3BWVA

Crystal structure of deoxyribonucleotidase-like protein (np_764060.1) from staphylococcus epidermidis atcc 12228 at 1.55 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
177
structure length
167
Chain Sequence
TRQRIAIDMDEVLADTLGAVVKAVNERADLNIKMESLNGKKLGLVMDILKEPGFFRNLDVMPHAQEVVKQLNEHYDIYIATAAVPTSFHDKYEWLLEYFPFLDPQHFVFCGRKNIILADYLIDDNPKQLEIFEGKSIMFTASHNVYEHRFERVSGWRDVKNYFNSIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative 5'(3')-deoxyribonucleotidase
publication title Crystal structure of deoxyribonucleotidase-like protein (NP_764060.1) from Staphylococcus epidermidis ATCC 12228 at 1.55 A resolution
rcsb
source organism Staphylococcus epidermidis
molecule tags Hydrolase
total genus 49
structure length 167
sequence length 177
chains with identical sequence B
ec nomenclature ec 3.1.3.-:
pdb deposition date 2008-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 3bwvA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3bwvA01
4Y3UA 3UMCA 5IT0A 1Z4PX 3PDWA 1QQ5A 4YIKA 1S2OA 1Z4KA 3FGOA 2JAOA 2D2VA 2WF6A 2GMWA 1L7OA 2B8EA 2WHEA 5AM0A 3KC2A 5AK5A 3SD7A 1YS9A 3W5DA 2W43A 5AI0A 3QUTA 4NWIA 4Y2YA 2EARA 3U7EB 3WK4A 4OHFA 1O08A 5AM3A 3WK6A 2I54A 3QU9A 2GFHA 3UMGA 4AS2A 4HGOA 2WM8A 2GO7A 3ZTWA 1U7OA 2FUCA 3EF0A 5AVWA 3N1UA 2CFSA 4EX6A 3KOOA 1RPZA 1VJ5A 3W5BA 4XPZA 5ALIA 4IFTA 5AI8A 3ZVLA 1J97A 3QU7A 4AP9A 1VFPA 5ALNA 4NFLA 2ZBDA 1IWOA 4EENA 4YCMA 3ZX4A 3KD3A 3OCUA 4O8CA 3I1YA 4L6AA 4QJBA 1ZD3A 3M9LA 4UASA 5ALSA 4C4RA 1EK1A 2O9JA 3AR2A 3FZQA 3FVVA 2ZBFA 3L8GA 2HF2A 4J2TA 1ZD5A 5ALEA 2C4NA 3KBBA 3VAYA 1T5TA 3OCXA 1ZS9A 3DV9A 5T41A 3QUBA 2BDUA 1RQNA 1ZD2P 2G80A 4UW9A 5AIAA 2HOQA 5ALUA 5AKJA 3N07A 3RF6A 3A3YA 1O03A 4KYTA 1Q92A 5AW9A 5AKIA 4C4TA 3ESRA 3DNPA 2YJ5A 2YMQA 1NF2A 4NV0A 5AVRA 4UMEA 1ZD4A 2G1AA 2FEAA 4YCLA 3EPRA 3E84A 2RB5A 2YMPA 1SWVA 5ALPA 3BWVA 4L57A 1K1EA 3QU2A 5ALFA 4UMFA 5A3SA 3SLRA 4BX3A 4UU1A 5AESA 3B9RA 4E88A 4ZEVA 5AKLA 1F5SA 2I33A 4Y2JA 5ALKA 5A3RA 3ZW7A 3ET5A 4UM7A 4CE6A 2FUEA 3L8FA 1QH9A 5AM5A 2GHQA 4J03A 3NUQA 3AR6A 2C8LA 2HSZA 3QUQA 4Y2RA 3L1VA 5AW1A 1Z4MA 1U02A 3NALA 4EX7A 3GYGA 1RLOA 2B1QA 2YJ3A 5ALLA 3BA6A 5AW0A 3L5KA 1ZOLA 5AVZA 1WVIA 2CFTA 