3BWVA

Crystal structure of deoxyribonucleotidase-like protein (np_764060.1) from staphylococcus epidermidis atcc 12228 at 1.55 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
177
structure length
167
Chain Sequence
TRQRIAIDMDEVLADTLGAVVKAVNERADLNIKMESLNGKKLGLVMDILKEPGFFRNLDVMPHAQEVVKQLNEHYDIYIATAAVPTSFHDKYEWLLEYFPFLDPQHFVFCGRKNIILADYLIDDNPKQLEIFEGKSIMFTASHNVYEHRFERVSGWRDVKNYFNSIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of deoxyribonucleotidase-like protein (NP_764060.1) from Staphylococcus epidermidis ATCC 12228 at 1.55 A resolution
rcsb
source organism Staphylococcus epidermidis
molecule tags Hydrolase
molecule keywords Putative 5'(3')-deoxyribonucleotidase
total genus 49
structure length 167
sequence length 177
chains with identical sequence B
ec nomenclature ec 3.1.3.-:
pdb deposition date 2008-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 3bwvA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3bwvA01
3OCXA 3WK4A 4AS2A 1LVHA 1IWOA 1QQ7A 1SWWA 2RBKA 3UMBA 3QUTA 1J97A 5ALRA 2ZG6A 2P11A 2IOHA 5ALJA 3U26A 3R4CA 5AM4A 2FPSA 2HF7A 1SWVA 2WHEA 5ALEA 5AVUA 2JAUA 4HGRA 3AR4A 4UARA 4AP9A 3RF6A 3ZUPA 4IG4A 3ZX4A 3B9RA 4BKMA 2Q5EA 3WK9A 3QXGA 3N28A 2C4NA 1EK1A 1Z4JA 2ODAA 5E0OA 4F71A 3U13A 2HHLA 2JAWA 5IT4A 2C8KA 2B82A 5AKJA 3ZI4A 1RMQA 3OCZA 3ET4A 3F9RA 5ALKA 5ALLA 5IT0A 4Y2RA 3WKCA 5AW0A 1JUDA 4Y2JA 2GO7A 2X4DA 3U7EB 4C4RA 1O03A 1SU4A 5ALXA 4EELA 2P9JA 1RQLA 3ZVMA 5ALWA 4JDPA 1MH9A 3PDWA 2B8EA 2O2XA 4ZEWA 3UMGA 4PNHA 2QLTA 5AI6A 4BEVA 3NALA 2R8ZA 3ZU6A 2ZOSA 2AGVA 4KNVA 2YJ5A 4FYPA 1U7PA 2I54A 2OBBA 4NFLA 3AR8A 5ALGA 2PQ0A 3QU7A 3ZWKA 3ET5A 1Z4KA 5ALNA 2YFYA 5AKHA 2I7DA 4G9BA 4HGNA 3QUBA 4I9GA 3WGUA 5AESA 3L0BA 3ESRA 5AK4A 3WK5A 4IFTA 3RFUA 2P69A 1Z4OA 5AM3A 4YIHA 1KYTA 5AI9A 3U7GA 4F72A 4NAVA 3N07A 5FP0A 4HAIA 3WKBA 3SHQA 4BX0A 4UW9A 4O8CA 1AQ6A 3KD3A 2ZBFA 3GYGA 2QYHA 2IOFA 3OPXA 4XPZA 3OCYA 1ZD2P 2FPWA 2B1RA 2WM8A 3I28A 3OCUA 5AVVA 3ZTYA 4HGOA 5AHXA 3L8EA 4KNWA 4CE6A 1YMQA 4GIBA 1RLOA 2CN1A 3W5DA 3A1DA 2FDRA 1T9ZA 4RETA 2IYEA 2CFSA 2OA0A 3WKEA 3QX7A 1RC8A 3L0CA 5AIBA 2EATA 3AR5A 2FPRA 5ALYA 4YCLA 1RKUA 5ALQA 3MPOA 5JJBA 1S2OA 1Q91A 5AKZA 2AH5A 4L57A 1Z4QA 4GXTA 2RB5A 2WFAA 2YBDA 3EPRA 2Q4RA 3ONNA 2HF2A 4JB3A 2ZXEA 2OYCA 5AIAA 2EAUA 2YN4A 5AI5A 5ALUA 4J03A 3OCVA 1WPGA 1RMTA 3K1ZA 3WKAA 3L1UA 1YDFA 2NO4A 5ALIA 1NRWA 1XPJA 2G07A 4I9FA 4Y2PA 2WF9A 3ZVNA 1VFPA 5AI4A 2B8JA 2I33A 4EX7A 1Q92A 2EARA 2HOQA 5ALVA 3QLEA 3QUQA 1TJ5A 4UMEA 1RDFA 2YMQA 3ZTWA 5AKYA 4Y2VA 1RLMA 4BX3A 2I34A 1QYIA 4UATA 3A3YA 3M9LA 5AW4A 1FEZA 5A3SA 5AW1A 4OFZA 3SKYA 3EF1A 1NF2A 4Y3UA 4DWOA 1N8NA 3L8HA 1WR8A 3QUCA 2YJ4A 1Z88A 3W5BA 4AS3A 4H1WA 1XVIA 4J2TA 1N9KA 5IS2A 3OCWA 1TJ3A 4XOUA 3SF0A 3PCTA 5AW2A 3R9KA 3E84A 1YJ5A 2G0AA 3UM9A 4BYGA 1RMYA 4FE3A 3WK8A 2YJ3A 2FPXA 3U7HB 2R8XA 2B30A 4EEKA 3IRUA 4KN8A 2HDOA 1YNSA 1ZRMA 2G09A 1Z5GA 1CR6A 3L5KA 2RARA 3WKDA 2HSZA 1Z4MA 5AICA 3WGVA 1TA0A 3NRJA 2BDEA 3FVVA 5AI0A 5AVSA 5AI8A 2JGAA 1L7OA 1YV9A 4L6AA 1K1EA 2MU1A 3ESQA 2YY6A 1TE2A 5AKXA 2HO4A 2C88A 5AM0A 4Y2YA 5AVXA 3NIWA 1J8DA 1QQ6A 2FEAA 2W11A 5ALZA 3N1UA 4BBJA 1ZD3A 4DFDA 1L6RA 4E88A 3I1YA 2FI1A 2NYVA 4DW8A 4HGPA 2D2VA 3DAOA 1VJ5A 5AW9A 3A1CA 3QGMA 1VJRA 1Z4NA 2FUEA 5AKIA 2C8LA 3HLTA 4MWOA 5AVYA 1RKVA 2NO5A 2WF7A 3J7TA 4B6JA 5AM2A 2YMMA 4QJBA 2G1AA 2BDUA 2CFTA 3ZX5A 3QU2A 2IA5A 3U7FB 2PR7A 4BNDA 1L7MA 2AUTA 4OHFA 3DDHA 3ED5A 4MUMA 3L0YA 3WK6A 3ZVLA 2O9JA 4BX2A 4Y2XA 3L1VA 3L7YA 4Y2SA 2I55A 3B8EA 3FPSA 3KDPA 4YCNA 3U19A 2C9MA 3QU4A 2YMPA 3EF0A 4KYTA 1RRCA 4QQFA 5T41A 5A3QA 1LTQA 1CQZA 5AKEA 3A1EA 4XQ0A 4UM7A 4OD0A 1T5TA 3AR6A 1L8LA 5AW8A 5AW5A 1L8OA 2CFRA 3E8MA 2W43A 2B0CA 4C4TA 4EX6A 4Y2QA 3FPBA 2VKQA 1U02A 4BEWA 4EZEA 2JAOA 2HX1A 1F5SA 4YGYA 2G80A 2HI0A 3AR9A 3MMZA 2I6XA 4ZEXA 5ALSA 4CF5A 2DQSA 5ALPA 5AM1A 5AK5A 3IJ5A 3UMCA 4UU1A 3ZW7A 3PGLA 2ZBEA 1Z5UA 2WF6A 3NUQA 4HYTA 1WZCA 4HGQA 3QU9A 3CNHA 2AMYA 3BA6A 3ZWDA 2HCFA 5ALHA 2B1QA 3SMVA 5AW7A 5AK3A 3R09A 3HYCA 3N5KA 5A3RA 1L7NA 4BNDB 2GHTA 4YH1A 4EENA 2GMWA 1ZS9A 3DNPA 3QYPA 2P27A 3E81A 2G06A 3E58A 1ZRNA 1PW5A 4UASA 5AKGA 5ALOA 1Y8AA 1NNLA 1ZD4A 3B9BA 3SLRA 1RQNA 3FM9A 1RLTA 4C4SA 5ALMA 3KZXA 3MC1A 3QU5A 3I76A 5AKLA 4CNQA 2JARA 3P96A 4G63A 4UMVA 3M1YA 5AVTA 2Q4TA 4UAVA 4UMFA 3VAYA 4CF3A 1WVIA 5ALTA 3SD7A 5AKKA 4NWIA 4ZEVA 1U2TA 3PGVA 4XE5A 3IB6A 5ALFA 4CF4A 2RAVA 2ZBGA 3KC2A 2HEGA 4YCMA 3WK7A 2MSNA 2R8YA 1EK2A 4OCZA 4YIKA 1O08A 5AW6A 4UU0A 2BY4A 2WF5A 3CZ4A 1RPZA 1U2SA 3QNMA 1T5SA 2R8EA 3AR3A 4FFDA 1QH9A 4UMDA 5AW3A 3L8GA 5AVZA 3NASA 1XP5A 3L8FA 3DV9A 3NANA 3KOOA 1RKQA 5AVWA 2GFHA 1S8OA 2W4MA 4NABA 3TLMA 2PKEA 5AVQA 1L7PA 3MN1A 1QQ5A 3N8GA 4Y2TA 4KX3A 1YS9A 4NV0A 4UM5A 2YMLA 3W5CA 1ZOLA 3OTQA 3AR2A 4UAUA 2IOFK 1ZD5A 3D6JA 5ALDA 3W5AA 4DCCA 1TJ4A 3I6BA 3AR7A 4KX5A 2WF8A 2FPUA 3FZQA 3KBBA 5AVRA 2OM6A 3BWVA 1X42A 2ZBDA 1U7OA 5AK6A 3FGOA 1Z4PX 2G08A 2GHQA 4RESA 1Z4IA 3NAMA 3SKXA 2YJ6A 4L6CA 1ZJJA 4Y2UA 3EWIA 3S6JA 1Z4LA 2FUCA 5AM5A
chains in the Genus database with same CATH superfamily
