A 3NEJA 4YI3A 4HX2A 3B9BA 3PQ6A 3UAVA 3GRCA 1OH5A 1TKRA 2D54A 1Z34A 2C57A 2H08A 2VCHA 4I0WB 4PGFA 3LFHA 5EMLA 1P4RA 1ULHA 1JUDA 2DCMA 1PLJA 2H65A 2I33A 2FOXA 1FRZA 3IHLA 4P81A 4AMBA 4EA8A 1WE2A 2FSFA 1T1EA 5F1KA 4AUKA 3CZCA 4EHBA 1V9CA 1NL3A 2G6TA 1UZLA 3FUXA 4J0DA 3OM0A 1I3MA 2Q5FA 4E08A 2Z9DA 5E0OA 3F6EX 3PQ4A 2DFLA 4ENVA 1SXPA 2FZEA 4DDKA 1R5NA 2QV0A 1QC5A 3L1HA 3IMFA 1ZNWA 2JF0A 3HCDA 3PD7A 1Q19A 2W2OA 2VYQA 1E18A 4TV9F 4N8DA 1YWGO 5FLXA 3AY0A 2WIAA 3P27A 5IJ9A 5BNZA 5BSEA 4MS3A 2ZZNA 3DE4X 1KERA 2Z6VA 4PS1A 2O3SA 4MEAA 2HLNA 4Q21A 4R2JA 1TUBB 4ZGWA 2F9MA 4GI5A 1SOAA 3LLUA 4G4SO 3HXLA 2R00A 2UXBB 1F0YA 2GBIA 1PR3A 5AQEA 2PX2A 3SMQA 2A5YB 4NENA 1TUBA 2VTKA 4N0MA 1LRKA 2WG1A 3JQRA 1VPWA 3AVXA 4WLOA 1EUYA 4C4AA 3RFFA 1JR6A 5JY6A 1VZ3A 1FQJA 3W5JA 5LJIA 3RUDA 1VQ1A 2NYVA 3F7OA 2PJRA 1JQ3A 5AIAA 1L0BA 4MUMA 1WCV1 2CK3D 3HO8A 3N3AC 3PL1A 3QU4A 8GPBA 2FMHA 3SJUA 4PTZA 5ILQA 4WJZA 2CLIB 4RTRA 3GEDA 1Q22A 2HBQA 3G2PA 3L8YA 4WERA 3M6WA 4CKYA 3M2TA 1UT5A 4EL0A 1G38A 1ZH2A 3Q88A 1YT5A 2BEKA 1KYTA 2V6BA 2IYEA 3Q40A 2RHWA 3KQVA 4MMYB 3T1TA 5C32A 4XVHA 1E3IA 3ZWQA 9GPBA 2NSYA 2QSJA 5AM0A 1FPQA 3UG7A 1E3WB 2Z98A 2ICAA 1AKUA 4WXRA 4II2A 4R0MA 1J7JA 3QLVC 4K1LA 1O96B 1ETUA 3STHA 3G2HA 1P2BA 1FXUA 3TI9A 1L5ZA 2FUSA 3VISA 4RVHA 1UBLS 3Q5EA 3MBIA 2VUHB 4NBWA 3PXBA 2VR1A 1R6TA 3OLVA 3CH7A 4J7AA 3OE5A 4QVKA 2X1LA 3D6FA 5D7NA 3RYFA 3K1TA 3MMNA 4ND7A 1CP2A 1SUCA 2FWJA 1LBHA 4BZQA 2ASEA 1LBQA 3AW9A 3FFAA 4FMCF 4LZLA 3PYMA 1V7QA 2RAVA 3GFRA 2VAWA 3O90A 4FU0A 4LBYA 3RVOA 4YRZA 3MWDB 1G8HA 1J33A 2WW8A 4KN8A 4OOFA 4D5GA 4ZK2A 1FFYA 5J5VA 1N2JA 2PZKA 2PWAA 1GT6A 1OV6A 3T7AA 3IPLA 2JG3A 2QDKA 1NRIA 3O0DA 5HKKD 4ZQCB 2HDWA 3PSHA 4X94A 4CQLB 4LG1A 5KSYA 5DK4A 3ZGZA 1CTQA 3G89A 2XUDA 3KXLA 3CN7A 1KVSA 3HACA 4JP8A 4WXPA 2AOUB 2R00C 