3BWVA

Crystal structure of deoxyribonucleotidase-like protein (np_764060.1) from staphylococcus epidermidis atcc 12228 at 1.55 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
177
structure length
167
Chain Sequence
TRQRIAIDMDEVLADTLGAVVKAVNERADLNIKMESLNGKKLGLVMDILKEPGFFRNLDVMPHAQEVVKQLNEHYDIYIATAAVPTSFHDKYEWLLEYFPFLDPQHFVFCGRKNIILADYLIDDNPKQLEIFEGKSIMFTASHNVYEHRFERVSGWRDVKNYFNSIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative 5'(3')-deoxyribonucleotidase
publication title Crystal structure of deoxyribonucleotidase-like protein (NP_764060.1) from Staphylococcus epidermidis ATCC 12228 at 1.55 A resolution
rcsb
source organism Staphylococcus epidermidis
molecule tags Hydrolase
total genus 49
structure length 167
sequence length 177
chains with identical sequence B
ec nomenclature ec 3.1.3.-:
pdb deposition date 2008-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 3bwvA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3bwvA01
3MMZA 5AM0A 1WR8A 2DQSA 3L0BA 1N8NA 5AK4A 3OCUA 5AW3A 4UM5A 3QUBA 2GHTA 3EF1A 3QUQA 3WK9A 2W11A 3L8FA 3OCVA 3WK8A 4OD0A 3PDWA 3R4CA 3NAMA 3A3YA 1RPZA 2B1RA 3UMBA 2FEAA 3QUTA 4AP9A 4YCLA 1RQLA 2OYCA 4KNWA 1CR6A 4I9FA 2CN1A 1X42A 5JJBA 1YMQA 2C8KA 3DAOA 4Y2PA 1QQ6A 3SHQA 5ALMA 2R8ZA 1RRCA 1LTQA 5AICA 1L7PA 5AI9A 1KYTA 2YJ5A 3OCYA 3RFUA 5IT4A 5AW1A 2R8XA 2G0AA 5ALEA 1U7OA 3WGUA 4Y2YA 2HEGA 4JB3A 3WKAA 5AW4A 4Y2QA 3J7TA 5ALHA 4UATA 4EENA 3ZU6A 4BEVA 3A1EA 4YGYA 1Z5UA 3WK7A 3KDPA 3TLMA 3P96A 5AVTA 1L7OA 4DW8A 3AR2A 3ZVNA 3DV9A 5A3QA 4CNQA 2G08A 3EF0A 5AI4A 4UU1A 1TJ4A 3UM9A 3WK5A 4UMEA 4CE6A 2EATA 4EX7A 4JDPA 3OPXA 1Z5GA 2IOFA 2AGVA 2AMYA 3ZX4A 4KX5A 4C4RA 3WKCA 3ZWDA 5AW9A 5AI8A 2ZOSA 3R09A 4BNDA 4MUMA 2G1AA 4H1WA 3HYCA 2IOHA 1Z4NA 1ZD4A 3AR9A 2ODAA 1LVHA 3E84A 5AKXA 1XP5A 2Q4RA 3KZXA 1WZCA 3QGMA 2FDRA 2Q4TA 1VFPA 5AM1A 4DCCA 5ALYA 3L1VA 1RKVA 1ZRNA 4FE3A 3W5DA 4XQ0A 3AR3A 5AW6A 1RDFA 3I76A 4HGNA 5AVRA 1RLMA 2EAUA 4UAUA 1TJ3A 2P11A 5AK3A 2FPRA 2YJ3A 2YBDA 5AKHA 1YJ5A 2JGAA 3I6BA 3RF6A 1RLTA 2OM6A 3ET5A 5ALLA 4BX2A 3U7FB 4QJBA 3D6JA 5AKEA 5ALGA 2HF7A 2RARA 3ZTWA 3A1CA 2ZBEA 4F71A 1RMYA 2GFHA 2ZXEA 2B8EA 2FUCA 3L8GA 1ZJJA 4KX3A 2YN4A 4OHFA 2HX1A 2WM8A 4RESA 5A3RA 2JAWA 4AS3A 1ZD3A 2BDEA 3R9KA 1ZD5A 4RETA 1L8OA 5IT0A 2HO4A 2R8YA 5ALTA 1J8DA 2G07A 4YCMA 1L7MA 1WPGA 3K1ZA 3NUQA 4UASA 4Y2VA 4HGQA 1SWVA 1NNLA 5AVUA 2D2VA 5ALIA 4FYPA 3SMVA 4G63A 3MC1A 2WF5A 3KC2A 2YMQA 1L7NA 2WF8A 3E58A 3ESRA 3QU4A 3A1DA 1TJ5A 3NASA 5ALNA 1U2TA 2YJ4A 5AK5A 5AKKA 3B8EA 4KYTA 3QU7A 4UMFA 1Z4LA 5AIBA 3QU9A 1MH9A 3VAYA 1NRWA 3CNHA 3N1UA 2HF2A 4NABA 3ZI4A 1QQ5A 2YY6A 5AKGA 5AW8A 4Y2RA 3ZW7A 4L6CA 3KD3A 5AKIA 2YMMA 5AVSA 1RKQA 1Z4QA 4HAIA 3PCTA 5ALZA 3N07A 3QXGA 3SKYA 3U26A 2PQ0A 2P27A 5AVVA 2P69A 3WKBA 1T9ZA 5AW7A 2JAUA 3S6JA 2WF6A 3KOOA 2YJ6A 3N28A 1Z4JA 2FPSA 3U7EB 3QX7A 1Q92A 3AR4A 2B0CA 2C88A 4UU0A 4DFDA 4B6JA 5ALSA 2IOFK 3ZVLA 4EZEA 1T5TA 3FZQA 4YH1A 3UMGA 4XOUA 3BA6A 2PR7A 4NAVA 5ALVA 3L8HA 2OA0A 2P9JA 4Y2XA 3ESQA 4CF5A 3U7HB 4DWOA 4XE5A 3SD7A 4NV0A 2AH5A 3FVVA 1Z4MA 3GYGA 3E81A 2FPUA 3MPOA 5AW2A 1U7PA 5AW0A 4E88A 4IG4A 2ZBGA 1SU4A 5AVXA 1RMTA 1RMQA 3F9RA 4NFLA 3L1UA 4BEWA 2G09A 2FPWA 3B9BA 4ZEVA 5AM5A 5AW5A 5ALWA 2CFTA 1IWOA 1JUDA 2FPXA 2GO7A 4UW9A 5E0OA 5AKLA 2I34A 1ZRMA 1RQNA 2CFSA 2I33A 1FEZA 5AK6A 1S2OA 3N5KA 2G06A 3CZ4A 3FPSA 1EK1A 3UMCA 3MN1A 4GXTA 3QYPA 1ZD2P 1VJ5A 1S8OA 3U7GA 2JARA 2G80A 5T41A 2OBBA 4G9BA 3W5AA 1XVIA 3SF0A 4Y2UA 3U13A 2HCFA 3WK6A 1YS9A 3L7YA 3AR8A 4BX0A 3OCXA 4NWIA 2NYVA 2YFYA 5ALFA 4MWOA 1EK2A 2QLTA 2NO5A 3QUCA 5AESA 2C4NA 4Y2JA 3FM9A 3IB6A 4UARA 2ZBFA 4BYGA 3ZUPA 1Z4PX 1Q91A 4GIBA 3EWIA 4I9GA 4UMVA 2WHEA 4ZEXA 2YMLA 5AHXA 4F72A 5AM3A 2HSZA 3ZVMA 2RBKA 2VKQA 2AUTA 4L57A 2C9MA 4UAVA 2I7DA 2O2XA 5ALUA 2HI0A 5FP0A 4IFTA 3WGVA 1QYIA 4OFZA 1Z4OA 1ZS9A 2MU1A 3W5BA 1L8LA 4XPZA 2GMWA 3AR7A 3NRJA 5AI5A 2ZG6A 2HDOA 4HYTA 3L5KA 1AQ6A 3WKEA 2W43A 3QU2A 5AIAA 2PKEA 1U02A 2I55A 4UM7A 4AS2A 2IYEA 2I54A 1Y8AA 1Z4IA 4YIKA 3OCWA 3ZWKA 4BNDB 4EEKA 3ED5A 3OCZA 1N9KA 4UMDA 5ALJA 3L8EA 4OCZA 5A3SA 1O08A 5IS2A 5AVWA 1VJRA 3FGOA 3ZX5A 1RC8A 5AKJA 2MSNA 3WKDA 3M1YA 2WFAA 2JAOA 2B1QA 2FI1A 4FFDA 2I6XA 2EARA 2Q5EA 4HGOA 2HHLA 5AVQA 1YV9A 3EPRA 3NIWA 3U19A 2BDUA 3ONNA 1QQ7A 1XPJA 2QYHA 3I1YA 3QLEA 2B82A 3AR5A 2IA5A 4ZEWA 1ZOLA 4O8CA 1TE2A 1K1EA 3IRUA 5AKZA 1WVIA 5ALKA 1RKUA 4L6AA 4HGPA 4YCNA 3IJ5A 1RLOA 2ZBDA 3NANA 1J97A 3OTQA 5AI0A 1F5SA 3DDHA 4HGRA 4BKMA 4C4TA 2HOQA 2YMPA 3PGLA 1Z88A 2FUEA 2O9JA 3NALA 1L6RA 1PW5A 3AR6A 3KBBA 4QQFA 4CF4A 4EELA 5AM2A 2C8LA 2CFRA 2R8EA 1NF2A 3QNMA 2B30A 4C4SA 5AVYA 5AI6A 5AVZA 2W4MA 1SWWA 2NO4A 3HLTA 3SLRA 3BWVA 3N8GA 4Y2SA 3W5CA 5ALDA 1T5SA 2GHQA 4J2TA 2RB5A 2B8JA 2RAVA 3E8MA 5ALOA 5ALRA 2WF7A 1YNSA 4BBJA 4PNHA 3ET4A 2BY4A 4BX3A 2WF9A 1U2SA 1Z4KA 1O03A 3M9LA 4J03A 3PGVA 4KNVA 3I28A 4Y2TA 3DNPA 1TA0A 5AKYA 3FPBA 3B9RA 4EX6A 1QH9A 3WK4A 4YIHA 3L0YA 3ZTYA 4CF3A 3QU5A 1CQZA 5ALQA 4KN8A 5ALPA 5AM4A 2X4DA 5ALXA 4Y3UA 3L0CA 3SKXA 1YDFA
chains in the Genus database with same CATH superfamily