3WK4A 2P6RA 3DZJA 1LVHA 4JC5A 2H4HA 2PD4A 4JUDX 3W9UA 5C2JB 2ZB4A 3SMQA 4D4KA 4PZEA 2JVKA 3MIIA 1GQFA 3AGQA 1HTWA 2PMWB 3P2KA 1U0TA 2VAVA 1LPPA 1U4SA 3PEWA 4DKXA 3FLEA 2BEVA 3GNSA 1SC6A 2XNSA 1CUBA 2F8LA 1DB3A 2HF7A 4KVAA 4EK9A 421PA 3G5MA 2O3SA 3HV0A 1PK7A 3RAFC 4AJ9A 1ECJA 4CBVA 3GJ0A 4HS9A 3K8ZA 4WN9A 3EGXA 1NOIA 3VZBA 4YUWA 1RWOA 3ABSB 3VO2A 3RUCA 3GFFA 4N49A 2QVBA 3OVMA 3UHOA 3OSUA 1A95A 2RHJA 2AHRA 2VQDA 2XQIA 5B1YA 3VDMA 3AFNA 1ZC3A 1YFZA 2X77A 5IC6A 2ZI3A 3HHEA 4KITB 3AG6A 1D6SA 1DELA 2OM2A 2Q8NA 3ACBA 3BQ9A 4PWZA 3VGJA 4YK7A 3W9YA 4ADLA 5SYAA 3DCJA 4IDFA 4WKPA 2ZRJA 4X1YB 4IYRA 1DQSA 3O0TA 3EZ6A 3WGGA 3KE8A 3F9RA 1BS1A 2Q2VA 3NV7A 3PR1A 4M7OA 5KYNA 4B3SB 1JFLA 1UBGA 4BCCA 1J2TA 1QIKA 1VYTA 3GARA 3MT8A 2X4DA 1B0AA 1QCZA 1JF8A 1PZFA 1UADA 3I2HA 3G5TA 2Y2VA 4PSCA 3PUIA 1F12A 1RQLA 5EXXA 1PJ2A 4F06A 2ZRPA 1QCYA 5LQUA 1RZRD 1E7SA 3IUMA 1GGVA 3FRIA 4E5SA 3C8HA 1EHYA 1V6AA 3CRRA 4IVQA 4TS4A 3D6HA 3ZHSA 4F7WA 2J0UA 4HCJA 2O2DA 4CTOA 2VH1A 2CXUA 2ZJBA 4U8GA 5FD8A 4QOFA 1J25A 2BFPA 5ICCA 2DLNA 1MCZA 1PE0A 5AWFC 5FOSA 3M6AA 2WTUA 3NBUA 4I2NA 1V35A 4A1FA 5BN3A 1M34E 3T9BA 4UC0A 5AKHA 4U2BA 1FS5A 2ECQA 2AYZA 5GZ6A 3I5UA 1Q7CA 3AB3A 1OILA 1JDNA 3KUDA 2ZPUA 1KDOA 3ROKA 2EXXA 1V11B 1C1YA 4IFTA 2GD0A 4JJFA 4GVLA 4A23A 5I8WA 1I7SB 2UV8A 1Y5IA 1QQAA 1U6KA 3D0OA 5FOXA 3IO5A 1CBUA 2OP0A 3IQDB 2QJFA 1DUVG 1SBYA 4B2YA 3EZNA 4HFMA 1ZMXA 1IUOA 3CVOA 5F76A 5GONA 3H1FA 1OYWA 3F5QA 2EIHA 3PJGA 4KO2S 5CB0A 4AF8A 2V97A 3B13B 1DCMA 3T99A 1BVYF 3OZEA 3RIMA 3RR2A 1ZD2P 2DY0A 1TTQB 2HLNA 4BO7A 2DULA 2BISA 2GYYA 5AVVA 3FOFC 3Q6MA 4KR6A 2QHXA 3ZTYA 4E33A 5FRDA 2JEOA 1N6KA 2AEMA 3MF4A 2IOQA 2FEMA 3WWCA 4G0VA 1NVEA 4P0QB 7MDHA 3UK1A 3ZBPA 4X6UA 3RYFB 3FSGA 1OPRA 3A1DA 3ZNPA 1VE6A 2VZ0A 2VHJA 5EJMA 1XTZA 4JDUA 1KPHA 4P35A 2OA0A 5FJJA 1KI3A 1M0WA 2PU5A 5FKJA 4BNMA 1X7WB 2VG8A 4C29A 3CN7A 3KPVA 1IWPB 1QORA 2GD2A 2O19A 3JZFA 2HRZA 2X5NA 1A96A 4Y2HA 5J59A 3WNDA 1NRIA 1NL3A 5LQSA 1FX0A 3AVVA 2EFJA 1S2OA 3ITNA 5AKZA 1WD5A 1E3WA 1I3OA 1PL8A 2Q5JA 4CW7A 1AKRA 4OHMA 1MJFA 1DV2A 1X86B 2JIMA 2WFAA 1XQYA 3L7MA 4NCIA 1NASA 5ILQA 1QBGA 3W4KA 1DCTA 2G5PA 2ODNA 4B43A 3TD6A 2JJMA 1RRGA 4JA0A 1BGXT 4PV7A 3TBFA 5CXQA 1GFZA 1TMYA 1A8QA 4U39A 4TYWA 1DZ3A 1LJLA 3BWMA 1XZEA 3IO3A 4FQ7A 4HVCA 3VZCA 5IM4A 4L9AA 4JT9A 3T4PA 2ZUBA 3G79A 1DIBA 3L6BA 3UF0A 4B7ZA 1YDFA 4C6TB 4O5OA 3AUYA 3U4DA 1N33B 1ZRHA 5IYZB 3T34A 1V1RB 2H8GA 2ZIUB 3DLHA 1KMMA 1VJTA 5EFZA 4CQNA 2R86A 3WBJA 3GOQA 2H2WA 4Z8YA 1B3BA 3U31A 3UGQA 3WQRA 3WWDA 4C1NA 5JH7B 4EKIA 1IL0A 3C1OA 4M21A 4M8SA 3GUVA 1XPUA 4L51A 2WIFA 1J09A 3O31A 4BX3A 1PFUA 3KQWA 2RBGA 2RGCA 3RM3A 3N0XA 5D5QA 3JALA 3DDOA 5CYGA 4PZCA 4R51A 5AW4A 5IT4A 3N3BC 3PNYA 4H3SA 2QZZA 5DYNA 2QXUA 1T2DA 2H1RA 2YJGA 2G77B 2IKQA 3CF4A 2BV3A 4ZYYA 3E2PA 4IIXA 4TXNA 5MF6A 3H13A 1N6IA 2MSWA 4MR7B 3I2GA 3ZIAD 3ANMA 1ORWA 4NQZA 1SXPA 3M89A 4KJXA 4TTQA 1BHQ1 5IDQA 5DULA 2O8EB 1V1MA 4J16C 1OKKA 3BM5A 4UEQA 2VNHA 3QOYA 3RRZA 2AC4A 3QVVA 4FDAA 2I78A 3G6WA 1T91A 3RAEC 2IE8A 3PE4A 3ZWCA 4MZDA 5M29A 2RHRA 4UHBA 4MDEA 2R6GA 4KIFA 3M82A 2E5FA 1OC2A 2H5EA 4RKWA 5TEVA 4CKZA 5KTKA 4Q1AA 2A78A 3KOXA 5KKAA 1FUEA 1TUIA 3U7HB 2B30A 3Q11A 2H0RA 4DOMA 3R8CA 4MV5A 1UEJA 2IGTA 3KE9A 3FBGA 5A0TA 4NHEA 2HIAA 3LW8A 1VM6A 5L7WA 3BX1A 3OQNA 1R4MB 2PL5A 3T1TA 1Z62A 1DTSA 1Y1TA 1ZJ6A 2PM8A 1Y3HA 2HA2A 4HHEA 3VVMA 1DC7A 2FSIA 3ISTA 4ZGWA 1Z47A 3P2OA 2R8BA 3BRSA 3CKLA 3H5OA 2X5XA 2MSCB 2WP0A 1YOVB 1EQ2A 1JEQA 5C4MA 1BE0A 4L6AA 5LZ9A 1JMYA 2DR0A 1P33A 2WU1A 2QMYA 4APAA 1TE2A 3C24A 4KQ2A 5DYIA 1V3UA 1I9GA 3CJRA 4IMJB 2YASA 1Q7GA 3G9QA 2PUFA 1Z5VA 5EQDA 4AKEA 1I1OA 1E2MA 1UR5A 3A28A 3WR5A 3U3MA 1OYOA 1B6TA 1R0RE 1XAGA 3JQBC 4TV9B 3U37A 3UPTA 1HNXB 5GOZA 1D3AA 1V4NA 2DWCA 1W4ZA 4RSMA 4EG7A 4C7OA 1H2EA 3CLHA 4EI2A 4NBTA 1QZZA 5FTJA 3W9BA 1LRLA 4N9QA 2XCLA 2WUVA 2GBIA 3NDRA 4FDLA 3S44A 4AJHA 3LDGA 4CXMA 3MAGA 1PSZA 1L4UA 3L0OA 4KL8S 1ZG3A 2P62A 1TL7C 3QEOA 2IW1A 3TQRA 5BNTA 5LR6A 1N34B 4W1SA 1HI9A 5ER6A 1PEDA 2J3KA 1V7QA 3C8DA 3GEEA 5IXYA 5KINB 4JJGA 4HH4A 2Q5IA 4L28A 2DWQA 3JWEA 1S3SA 1U9YA 5E4YA 3FCEA 3TTTA 1CSEE 5BSEA 3RC1A 2C8LA 1JHAA 1VSUA 3K1YA 4QPCA 4XH9B 3ND8A 4ISCA 3R5KA 4M1MA 1I0ZA 3J7TA 1EE2A 2JJYA 2CHUA 4C3VA 1GT6A 3QBTA 1T36B 5F3RA 1XG5A 1YZFA 4LN1A 1EUCB 1Z37A 3E05A 1O3YA 2H2DA 1DIGA 3MJEA 4OHBA 1LKZA 3KEGA 4MAMA 5CJPA 4BN5A 4EJSA 5CB4A 5JRJA 4R7ZA 1VYVA 3CISA 5SY6A 1KK1A 1MQ9A 3OU6A 1KYYA 5KTYA 1WHTA 4XB2A 5DBIA 5BSUA 2PRJA 2ZI5A 3HCEA 4G8CA 4I50B 1XNRB 4EABA 1XEWY 2C7RA 1J9ZA 3U4AA 3ZCSA 2BHSA 5KWEA 1J7JA 4X8OA 4MWZA 1Y7IA 1ZX1A 1U8ZA 3HJGA 2NOAA 3GCDA 3LSTA 3N8DA 3R0VA 3WNQA 2RCNA 1ZOOA 3I83A 4JKYA 3T3PB 2WM2A 2OK7A 2R7KA 3PFWO 4BO9A 2C9MA 4FK8A 4KYTA 3G0DA 1RRCA 1ULTA 2CLIB 3OPYA 1J2EA 2R8PA 3HPRA 2YS7A 1SKMA 3FPHA 1ONPA 2QD2A 4LPKA 3NHBA 5E2AA 3TQTA 3ZV4A 3ZLUA 4MUGA 3V8BA 1WSAA 1L8LA 1CZNA 3EC2A 3M6WA 2O8NA 1PHRA 4LY6A 1BJRE 1V45E 5C7OO 1OB2A 2I4RA 4JFAA 4Y6OA 1LBIA 3JZAA 3PC6A 3VNQA 1O9HA 7REQB 2PMCA 2DQKA 2VBFA 3DAPA 2PQ2A 4P82A 3SIPA 4INOA 5EKUA 3AFHA 5K0TA 3CZCA 4P54A 4B48A 1FDOA 3ZWVA 2YYZA 2GLUA 3DLCA 2P2DA 3B60A 5CVVA 1F8UA 1LNZA 1NLUA 2G80A 1JR3E 3N5CA 4WN9B 3WLIA 1KRWA 5J4LA 4GBJA 