4A0RA 3R2JA 3AB7A 1TM7E 3F3MA 2ZW9A 4K87A 4L5YA 4O2BB 1EFCA 4LTDA 2PO5A 3C5EA 5HEKA 5JMWA 1D4AA 4IG4A 1HRDA 1A1SA 2NZUG 4RM3A 5KKAA 5EQDA 4JI8B 3IESA 1NPDA 3NBXX 4I6EA 2V54A 1N0WA 3O31A 4B71A 3A04A 4YWJA 1OHHA 3OECA 3D4IA 4AW9A 2Z4TA 5CLIA 4DEVA 1HOXA 3KKZA 4WKBA 3U4HA 3AGQA 3FNGA 3OURA 4M7PA 4NDAA 4RKQA 4NCHA 4OHYA 1ZH0A 1TFRA 3KVRA 4EZEA 1IVSA 1QIDA 3A6PC 1Z47A 2D2FA 4HXYA 3DZKA 5KSZA 1IPHA 2H4FA 4O2AF 1N2SA 5IJ9B 1Y4AE 2Q46A 1YZHA 2V0GA 1EVKA 1A8PA 3AI7A 1RABA 3UKJA 2RC6A 3NT4A 5A1TA 1Q44A 3SZMA 1Z8FA 3CW2A 1N25A 2O3QA 1GILA 4RV9A 2JLWA 4B84A 3RSFA 3OHMA 1H93A 3FDZA 2ZRQA 1G7RA 1XKTA 3A4TA 3L8EA 1H8ED 2BKVA 3IIEA 3QPBA 2REOA 4MGKR 3P0EA 4YPOA 2IOFK 3MOGA 1JMVA 2RGWA 3I1JA 3SQXA 2VSYA 8LDHA 2VJDA 3I4LA 4UBNA 1DC6A 3I2HA 2FQQA 1N1GA 1DAKA 1LLDA 1P77A 4BVBA 1DUVG 5DI3A 2WWRA 4JP3A 4F6CA 1E3DA 1W4BA 1YQDA 4U7DA 1HE8B 4MWZA 5EWLB 2C8VA 3LKVA 1FDIA 1ZN7A 2C5EA 1KDOA 2B6NA 5AYVA 3DAGA 1A9QA 1IPFA 2GN9A 4FHZA 4I50A 2HYDA 4OQFA 4YJ2F 1AKWA 1U8AA 2ORYA 2XX3A 3OTHA 1E7YA 4MR7A 4HYYA 4HN4B 5DM4A 1U0TA 1KVTA 4WD3A 4CYMA 4JOBA 3FI9A 1DG9A 2BLLA 2PFMA 4N6NA 3ZCUA 2DERA 3AF4A 2P1RA 3DHVA 3GFBA 4C6TB 4GZ6A 4ILEA 4DMKA 4EUSA 5HKKA 3LCMA 1GFSA 4GX1A 3T5DA 5ABPA 3TO5A 4PPYA 4XYBA 1RI1A 2XD4A 3DW3X 4JJGA 4Y2HA 1MXHA 2GXUA 2JJ1D 3DL7A 4MW6A 1KBOA 2VDJA 5IAGA 1CY1A 2BH2A 3RR2A 2B3DA 2W4MA 3OQBA 3A25A 3DHWC 3X2SA 1VJ0A 1XTQA 4D43A 1CUDA 4AF8A 1RZRD 3A9VA 3EXFB 1CS4C 5KVQA 4GOKA 2YJTD 3BIXA 2Z4RA 3BWBA 3U61B 1YJ8A 4QFDA 3QG5A 4I4LA 3W9SA 5A0VA 2G71A 3EFEA 4P2GA 1Q11A 1GL7A 4PYMA 4HWSA 4GI3A 1QJCA 2P2LA 3EA5A 3QWFA 3ZN2A 3HVKA 3C3BA 4IJVA 1GL6A 4INJA 2GX6A 1OX5A 2ZSJA 2QRNA 5BW6B 3RM3A 1VE7A 2IRWA 3KZOA 3FMGA 5LM3A 3P9IA 5GJWC 3U62A 1DO8A 2VA8A 3AVVA 1WO8A 3DD5A 2WVHA 4G25A 4HNRA 4Q4JB 5FWYB 4JB2A 4FEYA 4V2IA 1PDOA 3ZDAA 