3N5KA 5AW6A 2OBBA 4BX0A 1VJRA 1Z5UA 3ED5A 2FI1A 4YIHA 3U7FB 4ZEWA 2G06A 2JGAA 4QQFA 5AK4A 4NABA 5FP0A 4OFZA 3K1ZA 2P69A 5ALTA 4YCNA 2I55A 1NNLA 3WK9A 2R8EA 4IG4A 3WK5A 2WF5A 2YFYA 4MUMA 2MU1A 3QXGA 2IOHA 3A1DA 2P11A 5ALQA 1SWWA 1U2TA 1RQLA 2YJ4A 4HGRA 5ALRA 5E0OA 2O2XA 3DDHA 1TJ5A 1SU4A 3OCVA 2B8JA 3R09A 3R9KA 4FFDA 3OPXA 4G63A 1CQZA 3I6BA 4I9FA 2NO4A 1RKVA 2JAWA 5ALWA 4KX3A 3AR9A 3ZWDA 5AI6A 4H1WA 3NIWA 5AM1A 1TA0A 4HGQA 3NANA 4L6CA 1L8LA 4HYTA 4Y2QA 3L1UA 3ZWKA 1RKUA 4FYPA 4BKMA 4EEKA 4UMVA 3EF1A 4UM5A 5ALJA 3WKCA 1XP5A 3QUCA 1L8OA 3DAOA 2G08A 3ZU6A 3FM9A 3SHQA 3U19A 1WPGA 2VKQA 1RMYA 2X4DA 4B6JA 4DWOA 2HEGA 3A1CA 3IRUA 3M1YA 5AICA 2AMYA 3FPSA 4I9GA 4Y2XA 5ALMA 3QNMA 1RMTA 3L0YA 2C9MA 4CNQA 4CF3A 2ZOSA 1U7PA 1Z5GA 5AI9A 2AGVA 1RMQA 1MH9A 2YMLA 2I7DA 5JJBA 4OCZA 4GXTA 4EZEA 1PW5A 1XPJA 3MPOA 1QYIA 5AI5A 3U7HB 2JARA 3P96A 3UM9A 3E8MA 4ZEXA 5AW4A 3PGLA 3E58A 2IYEA 3ZTYA 4F71A 3U7GA 3N8GA 1RDFA 2IOFK 2ZG6A 3AR5A 4BEVA 2IA5A 1N9KA 2HI0A 3AR4A 1YV9A 2YBDA 5AVYA 1WR8A 4DW8A 4C4SA 5AKYA 2FDRA 3WK8A 4DFDA 4XOUA 1AQ6A 2C8KA 4RESA 2R8ZA 2CFRA 4MWOA 3ZX5A 4BYGA 4EELA 4KNVA 2HO4A 2RARA 3NRJA 1YMQA 3NAMA 1RC8A 1YJ5A 5AW2A 3W5AA 2W4MA 5AK3A 5ALOA 2G07A 3QGMA 1X42A 5AVVA 2G09A 4BBJA 2I6XA 2PR7A 3B8EA 4Y2TA 5ALZA 1S8OA 5AVXA 1Z4OA 2RBKA 3WKEA 5IT4A 2WFAA 3L7YA 2Q4TA 4UU0A 5AK6A 4BNDA 4G9BA 2G0AA 3FPBA 3PGVA 5AVTA 2Q5EA 3ET4A 5ALDA 2ZBEA 3MC1A 2HCFA 3HYCA 3L0CA 5ALVA 2C88A 4RETA 3SKYA 3PCTA 5A3QA 5AKXA 1RRCA 3EWIA 2HHLA 1Z4LA 2MSNA 3SKXA 3QYPA 3D6JA 2WF9A 2OA0A 5ALHA 3OCWA 4HGPA 3QU5A 4KX5A 3OTQA 3MN1A 3ESQA 4KNWA 4NAVA 2WF7A 5AIBA 1KYTA 3B9BA 3RFUA 2ODAA 3J7TA 2FPRA 5ALYA 3U26A 4PNHA 5AKEA 4YGYA 1Z4NA 2HF7A 1L7NA 1RLTA 1ZRMA 2HDOA 3MMZA 3SMVA 5AW5A 3OCZA 1XVIA 4UARA 2FPXA 3TLMA 1RKQA 2NO5A 1Y8AA 4UAVA 2JAUA 3L8HA 2RAVA 3UMBA 5AKGA 3F9RA 2OYCA 3WK7A 5AM2A 2Q4RA 2YN4A 5AW3A 3ONNA 1ZJJA 2R8XA 2GHTA 4FE3A 2B0CA 3S6JA 4Y2VA 4JDPA 3ZVMA 3L0BA 1Z4QA 1L7MA 5AM4A 5AHXA 1YNSA 2P9JA 3NASA 4XE5A 5IS2A 1WZCA 2PQ0A 4CF4A 3ZVNA 4OD0A 2YMMA 5AI4A 3WGUA 2DQSA 4F72A 1YDFA 2ZBGA 1T5SA 3IJ5A 1T9ZA 1Z4JA 2YJ6A 4DCCA 3AR8A 2AUTA 4UMDA 4HGNA 1ZRNA 1NRWA 4JB3A 1RLMA 3WKBA 1QQ7A 3WKDA 4CF5A 2B1RA 4HAIA 1TJ4A 2FPWA 5AVUA 