5F1PA 4EA7A 4FN4A 2FRDA 1SFRA 1ZESA 1M1NB 1DP4A 1L7BA 2GLXA 1KFKB 2PMBA 4P38A 1VB5A 4EG0A 3TLGB 2XUDA 3KV1A 2W6QA 2OBMA 4HNQA 4QQ8A 3PFBA 4JR1A 4IHJF 5TNXA 3RIHA 1KJ8A 9ATCA 5ENZA 4JI3B 1SKUA 5HRUA 4KNYA 2QX9A 1TX4B 2IUFA 2CLCX 4FFVA 4HQ6A 4AG6A 4E7PA 1DRJA 1WB4A 3I34X 2JEZA 4KKXB 4NDZA 1UODA 2JJ2A 4I3FA 4JCOA 1YCDA 3VPDA 1NUQA 1EX9A 2YV3A 3HGMA 4DLSA 4LSWA 1A2KC 3CBGA 4I1IA 4DQXA 2EP7A 5EMHA 3GOHA 3LUAA 1V41E 1IXRC 3IUBA 3ELBA 1YZYA 4P4SB 3LYHA 3QFTA 4W8OA 4BPRA 2AOUA 3HYCA 1KKMA 2Y6VA 4O6VA 2JDIA 1GZ3A 3N5KA 4X44A 2PPVA 5A9RA 5BUZA 5JNLA 5J4HA 2E4VA 2VUIB 3KJXA 4Q7LA 4U0KA 4V3BA 1EA5A 2VR1A 5KSPA 5BWOA 5KTNA 2NUAB 2VRCD 3QYPA 4LNAA 1M5UA 1E1NA 1GQOA 4J9UE 1Z34A 1P45A 2P65A 2QZJA 4V0LA 4WZAE 4DCGA 5C52B 4L7VA 4GI2A 1X9GA 4HMQA 4OJTA 2J3JA 1PSWA 1R66A 3OT1A 4HN9A 3I52A 3AKZA 4CR8A 4XRGA 4BQFA 3UJNA 3B6IA 3MBIA 3NJ8A 4R41A 4Z7NB 5CFMA 4DB4A 2GBGA 1L5YA 5HKBA 3QLJA 3JAWA 4RS3A 3TR6A 4P80A 5EZQA 4U9HS 1SGWA 3IXQA 4M87A 1KO1A 3OF5A 1NSFA 5E1MA 1KE2A 1UZNA 2VOJA 2WSLA 3T06B 4D74A 1V6CA 2J5QA 3LF1A 1PR9A 2EC5A 4PYMA 3L93A 4WXHA 3FFXA 3AP1A 4CNQA 3L0SA 3TSAA 1IPEA 2IE0A 5AVTA 1R6AA 4DRYA 2PTGA 4Z49A 1I5OA 3C6MA 4ASUD 4RTLA 4I81A 3T3NA 1RW4A 4PXAA 1DCFA 3BVPA 3W2IA 1NOJA 1PU2A 1CFJA 2ZREA 1Z5ZA 3EG5A 3E8SA 3H9UA 4EG8A 5JDCC 2R0QC 1ZK1A 2RAVA 5C1OA 3GRFA 3M6UA 3HO1A 2IHTA 2D27A 1HZJA 2HEGA 4DLPA 1A71A 2HSEA 4ER5A 2PKWA 2CVQA 3HYLA 4BTVA 1V1RA 4UAGA 1BWSA 4YLGA 3ELWA 1C81A 4RY0A 5A5FA 4BNGA 1MENA 4EHKA 2V65A 4FGSA 2IP2A 4QYXA 3UJPA 5BPHA 1PR0A 2YHAA 3AY3A 3DP7A 1P4HA 4G5XA 5JMPA 5TPWA 1T5SA 5IAAA 2QMEA 1T0BA 3BRQA 2WD7B 3GZNB 1GYRA 2V8OA 4EPWA 4MW6A 4QPZA 3NEPX 4B87A 2FLVA 1F8GA 5CK4A 1MDFA 3RYFA 1SNYA 2R1VB 1T5LA 5HNKA 3NQ41 1PUIA 4M6WB 3E3AA 2F3UA 2R11A 3G2LA 3WHLA 2PMFA 2VP9A 3MA0A 1UMDB 2HBRA 2FWJA 2JFYA 1CZHA 2JIZD 3NBFA 4B3XA 4Z0TA 4BLUA 3GPLA 1FX0B 2IS6A 1O0SA 1VIAA 3G7UA 3RASA 3Q8KA 3FDFA 2IPXA 4DDWA 2G1JA 1E9EA 1Z3IX 1N57A 1SN7A 2H6EA 2Z30A 3HEMA 3KT8A 5AM0A 4JU9A 4HYQA 5DLYA 3RV3A 2FSVC 5K6TA 3EUEA 4KQWA 5FPHA 2EJBA 3NV9A 5K8TA 3NO4A 2BKUA 2QW1A 1SRRA 3AY0A 4GUAA 3A9SA 5B1IA 3U1VA 1K5HA 3WNBA 2VT7A 2CDAA 4BKUA 2C2HA 2KPOA 1NBWB 4M8KA 1VG0B 3JQPA 1NDQA 2I80A 4TMYA 5SYMA 2CEAA 4UE2A 5KKNB 4XAQA 2IUEA 3KFXA 3E18A 4DIOA 2J3MA 3NBYC 3VPGA 2QRVA 2ZBDA 1Q0RA 1Z08A 4G0ZA 1N2IA 1P0QA 4R8SA 2R6FA 3W90A 4GOMD 1IBKB 3WIOA 3TV2A 3WTBA 5IJZA 1NJ8A 2DXIA 2GERA 1AV7A 3R5HA 1EVQA 3NGMA 2X8JB 1TYAE 1EG7A 4TWRA 5DIFA 3MTQA 3ZHYA 4D4IA 4EEXA 5KSOA 4LWOA 5BWMA 3H84A 1Q17A 2KYRA 2WIJA 3OZIA 4RHTA 1NM5A 3QEMB 2FQ1A 3TMAA 2QDXA 1NSTA 1WXHA 2GR9A 4PLZA 3AIKA 1NR7A 4R54A 5DNUA 1KZYC 3HFJA 4JAVC 4B75A 3ROTA 1JYSA 1YTUA 3ZD7A 1QRDA 2JJ8A 3AONB 3CU5A 3LPAA 4E2FA 2L17A 5H68A 5B2ZA 1BN7A 1KZ1A 2PT9A 1E5QA 1ZL2A 2HGSA 4R5MA 2AT1A 4EY4A 2X9GA 2KSQA 4JYMA 1OFTA 3ZD8A 2BI4A 1OVGA 2Y1GA 3GEBA 1T5HX 3HCCA 5EXDA 3RS8A 4XQ9A 4D45A 1PTJC 2GEKA 4B3MB 5IM5A 1CUDA 4RMGA 1MJNA 2OYSA 2NVUA 1S2LA 1WPXA 2QSYA 3AV3A 3N28A 3R7NA 2RG1A 5KTTA 2YWGA 3QJ5A 2IYQA 3QIVA 1UC8A 5JS7A 5E38A 1IG0A 2XODA 2NT4A 2C2KA 2HHLA 1CRWG 3ZNOA 5JRZA 3PITA 1U8AA 1X0VA 2VDUE 1TO2E 3OCZA 4YJKA 1YCGA 4MYUA 2QV0A 4PIPA 1U0GA 4P4GA 1QVWA 2R7AA 2C5GA 4NU8X 3IUSA 4EPRA 3EMDA 5GV8A 3ZHTA 2J9GA 2B2NA 3L40A 1O03A 4IBOA 1M6NA 1Q6YA 2ZYVX 4LJYA 3VU9B 4CGZA 4Y0AA 1C4XA 3IUPA 3S2ZA 5JROA 1Q77A 4A73A 4GWGA 3T94A 5KCZA 3ZVMA 1E2BA 3X43A 4ZFNA 5ALWA 3KIPA 1F0KA 3A9TA 4X61A 2BH2A 2UKDA 4HEJA 3AB8A 4HVTA 1IN8A 3S2IA 3C85A 3QX3A 4BEVA 4TYNA 3KU4A 1SM4A 2BGNA 3UUFA 5LKAA 5KYKA 4JZKA 2TS1A 3CINA 2DSNA 3TZHA 4BIMA 1DADA 2I4LA 4CI9A 1GTSA 4R5HA 4KRFA 5CNKA 2I54A 2OBBA 1BD4A 2GEUA 4GBMA 3JATA 3KTAA 2GJSA 2HC9A 3ONWA 1UFKA 2VEDA 3QKIA 1GA4A 1V8BA 3FDJA 4JHXA 4LRYA 3ZBTA 1GEEA 1QG6A 5E7JA 4C20A 3IE2A 4C14A 3NEYA 5KJFA 4TRRA 4YCLA 1XA0A 1XO1A 1P5HA 4EW1A 4ENSA 3EYAA 1O8CA 2D2EA 2P4SA 4HQLA 2FR1A 3LDAA 2GM4A 4XGNA 1Z4OA 1C9DB 3E22A 4LPSA 2A9KA 3SQLA 1UPUA 5JD3A 4TTAA 5JO9A 4A8JC 1TUBB 3AEQB 4MYDA 5KAPA 1CQIA 4XDGA 1U0HC 1V5WA 3EGOA 1RAIA 3QH4A 1KOFA 5I9TA 1T3TA 1JA1A 3K96A 4Y2GA 4E22A 3IUNA 3LQQA 3SZMA 4BTEA 5CLIA 3JPYA 1SB8A 1R6TA 4XPIA 4XI9A 1DTWB 1T0HB 3DEKA 4QG7A 4ZC1A 3K0AA 4X65B 3F3YA 3OCUA 4ZYZA 5EN4A 2A9RA 1MC4A 1E3WB 1ZD9A 2B9VA 2O05A 1Q21A 3G9UA 3L05A 3NM5A 1G4AE 3HN7A 2AI3A 5AHXA 4DXAA 5F9MA 4CE6A 1YMQA 5IM4F 1B16A 4KK4A 4NOJA 5JFTA 2Z2ZA 5EQTA 1IOWA 4DCMA 4C0KA 3KS9A 2IEBA 4INJA 3K1AB 1E89A 3KBOA 4NE7A 5MGBA 3D4LA 1OB5A 1NTOA 3WO0A 4ER0A 1QOPB 4IUYA 1AHPA 2FXIA 1TCVA 3K4QA 1KDRA 1SQ5A 3SIXA 1ZNQO 4HF7A 5ARBA 3GH3A 4KQIA 2HWXA 1S8FA 1UT8A 2B78A 1UMCB 2GH1A 3TJZA 4LDAA 1DBRA 4HGZA 4ZOLF 1P62B 2W2TA 4AP5A 2YWEA 3VHQA 4RTQA 4L57A 1SQFA 1ENYA 3ZCTA 5FAKA 2PA3A 1KYXA 1X94A 4HY3A 1G55A 4RIEA 5HIAA 2Q5OA 4YRIA 4LOJA 2BD0A 1X19A 2XI4A 5A4DA 4X63A 5ER9A 2OCBA 2QM0A 1AUXA 1JLHA 2D2IA 5JH7F 3ZDBA 3HDQA 4HG2A 1RJ9A 3IV7A 3I2YX 4W7SA 3NW9A 3ZTTA 2OUIA 2PZBA 1PCXA 2V7QA 3K1ZA 1QAQA 5FA5A 4BASA 2X22A 4DNQA 2VC2B 4NPAA 3GP3A 4X84A 1D7OA 1QH0A 3WFIA 4B2PA 5LU9A 4PGGA 4TKVB 2VP4A 1C3LA 3HUEA 3D8SA 3M2TA 3LHFA 5FNZA 4CL8A 1QH1A 3GBPA 1FU8A 2G4VA 3OLZA 4FEGA 4WK2B 1ZMRA 4ZQCB 5EJIA 