4BNDB 1C4OA 4E3WA 3TQQA 3PGA1 1HMPA 2YWJA 3PT9A 3BXXA 4H60A 4CMBA 1R8JA 4I1UA 3IEVA 1DRKA 4OXIA 4DBVO 3EMDA 4UAUA 16PKA 2G1JA 4PRLA 3IAAA 2NVBA 2PM8A 4FEEA 2NV2B 2OV3A 2WUEA 3CLRC 3IC5A 1Z75A 3R40A 5GJVC 4BX2A 5J1TB 4LF9B 1SEVA 3QVGB 4NMLA 4D8WA 1UPXA 4Y6SA 4ZHQA 4U7TB 1YOBA 1J09A 4RIHA 2CBGA 3G2LA 2HO5A 4GZLA 4UUPA 2R2AA 1OREA 2UZIR 2QJRA 3HDQA 2H57A 3GJTA 4R2KA 1PR6A 4R0VA 2F9FA 2QM8A 3DWGA 3T4EA 3R9XB 1J0BA 3CNLA 2ATEA 1L4LA 4JWTA 4KBFA 3ZX4A 3ZV3A 3ET4A 5KNCH 2ONKA 3D8RA 4HPXB 3Q8LA 2BM8A 1WHTA 1E7SA 5G1OA 1CZOA 1J4AA 2AG6A 2QF7A 4Q3KA 1A5BB 4Z9XA 3M1IA 5L3RA 4J29A 3CCCA 1HZZC 2NADA 1E2DA 4IKEA 4WVLA 3TL6A 3OX3A 4DIUA 3QZUA 4IF6A 3OO0A 3SDZA 4UZFA 1N2HA 2NAFA 3A1FA 3VZSA 3I6YA 2F3PA 4AMZA 4CQMB 4PCAA 4BO3A 2YWCA 1N77A 4KXQA 1QKJA 1C0PA 4O4JF 2IV2X 1RJFA 2PDAA 4K8OA 5SZJA 4QZVA 1UC9A 3D3NA 3FIJA 4YMSA 4CZ2A 5AJVB 1I80A 3T3HA 5AFSA 4K03A 4A36A 2QTFA 1KQ3A 2BTQA 3FTPA 4FYXA 4TSFD 3EQZA 4LJLA 2P9HA 4MWBA 4G0XA 5DT9A 5E1MA 4AP9A 4EG3A 4Q7QA 2RGDA 1MMFB 5CYOA 4Q3LA 3R5KA 4DT1A 3PC7A 1AQLA 3P2KA 2JC3A 4WOBA 2PLWA 2JFZA 3M3PA 1TKBA 2QJFA 3GCGA 1P31A 1ZZEA 3EWSA 4IF4A 2OHJA 4C2BA 4JI0B 3RO7A 1YD7A 3EW7A 3P5BA 4J0FA 2IIQA 1MJ5A 1X6VA 2JIZA 3ENZA 4TSKA 4WZBE 4ZWNA 3U7JA 1Y1PA 4HDAA 1FDUA 4NYIQ 1W0JD 2FWBA 3FCCA 5DWVA 4JD5A 3JV7A 3FY4A 1E3SA 3I62A 4O5AA 1RR6A 2WZDA 3ZDEA 1ZJZA 1ESDA 3JQEA 5J43A 3CUUA 4FONA 2C7QA 3P96A 4IIYA 4S0ZA 1BN6A 3OQJA 2B5WA 2JANA 1SZJG 3U7IA 5JJIA 2PJZA 1U8UA 2B92A 1K66A 2VXYA 1DQNA 2WFLB 4LNUA 1BJTA 4MVWA 4B73A 5CITA 4ER6A 1C7EA 8ATCA 2WMYA 3ILSA 4Z2AA 2P7HA 2O4CA 3BSWA 4ZOCA 4ED9A 3U4QA 3DL2A 3K1AB 1RXCA 4YGYA 4JROA 2R8BA 4J0JA 5ALGA 1X1CA 3HKDA 1UANA 5H80A 4HL6A 4X3PA 1SULA 1YH3A 2PNJA 4N0QA 4UUBA 1J7KA 3DVSX 1RAEA 1E7WA 2R7AA 3UMRA 3SJAA 2Y71A 3QI2A 4B4OA 4JI2B 3DHEA 2CUKA 3FCOA 3PKZA