2JKYA 1DXOA 3A10A 3ZXYA 1Y7PA 3SZUA 4CV1A 3PNSA 2QTVB 1JXOA 1Y6RA 2PX5A 3L0BA 2V7QD 1LVGA 1TU0A 2XJ9A 4P4SA 4PXYA 3SEQA 5IYZA 1B00A 1T36A 2GEFA 2V4UA 2X86A 1T3LA 3D6VA 2AUMA 2FVYA 3VOTA 4F4JA 3GF4A 4HDRB 3KKQA 3CLHA 3EFEA 3L8FA 4KQJA 1BEUB 3TOZA 5KOIA 3QELB 2EQAA 3NOQA 1FRNA 2D8MA 1OAOA 1KOJA 1MENA 3K0AA 4OD0A 3RM3A 1H05A 4Z9FA 4RDCA 1I4DD 1CDZA 4CU5A 4C0LA 3VVBA 4X93A 2IE8A 3VZDA 5FO0A 2FP4A 2OHFA 5DI9A 3GQBB 2ZYRA 4AP9A 4UVEA 2QUAA 3QKTA 1SH7A 3R7LA 3IE0A 1VRVA 5F98A 1JKJA 3FMFA 5EZYA 2IDJA 1EWTA 3NWPA 1YUBA 2AZ4A 3UK0A 5JNVA 1ID1A 1BVRA 2O5EA 1MVNA 1KYVA 1QQ6A 1O3YA 1WMEA 4QXOA 5FUYA 1WCXA 6ABPA 2I2WA 3ZD6A 2ZRFA 1M2OB 1AGNA 2AC4A 4GM4A 2OCYC 1IBRA 4GS5A 1FNSA 2N1MA 1SXJD 5EIBC 4DBLC 3HYRA 5T57A 1OXUA 1QFXA 2JFZA 1X8JA 1QAQA 2VPXA 4MV4A 1B8OA 1KFCB 3JQ8B 4YXWA 3Q3HA 5K3DA 1G4UR 2GRJA 4C07A 3LH5A 4X94A 4EPRA 2QPAA 1BFKA 1MC8A 3KQTA 2Z04A 3TVDA 1SC6A 4GO1A 4QRDA 1SUAA 3P9QA 1DIAA 2XWJI 1FVOA 3GAMA 1F8GA 4KOAA 1DBVO 4PPYA 5EA2A 4X3OA 5BYBA 2R2AA 3C8HA 5LZ5A 3TLEA 3H99A 3FUWA 3E9DA 5AUPB 3RRZA 4YGYA 1HO3A 3WBKA 4EUKA 1ISFA 3OJWA 3BEDA 4KO3S 4F38A 1XMQB 3OTIA 3TLJA 1CRPA 1KORA 2Y05A 3WIVA 4OK6A 4XCXA 2WUVA 2IW3A 3COYA 3AR2A 5LA6B 1DARA 2B1IA 5A3QA 3TOXA 1FRFS 5ILOA 1CQJB 3C5HA 4U0KA 2PU5A 5JANA 3OLZA 3RF7A 1OWMA 2AZMA 4QTZA 1TRKA 3CB2A 5FTMA 3ISTA 4LIPD 4H16A 4K8OA 5JASA 5JTUA 4XYBA 1NVUQ 4HDMB 4YAOA 1E1DA 3DAPA 5H3LA 1ANKA 1FUKA 3GZJA 1JVSA 1SVKA 121PA 3B5JA 3WKCA 3VC1A 1FPQA 1OU4A 4MVJP 2X4GA 4K88A 3GZNB 3Q12A 3IAXA 1YVRA 1T2DA 4K40A 4YI5A 3VKHA 2PGLA 4EJMA 5C9ZA 3T41A 3ZKAA 5IZ4A 2M9MA 4OXNA 3B7WA 3KWLA 3O8OA 4OLJA 3TW0A 2GZHA 1UBEA 3E5HA 1Y0BA 5C1PA 2OORA 4HNVA 4G5XA 3AVXA 3L02A 3K9HA 3Q98A 1NPYA 1IWBB 2GR9A 1BDMA 1YC2A 2ZIZA 4P38A 4AJ2A 2FX2A 4KWIA 4CR7A 3T9EA 3ELYA 3A3KA 1DEAA 5K8LA 3DVLA 4TN5A 4L6IA 2AYYA 4WXYB 5AVRA 4ABTA 1RLMA 1XN4A 2FHPA 1C0PA 3C4QA 4KO1S 2DBRA 3GFFA 4EECA 1IONA 3M81A 3WGMA 3R7DA 4HH0A 3TNDA 1NUUA 5AK3A 3IO5A 4BU0A 1JSLA 5IAOA 6REQB 2JRCA 1R50A 3MS7A 3KTAB 5KTRA 1I9CA 5K3EA 4PC7A 2IZ1A 4HDKB 1JDZA 4TVSA 1PI3A 3LY7A 3QJGA 2FEKA 1KO7A 1XZKA 2X23A 1TEHA 3OEED 2Z83A 1UBCA 3QWAA 4I1OA 4AYWA 4EGSA 4AJJA 4JXXA 1TYCA 5D6OA 4F71A 1T4CA 3USZA 3E9EA 4POOA 5LQJA 4LF5B 3LZDA 2C2WA 2XIJA 3GLUA 4C9BA 3C5EA 1GLGA 4KPGA 1C2TA 2GJ8A 3SX2A 3NMUF 2ZLBA 3KAKA 4B44A 3IEVA 4NK5A 1OE0A 2Q6LA 3E48A 3I2IA 3TLAA 1JIXA 4B76A 4JOCA 1Z0DA 2IUTA 4DAEA 4DQLA 1RE0A 1AUXA 3VR6D 1US8B 1CZNA 4D9FA 4Q9NA 4DPLA 3ETDA 5C81A 4E2XA 2F64A 3IP7A 1FS5A 2JJ2D 1LDBA 4G0ZA 4YWHA 2E1RA 2GVNA 1JRLA 1OVMA 4YRMA 4G01B 4NV1A 2VYNA 3K1ZA 1DC8A 1TAGA 4RE5A 1U8AA 4C4YA 3JQFC 3OT1A 3OPYB 5ITZB 4H4DA 4J4HA 4Q9DA 4CN8A 2AOWA 3FF1A 4MYSA 5FNVF 3OIYA 5JG7A 1E62A 3HP1A 5IRCD 2GNOA 1RRPA 1VIMA 2YMQA 2Q9CA 4JBGA 4P5EA 4TL9A 5AVOA 3TM5A 5CFNA 2IW1A 1Z36A 1M5RA 4P0QB 1TJ5A 3HB0A 2HJSA 3IP6A 4JJ6A 1U2TA 2RGUA 5ALNA 5ICMA 1GYPA 1KJYA 4GZLA 5FEMA 3ZDYB 4EHLA 4B5KA 2ZRLA 3DVRX 2PS1A 2GH1A 1S7CA 3EFOB 3HYTA 5IDYA 4C6TB 2AW3A 1Z5OA 1BS2A 3EG9A 3JQGA 4O5OA 1N6KA 3VSAA 4A6PA 1ISGA 3R8CA 1O94C 3QEMA 5F92A 1IOVA 1K27A 1SB9A 2XMDA 2WJYA 3I37X 5L4SA 3C5CA 5EJ9A 5HF8A 1DAFA 5AW8A 1T3HA 2FQWA 2H51A 3CU5A 3P2KA 1K7YA 3EA4A 4E51A 4FN5A 4ND3A 4N5IX 3GAZA 3KD3A 3OHPA 4HTFB 5DHAA 4RZXA 2RGAA 5KQRA 5EXSA 4E46A 3HKDA 3PYMA 4EUNA 2WG1A 4RK6A 2AR9A 1BMQA 1VJ0A 2DY1A 2JDIA 3CXUA 1N2CB 2SBTA 3K2EA 4I4TB 3CX7A 3MERA 3FSJX 5J5CA 1QIHA 1ZM7A 3QXGA 1M5UA 2PWPA 3VR5A 5FHRA 1N9ZA 4MUXA 3V34A 5AVVA 4D26A 4B47A 1P6QA 3RRPA 1JG7A 3RYIB 3ZIDA 4GPZA 2PRJA 3DF7A 2PA3A 3KKZA 4RNDB 3PS9A 3CPJB 3KJIA 2C3OA 2R6DA 4CN9A 1QQTA 4ZCPA 3SE7A 3LL4A 3ADKA 4PIPA 4D82A 2QS9A 5EWMB 3VAZA 1YA6A 1MO6A 2VDPB 1Q7TA 2IEIA 1MNQA 1JFFA 1U3GA 2EL9A 3GLRA 3X44A 1Q15A 2QMQA 3OFNA 2Z8XA 3NTOA 2WMNB 5REQB 4QOIA 3PX2A 3ZQ4A 4R1PA 3JWEA 1P1JA 1MW9X 1P73A 4WZBE 5FTJA 3SJUA 1M74A 3SZ3A 3V48A 4D1YA 4UTPA 4ZJYA 4P2BA 1KH1A 1ZK4A 3G6KA 1OWPA 1HLFA 3RVLA 1UINA 5IKEA 5F35A 3FCSB 4JA0A 1OIVA 3DHWC 2G9RA 4GSLA 3KSAC 2VQSA 1VDMA 1X7XA 4W9NC 1G8HA 1X0XA 4O1MA 5LYJA 2B69A 3TIFA 3OU2A 3NJRA 3UMJA 3BL5A 4UNIA 5TMEA 1C1YA 2ZZNA 1ZHOA 2KMLA 1X3SA 1PR0A 4TSFD 4JI7B 2VZ9A 2CBXA 4V1CA 3K6RA 5FAXA 4A36A 3ZIUA 3V4ZA 4QT0A 2ZBGA 4ALMA 2EU8A 3PICA 4MR8A 1CZKA 3AI1A 3OQ6A 4MW9A 1GKUB 4XIIA 4CETA 4IKEA 4GEGA 2JJ1A 4EJSC 1SAYA 2DR0A 2FPWA 2I8CA 3B9BA 4MQ4A 3UTCA 1CUHA 2GCOA 3DV0B 4JSYA 4Z3KA 4F96A 1KY5A 2A5FA 2PBRA 4LJ4A 5DO9A 1QPZA 4DC1A 4XWGA 4L4SA 1A1SA 1UP7A 3D8HA 2ZW9A 3F5MA 2FMUA 2B6NA 5LCXA 2H48A 2O3TA 4QDZA 5AKLA 2IYRA 4QTUB 1NBOA 4UM8B 3D2BA 4IR7A 4M1ZA 4Y0NA 4AKTA 3PLNA 5JD6A 1L7XA 1DBIA 3FH0A 1SULA 3SZGA 2GCGA 4JASB 2Y2UA 4EFNA 4EJ2A 1NTRA 1SIBE 3RC9A 1OSNA 1O5IA 2HA2A 3PHHA 4APAA 1S8OA 3HACA 2CXRA 2X0DA 5CPBA 4Q1BA 1YRQA 4QWMA 5E6UB 5G1NA 4ZYLA 1GUFA 5IAAA 5A9SA 4R40A 4OB8A 1M2HA 4Q3DA 1TGYA 4CIYA 4B3BA 4XVRA 3K1TA 3WLKX 5DMXA 4E4RA 4M9CA 4YMGA 4L5CA 3VTAA 1R6VA 3WRXA 2QTTA 4WK2B 4MLPA 1TK9A 4QSMA 4JNKA 1H1TA 2ZI3A 4EEZA 2FW0A 3V80A 1QLJA 4ZIRA 3H1EA 3WBFA 4MWOA 2P9FA 3WS7A 4GNKA 5IJ9A 3C39A 2C4NA 3TDKA 2Q2VA 4R8MA 1I24A 4PZ0A 3HKEA 4IJ6A 1M6NA 4ZDJA 5CB4F 4LF8B 4L8LA 4B6GA 1JTFA 4OHCA 3ZUPA 4Z7OB 5FUXA 5JNUA 4KPUA 3DKPA 1A9SA 1S01A 3EVAA 