3CUTA 1Q2UA 4H27A 5DXJA 4AT1A 1ONNA 2YMQA 2ZRLA 1YFEA 4HP8A 1PJZA 1XFDA 2EWWA 1RLMA 2Z3VA 3CS3A 1L5OA 1Q2XA 2A7QA 4E30A 1VZ2A 3JQAB 1Y1PA 3CGGA 5I8PA 1H0SA 3GLFA 4KXNA 4MOWA 4RSRA 4B6FA 1I7QB 2ARKA 1OW3B 4P4SA 1WB9A 3NUGA 3IP5A 3RVBA 5L9AA 2I3BA 4D99A 1P4RA 4X64B 3EIEA 3ICWA 3O1LA 4ZHQF 1J5EB 4QPJC 1TUBA 5E4JA 1TJWA 4I8DA 1KJWA 1YRHA 4O4HF 4DARA 3W5BA 2D28C 3PX2A 4Z9BA 4A7PA 4MR8B 5K2OA 1CG6A 1D1TA 1TF7A 3OA2A 4M0LA 3RRNA 2PH3A 4DABA 3RSLA 2HF9A 1X14A 2AN1A 1TYDE 3AINA 2PS0A 5EINA 2CK3A 2YUIA 4TSRA 1A5ZA 1W49A 2X14A 4FE3A 4WCDA 2VP5A 3DLTA 3ABRB 4DLUA 4IGAA 1ZZEA 1J1IA 1W6UA 4K6CA 5LA6B 2C4VA 3EIOA 1OV6A 1JWBB 2E3JA 2YXPX 3FPEA 4ADMA 4TMFA 1IN1A 2GSWA 1Z15A 3R3HA 1K08A 1ZI6A 3CEJA 3IV6A 3WDMA 1XL0A 2NT3A 1N2EA 2VIIA 1MR3F 2ZM5A 3E7FA 4U2DA 3RC3A 3WLAA 5HFAA 4CIDA 4ZVPA 1KHTA 4ILKA 2WUEA 1KAHA 3D7LA 4EF6A 5FEMA 3NGLA 3JR7A 3TSYA 5DNAA 3NRJA 1HNWB 3R5FA 1G3UA 3QX8A 4IMIB 5AVSA 4C4AA 1B2LA 1TM4E 3WRYA 2V1UA 5LXTA 1OWMA 2D0OB 4D8YA 3PFFA 3TGPA 2GFIA 4H7HA 1SVNA 1FLNA 4FMPA 1R37A 4TKMA 1RVDA 4AO8A 2AWOA 2FHSA 1TEXA 4JWKA 2ZIXA 1PK8A 5BSRA 1EVJA 5JZVA 2D5CA 2NWQA 1A1VA 1JDVA 2YXNA 4CVNA 4G5QA 4I1UA 4CTJA 3DWFA 3R3VA 3IURA 2ZRKA 1NY6A 4DCJA 2FETA 3B6MA 4LRTB 1KQGA 1R0YA 2WNSA 3AOEA 3K9HA 3WISA 3NIBA 3O3MB 4RKEA 1YHNA 1C0LA 3EZ9A 3DOFA 1I1HA 1L6RA 1NATA 2QRUA 4B3IA 1GPKA 5L3SB 3D2BA 4N1AA 3SS8A 1DDIA 5PGMA 1S2GA 3LHKA 4PWYA 3I2KA 4JMPA 3LVFO 4F84A 3BFKA 4GQIA 4MV6A 2AXEA 3IBCA 4JBIA 1U1GA 1UL1X 4V02A 1E64A 2GLTA 2V7GA 1V8PA 1NKSA 3DW3X 2HPZA 3PHGA 3K5IA 4LMAA 5TEWA 1U4NA 4I1PA 4P34A 1EINA 1WM1A 1SCBA 4OXXA 2X2EA 3THRA 1FIUA 4F8YA 3HLTA 3A36A 3M0EA 3S8MA 4NCAA 2V4MA 3HSKA 3IR6A 2BGKA 5AM2A 3LUPA 2PTHA 3OCFA 4L0QA 1F3OA 5JARA 4FWBA 3VO9A 4OGFA 4QJBA 1B00A 3GCZA 5CA0F 1CF9A 3JQ7A 1UDXA 1QV6A 2YQ4A 3FFTA 3HXMA 2M6SA 4B4UA 2WUGA 1U8EA 2F8MA 2AZ4A 1N92A 4CT5A 2GZRA 2HJHA 2WICA 4JQSA 3FF1A 4TLEA 3MJDA 1M34A 1M2VB 2WJ4A 4WLUA 4EJ2A 3ZVLA 5EEGA 1VCHA 4IEIA 5KJ1A 3PGXA 3TSCA 4EM6A 4CM1A 1U2PA 4FEYA 2XB4A 5BVGA 3K0FA 4GYKA 1R6UA 3RYIA 4WXRA 4ICIA 1TVMA 2PH5A 4OKNA 4PG7A 3RRJA 1UPFA 5A3QA 1LTQA 3PYMA 1CUYA 3T3GA 4B9EA 5AKEA 3O9ZA 4UE6A 3F9IA 4KQGA 2NACA 3PQ2A 2JFFA 3DLPX 5KCMA 3G8BA 4Z9XA 4KXUA 3IQXA 3R2JA 2OQ2A 3DV0A 3X44A 2BMFA 4MAFA 5K01A 2CHGA 1SXHA 5IXJA 2HA0A 1Q0ZA 4PYRA 2W37A 3B6EA 4PYJA 4Y2QA 2CSXA 5B1DA 4K1XA 3ZQ6A 3HABA 4KXFB 1L7AA 3IALA 1CRPA 2OB1A 3DBLA 3EXEB 4BEWA 4RDXA 3AUTA 4CIVA 3L02A 1WSWA 1V43A 2DHCA 3OI7A 4BNHA 4DDTA 4EI7A 3V7UA 3LLSA 4A8JB 1CEYA 1HKHA 1RI1A 4N5IX 4OHPA 3SI7A 2BZ1A 3P9ZA 3IVGA 4UTOA 2H29A 4YXWD 1E1CA 5FNVA 3GXBA 3N75A 3H3JA 1HMPA 1OD6A 3PLRA 4ZEXA 4ALIA 4BMDA 2DAPA 4RNCA 4J0FA 1R0LA 3D4OA 1VHTA 1WXWA 1FDRA 3FHTA 1LJUA 2QTFA 4WVFA 3WGOA 5BQOA 2EF1A 4J1TC 5CDTA 5JUWA 4CCYB 1CEEA 5D51S 1KFEB 3ECSA 4KQFA 1GNSA 1QYWA 1WMDA 2BIFA 2XNKA 3L7NA 4Y9DA 1BW9A 5HOEA 3LF2A 2HDWA 4HGQA 2O8VA 3K0AB 2QL9A 3AM5A 4UE3S 5JFGA 4PAOA 1U5CA 2CKMA 4HXEB 4ENRA 3GNTA 3IT0A 2IIPA 3MBOA 3R6LA 2ZJ8A 4JT2A 4MV9A 3SMVA 2Y1CA 1SEPA 4XYBA 4Q39A 2EBWA 1AKTA 3VR5H 2ISSD 1YR1A 5FQNA 2VCYA 2Z4RA 3C3WA 3M34A 3OJCA 4G1VA 1NGSA 4I7EA 4MI9A 4REMA 5DM0A 3RRBA 2N42A 1S3IA 2JKYA 1U63A 5BT9A 2AX3A 3FOAA 4LHZA 1UFRA 4MQ5A 3CZAA 3GAMA 5DSXA 1Z12A 3G0GA 4JS0A 4RJKA 2QRQA 4LW8A 4JQCA 2V8BA 4NQRA 4RFSB 1SEVA 4JYZA 3LX4A 4RSHA 2QZ9A 5ES3A 3GNQA 1M5TA 1MB2A 2E4WA 3L0DA 4W6QA 1CZKA 1I0LA 1DQZA 3G0OA 2I2BA 4LQLA 2X2OA 3AI1A 4FKZA 4HUQB 5DM60 4HDQB 4EY6A 2OCKA 2HD4A 2CNOA 3GDOA 4QD3A 4EH1A 3MWJA 1MUUA 2WHPA 2B92A 1M66A 5A6VA 1II0A 3CWZA 2ZR8A 3IP1A 3L7BA 3Q1KA 4O4LB 1X15A 4Q3DA 1GGNA 4WLFA 1OLXB 4W5WA 1GGJA 3FAZA 2I0FA 4UOEA 4YUYA 3EPHA 2LCFA 5JAHA 2PTQA 2VJBA 4ZCLA 4CF3A 2R5WA 3F5MA 3C6QA 3EQ7A 2AK2A 2FPMA 1LEHA 1YS7A 4GKBA 1V7CA 5ICMA 2B6HA 4N3BA 4OG2A 5GQSA 4BDSA 5I7OA 2ZB8A 3ESZA 3FCCA 1QGAA 2PTSA 3E4CA 3FRJA 4GF5A 1ZM7A 2GXQA 4JX9A 1S5PA 2REQB 4DLWA 4XEUA 2XWJI 1JQDA 3BJMA 2LKDA 3CH5A 3T5CA 2ID8A 4YCMA 4QUEA 3BYZA 4UDYX 3WK7A 1KMHA 2WYIA 3N6VA 4PNZA 4OCZA 4NP6A 4K81B 1V4VA 3OWHA 1LD3A 2IYPA 2YVUA 1X1TA 3QNMA 2C7VA 2QLNA 1RAFA 4ACBA 3G2IA 1NF9A 4X1YA 2HRDA 4RQTA 2QRKA 3BCHA 2CUTA 1II9A 3L8FA 2XYVA 2DUWA 3F8WA 2WJYA 2AEEA 1CJBA 2R00A 2WKRA 3EC7A 4FE7A 3P0HA 4IZ6A 3EPKA 3K7EA 2RHMA 1SBZA 2DPGA 2Z2YA 4F8EA 3AVXA 3CCCA 1ZISA 3H5AA 5DGIA 2PKEA 5I7AA 1SXJB 4Y7CA 1DIAA 2R96A 1SELA 2PANA 1DCNA 3B1FA 3FKQA 2NUTA 4KHZA 4X8LA 3RQIA 4UAJA 5LZ8A 2WWHA 4FILA 5ARCA 1ZCAA 4QLBA 1Z8DA 3HFGA 3T5MA 1EG2A 1DSSG 2WM9B 1DQPA 1FTNA 1XN4A 2IU3A 1C9KA 3AR2A 4UQPA 1OFIA 5KNDA 3F8TA 3R1IA 2X0IA 3U4QA 1CQJA 2EF0A 2ZYHA 5ALDA 5CP8A 2D1RA 2W83A 4JVLA 3I6BA 5JW6A 2D0DA 2PKXA 2QGZA 2ZAYA 3C41J 3MT9A 4JJ7A 5F5NA 5C80A 4KSBA 1GHTA 1UPTA 5B57C 4DUZB 3ZGNA 1B8OA 2OM6A 2F2TA 3INGA 3DT6A 1TCCA 3BL8A 1X42A 3PPIA 1CKEA 3GA5A 3JVIA 4UHCA 2W48A 5TR9A 2P30A 4S1NA 3ADOA 5FPKA 1KEZA 1ACLA 2ERCA 2YHBA 1AN0A 1XLWA 4KGVA 3C0KA 2IIBA 4D3ZA 3DMYA 2WWGA 4EGQA 4KRGA 1SQGA 4DVJA 4L6CA 3LAWA 4C03A 5JXGA 2Q9CA 4UNSA 1PV2A 2CD7A 1IULA 3JASB 2OCIA 1UQUA 1H6AA 5U1PA 2Z6UA 1JHZA 2XMDA 3TZKA 1E6LA 4OU4A 2VXOA 4I5FA 2QP4A 2O7RA 1IW7D 4EUKA 2QLLA 1U2RA 1OZGA 2QY9A 4KOAA 