3SF0A 2FPUA 2FPSA 2OM6A 2R8YA 4BNDB 4Y2UA 1TJ3A 5ALXA 4Y2SA 1LTQA 1Z88A 3W5CA 5AKHA 4UATA 2W11A 2B82A 2AH5A 3A1EA 3HLTA 3I28A 5AW7A 4KN8A 2HX1A 3N28A 4BEWA 1U2SA 1FEZA 3E81A 2BY4A 5AVQA 2EAUA 3KDPA 3AR7A 2IOFA 3IB6A 1TE2A 1EK2A 2PKEA 1J8DA 2YY6A 3L8EA 4GIBA 1L6RA 3ZI4A 1JUDA 2P27A 1Z4IA 3QU4A 5AW8A 3I76A 2BDEA 2QYHA 3KZXA 2QLTA 3QLEA 2WF8A 2B30A 3ZUPA 3QX7A 4Y2PA 5AVSA 1Q91A 3R4CA 2ZXEA 4XQ0A 1CR6A 1L7PA 3AR3A 1QQ6A 1LVHA 4UAUA 2I34A 5AKKA 4YH1A 3WGVA 1N8NA 4AS3A 3WKAA 4BX2A 3OCYA 5ALGA 5AKZA 3CZ4A 2CN1A 2NYVA 2EATA 3CNHA 3U13A
chains in the Genus database with same CATH superfamily
3KFLA 1XAGA 3GVCA 3UMCA 4GMKA 2QG9A 1NZFA 4LF9B 1SUDA 2H00A 2I2BA 5L7WA 4I14A 2SBTA 3CW8X 3GARA 3ILSA 3NHUA 4C2BA 1TJPB 2HCTA 1ENPA 2ZUBA 2NIPA 2C0QA 2GUGA 2WF6A 3QX9A 4QOHA 5JANA 5LIPA 1L7OA 4C7JA 3Q7IA 4G0VA 1K9VF 3E9DA 4FGJA 2G9VA 4X63A 4ZYYA 1LLFA 1R9MA 4HMPA 4C30A 4WGFA 1W25A 1EQUA 2BRUA 2WVJA 2A4MA 5HKKA 4X8HA 1A5AB 1X3SA 2DFNA 3D7MA 4PY2A 4CG2A 1M3SA 3CF4G 4N3CA 3TAHA 4PCVA 1W0JD 4BO8A 2DBVO 3FWKA 1D03A 4R16A 1VM6A 5CFZA 1RJEA 1URPA 1CIVA 5FIUA 4BNGA 1GGHA 4BB0A 2KW5A 1H8EA 2RHHA 3D0OA 4HDKA 1ZG3A 3OU6A 3U0VA 4CKXA 3AY0A 4Q4AB 3B20A 3KU1A 5B37A 5B3LA 2XECA 2B0JA 2I7VA 3QEOA 4O4HA 4V0LA 4C3VA 5CITA 3M6VA 4K87A 1A1SA 4PZEA 3IP9A 2PZKA 3LRXA 1A2QA 2D1FA 2HA3A 4AJ4A 1KVRA 1KXZA 4QODA 2CBXA 2ZATA 1QHFA 1YZHA 4YACA 3STTA 3MINA 3IBCA 4D2IA 4DSNA 1RPZA 2FFAA 2XZPA 1VA5A 1P5JA 2NXJA 2ZSEA 3BD7A 3RABA 3TKAA 2PZFA 3Q40A 4KNYA 1FJHA 2P3SA 1NQUA 2HCJB 2OBLA 5K4GA 4R4JA 4I55A 1U8AA 4GNKA 3TRDA 4V0MA 3W5HA 4I2NA 4MUGA 1OKKA 5ELMA 2PUVA 3D54D 1A98A 3S2IA 4EY8A 1CJUC 4N7RA 3WFIA 1H8HD 3N8DA 3I62A 1NR5A 5ICSA 2X40A 1SVMA 5DYIA 5ALSA 4NCAA 2FZ5A 3OWOA 3BXHA 1BXRA 3HY4A 4LE2A 3L6EA 4WXYB 2O9JA 4PINA 1TYBE 4L75A 4MV5A 4CM6A 1MB2A 4C5AA 4IZIA 4PFSA 2YBEA 1B6RA 2QPAA 3QFCA 3TUIC 3PR2B 4GNRA 5BUCA 2KI5A 2NSDA 2QR2A 3PHLA 4RIEA 1MTOA 1T5TA 4RIGA 4DV7B 3IJPA 4E03A 1QG4A 3K96A 4ZPXA 1N1EA 5A62A 4P7BA 2YUIA 3C3BA 1ZD2P 3CVOA 2J9FB 3PD0A 2QAGB 1QH0A 4U9HS 2A0KA 3D2AA 2NXCA 4YAGA 3QV2A 2QROA 3K5IA 1ABEA 2ZYDA 2IU6A 3PNOA 4LC0A 5EHIA 5FXMA 5LCXA 4LXXA 4CM1A 3QXSA 1XTRA 3PDIA 3TSAA 5FNZA 3O6VA 4QOFA 2C29D 3CF0A 1N2HA 4G67A 4P81A 