2BEWA 4FNOA 1S8NA 1GNRA 1AKUA 3CEAA 3PFHA 2NQ2C 4QEKA 3KQHA 2GLXA 2FJUA 6LDHA 2A9PA 2HSZA 2XE4A 4AW9A 4XWKA 3TXYA 1OFTA 3RTGA 3V7WA 3MPUA 1E9DA 3F67A 3ROZA 3FHOA 1E77A 4IDBA 5ALUA 2MMGA 3MBIA 3AZPA 4C7OA 2GPAA 4XIJA 4K0KB 2H29A 2OFXA 1H5QA 2I8AA 2IGTA 3MRTA 1BFUA 1CUAA 3ZE8A 1W6UA 1RABA 1X1CA 5H82A 1YQEA 3PWZA 3G8YA 4LG1A 2FR0A 3W8DA 4A10A 4HSGA 4O6VA 3ZXSA 4U6QA 3R6VA 5EJFA 2W71A 3VSEA 3A70A 3C3WA 2BJHA 4CMGA 3E27A 3AOEC 5TARA 3ZU4A 1DG1G 4M1EA 5ABPA 3GV0A 3H97A 4ND8B 5HPYB 3I9OA 3Q0IA 4D3DA 2GBIA 3DF9A 3OCWA 4MQFA 1CB0A 2RGNC 5FV4A 4AB1A 1Z7BA 3SBOA 2FV8A 4AKHA 3QJ5A 3KR0A 3W4IA 3ED5A 3O26A 4EEKA 4TS9A 2Q5IA 2H8GA 2B21A 1LDMA 1UXKA 3A36A 1V9SA 4YO8A 1WXHA 3NBAA 1M2VA 4L2IB 4R8SA 1JHYA 4LI3X 1DFIA 1U3TA 5BN3A 1VJRA 3PNKA 3GLGB 2LGJA 1RC8A 3VR2D 2XZPA 1ZN2A 4MR9B 4FGLA 5LIPA 2Q99A 3U37A 3FRIA 3KYIB 3Q3CA 4QQRA 2IP2A 2WWVD 2WFAA 4EHNA 4B9AA 1EK5A 5FJIA 2FI1A 2VDJA 1JDTA 1V16A 1R1DA 3D8NA 1U98A 1ZMTA 4FHGA 1X1EA 1SZPA 1VQ1A 1FYXA 4PGMA 1IUPA 5E1OA 3TLGB 2H06A 3KE9A 1XEWX 1IDOA 3UFXB 4DXHA 2QMYA 4UHBA 2P6UA 2XB2A 3F4LA 4JBHA 3WYNA 1NN5A 1LSOA 2AKYA 4X85A 1R5JA 2G9VA 3VDRA 1G9XA 3U56A 1ENZA 3R3WA 1Q5NA 2WILA 1V26A 1M0WA 4CLHA 4RD3A 5IJXA 3LLCA 4TSKA 4R0MA 2QLMA 2HY7A 3OQOA 1U6JA 1VI5A 1D5WA 4YUXA 1VYUA 1ZNYA 1O6GA 4ZI5A 1QUEA 1U6IA 2IYUA 4JLVA 5JC1A 1JH9A 1Y6QA 2VLIA 2FZKA 5K8TA 2VF2A 4J0KA 4RZ2A 3BFJA 4AZ0A 1DTEA 1QIFA 3ELWA 3HBLA 4HBZA 3EIFA 1K7XB 1Z6XA 2W83A 3B48A 4J1QA 3WTBA 5AI0A 2UUAB 3DHNA 1C1XA 1WF6A 2GN1A 1XZGA 3E3MA 5GJVC 1XMOB 3SOPA 2FUKA 2YMPA 1JLLB 3REFA 3MK31 3IIIA 2DFPA 3QMVA 4HQNA 3LS2A 1RAIA 4H35A 5I9IA 1R9NA 1Z73A 1OUMA 4H31A 4MKGA 4S2UA 2ZB8A 1MCZA 1Z07A 1R0XA 1OROA 5DK6A 1HYGA 2ZPTX 1DPFA 1FDSA 1E3DA 2VJAA 2FFQA 2LTAA 2AOXA 2WVGA 3WIDA 3PQCA 3TINA 1FU4A 4ZQGA 2JAHA 1OH8A 5CHYA 1SOAA 1YIDA 2INGX 4ARBA 3TG8A 1DJQA 1J5EB 2Y2VA 3IDSA 4OXXA 2ZT5A 3MLEA 1JQDA 4CCYB 2BTEA 4CQNA 2FZCA 2CHFA 3FB4A 4LNAA 1RWWA 3QVVA 2WTAA 2PWZA 1JEEA 3NHKA 4LTNA 4ZTBA 3B2EA 2E7ZA 5LQMA 3HKBB 2RB5A 4HNSA 4IL5A 1ZR2A 5ALRA 3U0BA 2JFVA 3VJRA 1NQ5A 1Y81A 1XP8A 3EPPA 3C43A 4A8JC 2PGAA 4OH7A 1NBAA 5DRTA 1K5DA 1J8MF 1CS0B 1XTJA 5E9AA 1DE0A 5I9TA 2V7UA 1D6SA 4PAMA 1AGXA 1ZW6A 3LL7A 3P20A 4PPFA 3SJAA 3QFSA 4M9SA 4TTQA 1P2SA 4W8GA 5EMMA 4AUKA 1R16A 3DBIA 5FYQA 5AVKA 5AUOB 5JHGB 2BC9A 2WTEA 2JAPA 3ZDXB 2WIKA 2GSWA 4B4KA 2F8SA 4J03A 1GSHA 1I4LD 4RHYA 2QMEA 4GMKA 1NI4A 4Y2TA 5DTRA 3EK2A 4QVKA 3RLIA 1W59A 4KUEA 3JD2A 1I4WA 1MX5A 1IZ9A 4AZ3A 4I81A 5BT9A 3Q40A 1IDN1 4LJLA 3QOXA 4YRNA 4JL8A 4MVJA 3WGJA 1J3UA 1XIVA 5DHPA 2IEGA 3KKOA 3OEHA 3V4RA 1XWOA 2QZ9A 3INRA 4J1NA 2IS4A 1QTNA 3AEQA 1XYGA 1Y34E 4LA4A 3OLCX 4IXNA 5GP1A 3SM9A 4P58A 4Q12A 4QREA 2WPNA 3MMZA 2P5UA 1HOTA 4CV2A 5C80A 1NUTA 3A9SA 5H68A 1E69A 4OL9A 3B1FA 1KYIA 2PX8A 4UM5A 1T8PA 4NCJA 4P93A 1MV5A 1M6WA 2Q50A 3WNQA 3W7VA 4ICIA 1QCCA 1SM4A 2EKPA 1LH0A 1TD1A 3PT9A 1RI3A 1MH1A 2V7XA 1D6MA 3TTYA 4I6EA 3EIQA 3ONWA 1W2HA 1YBMA 2C54A 3VC7A 1GRRA 1LTKA 2CXPA 1F2UA 2ZRAA 2FTKE 4WCFB 1UC9A 3BE4A 4ESOA 1AKTA 3ZUGA 1FZTA 1XRQA 1XZDA 2B1RA 1II0A 2FSUA 2JC3A 2VJCA 3Q5EA 4FJ1A 1DXQA 4FSHA 4DEVA 4YCLA 1ONSA 4KV7A 2WIGA 1HK7A 4NL4H 3ENNA 3OLYA 4QJ4A 3E4CA 4NU0A 3D4OA 1IUOA 1HYEA 2AFIE 5F2KA 3HCWA 1QFMA 2ZRJA 5JJBA 4DDKA 1KY4A 5JH7A 1B6SA 2EKBA 3AVPA 4L51A 4TMTA 4RTNA 1C3LA 2OCAA 3O1LA 3UTDA 4FMDB 1D7OA 3HN7A 4XQEA 1YZYA 1IZ0A 2I4IA 1ECCA 2X0JA 1X77A 4P7FA 1JR2A 5EYPB 3RKUA 2DFVA 2WU1A 3ELBA 3IOCA 2Z5LA 4KLCA 3TK1A 1UOEA 4DREA 4E5SA 3GLSA 3KXDA 3MJFA 4W9MC 1N4DA 3KPYA 1H2FA 4FZ3A 2VSYA 4JQYA 1FXSA 5H1YA 4WJZA 2Y1EA 3BE8A 2IL1A 3X1MA 3ORSA 4Y2QA 3D8UA 2J08A 4YJ3F 1XEXB 4L78A 4Y30A 4CFZA 5ADUS 3C3EA 2O8CA 1G21E 2Q6VA 1GNVA 2OK8A 1BQ3A 4C01A 1X6VA 1ZN7A 2BEJA 2ONKA 2ZSUA 3PR2B 4A1FA 2XDYA 1E9FA 1RRKA 2L17A 4Y6RA 1XZIA 2H4FA 3U3KA 2AG0A 3DB1A 1T2CA 4F1WA 4NU6A 4MWZA 2LW7A 2VSQA 3VZSA 3UM9A 4P3YA 2QLLA 4B71A 2F8LA 1F8FA 1KPGA 5AK0A 3HUTA 3IBCA 4JDPA 2UZ4A 2I6SA 4AURA 3K8QA 3K9NA 2I6GA 5TY0A 1U7TA 3TNYA 1NUPA 1SHUX 3KT6A 3OZSA 4J43A 1NN0A 3B1KA 4KX5A 4DQVA 1VGRA 1U8XX 2AFHE 2VT6A 3CNEA 4QGFA 4RH3A 3UYKA 4DIMA 3WP0A 1QG4A 4DQXA 4AZ3B 4X66B 1EFTA 1BX0A 3H0CA 2Q3BA 1GPMA 2G9QA 1O8BA 4LCBA 5HR5A 5LUAA 4FW9A 3Q41A 4NZPA 4MUMA 2G1AA 1KJIA 1PL6A 2GXUA 3P5BA 2Y66A 4A8TA 3DULA 4AJNA 1QZ3A 3FMOB 3ICWA 3UB2A 1E2EA 3LP5A 4EJFA 3GQVA 4B6PA 1BWSA 1RVV1 2HHCA 2OTCA 4ZVNA 1Y4SA 1WZCA 1KKLA 2VYQA 4DCCA 4DCUA 2JK1A 2E3JA 3V8VA 2N3ZA 3G85A 2PM8A 2VF8A 4PZ9A 1P2BA 4KIFA 1BWQA 2C03A 3HV2A 4DA0A 3TW6A 4QA9A 1GTMA 5FUWA 5TGTA 3E9YA 4CMJA 4LF6B 1JZQA 2GAIA 3LVFO 4TXHA 2JG3A 1F7UA 4DBZA 2QUBA 5DI3B 4OUDB 1XROA 1G5RA 2YN2A 2JGAA 5AXAA 1Z8NA 4TRNA 3ZD9A 1CY4A 1GRNA 4M1QA 1JSRA 1EGMB 1NPTO 3P26A 4HMQA 2GXQA 5EKSA 2FMKA 3OU7A 4TWBA 3HVRA 4NU8X 4KLZA 4ACBA 4BVEA 2YY7A 3KTOA 4P3XA 5BN4A 3CZRA 3AFNA 4KVGA 3MINA 2V6BA 4K9QA 4BV2A 2EG9A 3GZ4A 3ZGOA 3CUVA 3G79A 3KQQA 5CEEA 1P0PA 2QR5A 3OUUA 3QP9A 4DSOA 2CLHB 4QU8A 5SICE 3MT0A 5DYIA 3NTLA 1MB9A 3W3AD 4FFPA 1O9HA 1AT1A 4WOKA 2TMYA 1MQAA 3HO6A 2NUAB 2IH4A 1HX7A 1PR5A 3LMKA 4QRHA 4LDZA 3K70B 1OPXA 1NIPA 4OF4A 1QYWA 3B20A 1Z0ZA 1YFMA 2QMHA 3BGDA 4JL6A 4JLDA 