1XCMA 3FVRA 3LC2O 3DMRA 2P11A 1QRAA 3IV9A 2KWIA 5AOVA 3QHQA 3MCVA 4GSKA 3FPKA 3HR7A 2II6A 4QUDA 4OU5A 1XA4A 4QUGA 2Z2IA 3KFLA 4LC9A 3W34A 1VGQA 2VHUA 1NVWQ 1TLFA 4HGRA 4UPDA 1LSOA 4ESEA 4JXZA 2GJ8A 4EY5A 1WBJB 2C3PA 1TZBA 1W34A 2OHFA 2ZE5A 2P5SA 4GSYA 4ROSA 4BFWA 5ADWA 1SCJA 2LBPA 2PU7A 3LPCA 1ODTC 3MFYA 1IRIA 1W2WB 3MNFA 1SOUA 4UUBA 3CPJB 2ZB2A 3FFWA 1EBBA 5T5QA 4WASA 4JLAA 5FOUA 3MCZA 4LWZA 5AKJA 3NKFA 4CQMB 5JZMA 5J5VA 3U44A 3L77A 4G0NA 1O96A 4UCXA 1XXHB 1IUNA 1MAUA 2ZBUA 3IH5A 1CR2A 3BFJA 5IT0A 5GADl 4O4IB 5EHIA 3MS2A 3P2IA 2OD9A 2OCGA 2G17A 1XNJA 4Y2JA 1EVKA 2VAWA 4EELA 2NXWA 3MXOA 2EFEB 3S8YA 5JSQA 1WJGA 3C7TA 5ITVA 3BGWA 4QDZA 4TSFD 4BJ6A 3RADC 2YVLA 3L8MA 4MR7A 5DCLA 2YZ2A 1EDZA 1QC5B 1S9HA 2YXBA 3GWZA 4RAOA 4CODB 1YVPA 1MAAA 4TKUA 4DGSA 3W6ZA 4CDRA 3TQHA 3OZDA 1KJ9A 1G98A 1JALA 4NV1A 3A8TA 2QM3A 2OE2A 3ST7A 2VSXA 4TT3A 2B99A 4N39A 4GR9A 1RHJA 5FTNA 4A2CA 1UKCA 1NULA 4DLTA 1H2RS 2FTKE 1DEKA 2OO3A 5ICEA 2GN8A 4LY9A 2GCOB 4NZZA 1IG3A 5EAIA 1UAGA 1WUIS 3ROFA 3ZHUA 3N74A 1OI2A 4DR5B 4FNAA 1PNVA 1NP7A 2X6RA 2D5LA 2Q7DA 1RXWA 2Q41A 4K9SA 2QPTA 5AK4A 5K8CA 5TQJA 1NQOA 4AJPA 3RFUA 1GZ5A 3HJTA 1UKBA 4GOLD 1W1WA 1E6EA 1T2UA 4UBLA 1IEQA 2Q5FA 2C94A 3HBMA 1Y5NA 3OAAA 5JECA 3DUFA 3L18A 4LRSB 2PVCA 5EWLB 2NV2B 4BEJA 4QOIA 4WTOA 4K2HA 2JGIA 1OBCA 1GNLA 4RYDA 5CRIA 3ZBUA 4ECAA 1TCBA 2C0CA 1ESEA 3BXOA 5MDHA 1F4PA 3QYJA 1YAHA 3DVSX 2YOFA 3KLBA 3P97A 3WX0A 2NTNA 3BK1A 3BXHA 1T9GS 4LJAA 3D5TA 121PA 2B1RA 1RTTA 1T5IA 1TC2A 2WM8A 2WUDA 4Q4HB 1JDBC 1O57A 4IEFB 3ELYA 3OZVA 1XDSA 4OP1A 1GRCA 1GZSA 3RS3A 2ZVPX 3GZ4A 3V4FA 1JDUA 1EM8B 2C3YA 3KU1A 3PHHA 4JVMA 4M86A 1C9NA 5CVUA 3SS9X 3UN1A 2ZWOA 2AEJA 3I73A 5HIKA 1JQ3A 2G9VA 4RPLA 1T4CB 4JYAB 1A50B 2QG4A 4GQBA 3QRWA 2HBZA 2P2ZA 4U8HA 2CFSA 4QUAA 4D96A 3CF0A 3WKEA 4EFLA 3V1UA 3RYCB 2B4QA 3H17A 3UAYA 5C8YB 2AJCA 5CM9C 5C7IO 1E1CB 2CXNA 1FNCA 1UBJS 3QWAA 4ON9A 5DLPA 3EE6A 5FNVB 3OBIA 2P2CA 2XSZA 3U2QA 3MPOA 4TQ9A 3C5WP 4LNUB 3ZDCA 2IKSA 3MWDA 3OZUA 3U7JA 3IDAA 1RQPA 1V5EA 1UJNA 3MUOA 1ZCJA 2IEAA 4N0PA 2AH5A 5LDDC 1P4SA 4DV2B 3EFBA 4GXTA 4DAOA 1F1JA 1GCGA 1RWNA 4BWGA 1BX0A 3CLUD 3SYNA 5IWCA 4F92B 2AJDA 4ZCRA 1AS0A 3U9SA 2G9ZA 4BQEA 3ZK9A 1JNYA 4RBNA 3HFSA 5AIAA 5J5CA 1VKOA 4Q02A 1M6HA 1AURA 2EAUA 1H1DA 4BHTA 2OESA 2Q6KA 1XDWA 2NO6A 1U11A 4FT2A 3RBAA 2AN9A 2PT5A 3HVKA 2NO4A 2ZBPA 4N3NA 2YXDA 4OUDB 2GAIA 4DRXB 4PIVA 2CW5A 4FT4A 4OF4A 2BE7A 2COKA 3T3IA 2VBCA 4MIKA 3WGTA 5BYBA 3ZEAA 4K6OA 3H5WA 3ILSA 3S29A 3CLUC 5EQFA 4MVJI 2GVNA 2BKEA 5HX7A 1VXOA 4Z0HO 4QHSA 2FKAA 1NVAA 3K71B 1DXOA 2PUTA 4C4OA 4HT3B 2UYHA 2POCA 4PPQA 4EZBA 5TT0A 3UT5B 2K5UA 5BSMA 2I8LA 2GARA 1AMNA 1YCHA 2D3TA 2VDWA 3A3YA 5KKCA 4EW3A 3NVKI 3NWBA 1BMTA 3PXGA 2FF5A 4MYHA 2OFFA 3C3XA 3SNKA 4CG1A 3EQ9A 4Y3UA 1MVOA 4HQ0A 5CD1A 3HCDA 3OU2A 2QUKA 1JIJA 1YA8A 1Q1EA 2MSDB 4GVPA 2H1CA 2C99A 4C9BA 4I46A 1SQ6A 2VJLA 2ZVQX 3X1ZA 4D1YA 4G5SA 4H1WA 1JIXA 1BOFA 2FUNB 1GLNA 2OCLA 2VBGA 3GELA 3OTOB 2RJOA 3JQ6A 2CB9A 5ITZA 5IS2A 4FLEA 1HYBA 2UYYA 4H1UA 1ZM4A 3L8ZA 3HMQA 4CLRA 1P2GA 4V0RA 2Y2UA 4W4TA 4URWR 4JZYA 1DKQA 2AZTA 2FE1A 5FPSA 3O4HA 5ILGA 1KS2A 1CY8A 2BAGA 3A1FA 3C5VA 4I3GA 2PJZA 1DAMA 4K9OA 3CO5A 5KSYA 4RULA 1EVIA 3TOCA 3UA4A 4BS9A 2WQ7A 3WIUA 1L9XA 4IH1A 2H5JA 1VHJA 1CJSA 2ZJYA 3FUWA 2ZVDA 3LNCA 5DN6D 2Q29A 3L6DA 4ZTZB 2GCIA 3CLKA 3SEZA 2XSZD 4TVSA 3GVHA 3OIVA 1YU6A 1Q0SA 5J40A 3EMBA 3K5WA 3L4SO 3V7FA 1NM5C 2XJ9A 3USCS 5T8KA 1G8YA 1V39A 1LC0A 1GZ4A 3EVFA 1WKBA 2F9FA 4ILEA 2F3QA 2HUPA 3OX3A 1ZXBA 4YJFB 1FYDA 1ABEA 10MHA 1ID8A 1YBHA 3TL2A 2GUGA 3H9JA 5E0KB 1RE1A 2NUBA 4BDTA 3FTFA 1TEVA 4PRYA 2W11A 3QXHA 1YI1A 1JTFA 4BGDA 5ALZA 4BFXA 4RVNA 2ILVA 3MGGA 4OHXA 5FF9A 1UCFA 4DFDA 1E60A 3TKLA 5E3JA 1EIWA 1LDNA 2BZ0A 4E88A 2W98A 1A7JA 4H7PA 4GYYA 4IWYA 1EJ0A 4DNOA 1HLDA 1SOMA 3H2YA 3HA5A 4L16A 4MUHA 1U31A 4HL6A 3R44A 3SR4A 1IVSA 1IZ8A 1G5RA 3GUUA 2GBLC 4M9RA 5DX8A 1KO4A 4DUGD 1QH8B 1RXUA 1J0XO 1B8UA 2E82A 1A9OA 2XR1A 3WLKX 2QRZA 4MQUA 1UZMA 1PBTA 2JFVA 4N7MA 3RIEA 3M6MD 3WMRA 2BP7B 3P0IA 1AMOA 3ON5A 2ORYA 1JAHA 1VL0A 2CEKA 2QYOA 3USES 1CJUC 2FWMX 1QHGA 4MKIA 1WUKS 5JHGB 2NP6A 3DO6A 3WTCA 2YMMA 4BFYA 3R23A 4RTRA 2QUJA 2XVMA 4E2XA 1JZTA 3RD8A 1CUXA 3RSZA 2ES4A 5HKOA 3KYCA 3G5AA 4A2WA 2EQBA 3QU2A 2Z57A 5C1BA 3C7CB 4P6VF 4EJSB 2XOKA 1RKXA 1OHHA 3NT5A 1AKWA 4I9UA 4D9JA 1EDOA 5FLKA 4ZOAA 1PDWA 1DLIA 2AUTA 4EWLA 3C8ZA 4YXFA 4ARSA 3SZRA 5TQ0B 1W8DA 3VC3A 3NDBB 1UDCA 1BYIA 4J4TA 2HCJB 1ID1A 5FLXA 2BMVA 2I55A 1AG9A 1GGHA 3C74A 2R7NA 4Y2SA 3DFIA 1QE3A 2BFFB 2COEA 2ONKA 4PQFA 4WBXC 5K8JB 2IXTA 2W6CX 3EFOA 2A5DA 2VFAA 3OMWA 5LMZA 2PJRA 4JL6A 2J8ZA 3TOZA 4F3TA 3A2NA 3JAKB 3K9BA 3NRCA 4HR7A 4JIMA 4MQMA 1JDTA 4PS0A 1J07A 3ZD9A 3Q12A 3F6CA 3KYDB 4HUTA 1RYNA 2V5VA 3CTPA 1WQ3A 1L8OA 4MUBA 4V1CI 1HSZA 4YP5A 4C0JA 2W58A 3WDSA 1NMZA 2V7VA 1E2UA 1Q3KA 4D81A 1JT9A 4UOZA 2A3RA 1G1AA 1T2AA 2GVZC 5DTEA 2XYQA 4QU9A 1LCIA 1F5SA 3UWOA 2C8JA 2D0IA 2HHJA 1P9RA 2PGJA 3FZGA 1FSFA 2R1VA 2QMQA 4MQLA 4D56A 4BNWA 1XZBA 3AR9A 3DT8A 1TADA 3FJYA 1SOWA 3H1GA 1JEAA 3N0WA 4IOLA 2P6MA 5DN9A 4UEWA 3T7RA 3TQFA 5T64A 1ESDA 1WHSB 5EE5B 1E79A 5CHYA 4C7MA 