5IABA 1E9CA 2OQ2A 4YDSA 2Y76A 2B36A 3DZBA 3I4CA 4DBVO 3CUKA 1HY0A 1SK9A 3DXZA 1G20A 1U81A 4UU7A 4WFKA 1Z07A 1WHTA 3RYCA 4KFCA 2BMEA 4ZRNA 5BOVA 4CL0A 2YWFA 3NWEA 4K26A 1XMJA 5SYMA 2WOOA 2H17A 5LLSA 1JFSA 2IE8A 1JAHA 3OFJA 2WPDA 3HXPA 4UMFA 2ZVPX 3HXKA 4WL0A 4JI1B 3VYUB 3ZE2B 4M7OA 3IL2A 2QUIA 3SVTA 4PLFA 3WAKA 2A78A 3PPVA 3EAGA 1RI2A 3F5QA 2C0CA 3P9CA 3K1AA 1GPYA 4Y2JA 3T1QA 3UJHA 4AG3A 2HRQA 1CB0A 3TQCA 3H99A 3HPQA 5CDTA 1ESDA 2D74A 2I67A 3RUFA 4BQSA 1UKEA 4JP3A 3UENA 3GG9A 2XRZA 1QWSA 1LV8A 2XVZA 2YIJA 4RVCA 4YMIA 5M29A 1KAGA 3QMWA 5AJYA 1JIJA 3QF4B 4NU5A 4D3YA 3CUEF 2WT8A 3P5BA 4HLUA 5HWSA 4EUEA 1T5DX 2MR5A 2VDKB 3DB2A 1ZR2A 2BGJA 1JHAA 3DC7A 5AW1A 1MJGA 1PN3A 2VPXA 4R2WA 2DEUA 2X7JA 4GDFA 1CCWA 3P5SA 1AZSC 4M46A 3RTCA 1RW4A 1XMOB 2EZ4A 3QBVA 3RSFA 2V7QA 3BG5A 4UC0A 4D26A 2DERA 3OJXA 5A3VA 3VKHA 4PRKA 1T4DA 4QYXA 3INTA 4E1BA 1LFDB 1U15A 4LBWA 3AVYA 2PKYX 1H4TA 1ZU4A 4DHEA 2GTIA 4I99A 4LXUA 2VQ3A 3WGMA 3OBIA 1Y7LA 3N74A 4YY3B 4LNHA 2B99A 2ZM5A 3PUHA 4QPCA 2IGBA 4B83A 5ICGA 3C97A 3FVRA 2VHEA 4N82A 2ORIA 3BMOA 2JAXA 3BAZA 1KFEB 3JQ8A 5A06A 1Q1QA 1GL7A 4NV1A 3LGSA 4LRWA 3V1YA 4BZXA 3MNFA 5DM4A 1NQAO 1NW7A 1IXYA 2EFHB 1NASA 3VV3A 2XZDA 4D8VA 1N5DA 1JE1A 3HYSA 3DR5A 4COOA 1C4XA 1A3CA 3BB4A 1OXMA 5JASA 3GLFA 2FQYA 2ZBRA 1B7GO 1E1LA 1FNDA 3QMMA 5B2FA 2M1XA 4MW9A 3T5DA 3JVUA 1ARZA 2V9ZA 5CLJA 2XIQA 1VJ0A 2A8YA 3HB0A 1WXWA 2IIBA 3JTMA 4OAPA 1QORA 5DNWA 2O3SA 4AY4A 4II7A 1OR8A 3WZLA 4AJIA 3LU1A 2DBQA 1KYXA 2E1RA 3CEPB 4DV2B 2IVZA 1TOAA 3C1UA 4PM4A 1P2BA 3B38A 3F6EX 3A4VA 3QENA 1H2WA 1PS8A 2GN8A 2I8AA 4C0KA 3F9IA 1TIBA 2O1SA 1YB2A 1O6BA 4DV5B 1XK7A 1BCSA 4LZOA 2ZRJA 1Z0KA 2BF7A 2XB8A 2BFFB 3GD5A 1Q16A 5LOVF 3DE4X 1P7CA 1WUTA 4D5GA 3ZLBA 2X22A 4UBMA 4G09A 4U6QA 1QRRA 1I9CA 1THMA 5G4LA 3A4MA 3FR8A 4OXKA 1YSCA 2WFLA 3EF1A 3WB0A 3K6SA 2VPPA 3ZCSA 3HA3A 2G1PA 3FNHA 1W4RA 1L8OA 2HU8A 1SUAA 3LL7A 4P9NA 5A5EA 3MGCA 4CJXA 3MJRA 5L51A 1BQEA 5CPFA 5BT8A 5L3SB 3HDJA 1Q77A 1RWVA 3Q9UA 3DQZA 2O4CA 3EBLA 3ICOA 4CCWA 1G59A 1Z2OX 3DMHA 5KSOA 3FCEA 4Q02A 1QM5A 1PL6A 3BUSA 1FCJA 1RT9A 1NDUA 3ASUA 4OK6A 4XGQA 3RTGA 5EUCA 1BOFA 5ALMA 3SHOA 1UFKA 5IW8A 2LCQA 1RMTA 5EHXA 4UQLA 2PKQP 3T9AA 4K9RA 4WLNA 2ZVDA 3HV2A 