1LBQA 5C7OO 1NNEA 4RA6A 1JDPA 2XMSA 3MRXA 4LJYA 1QX3A 4M8SA 5GY7A 1V11A 4TMVA 1A0OA 1J7JA 2OBYA 4UHEA 5C31A 3CJRA 3WLJA 1UBHS 3ZKWA 1G5IA 3DXZA 3F2VA 3ZXXA 3KOYA 4BV3A 4IS2A 3RASA 3EDOA 1CP2A 5CXQA 3U17A 3UT0A 1X1TA 2NU6B 5J40A 2XT6A 1XRJA 4G63A 5IULC 2BTOA 1GPJA 4J91A 2O8CB 3QU4A 3BJMA 2WKSA 4AMZA 2J5XA 1VBNA 5ICCA 4PYJA 2YV5A 3LUAA 4M1TA 5B30A 1YVDA 4MYTA 1KYQA 3L6CA 4HC4A 3EF3A 1RQRA 3A4MA 3KCNA 3LVBA 1CG6A 3SC4A 1TT7A 2FSPA 2FPIB 3DM5A 3MMPA 4ID9A 3C1TA 2GUWA 3OETA 1C4WA 3ZV4A 1TW2A 1XWIA 2RHOA 2JJMA 4EB6B 1NUHA 4OOFA 1NXTA 1A8PA 2ACEA 1DIRA 1NZJA 4Q3LA 4B7XA 4UDYX 5KYGA 1HE5A 1T6BY 1KJ9A 4GLJA 1RJ9A 1T9AA 1EAMA 2PD6A 3UH0A 1YE8A 2IYWA 5AKIA 3S44A 4RQUA 1SU6A 2EKZA 1AV6A 5EIBD 3FOBA 4GM0A 3DGEC 3FNQA 1A5ZA 1SBZA 3QKSA 4LZNA 1Z4QA 1Z37A 2HJVA 3BMCB 2BBOA 1LU9A 4HXGA 4K05A 3T3GA 5FBHA 4BL5A 1Z3CA 4NEQA 3CKYA 3T1TA 2PUBA 1IH8A 1MG0A 2UV8A 3OHSX 1CW2B 2BM8A 2HZ7A 3S7TA 3EA0A 2VAXA 3FZYA 4PC6A 1OAOC 1T9ZA 1U5CA 2R66A 3CNLA 3KHUA 2GPSA 1FSFA 1YRHA 3NWOA 5EEHA 2IV2X 4BO4A 2NNLD 5HGXA 2XYHA 1YQDA 2D0DA 1YFKA 4WT7A 4IFIA 4EG3A 1J70A 1LA2A 2C88A 4OJQA 3DMRA 5EP1A 5BMVA 1E94E 2A8YA 1F5NA 2IOFK 2IPOA 1DX4A 4EZEA 1UPXA 4ZT3A 4CLRB 3BIJA 3S0JA 1YCDA 3RC1A 4N9WA 2VHYA 1UCFA 1WNFA 4OEHA 2IUFA 4W6ZA 3UUEA 4LGYA 4I6GA 1TLLA 1E2DA 5TQJA 2VNHA 1RZRA 1ZK3A 2FWPA 1TJWA 4I8DA 3F6SA 2ZIVB 4LVOA 2PJUA 4LKOA 2FA9A 4B84A 4DWOA 4JV5B 3HDTA 3N7TA 3HO1A 3VYVA 1TJNA 2J67A 4FOTA 2IXFA 4IYRA 5KNCA 1HQYE 1TVMA 2IHNA 3FVVA 4PR3A 3WGGA 3RD5A 2C7PA 3KOMA 4XWAA 3TOSA 4KE9A 2CDAA 3L05A 1TKCA 3M5DA 3BSWA 1Z35A 3HRKA 2EP7A 1K7FB 1LDNA 4OHUA 4B7AA 1L5ZA 4E7PA 3Q8MA 2PWBA 4GQIA 3RC3A 1HEIA 1FP1D 3QX8A 2I5PO 3GLIE 4HDSB 4FOLA 4UDNA 3GLTA 4UUPA 3WA6A 2K5UA 4BEWA 4PNEA 4MYCA 5BWNA 2ZJ4A 5BSGA 5LFAA 4OU5A 1Z3IX 3V4SA 4EOGA 5P21A 4HNHA 1LK5A 1GD1O 2V8OA 4LJ7A 1GZVA 1Y3FE 3G17A 3QFTA 3AHDA 4NQRA 4Q3KA 4DCMA 1NQOA 2J32A 5J4KA 3FPHA 1NI5A 4TGLA 1ULZA 3F3YA 3HUFA 1RQNA 3U81A 3ZCTA 4LRQA 2X40A 3C6BA 3EMBA 3DEYX 3EY4A 4R1SA 1IN8A 4R8LA 4Z7JA 1XL0A 1OI4A 2QF7A 3UMCA 1UPCA 2HLPA 5CFMA 2O2ZA 1A8SA 3JASB 4HWGA 2Q8QA 3MOGA 4UKDA 4RF3A 1N6RA 3GRPA 2VUHB 3NBZC 1TU3A 3EJWA 2XQJA 4HMOA 1HLDA 4FMCB 2WJVA 8GPBA 1D7AA 3FG9A 3JRWA 3LOPA 4GQAA 2PXCA 3N75A 1DTWB 3RBXA 3WK6A 2AI1A 2Z98A 5C8YF 2YNMA 1M76A 2FR1A 2QG6A 3ZDDA 5J2TB 1FSGA 2DY0A 3R0ZA 1L9XA 1R6AA 1LSSA 4TT3D 2YRFA 4WKCA 3S28A 4BFWA 3OWOA 5E1MA 2DUJA 1J24A 3FVWA 3MWLA 3U31A 4XJVA 5JU6A 3COSA 3IB6A 3PXCX 3W8FA 2C9OA 5DGXA 1AXRA 2WINI 4BZXA 5JBNA 1CUVA 4LDNA 4G4IA 4WD3A 2IDZA 2GF2A 2PUTA 3LC1O 1PTJC 3THWA 3RIYA 2PRZA 3QRWA 3U9TA 3T3OA 2ZEJA 4BASA 2YZ2A 1V8ZA 2WHEA 2X7JA 3H9GA 1AXGA 3JV7A 4AJ4A 5JQGA 3DBVO 3HCAA 4W99A 2YX1A 3M5WA 2V7PA 2YDXA 1EWRA 3PGXA 4L76A 3H9BA 4EGFA 4YA6A 4GX0A 3H1BA 4CMIA 1MEOA 2WIJA 3NEJA 1NYRA 4L57A 1V2GA 2QUJA 2I7DA 2O2XA 5GPBA 3CKMA 1UOOA 5KX5A 3P0HA 2Q45A 1PRYA 2OY0A 4IFTA 5K0NA 3ZNOA 3TKAA 4EKEA 1QRRA 1BCSA 3PC4A 1NJ8A 1USUA 2ZSKA 4DHEA 5JWOA 3RSHA 4CCSA 4URVR 2UZ1A 4YRZA 3I73A 4CKWA 2GMWA 4M9XA 4XJTA 3VJLA 4P4NA 3GPBA 1O94D 1P75A 2HDOA 3K8OE 3O4VA 2J1LA 1CUBA 4Q1CA 3IVXA 4U7GA 3HDVA 4QU0A 4UPVA 1Z0IA 1EP1B 5G0VA 4E0BA 5DCWA 5K45A 4CGYA 4PHFA 3KE8A 3COPA 2O8BA 2EWVA 3WJ1A 4DV5B 3NBFA 4PYKA 3WQQA 3O8BA 2EZ8A 2ZKLA 3A0RB 4WXRA 2WOJA 2JLXA 4KC0A 3KSDO 4HADA 2WICA 1THZA 2PKWA 1M2WA 2XUHA 3H1PA 4KAAA 3LO5A 3NCTA 5DASA 3IESA 3TJMA 4Z9YA 2BRUA 1EK0A 2HMSA 3QVJA 1BHJA 4O1IA 3DOCA 3UAOA 4AMGA 3QXXA 5EGNA 3SQDA 3TRJA 2NV0A 3BILA 3K4HA 4IX1A 4JYCA 3DZFA 4KWHA 2G0TA 3D3KA 4B48A 3EQ2A 4KXQA 3L7NA 3MUOA 5BO5A 4WKGA 4IDPA 3GEBA 2ATIA 4J75A 4KK4A 2HMUA 2PKRA 3FJ1A 4XZ3A 2ZIXA 2ENUA 3FCXA 2ZVQX 4MWEA 3VVMA 3OIFA 2Q5EA 1N0WA 3UOGA 2RGGA 2PGJA 2Q1WA 4H17A 1FURA 2QLJA 3ZW8A 1TFRA 2X8JB 4CDMA 1NLZA 3EPRA 2WP0A 4TMFA 4AMBA 4ZI2A 4UUAA 4IH4A 4WZBB 1N92A 4Q7LA 1QQ7A 1XPJA 3II6X 3RHZA 1PEKE 2PV7A 1I7LA 2UDPA 2HTEA 4YRQA 2W6QA 2ONCA 4C7JA 2BBSA 1ZOLA 4UEQA 1R4ZA 4W5NA 1ADCA 1XMVA 3AILA 4OYYA 5HTOA 1VE1A 3IRUA 1OU0A 1XQ6A 2VDRB 5AKZA 1P6UA 3PNYA 4JENA 2YHAA 3IT0A 3E2PA 2ZYTX 4HX9A 4OMFG 3HA3A 4ABYA 4P7KA 1NWCA 3LYUA 4DWVA 4W8OA 4HN2A 4O4JA 3HB7A 1R0LA 1L5NA 1C9KA 4QXQA 3HVKA 4LRYA 3T4PA 4AY6A 3IIEA 3GLGA 2C4WA 2PUWA 2ZBDA 3A4LA 3QNWA 4MMXB 1J97A 1Z5NA 2NADA 1WIWA 3G13A 3QFRA 1B0UA 4NOJA 4MTCA 5HGJA 5JMPA 3ZWAA 5L3SB 2OE2A 2PX0A 3GJYA 4ZVOA 4HGRA 3JYOA 3PFBA 4C4TA 3FOFC 1JWLA 1T43A 1CJUC 4KJZA 3U62A 2E37A 5HF5A 4CPDA 3LF2A 3HFJA 1LPNA 1W4LA 4TLDA 4A7PA 4CMHA 1E89A 4D6XA 2O9JA 1NVMB 1T1JA 1PTKA 2RGYA 4B6RA 3IP9A 4XUCA 2W2TA 2VA9A 4ZGGA 2WYIA 1OT3A 2QJFA 3KEFA 2G1KA 2XCLA 3D7RA 4QJIA 3ZE9A 3SXJA 3TZBA 3BX1A 1A88A 2R96A 4AXBA 5JMTA 3SWWA 4Z1OA 5IJ0B 5F4ZA 3MTBA 2XYGA 3HU1A 5JYCA 4QGGA 4MV0A 4NDAA 4Y2SA 3W5CA 2YXBA 4OKNA 4XB2A 2BFDA 3P32A 4GPTA 4A26A 1OFGA 2I99A 3TZEA 4H4CA 2CF6A 4U3JB 2QY9A 4PX9A 2GI4A 2PBFA 1HXHA 4WHMA 4ZI3A 2F9FA 3JWHA 5HZGA 4WZ6A 2FFAA 2PJZA 4HV4A 2IEAA 3U5ZB 2ZAOA 1B8VA 1K92A 4LQLA 2ZSEA 1A3CA 4Q3NA 4JI1B 4MUJA 1YD7A 5DEOA 1SCUA 1T24A 4RY0A 2OFFA 3P4XA 4R84A 2CSUA 4C30A 5HK9A 5DSTA 4GXQA 1XRPA 1JH8A 4MZXA 2BKLA 1SCAA 3I28A 4FNAA 1E2MA 521PA 4BFSA 5KWJA 1X7GA 2PNFA 