2JAHA 1TUEA 2PKYX 5H4HA 5EJ2A 3AVPA 5JLAA 1MW8X 2IXBA 3SX0A 3WKAA 1ZL0A 1IZ9A 1SO8A 4QBFA 1XHFA 4URHA 4GOJA 3SS7X 2WE7A 2A8YA 1Q50A 2GKOA 4L50A 5C7YA 3TAXA 2H1OA 1RXEA 3DZ8A 3RH0A 5TGDA 4ZQGA 2GCGA 3QLUA 3RT1A 6AT1A 3TH5A 4MULA 2YCLA 4O59O 4OTZA 4EFNA 4TQUS 5DM4A 2ILTA 4TL7A 1G21A 4R6WA 1L7NA 1Y7TA 3G8DA 1P1RA 3BJEA 1Q5NA 1HOTA 4X71A 1RRKA 1W96A 1JVBA 1V1JA 1DO0A 2OYRA 4O25A 2H0AA 1JV2B 1MRSA 1CRZA 4BNZA 1NBEA 4X3OA 2FNAA 1TM3E 1PL0A 5G4KA 3JZMA 5JWRA 1FVHA 3OY2A 4G85A 4W9MC 5EPOA 5FR2A 4AF6A 5F73A 5IBCA 1ZIPA 3MFQA 1EX6A 1GU0A 4J7UA 4MQBA 4DQKA 2P5TB 1X6VA 3KKPA 5DXAA 2XBUA 2GX6A 1X1QA 2IZ7A 3PWTA 1ECBA 3OE7A 1UQTA 2Y3IA 4JFRA 5GGXA 4DZZA 4E5MA 5K8VA 1SCUB 1CY1A 3N76A 1DOFA 3G5LA 2CT8A 3TRIA 3K6SA 2DECA 4UAVA 4EJ0A 1LW7A 1XQVA 2FPGA 2H7XA 1PEAA 2HRQA 4IDAA 3L4JA 1ISFA 4Z4QA 1E8DA 3RJZA 2A1UA 1SQSA 1UXKA 2QE7D 2Q0HA 4ZEVA 8LDHA 3PGVA 2VDKB 2QOEA 5BSKA 4MUJA 5ENDA 1BH6A 2BGIA 3GUCA 1TC1A 3IPYA 3MJHA 5HJ2A 4CF4A 4OMDA 4LDPA 2FEPA 4CU5A 5JC8A 1VHWA 2CLOB 1H5QA 2HEIA 3EVDA 3L1IA 4GWKA 1P3Y1 2C92A 4HADA 3CB4A 1LTHR 3TECE 1UWKA 3IBFA 1ENZA 2PJUA 2EBUA 2Q1YA 2QRPA 1H2BA 3GY0A 4H6WA 4HWRA 5AJTA 3KB6A 1JHYA 2QBYA 5IX8A 2X9LA 4OEHA 1KMIY 4ZQBA 1AVTA 4R1LA 5TPZD 5HZGA 4ZZ2A 1J23A 4PRKA 4H59A 3ZQ4A 4ARCA 3GU3A 2A5JA 1T1IA 2X58A 2CXTA 3H11A 3DYBA 4H9GA 4IDQA 1SQ0A 2PGOA 1R8JA 4GMDA 1KRXA 2GN2A 2FZWA 4KRYA 1SBHA 1ZUNB 5CLGA 5K3OA 2FPIA 1EK0A 2ADMA 3WNCA 5JDCA 5I4CA 1EX7A 2D74A 4OI4A 1ABFA 1AA9A 4AUNA 1L7PA 2F17A 4JLMA 4XVHA 5HS4A 2IXFA 1NYLA 1GVNB 4FS8A 4X1KA 4YV1A 1CS4C 4PU0A 4JEUA 2XKBA 4G0MA 3I23A 2NPFA 2QVCA 5LP6F 3EGIA 3W5CA 1TMGE 5FUMA 1XRNA 3OTQA 2XITA 3DMDA 2WTMA 4QXAA 1DAFA 1VGVA 2W0MA 3JAKA 1Z5WA 2OWEA 4HQFA 3AVUA 1JU3A 1TJ4A 4Q16A 4KBFA 2VJQA 4NEGA 5IJ0B 4CHGA 1OFGA 1DC8A 3QK7A 3R6DA 4NJOA 1E8NA 1GQSA 1T8WA 1G8PA 1SVSA 2C20A 3CWQA 3PLNA 3V34A 2PZEA 4HX2A 1Z68A 3GWGA 3TUIC 1W1UA 1EQUA 1T8PA 1XEXA 3JASA 4G9GA 1L5SA 3C48A 4OP3A 1UOPA 1TJVA 3VHXB 2VRWA 2RH9B 4KDEA 4TTPA 3U49A 3VX3A 3W5SA 1P19A 2V5UA 2XQKA 2QVGA 1RJEA 1T8RA 2Q6VA 5B3KA 2XPCA 4DA6A 3I72A 1RMQA 5A4IS 3L9XA 1HDIA 2JW5A 5FPYA 2E21A 3TVDA 1I5RA 1KK2A 1N75A 4H0FA 3FDZA 5FI1B 1OXUA 3UMBA 5TARA 4CV0A 5LYJB 2GPNA 3O93A 4JNCA 3CIOA 3FZEA 4D26A 5J1TB 4QHYA 5A2QA 2UVPA 4F9TA 4B4WA 1WE2A 3GMTA 1HDOA 3KP1A 2GN0A 1SWVA 4DPLA 2GNPA 2JAUA 3A6FA 3PQEA 3ZI7A 4Q4CA 4O1MA 5I5GA 2ZKIA 4B7CA 3BILA 3DTYA 3ZHBA 3O6VA 3VBCA 3ZUPA 4KJZA 3J81k 4EUNA 2AOTA 3MT0A 2I1WA 3MGAA 2X6QA 4OMCA 4RABA 4TN1A 4C2UA 4MGKR 3RTEA 1HG0A 1FCJA 4YRTA 4YMUA 1YE8A 3BULA 5K4GA 4EB8A 2EL9A 5T6BA 1N8SA 4GLJA 1ZGGA 2PYDA 4D9KA 4TXMA 2JAWA 2DCMA 3OZTA 2ZS8A 4XIYA 1HZZC 5A4JA 1PR5A 1KL7A 2C7OA 4Q9JA 1PZNA 2XVAA 3EXG1 1G8JA 1JR3A 2XNHA 1NBHA 4HSGA 5DI3A 1XMQB 4NPCA 4A5SA 2BH9A 2QEQA 2A5YB 4MYRA 1HEYA 5ALLA 4EG6A 2GCPA 3QVJA 4Y2RA 2ZE8A 3WKCA 5LKRA 2OXFA 3FJOA 4GD3Q 6LDHA 3BJIC 2J3IA 5KYYA 4XYGA 1XTVA 4B4KA 1G5QA 5D3MA 1GN8A 3FWNA 4LTMA 2C2ZA 4K2AA 5DXFA 5JJCA 2FYTA 1DWOA 1FDVA 3NH6A 3AGPA 3FNQA 3FLMA 5EZYA 3W3ZB 2CLEB 2GJKA 6NULA 3VYVA 3SM9A 5IU6A 2A5LA 1ZKMA 5L3ZA 4RH1A 2I99A 1K8QA 1Z25A 2VQ3A 2XMPA 2G83A 3CEPB 2R8ZA 3CNBA 3K05A 5GIOE 4ZYWA 3JZDA 3S0JA 4CTMA 4KNVA 1FUPA 1O77A 3VU8A 4KPYA 2HFKA 4Q66C 3L0IB 3KYCB 3O2QB 4HAUA 1JE0A 3WL5A 4S0ZA 5LA6A 4B17A 4C01A 1FUYB 3AW8A 4U00A 2P9CA 3E27A 5DYTA 1RYZA 1G291 1Y34E 1GZ6A 5ADUS 3QUBA 4I55B 1NC1A 2YNMC 3K09C 3WRXA 2MCFA 4IRUB 3I9KA 5TMEA 1UWVA 2ZJOA 2XNDD 3R41A 2XXBA 3LCJA 3URMA 1ESZA 2EJTA 4DRXA 3V6LA 4Y1EA 4HYYA 3I4LA 4YIHA 1IN6A 3PK0A 1YZGA 3L8DA 3WHIA 1XUOA 2IS4A 1RYYA 4KEAA 4A91A 4F4DA 1GNPA 1K7XB 2CGEA 4JK3A 4MKGA 1IHYA 4AMBA 4BX0A 2NU6B 3HKCB 3CUSA 2ZS9A 3AQ4A 3FMVA 3IVXA 3GYGA 1VKRA 1MA0A 2IOFA 3K2QA 4L3WA 4CIWA 1NBIA 1HV8A 4HXYA 2O3TA 3I28A 4PE5B 4YONB 1N1GA 2GM9A 3H6GA 1FFYA 3C3KA 3KD2A 3G2QA 5CVDA 4FMDF 4IR7A 3KPJA 3HVJA 2W2XA 1VP3A 4OQYA 5BUCA 1HXHA 2FK7A 5HVNA 3I04A 4GP7A 2WTXA 3VU0A 1KI6A 2WSSD 1OBFO 3DVQX 4ME6A 2CD9A 2JFZA 4RETA 1V16B 3M49A 4OJKA 1KA9H 1JG2A 3VO1A 1XZQA 4QXQA 1M7HA 3FMGA 3KUKA 5E2IA 3X1KA 1G64A 2HWYA 1J70A 2IRWA 3M5PA 1RHMA 3ORHA 3A6GA 2FPRA 4RW0A 4NBLA 4AG5A 1LLDA 3NCHA 1VL5A 1MO4A 3LA8A 3OUZA 4QDJA 5BOSB 3KR0A 1R4MA 4AY4A 4M9QA 3ITDA 4KRXA 4FNOA 1ZCBA 5CG2A 1JHUA 2FEOA 3HE3A 3Q7QA 4IIGA 1UEXC 3RBZA 4RF5A 2RB5A 4YQEA 4MEBA 1KARA 5JFOA 1YUMA 2RFLA 1Q3HA 4MB0A 4MVYA 4YO7A 1R2QA 1O4WA 3DUWA 3UBTA 3AY6A 1VJDA 2P6PA 2WVAA 2YIDA 2FUG1 4NZPA 1QFYA 4ID9A 4JVSB 4AN1A 3UWDA 3RRPA 3E3MA 2MT9A 3D5EA 3T0FA 1FURA 3AEQA 3ETDA 2QXTA 3L1UA 4ITRC 4KXMA 1L5GB 3VTZA 1FDTA 4AXXA 3BHIA 2OHOA 1NRWA 2QYTA 4IUDS 4V2IA 1VYHA 3K2EA 3LOUA 4UNIA 3VRHA 2WF9A 4IIUA 3QKUA 5K0NA 3WHKA 3ZVKA 4WOJA 4L4YA 1N2JA 2C42A 4RF4A 2QLJA 3HY3A 3INYA 3LA6A 4LXQA 3HU2A 1NVTA 3T1QA 3ZE9A 3PB3A 1G6HA 1Y63A 1UJ4A 3BFPA 4YPVA 1E2DA 1RDFA 2DX7A 2XQFA 1OH8A 2FJUA 4OGGA 4WZZA 5L8VA 3FKSA 3Q4GA 3OZWA 4ZOLA 1GIAA 5EXSA 5CEJA 1WQ1R 1M7BA 1DCKA 2I4TA 1F20A 1NVVR 2OV6A 4EHFA 4NZYA 1G38A 2J0UB 1W5TA 3DCIA 1HTTA 3WGZA 1ZJZA 1FNSA 1NQTA 2FB9A 4WK0B 3PXDA 4K1LA 4E6PA 2A35A 4P4LA 3DXYA 4OVKA 3ROZA 1LU9A 1KRHA 2C7GA 2QZSA 2VHQA 3X1XA 5T4EA 4R40A 1FQJA 4NECA 