3BORA 4JLBA 2E0IA 5IRCD 1EFPB 2QBYB 1OTYA 2VDUE 3T8YA 2XZTA 3GZTB 4NMLA 3BK2A 1ZYUA 1IHUA 1E6WA 4JU8A 2EVWX 5AI5A 4EGSA 3WJ7A 1LH0A 3UM9A 4CLXA 2WYWA 4X1IB 1E9FA 1WUJS 3Q2OA 4QRHA 2FF5A 1FMLA 3S5JA 2ECQA 2P6PA 4DWWA 3IBFA 4TS1A 4AS1A 1FFAA 1I7SB 3SFVA 2UYCA 1NI4A 1NPYA 2P35A 1X1EA 3D6TB 3QBTA 4L9AA 1XD2B 2NAPA 3OQIA 3D5EA 4H9GA 2O5RA 4FK8A 1RYEA 3WYCA 4TKZA 4TVBA 3RU3A 4OJNA 1MX5A 1LLQA 3QE4A 4WMLA 1N2XA 5IJ0A 5FNVB 3GELA 5AOAA 4DW8A 2I4NA 4TV8F 5HOQA 4BEBA 1KRXA 1AQ6A 1M8FA 2H8GA 4HNGA 4MWOA 4LTDA 4CDNA 3RYIB 4AURA 5IF9A 1NJ6A 4LCJA 5KINB 4M1TA 4CEJA 1Z2DA 4J0DA 1YL6A 1GSAA 4KXVA 3TD2A 2YASA 2J30A 5F9MA 2J32A 2W4MA 3WTCA 2DJIA 4PYJA 4GL2A 3FTPA 2FZ4A 4W9NC 2HQBA 1WTCA 1EFAA 3OPMA 2QM8A 1DX6A 2FK8A 3KQSA 1GFWA 3IBGA 3D1JA 1HUQA 4HNSA 4IGEA 4MDHA 2JVKA 2ONYA 3MT8A 5ALZA 3BWXA 2J6HA 2O0MA 4WPGA 1R4AA 3GRFA 3CM0A 1S01A 1ULTA 3P0IA 3RW9A 5TMDA 4E46A 3Q2KA 1GLVA 1E6KA 3FDZB 2WC1A 3KSAC 4G9BA 3IQFA 3DT8A 1RWOA 2CBZA 4D4MA 2XQVA 1EAMA 1V1JA 4RZHA 4Q3OA 3IESA 4N47A 4A2WA 3SKYA 2R6DA 5LSAA 4MR8B 4MV6A 3A11A 2EL9A 3X2SA 4Q1FA 4ZAGA 4C4ZA 1QE5A 1FYWA 1Z4LA 4QYSA 1VYTA 2R48A 3VBCA 4XVCA 4LYEA 4CT5A 1JDSA 2BE9A 1D0SA 1KFBB 3LQ4A 5G1NA 3OCWA 2ZITA 2FSPA 3NXKA 1ZAKA 3NBYC 4QYIA 3FI9A 3OTQA 4WLOA 5EG5A 2BTOA 2IXAA 2Z58A 5MN6A 4ZARA 1FMTA 3HM9A 5CHEA 4DLXA 4KKVA 3MB5A 4NE2A 4D57A 4MO9A 1ODIA 3M5CA 5DASA 2BFWA 2GM3A 3NYQA 3R7DA 2BFBA 3IEVA 5ELLA 1QG6A 3PGKA 3ESXA 4RUKA 4DLZA 1L4NA 2I65A 5JQWA 3SR3A 4IUDS 5AJZA 3L7MA 5B3KA 3TSCA 2VTVA 3DHWC 3F5SA 4JODA 5BN5A 4KQXA 4MCIA 4HFJA 3DEJA 3G6KA 4WZAB 1CQXA 3C87A 3U62A 3USCS 5JBIA 1PZFA 4NCXA 2X0EA 5CFNA 3F78A 1L7BA 1QUEA 2MYNA 2D62A 2IYXA 1P1FA 2DHCA 2RAVA 3OA0A 3DZJA 4QBKA 4UEOA 4XD7A 3R7FA 3SZOA 3TJRA 1WTAA 2YC4C 1WKVA 1U8XX 4YI5A 3AJDA 1PSWA 1Y82A 4FE3A 4K6KA 4BGDA 1H9BA 1OLSA 2ODQA 2ZROA 1PO7A 5FORA 1XOIA 3HA7A 1G5RA 4OHWA 2RGBA 1YI8A 1DT5A 2AOTB 5H02A 5AHXA 5DB4A 4X3OA 5BVHA 4XE5A 2NTVA 4LHSA 1JR3D 1WZCA 3P9IA 3RRXA 1OWMA 4D0NA 1ZPDA 4JUFA 4MGHA 4ZGBA 1IUKA 2POCA 1KPGA 4KG7A 1VXRA 4MGZR 1II0A 1QGED 3K2IA 3RS5A 4K6HA 4TLMB 4TZ6A 1DC3A 1T5SA 1RQXA 3I2JA 3UHJA 3IA2A 3AHHA 4Q01A 1RU3A 2QXTA 2VFAA 4GKAA 4YJ2F 4M1YA 3P9KA 2F2TA 5IP5A 3O4JA 4RHTA 5EGSA 