3I45A 1DT5A 1CJSA 3RGGA 1IBMB 1R8JA 2PUVA 4EJSB 4JBYA 3IP8A 2JFNA 1UZAA 2ALJA 4NH0A 5F73A 4AP5A 3S70A 2GPJA 1I6KA 3F74A 2IV7A 4D3YA 4Z6KA 3EDQA 2VWGA 3NV7A 4Y3UA 4O1HA 3D59A 2ZIXB 4O2BB 1JHMA 1MABB 2VDWB 2HJGA 3QBDA 4K46A 3WRXC 5B55A 1UFQA 2D28C 3DUWA 1BD4A 2CMDA 1DGQA 2DMRA 2VHWA 1T9GS 4X1YB 2YFQA 1HEYA 4NPHA 4WNAA 2GPYA 2X14A 3RSOA 4OLFA 1KSHA 1LW7A 5T8KC 5GIPE 1XCMA 4WGFA 1JZSA 4UJ5A 1UK9A 3DCYA 4QFCA 1Y6JA 4OMUA 3BMXA 1TMOA 5EZSA 5IFKA 3TJZA 4FPXA 2V3WA 4ESEA 4YPFA 3UUWA 2IEDA 1YMUA 3ZDQA 2O0KA 2H08A 1B26A 2IF0A 5DNVA 1JR3E 1I4TD 2DQYA 3LW8A 5B6JA 3WGQA 2BBTA 1CR6A 1ZN8A 3I8OA 1YQUA 4BRZA 4LVCA 1QO0A 1DWQA 4L75A 3PP8A 4Z3DA 3VPSA 3RAEC 3PHBE 2C8KA 5JD4A 3AL3A 3GCZA 1NLFA 1XZLA 2BE9A 1NNI1 3VZBA 1J0XO 2AOUA 3RRNA 1J99A 1LTQA 4FOOA 3N58A 4YV0A 1HFEL 5DTJA 1FX0A 2NZJA 1PWHA 5C34B 2NXJA 1T2UA 4D57A 3VKVA 1MJNA 4UPDA 5AW1A 2ID4A 2GPNA 2OB1A 1K68A 4H2DA 4LYEA 4RSHA 1WWKA 3VVCA 1V4NA 2ENWA 3E0QA 3MUNA 3TR0A 4S1PA 2X6RA 3UMYA 2QN1A 4EYEA 3FNIA 3LFHA 3LT5A 2CV2A 4RZHA 3IAEA 2HIAA 2PZEA 4NFHA 3VYWA 5KYYA 3GMIA 1QH8A 4QDJA 4WSOA 4OJKA 3O84A 2HWYA 3ZS8A 1A8UA 1TJYA 5J2UA 4M7OA 3OICA 5ENDA 1E1QD 1SG6A 2J09A 2NO6A 2EBWA 1L7OA 3QI7A 4EPXA 5BR1A 2O6LA 3EF0A 4XUDA 3M4XA 2WHPA 4OBWA 4UU1A 1E2UA 2WAAA 2LNDA 4KQ2A 4DGQA 3O8RA 3NIBA 4EAAA 4GKAA 4YDSA 3QV2A 4D56A 4JLOA 1YR3A 3FTQA 3GJ4A 2RIRA 4G3XA 2IOFA 3A25A 3QVLA 4PRZA 4U2KA 3D64A 4FLFA 3ZX4A 5IAEA 1YR9A 5CDSA 2SKDA 3U3DA 2QG9A 4EATA 1TLFA 1Z6AA 3OE7D 3LUJA 3NYQA 3QEJA 4PRYA 1NX6A 2HJHA 4KN9S 1NBWB 1E3JA 3NUZA 1N77A 4RMJA 2HREA 2AXEA 3UXYA 1OBCA 3RAJA 2HLNA 4Q4CA 1VKRA 3WLMA 5B6PA 3FBGA 1E61A 4NIMA 2RDMA 5IZCA 1TC2A 4HYEA 3X1XA 4QGSA 4WN9A 1N0IA 2X15A 3AR9A 3CJTA 3MELA 4ZOCA 1J2UA 4E4YA 2H4YA 3LUDA 3ISJA 5CG2A 4EL5A 4EG5A 1E1LA 3IAS1 4IDEA 3ZLVA 5ALYA 2QAIA 1DTSA 1NW4A 1RKVA 2QQ5A 3AV0B 4E94A 3RT7A 4BXOA 2PMEA 2C2BA 3I76A 3RUDA 3EZFA 3CLTC 3VU9A 1P5ZB 2BFNA 2HRDA 3EWNA 3ZH2A 4ZI7A 4ESVA 2CFIA 2CXUA 2N0SA 3HJTA 4BB5A 2PLAA 1MFZA 4OJNA 2F43B 3JARB 1IJFA 1NUQA 1CJTC 2NXNA 1OB2A 1RLTA 5L3RA 3U7FB 1U8YA 1XDSA 3ICCA 4NCBA 1ZA1A 2ZUVA 1OWOA 1WM1A 2RARA 3EW7A 1HBJA 1B43A 1EIZA 2A86A 3ID6C 4MXDA 1QYRA 3E7WA 4ED9A 4B7ZA 3AP1A 3B53X 2D54A 1TYEB 1ZVQA 4QUGA 4NCXA 4C6HA 1QIJA 4Z86A 1MAHA 1HDXA 2JGDB 1CC1S 3GD5A 1KL7A 1E5DA 3OZDA 3IBTA 4PYQA 3RUAA 4BLSA 4EF6A 2OHHA 1IJKA 3EMDA 1PGOA 1XZ8A 3D5TA 3DBRA 4AZVA 1KEVA 4YK7A 5DHTA 3U4AA 3VX3A 4FYMA 4TQUS 2AK3A 1R6XA 2NQTA 3VR4D 3TWOA 1WPGA 3N5CA 4Y9RA 3SDSA 1P81A 3R5SA 4EUHA 2BMVA 1JQEA 1ZJ6A 1A4UA 3UJ8A 1H85A 1B41A 1DXYA 1RXCA 2OZVA 4LISA 2FSSA 3NC1C 3P94A 3UXEA 2JANA 3W2HA 2UU9B 1LF0A 3AVUA 2X8LA 4PZUA 3PQFA 2PUHA 2PGDA 4TUYF 4DYVA 1GTJ1 1NMQA 4IOJA 4EITA 3ZLJA 1MKYA 1ZEJA 5EJ8A 4XQCA 1NXQA 4JH0A 2EW1A 1PVOA 3DO6A 3DVSX 3CH5A 3NO4A 5AK5A 3LIPA 2ZYGA 2V8BA 4NCAA 1OILA 2VJKA 4DIEA 5CFPA 3QKRA 1CF2O 2PRYA 3QU9A 3VAYA 4CXMA 1MJGM 1VECA 3DL0A 3P2OA 3PF8A 1Q0LA 3AEYA 4LHWA 5FORA 1U2DA 2OBLA 2P2YA 1PHPA 1G7CA 1COWA 1C3VA 2OHOA 4HFNA 3LJKA 4Y2RA 2CVQA 3QVOA 5AMXA 1SN7A 3UWDA 5EHIA 1G9SA 1W1IA 4DM7A 1GTL1 3MYYA 1JSZA 4YGXB 3WI7A 5EIXA 2WV7A 4RHUA 3HVHA 3TTTA 2AFIB 2Q8PA 5AVSA 5I7VA 1QBKC 3DE0X 3QMPA 4KB5A 4XI9A 5CDUA 3KYCA 3U7QA 3PRYA 3WWCA 3N86A 1MXFA 2G6BA 1PJBA 2WT9A 3ZCPA 3SKYA 3UA4A 1TO2E 2CMKA 4PZPA 2H4XA 3H13A 3PGA1 1A27A 3ZWBA 5G4KA 2PQ0A 4JOQA 2I29A 1CZUA 1B7GO 2WMYA 1EFAA 2MYUA 4BBAA 3KQOA 5JECA 2WD7A 5AJUA 2DRIA 1BMDA 2FRDA 2AZTA 3RE1A 3ZE1B 4ZMRA 1KY2A 1YOBA 3T7DA 3AR4A 3LAWA 1NJ6A 3FSGD 4KVAA 3JAMA 4BXOB 3STYA 1DOHA 1ODKA 1JQLB 1L1QA 1U1EA 2DWCA 5ALSA 2LRHA 1E3IA 2RKWA 1YS1X 3G8CA 4O0MA 1N25A 1ZHHA 2JIZD 2QN9A 4MRNA 1D2EA 1X9IA 2O3SA 1G21B 1LWNA 3HY4A 3HJUA 2VUSA 3ZYCA 1YR7A 5E2IA 3OX4A 2I3DA 4O4HA 4HAVA 2WVHA 3WADA 1YKGA 3L7DA 1H9CA 2ZTHA 3QE2A 3NBQA 3GZTB 3PUIA 3U7HB 3Q5GA 3HB5X 4ZZIA 2BGIA 1CEQA 4A2PA 4Y1GA 5A6SB 1N9GB 2PH3A 1C8BA 1UKAA 4E13A 2JI7A 2ST1A 3HVJA 4U5QA 1X1SA 1RIIA 1Z39A 2P6PA 3F4SA 3C1UA 2BUBA 3M3DA 4ND1A 4QGBA 3TLYA 5IPFA 1HE4A 1VIVA 2HLDA 1GUZA 4IG4A 5DN6A 4Y1RA 4RDIA 1UBJS 1CT9A 3NP9A 4BLOA 2UVPA 2AFHB 3X3HA 1RMQA 2H7VA 1S9DA 3COWA 1H2HA 3O31A 3A8TA 4GR4A 4N40A 4OOEA 4RH0A 2VHUA 4GOJA 2F1KA 2CC2A 2QYOA 3ZGNA 1ZK2A 3R0QA 1J8FA 2GD2A 4W1PA 3DMPA 1OA0A 1V2HE 4ZDWA 4PXAA 3IUPA 4BKPA 2JHFA 3PA6A 2BFFA 3IELA 3OLWA 1IHPA 3MB8A 4I1IA 2I34A 5CH3A 1PZXA 1C30B 1UPUA 4UVIA 2ZANA 5THXA 1KDRA 2FK7A 2CL0X 3R6TA 1USGA 3ZE2B 1JDJA 3QYAA 2CL6X 1D1TA 1F0NA 3E5RA 4RJLA 4AL4A 3T3MB 4PIMA 8LDHA 3CZ4A 3I23A 5ERYA 2NSLA 3P0JA 1UJ6A 3R2JA 4J16A 3I4CA 2XF8A 4GXTA 4QOEA 4MIKA 4BKUA 5C8ZA 1RC1A 3H4TA 4I5EA 3AKZA 3CQ9A 1F4LA 1QRSA 3FOZA 3NNNA 1V1JA 2FF5A 3ZVKA 3FTDA 4OREX 3E9NA 4CKEB 4GKKB 3AWIA 5TQ2B 3C4VA 3EXAA 2FQQA 3SM3A 1O0BA 4AJLA 3V8PA 1G1MA 3RSCA 1LJLA 3FBWA 4V0ME 1DIGA 2FP3A 4B3SB 1UFVA 1IHXA 4B4WA 3OZBA 3NXKA 1C9DB 4WADA 5ALFA 3IPLA 1POWA 2WK1A 4DIFA 1XAJA 1RP7A 3D3WA 1D0VA 1KPHA 3TQHA 4WUVA 1JR6A 4NH4A 5A4KA 2JGLA 4AUNA 3ETLA 1SXGA 1PL8A 2BEUA 4R71A 1S2MA 5LIRA 2BDTA 1DRJA 2E4UA 2R68A 5THQA 5BVGA 1NG9A 5HMMA 4LW8A 1ZD9A 2NYRA 2VF7A 4TV8B 3WYAA 1PD1A 1GCIA 1XD2A 1EGHA 1BFDA 3DW1X 1ENYA 1PJCA 4FDAA 1Q83A 