1IMJA 1DG9A 3JTEA 3NOOA 2OHJA 5I4KA 5K3FA 3K6KA 1I3CA 1VPVA 1TJ3A 1SXIA 3FGNA 1RRFA 1NJ1A 1K5DA 1N1EA 4NCBA 5EHZA 2Y71A 3AVQA 3DJYA 1LDEA 3IELA 1JTEA 3KKQA 1DZIA 4V39A 4KXQA 4UUOA 2CNBA 5COAA 5D87A 1DMSA 4V1CA 3LUBA 5B53A 4PCLA 5BR8B 4YTEA 2QUBA 5BSWA 2BMJA 3LCUA 4X1KB 1W0JA 2WKPA 2OFOA 4HRAA 4A8JA 4EEKA 5THQA 4GC9A 4JUFA 3H5LA 4AX4A 5CFOA 2W6IA 3TM4A 4RZXA 4H7DA 2FN7A 3K2BA 3ELUA 2PKCA 1N5RA 1EIZA 3F1KA 2OB2A 2ODTX 1C29B 3PJDA 3ZWWA 3UAXA 1TTHA 3OEHA 1PW7A 4FP9A 1U3TA 4KE9A 4Y30A 4HN2A 4QPNA 4DLZA 3NTOA 4RHXA 3R7AA 4JLPA 3WGVA 3Q6IA 4EGCB 4IZOA 1F5NA 1P39A 2G04A 2VTVA 4W1QA 3RREA 4RCZA 4PCVA 3QMMA 3DXFA 4KVGA 1N3YA 5DGTA 3NOVA 4YBRA 1K1EA 2J1LA 2DF8A 1AZLA 5BWCA 3ESQA 4CG2A 1WCXA 3ID6C 3NBKA 5LLTA 1C0KA 3FFAA 4DADA 4B73A 2ZM6B 1R0BA 1X9IA 3RSFA 2QU8A 2OGSA 3KOZA 4ZQHA 2OUKA 1FFDA 4XSGA 4ENPA 4PZDA 4BZPA 3PRJA 2Q3CA 1P7PA 3I1YA 1M8KA 4GYJA 1NQ5A 4G0UA 4DB2A 3V9AA 3NC4A 1D1SA 2Z08A 1GL9B 1Y7PA 1TU0A 2J87A 3B9QA 3C3AA 1C3CA 3MPUA 1DDGA 4P98A 2PTRA 3DMGA 3BWEA 4J49A 2YXLA 3IYLW 1P80A 1VA4A 3ZQJA 1VDMA 3KZVA 3M9XA 3PL1A 2NP7A 3TEMA 4EBFA 5FOTA 3MK31 2BEVB 1FP1D 2IF0A 1PD1A 3GVXA 5FI3A 4RU1A 4B6JA 5GZ1A 2WR8A 3NR2A 5E6SA 4LYGA 1WLSA 2CHQA 2P9GA 4HB4A 3GT0A 4Q82A 1C7EA 1UK9A 3FNHA 3MM4A 4JQZA 2GT1A 3ABZA 1ZW1A 4TSFA 4DUGA 8AT1A 4Q4HA 4ALNA 2HRBA 2IA5A 1KK3A 2HUNA 2P2NA 3A4LA 4KBGA 5B7NA 3U7FB 2UXCB 1XALA 4H7IA 3ZOZA 2WJ3A 1X39A 2ZGVA 1FTSA 1YXMA 1XP8A 3IAS1 3BRWD 1P7ZA 1S96A 1S6YA 1WCYA 4J0KA 4BNTA 1RPTA 4LXIA 2G8NA 3FB1A 1RABA 3L0YA 3WK6A 1I4DD 3E9NA 1YS2X 2O9JA 1R5BA 3EJ6A 3ETHA 4MVJP 2ZRDA 4NY1A 3WLOA 4Z1OA 1A8UA 5FL3A 5F77A 1FUIA 3E3LA 4FLFA 3WP1B 5CU7A 2WWFA 4YP0A 3B7WA 2D1FA 5DGHA 1MABA 3RU7A 1HNZB 3LT0A 4LCJA 5CNJA 1W5AA 2A0XA 4DPKA 1Y4SA 5K9ZA 1CQZA 4CZ2A 1GPH1 2V7UA 1C3EA 1KMHB 1K89A 4EL5A 1T5TA 2JCXA 2I65A 1Z7GA 4C3ZA 2REQA 2X0DA 1XT6A 1N2CB 3PDIA 1JIIA 3UEOA 1J0EA 4DBVO 2W43A 3B1YA 3KG2A 4WOPA 4DR3B 2V3WA 1YBFA 2W6NA 3WQSB 4L4XA 2I6QA 4RVUA 1UPCA 3BFVA 1Z74A 2IPLA 3JYQA 1QIEA 4H4EA 3LH5A 3HU5A 3O4IA 2FUSA 4AMYA 1QIFA 2R9VA 4S3MA 1I0IA 3D6NB 1HT2E 1I1NA 3COVA 2Y68A 4LYHA 4U5QA 1C2TA 3ZK7A 4EHBA 3HACA 2A9PA 4A2PA 3ZW9A 4ZVRA 4UTZA 1CUCA 1W94A 1MQAA 1FPMA 1FUOA 2AUNA 3OFSA 4O5AA 5CH8A 5EWJA 4EP1A 2RGRA 2IHBA 1G20B 1FJHA 3UJ8A 1BFKA 1ODJA 3JYLA 1JEYA 4HKTA 5JSHA 3FYSA 5ALPA 1SZCA 4V0OA 1D5WA 5J2TA 1QLWA 1BA2A 2W2MA 4H15A 4DCOA 1P61B 2Q49A 4JU8A 1CJKC 2FW1A 2QAGC 2QMUA 3KVYA 4OFXA 1YBAA 4WN3A 4BGUA 1GM5A 2ZBEA 4YCBA 3N0VA 2XUKA 4ZEOA 2JZNA 1E92A 1MHPA 2ZRNA 1VXRA 1CQXA 1T9GR 1WZCA 5DBGA 3CNHA 3KJEA 4ZU6X 2GYWA 3VPXA 2CYCA 5FL7D 1UBLS 3IUJA 1NBAA 2ID7A 2XXAB 3CLRD 2NU6A 3HKCA 2B94A 1V8OA 4B3JA 2PD3A 3DQZA 1ZI8A 5AO9A 3KB1A 1KE1A 3T4UA 3LY7A 4BMOB 2GMWA 4EY7A 5LP6A 1WVMA 3G89A 3UTCA 1I2MA 5ITZB 2I9PA 4YLEA 1RWWA 3E58A 2ZZKA 3I9V1 4M7PA 1KJJA 1D1QA 5A7HA 5E6SB 2B1IA 1DAGA 5FEUA 4WI1A 2JVJA 1P1IA 1DU4A 2X2FA 4L2IA 2VWPA 5F7XA 2ZUCA 1PJCA 1I10A 4G8DA 1N7JA 1AF4A 3MB8A 4UCWA 4L0DA 4EVSA 1R5JA 2O8FB 4X7MA 1KXZA 3KZXA 1NVDA 2H1SA 4MPDA 5CGQB 3S2UA 3ZS8A 1OIXA 1U80A 2FA9A 5LUBA 3H2JA 1XKXA 2XNCA 2F7SA 3NHSA 1HDZA 5AQ1A 1D2MA 1EK6A 5B2FA 4LOAA 1U2TA 3JQ9A 3VTFA 2FN4A 3PICA 4YQYA 1JR2A 3K9CA 3BQNB 4R4JA 2ABWA 5BQXA 2C9BA 5F51A 4RXTA 5CLFA 3KC2A 1XDZA 1RC0A 4TXHA 3V80A 2IV7A 1O2DA 4OGLA 2MSNA 1CXZA 4IX9A 1AY0A 5KDLA 3LRPA 3A04A 4DILA 1UIMA 4HGYA 3GFOA 1MT0A 4KB5A 5H5JA 4IF4A 3KZNA 3NASA 4IIFA 3CUKA 4IDOA 3T3OA 4QVIA 1KI6B 4J0DA 1WBDA 2ZSEA 5LCXA 1CVRA 3LUFA 4EATA 2REBA 1SCDA 4F45A 3HJNA 4GLOA 4WD3A 4DCUA 4RA9B 3TLMA 3TPCA 1HDXA 4QLAA 4ZDKA 5KQLA 1FMTA 4D44A 2FZ4A 1C14A 2X3FA 4WKCA 2RHWA 3NC1C 1NW9B 4Y1FA 3N8GA 4C07A 5A3VA 4WFQA 2PBRA 2ZETA 2HK6A 2VYNA 3IAXA 5A05A 1G3RA 2YMLA 1LC3A 1PQWA 2IYXA 5IK2D 1AH2A 1OLOA 1PVDA 1LRKA 2VYFA 1NVFA 4HB2A 2WHQA 3AESA 5F4BA 2I3DA 2WILA 1P9LA 3IS3A 3VQTA 1KEWA 8GPBA 4MNTA 4Q01A 2WSSA 1BDJA 2WHXA 1V1MB 3P71T 4J8PA 4DV1B 4B2LA 3T7AA 3NXKA 4NI5A 1AC5A 3G0BA 3GVCA 2G1PA 3D8UA 2WIKA 5B3LA 3AHFA 3FZQA 2NUAA 4PZ9A 4NJMA 3ASYA 4BNYA 1OWNA 4NS4A 3HCOA 4MCIA 4JB8A 1IN7A 1SG6A 3N6XA 1NQUA 3H4MA 2JI7A 4K3UA 2QUAA 1TQDA 2E4ZA 4GAEA 1Z2OX 2OXRA 2BI8A 3BZWA 1C1DA 1I4OA 3KVOA 3EWIA 3PNMA 3QELA 4FYJA 3HWSA 2EG5A 1W46A 1QM5A 4KR0A 4RDIA 3S6JA 3VMFA 1U8UA 2OWDA 4C6RA 2VQFB 4KIGA 1LUAA 1HT0A 1UOEA 3DEYX 4RVSA 5BNWA 5I01A 4OHVA 2X8WA 1L5NA 2Q07A 1J90A 2V6IA 3CMCO 2GTPA 2RGEA 3EIFA 4UJ5A 3BTOA 4QUHA 5ALRA 3IXLA 5EE9A 4ARAA 4I4TA 5F35A 4LZLA 3PNBA 3SSOA 4QJ3A 5AUPB 3GHYA 3QVUA 4WPGA 2C00A 2E6KA 1PWEA 2NM0A 1EP9A 4GRDA 4GS5A 4MW7A 4BNFA 1QGZA 5L3VA 2WHEA 2IEZA 1MJGM 1GU7A 2XF8A 3X1WA 2Q0QA 1TYZA 4TL9A 5DB4A 4F5ZA 1VFNA 4I0WB 2NU7A 3RF6A 3PPYA 2ON6A 2ZDHA 1RR6A 3V8PA 2W8BB 4BKMA 2XCQA 1R8XA 2CWDA 3EB9A 4HMOA 3RUAA 1YRQA 3CJTA 3RARA 4TMWA 2ODAA 1D2RA 4BAUA 3PE3A 4CMIA 3DEFA 2BT4A 2OAGA 5HG0A 1KC1A 3RFXA 3QBEA 1AKEA 3TB6A 1T0UA 1F2TA 4Z2YA 5DM70 4PIMA 2DBYA 4V1CB 5DHRA 4C7XA 3H5RA 3ET4A 4OH1A 1N1MA 4F4IA 5DK6A 3KHSA 5ALKA 4EHJA 1MLDA 1NVVQ 3DE3X 3QJGA 4X90A 1DC3A 1KP3A 1AZWA 5DTIA 1RYBA 4Z4CA 5JJKA 4MS1A 4OM7A 3WYBA 1DAEA 3UKDA 1NMEA 2ZTMA 2QA5A 1OAAA 2L18A 2WYHA 4Q9KA 1HG1A 2DBZA 