3EG9B 5EIAA 4LHVA 1DDIA 1N1DA 1XKLA 2P9TA 1N8TA 5DT9A 1EA5A 1ZN9A 3U6KA 1ZUIA 2PSDA 5D00A 1FIUA 2XGJA 4TYWA 2GPJA 3KXDA 4ZXFA 3FSEA 1ENYA 4HEHA 2WWTA 2B83A 4PBRA 5G1OA 2H1RA 3VPCA 4Z9XA 3SI7A 5F2EA 3SF0A 2R8YA 3AG5A 2OM6A 3ADBA 4ZVNA 3ZV4A 1G21E 2Q5OA 4WCDA 2YHSA 4WNYA 4GKKB 3AY6A 4PO1A 2Z6UA 2QN7A 2OHVA 1H6AA 1NFFA 1DCMA 1KZGB 3NDJA 3WX0A 2IV3A 1BGWA 2QS9A 3HLTA 2FEOA 2W2KA 5DX1A 1RI4A 2A92A 4MVJF 5D3KA 3ZWCA 5JI3E 5LKAA 3KETA 2HX1A 1JDPA 4BEWA 1RFGE 5JPIA 2PRIA 3SG0A 5I5EA 1MW9X 1Q3KA 1SVNA 2BR4A 3GJ8A 2J45A 1O96A 3NPAA 5EWMB 5EJ8A 3V2IA 1G42A 5J2TB 1LK7A 5ARCA 3GLIE 1P2GA 2OEPA 3IB6A 2Q2OA 2JFVA 1GCIA 3JAWB 3O90A 3O8LA 4FPXA 1O9BA 4V0SA 3U49A 2KS6A 1FL9A 1L5WA 2JKZA 4BNVA 1J8DA 2YY6A 3CRRA 3AW9A 1M34E 3KLBA 1Q7RA 3GA5A 1XCLA 3H3JA 1D04A 3I8OA 3KZMA 3VR3D 1Z8NA 1G8KA 1MX1A 5KYGA 2XDAA 3HJCA 1X8XA 2QR5A 3PQDA 4O6VA 4OUDB 4PQFA 1Z35A 4OQPA 2NX2A 3ETGA 3ZY6A 4PZCA 5EERA 1K7WA 4ZGWA 2A9RA 2B6HA 2VSOA 2C9BA 3L6BA 2XBLA 1G5TA 2NUBA 3OZAA 2P9EA 1N6KA 1EX1A 1B8VA 4ND8A 3QOXA 4IMJB 4AUEA 3LJKA 4C3ZA 1QV9A 3TZHA 3F6YA 1H0SA 4FOPA 2UUPA 3FYUA 4AZ0B 3S3TA 3WADA 3MEQA 1M2OA 4I8XA 4Y18A 4B0OA 4JN6B 4BFSA 3B1XA 3Q9SA 1RPTA 4RH0A 4WKOA 1DTSA 3AUFA 5CLLA 4X20B 1KEKA 1AKMA 4MW5A 1TCAA 4O4IB 4L8VA 4Q9LA 1BHQ1 2GYWA 4O8ZA 4Q1VA 4CMCA 4RHEA 1AUOA 2FP4B 3DPIA 4JBNA 1DVRA 2OQIA 4M1KA 1N8NA 3OICA 3A1UA 4R2HA 4YMUA 1JHPA 3PC6A 1HGXA 3ETJA 1Y1QA 2IYWA 3WG9A 2NU6B 3R3UA 2XT9A 3W6OA 1MVNA 3ZIAA 1WSWA 3S0JA 2YQ4A 3K2EA 4MQLA 1F9AA 2O48X 2XF2A 4HAOA 4JBYA 2IBTA 3DTTA 1EDBA 4MQEA 2WTAA 2ZSHA 1DKMA 3S2UA 3ZCVA 1ZH8A 2CXSA 4F96A 1DIAA 2VJMA 4P7JA 2GMWA 1UC9A 2A4KA 2C94A 1G8FA 2ZRBA 1KQPA 1Y7PA 1ZL2A 4Y30A 5FI1B 4KC0A 4CKWA 1UJNA 4PZPA 4I3HA 1J2YA 1UDWA 3R76A 4G65A 2XMSA 3R8FA 1ZNWA 1C30A 3BKWA 1T34A 2Y6UA 4HDCA 5IDWA 2QUHA 4X6YA 1JLSA 2YRXA 1T8YA 4ZKEA 3GCWA 5H7XA 2EFCB 3MT9A 1BN7A 3MCUA 4LF7B 3R2JA 1YOVA 2JJ1A 2GCGA 1XZNA 5FTKA 1F20A 1ZI6A 3QOFA 2XWSA 3IIEA 2LDBA 5EC8A 3SBOA 3TMKA 2AG1A 3FPLA 1EB8A 2ZTSA 3P9RA 2B20A 2CT8A 1KO8A 1MKYA 3BDAA 3MRTA 3O2JA 3C5HA 3PCRB 3BE6A 4FYYA 4X8MA 1OBFO 1GCAA 1MOQA 1OT3A 1SVIA 1UAGA 4AULA 3QKRB 1HA3A 1B0UA 4HGOA 5I7RA 3B3QA 4JLVA 2WM8A 5K3SA 3IUNA 5BV7A 4X7BA 4GBGA 2CFSA 2X1MA 