4F72A 1A9YA 2YIVX 3LDAA 2DFNA 3KUUA 2XLCA 3Q9NA 4OGWA 2H65A 4X7PA 3THRA 5A5FA 4DTIA 3T3HA 1HZZA 3O8NA 2HPAA 3KOUA 3F90A 1OLUA 3WYGA 1JHQA 3E15A 5BYKA 1TZKA 4KH0A 5UKDA 4FIDA 4EL0A 3EUEA 1MQSA 2HRZA 1NAIA 5AQEA 4F3YA 4APBA 2RCNA 3A26A 1I1HA 3C2QA 5KYTA 2X9VA 2H9AA 2QPOA 2W43A 3ODGA 3DZHA 1KAOA 4UVHA 3ROQA 3DWIA 4DLSA 3PG5A 5KTKA 5C7YA 3U44A 5LMCA 2I54A 1Z4IA 2FKAA 5JEEA 3UEOA 1RJDA 3PEEA 1P8JA 2VO1A 3UG6A 4PBTA 4C4XA 2DU8A 4RA9B 4QIHA 4CFYA 1E1YA 2CD7A 4IIBA 3W6ZA 2B3TA 1SK9A 2E18A 1NMEA 1XTUA 3EOAI 3G02A 3OPNA 2VZLA 3BS4A 3L7KA 2C4VA 2H57A 2UYYA 1KE2A 1N7IA 1JAIA 2ZE7A 3WRWA 1R0YA 2G77B 5K3SA 5C1BA 1ZKMA 1MX3A 1XDUA 2B4QA 2NGRA 4MK4A 1ZXLA 2BFEA 3IVAA 2GZDA 1RCFA 1Z7GA 4HB2A 4K3VA 4Q7KA 2BFFB 4H1HA 4I1YA 2OWEA 2PMBA 3T52A 4L0QA 4R2HA 4FCWA 4I19A 4S05A 4MX8A 5CA0B 4U39A 3CLRC 3EZ7A 3KJEA 1WSWA 3IR6A 2FDCA 3EH1A 2EARA 3BFVA 1YBVA 3MEQA 3DBLA 4JL5A 1T26A 4OHYA 4PICA 1XHLA 1ODJA 5KQLA 2ZQYA 5F5LA 4CT0A 1C2YA 4RZSA 1CVLA 4FGZA 4ZZ1A 5LZ4A 2P9ZA 3CW2A 3JYNA 3DEIA 2D7CA 5L53A 4RTOA 1Y1RA 1XJWA 2I4LA 2QROA 5JVDA 1II9A 3AR5A 1AO0A 4EGAA 3G2IA 3LHIA 1R88A 4PU0A 1E2NA 1LB1B 3FCOA 3ETGA 3NDRA 2QRVA 2YXNA 1EWYA 2GD1O 2JEYA 3E1KA 1U0TA 2GN4A 4H7JA 1TM5E 4LWQA 4PAOA 4PGFA 3UJNA 3MF4A 2A1TS 1QJCA 3CH7A 5KKCA 1UJMA 1GNSA 3O4HA 4RJKA 3TMAA 1Z7EA 3AH8A 3EGXA 3JQCA 4HI0E 2WSYB 3CMMA 4N7JA 1TAQA 3ACBA 4OL0A 1IQPA 3RVDA 5BXYA 3L07A 1RLOA 3NANA 3ZHBA 4H7HA 1YOVB 5HJ2A 2VI5A 3VDQA 3OD1A 1R6BX 1GGJA 3GA5A 4DDUA 1A9RA 1CUIA 5DYTA 3DYIA 3RK0A 3GLIB 1TB4A 1XZEA 3OHMA 2ZTMA 1ZL0A 4Q47A 2A0WA 3S2FA 1G8GA 1O2DA 2HH9A 4ZZ3A 3TFWA 3H8WA 1ZSYA 1WD5A 1RTKA 4MQMA 4N01A 4ARCA 2AE2A 2GN8A 3EW9A 5HP4A 1KTVA 4QQFA 4MRSA 2L18A 3QIVA 4ARUA 3AHGA 4JR0A 4LOJA 1Q6YA 1R9JA 2OO7A 4L08A 3RVKA 1QP8A 3NVMB 3R0IA 3ZXUB 4CM3A 3H6HA 3D1JA 3HY3A 1QE0A 2EX1A 4HDAA 4K5QA 5AJTA 1NXOA 2R8EA 1S2GA 5F3RA 3WLEA 3WYCA 1OXSC 4GOOD 3QNMA 1A8IA 1TCCA 1U0JA 4HO1X 5ED0A 5K2OA 1W46A 3R3UA 3HLTA 4D44A 2FEWB 4Q0MA 5HCUA 1IOLA 2ECFA 1KYXA 2RJOA 2QIOA 1WLSA 5JYBA 2ZJ2A 2XXJA 2W4IA 1MJFA 1ZW1A 5TS2A 1T1GA 3L9XA 1WTAA 2DGDA 4LMBA 4M7WA 4MRRA 4Q66C 5LBUA 4JLBA 1V3VA 4E33A 3DDZX 3MLAA 1UC4B 5CX1A 4OJTA 2M1ZA 1IB6A 3I3OA 1M1YA 1PWYE 4JOBA 1RACA 2OENG 1QAOA 3Q72A 1TZBA 5GINE 1W73A 4AYXA 4ZDKA 5HQ3B 4XGRA 2VT3A 4Y7CA 3EZXA 3M9LA 4LMPA 2ICAA 4F4HA 3OT4A 3FPGA 2CJFA 1DCNA 2EIHA 4HJXA 3N2KA 4IQ0A 3FYUA 1I0LA 4HPJB 2DKNA 4BWFB 2PUJA 4JLJA 5FNVA 1CUSA 4FDMA 1LS6A 3H2JA 5E2BA 3QU5A 4RSMA 2JH8A 1IY8A 1G4HA 2ZYVX 3KYDB 1MZVA 3AKYA 4M83A 4PS0A 4X1IA 4XSGA 3AF5A 3N3BC 2HCBA 4Z0TA 3FDXA 2AZXA 1AUVA 4RD6A 3GNTA 4RZIA 3AIKA 3OCCA 4YAEA 1GG2A 2O20A 1OFUA 1AKVA 2YNMC 3W9SA 4C0KA 5AJYA 3F98A 4R8KA 2OZPA 3IA2A 3EF1A 2IE0A 2O0LA 1F9AA 1Q17A 1RJWA 4IPTA 1EJ2A 4IXTA 1CUEA 1P2VA 2BHLA 2HCJB 3HBAA 2VWHA 4JLNA 3RS7A 1FTGA 3WLQA 1ZM4A 3AFHA 3F7TA 3PR3A 4Z9AA 5HK8A 1NVVR 1QFZA 3M1IA 2AI2A 4B35A 2EFCB 4PHTA 4E09A 2W0MA 4IGKA 1G2OA 4BMXA 2FWIA 1TTQB 2A94A 4UAGA 3ZZ0A 5GQSA 2O8EA 2HGSA 1UKEA 4H59A 4CKXA 3UHJA 3F6BX 4M1OA 1HSZA 2A30A 3CRW1 2XTMA 4ERNA 2QVCA 5EQFA 4BUJA 1K8RA 4MR7B 3T3PB 5A02A 5L6LB 1AKYA 1QGAA 1WU7A 1U3UA 4RV5A 5FWDA 4Q15A 3T5PA 1YR2A 3I05A 1L7QA 3UAVA 1I4EB 4P36A 4ROTA 3LHFA 4Z53A 5K6RA 1QXSA 2ETVA 4RGYA 2QNIA 2Q6IA 4JODA 3IR7A 3ILYA 4X8HA 3NTRA 5IX8A 2XZLA 3RFUA 4WFQA 5JOQA 1QF6A 3ESCA 1AS2A 1M7GA 3KZOA 1PEYA 1CQWA 1ODFA 1ESCA 2R8XA 2RKOA 4HH3C 4OA5A 3WWPA 5ADWA 1P7PA 1MR3F 4P33A 1Z0FA 2FUNB 3DVAA 4COKA 1OYYA 4XRGA 4YC7A 4HPXB 4Y2YA 3TL3A 3DT6A 4KREA 3I52A 4FFSA 4YAGA 5CA1F 1WDTA 3EDMA 1T25A 3HH8A 3SIPA 5MN6A 1LLQA 1ZVVA 4X20B 2H3HA 5HKOA 1JYEA 2EW2A 2EERA 4EENA 3BULA 3A1EA 4FYWA 1W5AA 1G291 5CJPA 2I03A 5MFZA 1WPQA 1OH7A 1U0FA 4X95A 1Z56C 4L8YA 3RFVA 3SX4A 1P18A 1VL5A 2HJRA 2OD7A 3M9WA 3ZVNA 2H4HA 2H1HA 2B25A 1WXWA 1N33B 2OV8A 1TCAA 3GG9A 3LLVA 3OPYI 3RAGA 5BP7A 4LJAA 1T13A 3WHPA 1QHNA 1SBYA 4Q24A 3OFND 4BNLA 4F3TA 1X80B 1CUCA 1JG6A 2IYYA 2ZZKA 1XR3A 3EVGA 3GFPA 5E38A 3SVLA 2UUBB 1NNUA 1V8DA 4BNFA 1E96A 3G1WA 1K2VN 2ZP1A 2OD2A 1MV8A 3M33A 5A71A 2PLFA 4TZTA 2CWDA 3UBMA 5KOJB 3KQPA 3QWFA 2QRPA 2ZOSA 1NURA 4QKQA 1P2GA 2AB0A 2R1TA 3MTIA 1RADA 1Z5PA 3KJNA 3STVA 3C3AA 4ZOAA 1K9SA 3Q7EA 3HABA 3K4PA 1Y3BE 2ORYA 3LIIA 4B8WA 1JJAA 3R3JA 3OAAA 4WZAE 4JBIA 3E6AA 1EKXA 4KIJA 2HNKA 4IHJB 3BAFA 4AIIA 2IHVA 5JSQA 5U9CA 2L2QA 3W5DA 4LE2A 2CLEB 1PK7A 2LDBA 3V42A 4DV2B 1W8DA 3TECE 3BC1A 5L7WA 3JS5A 1M2NA 1J23A 3NVDA 2W2OA 1U0EA 2Q4BA 3IE2A 3O3MB 4PZCA 1EGQA 3U6BA 4LMRA 1H2AS 2P11A 2PWYA 1NLMA 5K0FA 4QVGA 4LJ9A 2B1GA 4TKVA 1E1CA 2QL9A 3FNRA 4ZOLF 3OQNA 1JEYA 2C3YA 4X5OA 5T4FA 5LKAA 2JLAA 2XUJA 2OM6A 1Y9JA 3ILVA 2HIHA 3BMOA 3KUDA 1ATZA 1MEEA 4BNWA 1JB1A 4EP1A 5CB4A 4PLCA 3D6JA 1P9NA 3NM5A 1E79A 2K87A 1Y4ZA 5U1PA 2P6MA 2PMKA 4OA8A 2FWAA 2JI4A 4LPKA 3RG2A 3M8KA 2H92A 4M2LA 2GFHA 3WNZA 1JJFA 3HUUA 3UCXA 3VZRA 4A6XA 5BWLA 3RJ5A 1KGSA 1PUJA 1AMNA 1UR5A 2CXSA 4X91A 2FPLA 4CVNA 2WNSA 3LA8A 4OHFA 2GK7A 3CUEF 2Q5JA 2UYGA 3E0XA 4YREA 2XMGA 1U7UA 3PVCA 2CLOB 1Z22A 4RETA 3G2KA 5E2AA 3VR5H 4PM4A 3QVGB 4XPIB 3WGTA 5JFGA 2X0EA 4JUAA 2CZCA 4XVQA 3I53A 4ZYYA 5GJCA 1SKBA 3UXMA 1XDZA 3GGJA 3WTCA 3X1YA 1K08A 