4HBGA 3Q7EA 4M1WA 1TO6A 1CEXA 4QAQA 3S40A 1XMJA 1F60A 4DWJA 2NVWA 3F5FA 3QV2A 3JD0A 3RG8A 1I51A 2HXYA 2IU4A 3Q7IA 4MGZR 3KB8A 3LPDA 3UGJA 2VXCA 1T3ZA 3ZU6A 1S3GA 1J5PA 4FFBA 1E99A 2XRFA 2YYSA 4OBWA 4TPKA 2GSDA 1KDYA 5FAXA 1QANA 4CFZA 3TNYA 4AURA 4FI3F 3LC0A 4XOIA 4NEHB 1R10A 5LWQA 2JJ2D 1RADA 4NYJR 3T3HA 3KAKA 3KZMA 4I9GA 4B3TB 3RKUA 4ZOQI 4I5EA 1ZH6A 1PV1A 4JY7A 4B35A 5AM3A 4DMHA 4ZAXA 3PSAA 3UKOA 3ZHZA 1SH7A 1FUQA 1N0VC 1HLGA 3TVYA 2G40A 4J43A 1BEEA 1OROA 2FUKA 5F1OA 1R9GA 2H1IA 3AG5A 4MMXB 3W5JA 1LXCA 1Y4AE 4KE7A 2ZE6A 6ABPA 1XZMA 5CBPB 4O8CA 2G8LA 2HGZA 5GJCA 4CMHA 3PF8A 1CK4A 1M1YA 1P1CA 2ZBFA 1WKCA 3BB1A 4FJ1A 4LG1A 1NJ2A 2LGJA 5EIWA 4CLEA 1NXVA 3B48A 4YI5A 4RD3A 1BWRA 2AQIA 4DG8A 3HCFA 5IRCD 2NUPB 4JI2B 1KETA 4DV6B 5AJHA 3L8EA 3DZKA 4HTFA 4W9NC 1G2QA 2C97A 5CLLA 1K5GA 4A6EA 3H86A 4B76A 4Z6KA 4D5GA 5JS6A 4O8ZA 1USVA 4KKVA 1Y5MA 2OFWA 4QXMA 2J5KA 5CAEA 1XQ6A 5AIBA 2V7PA 3AC0A 2ONZA 1WNFA 4JI8B 4B8WA 1UC5B 1FL9A 3QKWA 5KQGA 4U3JA 3VOBA 1E0AA 3I0ZA 4Y9TA 2WMYA 4LXGA 3LE8A 1Y1LA 3UHAA 5JNVA 3T61A 1XGKA 1Z73A 2H5LA 1R1DA 3WGMA 4N0QA 4DG5A 1IONA 1NXSA 2E5WA 2OBXA 2PMDA 4KN6A 4Q3CA 2XHZA 1O94C 1KZHA 4DS3A 1UJ6A 3TNLA 2Q9BA 1JAZA 2YY7A 1QYRA 3HBFA 1ZUWA 3ODPA 1JFTA 4A26A 1OAOC 4ZXFA 1QVZA 2BBWA 4UTNA 4HB0A 1NI4B 1YK1A 1IIRA 1B1CA 2CSUA 2D62A 2N1MA 3W5IA 5AUNB 2FW8A 1QNFA 4H7KA 1RMTA 1U9ZA 1RJGA 2H57A 3FSJX 5CM2Z 1G21E 2Q2OA 4BVLA 4MRPA 1ZU5A 5TGTA 1EZ1A 5ALIA 4Y8VA 3UMMA 4TMKA 4KDCA 4AICA 1FSPA 1JAXA 1E94E 3ANSA 3CSUA 3OUUA 3JAWB 5KTPA 5I3CA 3PG5A 3LC7O 1UAYA 2WLTA 4NFYA 4PC3A 4ZI2A 2Z1DA 3LX6A 4KREA 1E4VA 1ZICA 1QHFA 3QUQA 4K6FA 2R8RA 1TJ5A 4WOCA 3ICCA 3RS9A 5B1EA 4GT1A 2QE7A 3BDIA 1E6UA 4MW4A 4RQAA 1Q83A 1NYTA 2HU7A 1GG5A 1TXGA 4DNFA 2BTQA 3IEIA 5LIRA 1JQ5A 3PFKA 1NUSA 3D6UA 2KI5A 1HSOA 2GYUA 4P0PB 3QTTA 4TVKA 2O5CA 4KWEA 2HCRA 2PWAA 4ETNA 1VC2A 3KTDA 2PAAA 1FRFS 5AW1A 1KI7A 4XWAA 2EJUA 4K8RB 1XPRA 2IY8A 3SKYA 3TD2A 3Q3IA 3OE7D 4GO1A 2FG5A 1TAQA 1VGRA 2YZKA 3EEQA 2B6NA 1Z0ZA 4KGDA 1JR4A 1FPQA 1EXWA 1G6OA 3B5EA 2PUWA 2V98A 1UBOS 4B3GA 1ZK3A 4Y6PA 2ZR7A 2J9YB 1HT1E 4J94A 2BGJA 3R7WA 2CJWA 1O9BA 2HWWA 1ORVA 2V54A 1Z8HA 1B14A 3R3WA 4WNCA 4ARVA 3WXMA 3FWYA 2FRXA 3K70B 3VKHA 1TTPB 5DO9A 1E3EA 4JLNA 1J8FA 2G0AA 2RGAA 2X7HA 2EFHB 3VI4B 4MAAA 2ZUWA 1XXHE 1X7ZA 1REQA 2HQOA 4JKOA 5IMBA 4AN4A 3LW7A 3O94A 3CVWA 2IFTA 4WHMA 5FT9A 4RXMA 4OL9A 1MO2A 3IKJA 3CUUA 3K35A 4P3YA 3ZH9B 1QTRA 4Q4DA 4V0SA 1WP4A 3IRUA 2VJMB 1NF8A 1GILA 3D6FA 2JIQA 2C5LA 1PJ4A 5I4IA 5JATA 1YNSA 1FJXA 2G09A 1QP4A 1N5KA 3L5KA 1UWLA 1NR1A 3I04M 2P8JA 2I1LA 2QTVB 3VOTA 2HSZA 2GM5A 4MEJA 4OAQA 5REQA 3A14A 2GRJA 5AJZA 3MCUA 1UXHA 4ZVOA 4PRZA 3W3AH 5HGXA 1JL3A 1B3RA 3AEKB 3DL7A 2O7VA 3CLVA 3CTMA 3OZRA 3OZSA 4NK5A 2Q5HA 5KEIA 1KYZA 1WDMA 1N1DA 3D81A 3PQ8A 3JS5A 1SD5A 4X0EA 2E4YA 4HDMA 4EB3A 2MU1A 1CZRA 2CF5A 3D5QA 2ZJ3A 2A59A 2WZCA 3JX9A 2C88A 2ZYSA 3MRXA 1M72A 5BW4A 3MWFA 4FR2A 3TJMA 1IK6A 1CETA 5CT9A 1QQ6A 1YJAA 2DFKB 2Q21A 3HA3A 4FOTA 4JJ8A 2P3OA 4BV8A 4CETA 1ORDA 3OF3A 5JZSA 1QHIA 3KOUA 3FUXA 3UUEA 2JZOA 3N1UA 3C7KA 5M34A 1YIAA 3C87A 4HDRB 3V1TC 4ND4A 2NQTA 1W6RA 3TGWA 3FCUB 2OBNA 2C59A 5LL6P 2CV1A 1TNDA 4KGZA 3ER6A 3PX3A 3CZRA 3SR0A 3SZOA 2DM6A 1C80A 1U3CA 5E9JA 1ISMA 4QARA 4QTXA 3BB4A 2OILA 1AV6A 1AMUA 4E08A 5E1OA 4FZ5A 5HTKA 4D80A 4PHGA 1M2JA 4XVUA 5CCBA 4YASA 3DE7X 1PR4A 5AKIA 5KNBD 3JARA 4IDNA 3CJQA 4HBZA 3JY6A 4LZNA 4N03A 1O6ZA 3AESB 2GO1A 2XGMA 2VSFA 2QD3A 3MT7A 4NIMA 1K6MA 5AJVB 1YH3A 2ZIEA 3MD0A 4BOYA 1IBMB 2BKLA 5KWIA 1PQPA 3AUUA 5LMUB 4TYYA 2XE7A 2VNJA 3NORA 5HW2A 1BFUA 5FNVF 2ZDQA 3LWZA 5HHTA 2FW7A 1T29A 2HJSA 2R7MA 1TJYA 2LDBA 3DHEA 4FKMA 1D2HA 1KP9A 4OHFA 4UJ3A 3OZBA 3L4EA 1UBFA 3BN3A 5TE9A 4C7OB 3OMXA 4BXOB 4UUNA 2ZEJA 3WA6A 4QG3A 2X4IA 4RGYA 4GX5A 4Q1DA 4OLFA 4P7FA 3KUUA 4RK4A 5EWMB 1XCJA 4RCYA 1XRPA 1POXA 4Q3BA 4DWVA 4E4RA 4KE6A 1GVHA 1J2RA 3HB4X 4R84A 4LJ9A 5HCNA 2EGHA 1KNQA 1G8KA 2XIJA 4PF1A 3TBHA 1I7DA 2IEDA 3ZYZA 3IERA 2O7QA 1M83A 2ISCA 1NYQA 3I6IA 4PLVA 1E62A 5DGDA 4TTRA 3LY5A 1DBPA 1QF6A 3ZHXA 1SHTX 2DH6A 5F91A 1W75A 1V37A 1XWIA 4HWTA 5K5EA 1BCSA 2ATVA 3H2GA 4L1KA 4YJ2B 1Q5PA 3O38A 4TLCA 3JZIA 4CEHA 1WKVA 2O57A 2KLHA 3MMXA 1L3BA 2OQVA 3TOSA 3IC5A 5LFAA 1PFGA 3DB2A 4WL0A 1E3QA 4JYPA 1X8LA 4KXWA 4OPMA 1RT9A 1UFVA 1ZVVA 3AFOA 1A8SA 2BM0A 3DQPA 5I8ZA 3I05A 3ND7A 3DDNA 1GFSA 1BHJA 3TDKA 2VA8A 4KLCA 2IOYA 3U5TA 3U1BA 3HBNA 1QR2A 3CCBA 5THKA 1X7WA 4I8XA 5JY6A 1Z22A 2Q1WA 3DBRB 2Y4OA 2BRUC 4HFJA 4C7JA 4ZYLA 3TYXA 5NULA 1SKYB 2I8CA 2FQWA 1VLLA 4UBMA 4OK5A 2Y0CA 1H8EA 4WADA 2OLJA 2Q7XA 3SFTA 1DGQA 2XWBF 4JQYA 3KXKA 4HAOA 4RFSA 4WUTA 5J58A 4KPEC 3RKSA 2P6OA 2H9IA 1N0HA 5EXTA 1K68A 4URZR 3CW9A 3AHHA 5IEBA 4ZGGA 1NMQA 3HC7A 3B51X 1GDHA 3M4XA 5C37A 3ZDEA 5KJ6A 4GH5A 5ALHA 1E6CA 4RXUA 5AK3A 3AVTA 4RK7A 1VPEA 1K98A 4AZWA 5DASA 3PV0A 4QU5A 4B4DA 1ZK4A 2GN4A 4KXVA 4P81A 4LSZA 3OTGA 5H9WA 3L2OB 4CDGA 4KMMA 2VZLA 4I8IA 3ZW8A 2VUTA 1IN5A 1I6MA 3DNPA 2G70A 5EMLA 2AG6A 3O8OB 5ERYA 1ISIA 3ZHRA 4WZ6A 1K7EB 1U7WA 4EQZA 3IAEA 4EMTA 1C9YA 3BGIA 3VR3D 4LDQA 4MROA 2FWNA 1EAYA 1SIWA 2WY2D 1OLSA 1MX5A 1RP1A 2PZGA 1ND5A 1U7TA 3RWBA