3KTAB 3B1VA 3PEEA 4I81A 4KI0A 2QZ4A 2WD9A 4YP9A 5A9TA 5CVUA 3O93A 5JSHA 1KOGA 2IBSA 1KFJB 2FWBA 3R3YA 3AI1A 4KPUA 3IV9A 1GZ6A 2EP7A 5JWOA 1XLVA 2FGJA 2IE0A 2QQ5A 3GPCA 3WNQA 3LRTA 2D5CA 3K8YA 4EUNA 2YDXA 4F5EA 821PA 2P5TB 2WJIA 2DPMA 2NYRA 3O91A 1C7IA 2BMWA 3DOIA 2DBYA 4IFTA 4MV0A 4ZICA 2P0AA 4ZU6X 3GRYA 5U1PA 1IY8A 2HUPA 1M1NB 4BMPB 1HM5A 3PJRA 5TY0A 5HYVA 3D3EA 3QEKA 4MVYA 4ALMA 3KD3A 4BQIA 4OEHA 3WFZA 4Q15A 3HTXA 1CLUA 1AE1A 3DL2A 1X3LA 2YWGA 3DVAB 4L28A 4BLTA 2YOGA 2EP5A 2YZNA 5DLPA 1DDOA 2VXCA 5C5CA 5K0FA 2RKOA 3NT4A 5EXTA 3LXUX 1CYEA 4X7PA 1U7ZA 3A3NA 4ANFA 4EY5A 1DMRA 4GH5A 1NW3A 4DM3A 2JGNA 5IJXA 5HUHA 3OJCA 4B7CA 1LQUA 1Y1PA 2C4NA 3KBBA 3AF3A 1YB1A 1I2MA 5IUKC 2AOUB 4P3XA 4WY8A 4Y9DA 5LQUA 2OZPA 3FYUC 4B2LA 1LLUA 1TW3A 1JVBA 3A3OA 4LRUA 3QEJA 4HDOB 4XUCA 4AX8A 3GGJA 3WGOA 3WA7A 2X8WA 2C04A 1QO9A 2KM1A 4H1TA 1N7HA 3RUHA 3SXUA 3ICQB 4CTKA 1W1WA 1Z0FA 4NP6A 4RTQA 5HRAA 2Q29A 4HWSA 3AINA 4IM7A 1RWPA 2C2OA 1O03A 3G3EA 4QO7A 5JFGA 5KDLA 1XMXA 4P3KA 2FDXA 5H3LA 1RQPA 2VAVA 3BWCA 1NR7A 1U1IA 1RWKA 1JI0A 2WAXA 3ZDCA 4KQKA 4MQFB 1DIBA 3BHNA 3IBYA 4QU8A 1GRVA 1KFCB 2ZB8A 1GY8A 2WMNB 4J1NA 3V9AA 3W3ZB 2BTEA 1B23P 3BWVA 4JB2A 5C4MA 1BE6A 4JI8B 2HHAA 3N7AA 3K6JA 3I9OA 2X6TA 2PRSA 2HVGA 3FYCA 4BQRA 4UUBA 1K27A 2HHHB 1OBHA 2QUBA 3FLMA 2PBFA 2VT2A 3D0QA 4WVLA 3ELUA 2BYTA 1M6EX 2JLXA 1IY9A 2ZAMA 3OEHD 5ALKA 1Q0TA 1ZGHA 2CUZA 1UBTS 4DLBA 1A95A 5FBRB 4TTIA 2XLCA 4ZVOA 1VKNA 1FUPA 2GBIA 4V0OA 5BQPA 3DYIA 4LZWA 3O47A 2IHKA 4HAVA 2GHQA 1L4YA 2MYTA 2HXGA 3ZLTA 1X38A 1ONBA 4LMPA 4D81A 2VDLB 4KBGA 2ZYVX 3QLUA 4HNAB 1QGDA 1UODA 4KO2S 4WKCA 1HTWA 1QNFA 2IYAA 3LDUA 1ZNQO 3C8UA 3I09A 4JJ7A 2UZ0A 2NZYA 1G3UA 1FU4A 4FMPA 2ORWA 2KBFA 5K05A 1S9DA 1ZOLA 2WKPA 1QHSA 4GOJA 1SHJA 3R7WA 3RKSA 4BX0A 4EVSA 1XO1A 2PGDA 1DDGA 2OR3A 1YMVA 3N7UA 4ZVVA 5H3HA 1E1RD 2VLIA 3DVRX 2CHVA 4B6SA 1LVUA 1S7GA 4BXOA 2OV6A 3KHSA 4JDUA 5BN3B 5IDQA 2RHGB 3V8MA 2JFXA 3LLVA 3O8CA 2L19A 4DSAA 2FR0A 4OQXA 2I55A 1V9LA 1KL7A 4GGPA 1KK2A 1KI4A 5CM9C 1YXMA 3S81A 2ZJYA 1G6HA 3STUA 2YQZA 5CH8A 3S7TA 2JH9A 2WP8J 3OE7D 4MUMA 1HRDA 3QXGA 1EE1A 1PTJA 1YDGA 3I72A 4H2DA 4LXGA 3VZRA 3DKIA 2XTAA 1FXWF 5L8VA 4D3SA 1X7ZA 4KXXA 1T5IA 3CBQA 1BFDA 3ELDA 