1UDAA 3C8DA 3Q8KA 2DFDA 5DCLA 3RANA 2CE7A 3VNAA 3RAPR 5JXIA 1IZ7A 2QW1A 2W2LA 3L0IB 3MJTA 1YO6A 2D3TA 4J0QA 1T4MA 1SWVA 1NNLA 3NBUA 3PA8A 1JAZA 2MSDB 3ZC3A 1QGOA 4CEJB 2ZATA 3V2GA 5CG1A 4E5MA 4UHCA 3A1TA 3KOZA 4JP5A 1F0KA 4FDUA 4XXHA 1TEZA 2R6AA 1KXJA 2XGSA 4KRXA 2HSEA 4YMIA 2BM9A 2OV2A 3DZBA 4B3HA 4D4MA 1UOQA 2ZIUB 2RHMA 1YTLA 3O3CA 1W0JD 5CT6A 5IK2D 4ZYUA 4N76A 1QB7A 2J59A 1ML3A 3H9EO 4L5AA 1R66A 2AX4A 2OBFA 2YXDA 1OFIA 1QHXA 5G3ZA 1ODIA 2PWAA 1OXTA 4M0DA 5JT1A 3BRWA 3JAKB 3L0SA 1XYYA 5KSPA 1EUDA 2WSSA 5CYFA 1TQ6A 1TIPA 3L2OB 5EMNA 4BPRA 1XNQB 2J3IA 1GL3A 4PCLA 1XJ0A 2OSVA 1QHHB 3GGDA 1RAFA 3KVNA 1ZICA 1KF0A 3LYLA 4RAOA 2XGGA 1ZVMA 3A4IA 1JA9A 3G1UA 4XVHA 3CVOA 4KKXB 2J9GA 4GPBA 3HA5A 4NYMQ 1XFDA 4N5NA 1PJAA 4MUBA 2H2FA 4KWCA 3WQBA 4R05A 1ZGZA 2YJGA 3ES9A 4ZTZB 3SF8B 1NFQA 1V3TA 1TM1E 4WXEA 4E14A 1SKMA 3GVXA 2DPLA 4GAEA 3OWXA 1K89A 2NSHA 3FHTA 5C51B 3B1JA 4YAIA 2J4DA 3TTWA 4J1SA 4IVQA 1S2LA 2X9QA 1Y7HA 2WAOA 3OOJA 3TMKA 3HDHA 2GEUA 2Z56A 1CNMA 3MAJA 4DADA 4DFDA 2C3MA 2B94A 3VKFA 2RE8A 2QN8A 3UGQA 2PS3A 1DO2A 3H5NA 3JQBA 4I5GA 1R0CA 1ZOSA 4DRXA 4NAVA 3MSCA 1OLOA 3A6HA 5DHFA 4S0ZA 5TVKA 3HCCA 4WN3A 1NQXA 2R1ZA 3RVQA 3T61A 4Z8YA 2R4UA 2EZUA 2G7ZA 1UMKA 4CKYA 3K0KA 5C1DA 2YVKA 2Q3HA 3B1VA 4H3HB 4EDFA 1U31A 1NW5A 3OQIB 3MCUA 2XECA 4LXGA 3H11B 2FJPA 1PJSA 5IBQA 5LR6A 1Z4MA 5LP6B 1PFYA 4QM6A 1DIHA 3PIDA 3NBXX 5ER9A 3U60B 4J0GA 4UXJA 5DKFA 3E61A 4J3NA 4G0WA 4QZVA 4QOJA 1FW8A 4TLAA 2FY8A 4WPGA 2IYQA 3U44B 1ZQ9A 3BK2A 4M1WA 1NDQA 4TWRA 1SEVA 3HXQA 3N74A 1NY5A 2WDZA 5EVCA 5KDLA 5CJJA 2FWBA 1L4GA 3GJ0A 2O2YA 3TPFA 3PTZA 3V4FA 5IM4F 2GRAA 1M67A 2XOEA 3F0TA 3SJ7A 4DANA 2CFTA 5G2OA 1X39A 2O3RA 4EVQA 4ZVSA 3B60A 2PVCA 4WA7A 1JUDA 2PZLA 2IZ6A 3P2JA 2J6HA 2WWWA 3RKSA 2KB0A 1K98A 2M6RA 3V00A 1XVAA 1E7WA 1IATA 3CLTD 3NYWA 3O03A 4R68A 3GRKA 5EE3A 5FFNA 1ZITA 1T9KA 5IH3A 1XZQA 4KSCA 4MWCA 1XQVA 2ZTSA 1NU8A 4I9HA 1HT0A 3PC2A 3R24A 5K9ZA 2E55A 2PH7A 2YYSA 3EBLA 2CXOA 1SXIA 4G5OA 5DULA 3W90A 1FE8A 1KVRA 1P0QA 2EQ5A 3DCIA 3H2KA 3MYRA 3OX1A 2AHRA 4MS3B 3T94A 4BATA 4BMNA 2X0IA 3IMKA 3TRDA 4BDTA 5K3AA 2A0FA 3HZHA 2WIFA 1XC7A 3VU3A 5CYOA 2OBBA 3I9V6 4AFNA 4M36A 1G5FA 1XA0A 2XDQA 4G5GA 3SF0A 3U13A 4RPIA 5EKUA 3T4EA 1OAKA 4D4HA 3UH1A 1DBRA 4TVOA 4DDMA 3UG7A 5IZCC 3KU4A 3L6UA 4O4LB 4HUQA 3R9XA 2IEZA 2IEBA 2XBLA 4NWIA 3THXA 5M29A 4MITA 2JCVA 2YFYA 1ICIA 1YWGO 2PZMA 3CWQA 4QVIA 4MTLA 4WLOA 1T5BA 1W85B 3N9IA 4IDNA 3A14A 3OZ7A 1G0NA 4YBZA 4F3CA 3FHLA 2IBSA 1LTHR 5CM9C 5IANA 4BNNA 5JWRA 3OUZA 4GIBA 4HRXA 4J0HA 4K87A 2VVTA 4C0QC 1MOZA 1ORVA 3GH1A 1QHFA 2ASVA 2PQMA 4QXMA 1JFTA 2JJ8A 1HG1A 3ELUA 3GIWA 2GSDA 4ZCSA 1R64A 2R65A 2RBKA 3TSWA 2A9FA 3P52A 4YPVA 5C4IA 2VA8A 5FT9A 5KDDA 4PLTA 1ZHFA 2KLBA 2YWFA 3QK7A 1QYIA 4PLHA 4CQMB 1AS0A 2WA1A 3FWPA 5T6MA 3HB9A 2PKQO 4JT9A 1TJUA 1XQ9A 2J5KA 1L8LA 2XW6A 4JT2A 4PFSA 4WEOA 4BNMA 5ED4A 5I9BA 1KU0A 3OEHD 1GEEA 5KTPA 4TLCA 3H84A 3DWGA 1H8EA 3MWJA 2R6JA 1FYDA 3R1IA 3I9KA 2VTBB 4BB9A 2NUTB 4NZ9A 4NV3A 1NVTA 2GUGA 5BSRA 4GQBA 1YCFA 2EHDA 4UM7A 3D6NB 2B20A 4BRUA 2XNDA 1E2FA 1PP4A 5H4HA 1GTSA 3L5OA 4LZZA 3EZ6A 4E3ZA 3FI9A 4JBXA 2HM7A 1D2MA 1QPGA 2GEDA 4WV3A 2HBZA 4DXDA 3STXA 1ZJ4A 2X7HA 5EP2A 2ONYA 4BNJA 1U16A 1UWKA 4LHEA 1EK6A 4ZPXA 2JW5A 1P4JA 3FGNA 3QX9A 2GA9A 4ES6A 3TIVA 2R7MA 4OB6A 4Z2YA 4W9RA 4UHKA 5EINA 2A0UA 1SQ5A 1E4EB 3AX6A 1LK0A 2QV0A 5F64A 3F8TA 1RU3A 5AKJA 4C76A 4EHIA 3G0BA 1HG0A 2XTZA 2REOA 1DRKA 2G04A 3GCDA 3IUBA 3QITA 4YJ3A 2NU8B 1R0BA 2IVZA 4DARA 2UYCA 5K01A 2ODTX 4I50B 3JQAA 4RIGA 4XEHA 4EHHA 2ARKA 2WJPA 3CT6A 1WEHA 3PUYA 5IM5A 1U2DC 1L3BA 4UCQA 5FBRB 1SU7A 4WLEA 3A58B 2H9YA 4PCVA 1PFVA 3R5FA 1JEJA 3WYBA 3VPBA 1MDBA 3ONNA 4ACAA 1T9CA 5DNYB 2Q6TA 3I5UA 4RHCA 5DTMA 3ZBTA 1YB2A 5L3QB 2QYHA 3K2QA 4GOXA 2FJ0A 1VP3A 4YO7A 3NTXA 3ZU3A 4DNFA 1YR1A 2VUTA 4IDQA 1RPJA 2Q3CA 4G23A 4AI6A 1D1SA 1UT8A 1KJZA 4ZZ2A 4DDVA 3L01A 3IEXA 3ZBQA 3EGDA 1N2JA 1RHUA 3EQ8A 3GDHA 2AC2A 3W9UA 2GBGA 5HIIA 4LOAA 1Q0ZA 2FF7A 3FDZA 3JR7A 1ISIA 3IXLA 1KEUA 3VUFA 2FRDC 1DC6A 4MCJA 2WJIA 1KP3A 1JJBA 2P2SA 2ZRPA 5I7HA 1NE2A 5HQTA 5ITWA 2HMVA 3ILSA 2IHTA 4GDFA 3P0EA 1BE6A 3P4UA 1D4OA 3PC6A 2DETA 5DHSA 3ONEA 1H6CA 3GK3A 2O19A 4BKMA 3U0VA 2J3LA 3O93A 4L3WA 4MVJH 1KYWA 1YFZA 2ASEA 2A14A 1NC3A 2GKSA 4NS4A 4G1CA 4IGAA 2W93A 4HFMA 5JY6A 1P45A 3CA8A 3Q9SA 1E6CA 4XW2A 3F8WA 2OEPA 3U4QB 1YC5A 2CF5A 3K94A 4BFVA 2NTVA 1WCWA 1MX1A 1BTOA 2FEPA 2CUZA 2R5WA 4B2PA 2BFCB 1Q0UA 1H2BA 2FZVA 4DMFA 1N34B 1PSDA 3KQSA 1UM9B 2MJLA 1NF2A 5A0VA 3SBEA 2YH2A 1Y80A 3C5WP 1HKHA 4NBTA 4C29A 5AVYA 4JQSA 3WSWA 4I36A 4JYZA 3T5GA 1WP4A 1TMKA 2ABWA 2Q5LA 3RI3A 4EG8A 3MTAA 4W6QA 2HPVA 5JS2A 4NOMA 3KSUA 4EY7A 3QH4A 5B37A 1E7SA 4H7DA 3LVRE 4I46A 4X45A 3HA7A 3D4NA 4RTLA 4FGSA 4QUJA 5BUQA 1SA0A 1SRQA 3IHLA 5ALOA 2HSGA 3WL8A 1BG6A 4MGHA 4DM3A 3LQQA 3VHXB 1T6XA 1JDUA 2HXYA 4NTZA 1C3XA 1KERA 1PK8A 4HQKA 3SN6A 3GEGA 1RAEA 5JNWA 2A58A 5HS4A 5B1YA 4BX3A 3FPCA 3FFBA 3ZJ4A 2YJNA 2RIPA 1Z4KA 1FUPA 1C4KA 1VHWA 3C48A 3LPMA 1TO6A 1BU5A 3RYHB 4D4LA 2WMOB 3H65A 5KWSA 2NM0A 4JIMA 2Q4OA 3CLSC 4MKXA 3W9YA 5JBQA 5FBLB 4IJVA 3GPCA 4TYQA 5FI1B 2NO7A 3WLHA 3OBBA 3U1VA 5D1NA 4L4RA 2ZETA 3OLXA 5D1HA 1N32B 1DMRA 1MB4A 4TRJA 1E9CA 1EDBA 2GZSA 1CY7A 4IIEA 3NDIA 5CDGA 5LA6F 3RTAA 1CV2A 2WUEA 4Q21A 5ECWA 1L5VA 4YONB 1GPYA 1T9GR 1X94A 4CT4B 3C5VA 3L7YA 4XKJA 2VPZA 3DXYA 1K8XB 4RJTA 1ZYUA 2ZRIA 1JT2A 1AF4A 1GZHB 2AYXA 2DQSA 2QTFA 3QTLA 1Y5NA 1RRMA 3G49A 3EHDA 2N47A 1S3GA 2R7AA 2P4UA 5CUQA 3QJYA 5DM0A 5IAJA 5B4UA 2O8FB 4MRMB 4G09A 1U2EA 3BHMA 3COVA 1UOPA 4RTSA 4MVJI 1DDIA 4BJHB 2OHJA 3UB3A 3G2OA 1SUDA 4LDJA 1ZX1A 3FX2A 3AEKA 3BWCA 1TJVA 3FW1A 5A2QA 1ID8A 4TM7A 2NG1A 3LWZA 2ERYA 3OCVA 4G86A 1RZVA 4ITRC 3M6LA 4Y9SA 1GPUA 1P2DA 2GNAA 3AETA 3KM0A 4L15A 1QHGA 3RS4A 2ZB3A 2O2IA 1DKUA 2I76A 5EE1A 1XSEA 2AQHA 2WI8A 3QOYA 5AVJA 3SXPA 1Z6PA 3PFWO 1O77A 1RPZA 2IITA 5FLYA 1ECGA 3MIZA 1ZOOA 1ZVJA 2ATEA 4RGVA 4EF5A 1T2AA 3HN6A 3GLFA 3GNQA 5FPSA 3I62A 2F1OA 1BE1A 4GI1A 1RI2A 4R9NA 5F52A 1F06A 1LX7A 3JVVA 1BW9B 2CLMB 1YIOA 2Q49A 1WHSB 4M0KA 4XSVA 3SHFA 4ARIA 1NSYA 3QPDA 2QYTA 1W34A 4XM2A 4ZVTA 4GVPA 3M6UA 1MA0A 3VYSB 4M8LA 2OCIA 3OC0A 1RRCA 5BWMA 3CLRD 4CF6A 3V1MA 3S8YA 5FFFA 3LUPA 3TQTA 2X9NA 4EMSA 1CR4A 3OCYA 2HO5A 1UBSB 4MKIA 1DQRA 4KXVA 3GDFA 4O29A 3BSFA 3CRMA 2JGFA 4DLVA 1SELA 16PKA 3JQ7A 1YONA 2BMJA 1DMSA 3KR2A 3NYRA 5EZYF 1M3SA 4M46A 5EPUA 4I66A 4JR1A 4Y0VA 1H22A 2G83A 2EJUA 4RXUA 4Q6BA 3IO3A 1U9ZA 4CKCA 2QL6A 2F55A 2MDTA 1I7DA 3EXIA 3KK0A 2HL6A 4N6GA 4BUZA 3QE9Y 1HTTA 3ADCA 4GDMA 5ANRB 1G2IA 1NQUA 1H2WA 2RK6A 2D0OB 3P9CA 3P45A 4G5YA 5CJ2A 3ORHA 3VAAA 4BNIA 5IUNC 3TLMA 1SA0B 1DLIA 1WUYA 1O97C 3T5AA 2IYSA 4UHJA 2FMXA 2OL4A 4J7CA 3ABZA 3SSAA 4UUBA 3ZBUA 1EWQA 3ANLA 1OIXA 3IV7A 4NBKA 1LY1A 1QLHA 2QE7D 5IASA 4EPYA 5JSFA 3BKWA 4IIDA 2ZJ8A 4M8KA 1YHZA 4L50A 1BD3A 3DOJA 1R0SA 1TGVA 2NO1A 3AUXA 1V8FA 4C2TA 1XTBA 1GUBA 4KXNA 1RZRD 3F3SA 3KFLA 1JBKA 1RYEA 3PENA 4I8XA 3LKBA 4KMSA 3C45A 4I4IA 3RK1A 4OM7A 3V8EA 5AI8A 4FOSA 4BNDA 2PO5A 4Q16A 4LRSB 2JGNA 3ODPA 2YIDA 4G1VA 1Z28A 4EFCA 5C35A 2EBUA 3HCFA 5DHQA 3PSAA 2OG2A 1FNCA 5AKXA 1G42A 4BB6A 2A7QA 2HQRA 5CB0A 2R6CA 4P83A 1RWQA 5H9VA 1VFPA 2HAEA 3S2YA 1ZI6A 1RZ3A 1QX4A 2JCSA 3K0FA 2H1VA 1Z8FA 4ZHQB 4B3RB 1UJ5A 2IYLD 2UZ3A 2YYYA 4NECA 5EWJB 5C8YA 3W1WA 3BWXA 4BKQA 2MYTA 2EJWA 1UWCA 4P5PA 3PEVA 5BV8A 2WWYA 2XD4A 4UAUA 1D2HA 3VO2A 2W58A 2EQBA 2O2SA 2VPQA 4LFBB 3AETB 3BMQB 3HC7A 5DOZA 3FNFA 3T1VA 1P1RA 4DCJA 3UIEA 3WQRA 2DQ4A 1CJBA 3VRHA 4BX2A 2ZRGA 3ZZMA 3HGQA 3W8RA 2W2PA 3O2JA 3VDXA 3T0FA 4HNUA 2XKKA 3L9WA 4OX9B 3WLOA 1J00A 1PV4A 1RMYA 4CMEC 2JBAB 3S99A 3HR8A 4BGUA 2Q5QA 2PEZA 4C05A 1A9XA 2Z2ZA 1IBCA 2JVIA 2RAPA 4TS3A 5FBQB 1JYFA 2OVBA 3L8GA 5CCDA 3BE6A 1JPNA 1ZJJA 3D5QA 3OOYA 2QYSA 4KE7A 2Q2NA 4KMOA 1RXSA 1ZOPA 2K7FA 1E92A 4CM5A 2WMDA 2P2GA 5A3RA 4OQZA 2F59A 1U94A 3NU1A 4G0OA 5CMLA 4B33A 1AK9A 3HEAA 2PZKA 1I10A 4FK8A 1JAXA 1GFWA 3NYIA 4GL4A 4QFBA 4BQSA 1IW7D 1DXHA 5CTAA 4QT4A 3PD0A 2P1DA 1OY1A 4Q01A 5ALTA 2YNMD 3WL4A 2G07A 5JAUA 1GPDG 1R8YA 2Y76A 4ZO4A 4AG3A 4RABA 1IU9A 2Q0QA 2QR2A 4Y2VA 4OXQA 1G8YA 5AJZA 1XKLA 4IAOA 3A3PA 2Q9UA 4OYRA 5LDDC 2JD0A 1SC4A 1O8CA 5MF6A 4HAYA 1QO7A 4WDQA 4MCAA 1A7JA 2NVUB 2Q6OA 1U5BB 4DVJA 1L7NA 3D81A 3WMXA 1IPHA 2O52A 3GJ8A 4IJMA 3KQWA 1DHTA 4IO0A 4P82A 3NASA 4TL6A 3UK1A 2PHZA 1FJ2A 2BAGA 1RVDA 4X7BA 3L7AA 3FYUC 2AL7A 4JLSA 1IBKB 5BPHA 3RU2A 3WJ7A 5KNCH 1E20A 2V45A 3KZCA 1AOXA 2BLLA 4GBGA 3N1UA 3VM6A 1NV8A 4EHKA 2QI9F 2YY6A 2HQOA 3BXHA 3RUCA 4J94A 3X43A 3AC0A 5J4YA 5JZOA 1XKQA 2EIXA 3IOBA 4ZAWA 2PX2A 5K09A 1M1UA 4JU9A 1D07A 1X38A 4H7EA 4EEIA 1M7HA 1WOYA 4NJEA 4PZEA 2IV3A 1GG5A 3WO1A 1JJVA 1C3UA 2ZDHA 4KE8A 1CUGA 1RKQA 1D4FA 3DSRA 4RKRA 3C6KA 4D8WA 2VC2B 4DLRA 3PPYA 4JJIA 1Z29A 5FL3A 2BGNA 3CGGA 3IOMA 5K6TA 1P7WA 3G1TA 3JZFA 5HM8A 2PUGA 5CLFA 1E58A 3GVPA 3HR7A 3TI9A 4BJ6A 5CDHA 2VYCA 4CLOB 5DLPA 5E7IA 1P4RA 2WTNA 1ZGGA 1FUOA 2JAUA 1HT1E 1SCIA 1UBTS 2I7TA 2ZUDA 2NQ8A 3JCZA 3KOOA 4IZHA 4RVNA 1CTQA 1U81A 4GKJB 3SIRA 5LQDA 1RM3A 3NNDA 2P4SA 3F7NA 4QODA 4ZT2A 4D43A 4D46A 2W2KB 3A04A 3RFTA 4PGHA 3TD2A 1AN0A 1T5TA 1C4OA 4LQDA 4XOUA 1NHGA 4R3UC 3T7TA 1GADO 2IC5A 3FUTA 3O1HB 1AV7A 1R4NA 3NC4A 4ETNA 1REQA 3B85A 4TYYA 1FTSA 3CXRA 3KQYA 1CIPA 4D9HA 1MBZA 2ID7A 1Y63A 2X75A 2DERA 4ZVMA 3WLIA 3KFXA 4D0LB 2MYNA 2A9OA 3OQVA 3SFVA 3CWZA 1LWOA 1ZRHA 2UYQA 3EG5A 3FMVA 1J2TA 2JEOA 1ECJA 1Q3TA 1N6HA 3JALA 1J0AA 4LTDA 4RGQA 4TV9B 2AEJA 3UY4A 1J4AA 4KR0A 3BF7A 2KS6A 3RJMA 5JSUA 1ZAYA 5IUJC 1KFKB 5AW2A 5BN5B 3EYAA 3I04M 3SXUA 2PX6A 4ZHSA 5I7SA 3I9FA 3ZWNA 4EI7A 5KYWA 1RMTA 4RV4A 2QD1A 5JJCA 1NVXQ 3LUGA 4DSAA 2I62A 5T4HA 5AXCA 1Y3DE 1CU1A 4JEIA 4FB4A 1N2EA 5LYJF 3PUXA 1DELA 1QVVA 4HEHA 2JFWA 4Q9JA 1Q7BA 1EXDA 4JI5B 4RY9A 3ZW9A 1V6SA 2QAGA 4ISCA 4YYZA 1U2ZA 2ZR8A 3ITNA 4U7JA 3L7CA 1RRGA 1V41E 4WZAB 5E0OA 5IP5A 2CFSA 1M33A 1MX9A 4IGEA 4GWLA 4WLNA 1FFEA 4B82A 4FE7A 1ISMA 2J7PA 2WV9A 1GQFA 2PL1A 3EIXA 3NBMA 1EK1A 4C1NA 1AMUA 3ZZTA 2GYUA 1ICEA 3MAGA 4LJRA 2WYVA 4J0DA 3WIUA 5HFJA 4HDNB 1M54A 1MLDA 1Y5RA 3KUCA 4J9VA 1G20A 2DM6A 5EUMA 1PVVA 2QX4A 2Z9BA 1Z6QA 3JQ9A 3LCJA 4FUQA 5I9NA 4IMIB 4WL0A 3KAPA 4GM1A 3VR0A 3BDAA 4JJAA 1DJMA 4R2XA 2P9EA 3H3JA 1BH6A 4P9NA 5D7NA 2D4HA 4PG7A 4CU2A 2C42A 4FX2A 7AT1A 3CF6R 1NXXA 4R5MA 2V1XA <