4WN9A 5KWEA 1A76A 4N5LA 2JVIA 3KWJA 4Z86A 2BL4A 4K9LA 3ZZ0A 4BEJA 3P0FA 1F6DA 5ITWA 5F2NA 1W52X 4US2R 1VXOA 1R66A 4DEVA 2XE6A 1ONNA 3IVRA 4FI3C 4MAAA 2WJ6A 4BX8A 4J7AA 3R9KA 4OLAA 3ZQJA 3L07A 3SZLA 1ISFA 1KZ9A 2CXOA 4JX8A 1RKVA 2VRBA 1IBSA 1VJDA 3OT4A 1K62A 1PV1A 3Q3HA 2GRJA 2FVXA 3FKQA 3KQKA 2C7VA 4PXAA 4CIYA 5GTDA 5JAQA 3GIWA 4PF1A 4IIJB 1DWOA 3N0VA 1A8SA 4H7FA 4NJMA 2W8BB 3WNZA 5IHXA 4DV0B 2HBRA 5FA8A 1H6DA 1O95D 1BE8A 4Y0AA 3UB2A 2LW7A 2VJYA 3X1MA 1T9AA 3ANNA 3LZ6A 4I4TA 2OK8A 5GONB 1DC8A 3MBKA 5L3QB 2H0RA 4DDWA 4G4GA 2VF7A 4Y98A 4J0GA 2BMFA 2PKQO 4G84A 1Q0PA 4IEEA 1YA4A 2WPNA 1N2GA 2P0EA 1W4BA 4HKTA 2P7IA 1GZUA 3I1JA 2QTNA 1YR1A 4D74A 3HCRA 3KELA 1J00A 2PRKA 2X4GA 3OIFA 3HA5A 2IYLD 4H15A 2IUFA 1R0YA 4WI1A 2ZYSA 2HK8A 1XTPA 3L7BA 4RQBA 1VPWA 3DM5A 4U7JA 4LNUB 2I22A 4I5FA 1QVZA 3FD8A 5MFPA 3RK4A 3U3JA 2CK3A 5M7EA 1GNSA 2P9HA 3BOSA 4Z0PA 5DGIA 3D5TA 4P4GA 1ESZA 1U7HA 1PW5A 1I80A 1OLUB 1VSUA 2GPTA 1VMKA 2PU5A 1RRKA 2XA9A 4LOLA 4PRLA 3IYLW 1GTZA 1WKBA 2JARA 3FZYA 2PZGA 3ER9A 1X74A 1WMEA 3FUUA 4KJZA 1ZCBA 3EZXA 1PEYA 1W75A 4UVEA 1R6BX 3TRFA 1WBJB 4MV3A 1A9XB 1AKEA 1WIWA 3KB1A 2RG7A 3OSZA 3PR1A 3C45A 4RIFA 5IHPA 4F3CA 1KI6B 4MPRA 3ISTA 5FBLB 2VDWA 2YYZA 4G36A 3BPSA 4XQGA 2IA5A 3RS7A 1LDYA 1YV9A 2GJAA 1Q7BA 3SFTA 3JS5A 3PQ4A 4GOKA 3RJ5A 2CXPA 3AEUB 4EPTA 1ADBA 3FHLA 4L0CA 5A5VA 3VU1A 4DA0A 2RH5A 1E61A 5JAPA 4QATA 5JATA 2P4UA 1QQAA 2VRNA 3DUFB 5KQMA 3Q6MA 1BH6A 1T5BA 1YRBA 1SBTA 4S1OA 4XGRA 3U7QB 1C80A 1MRSA 3W5AA 4QTXA 1I3MA 2CHFA 3HUDA 3OZTA 3PR3A 4AJPA 1GZHB 2H4YA 1ZD9A 4BNFA 5JAZA 2BONA 2P3OA 2FFJA 4G6ZA 4MWDA 4R1SA 2BGRA 4Y2TA 3TCNA 2XBMA 3BILA 2EXXA 5JCZA 3EXEA 1PHRA 1PWEA 1KI8A 3PE4A 4FGZA 2VWPA 1KH2A 1P7WA 4BFXA 4ZHQA 8LDHA 5EN4A 1ZAYA 3DZHA 3JR3A 3I6ZA 2CJXA 3GHHA 5DTQA 2Q4TA 4P83A 5G41A 1L5LA 2O8EA 1JEQB 3V00A 1JW9B 3WWCA 1KMHB 2FV8A 1E2LA 3Q7RA 5SY9A 4UCWA 4YV0A 2XB2A 3N75A 1KE2A 2C88A 1PWZA 3THRA 4YXWD 1Z2NX 2QRGA 6YASA 2BVNA 4WKBA 3AFNA 3BH7A 5A3QA 1USGA 2CEKA 4GR9A 4ZFNA 4EQ6B 2JDID 2OVBA 1DUIA 2GZRA 4PQEA 3DE5X 2BZ1A 3TOXA 2FUSA 4ARZA 4CKCA 1AV6A 3SKXA 1JZQA 2OXEA 2QQFA 2OA0A 1DFIA 3FMOB 5ALHA 1CQJB 4NXNB 4PZDA 1MEOA 1RXUA 2J6CA 4O59O 3AY7A 3EXFB 4M1SA 1DIGA 5EESA 3UJ8A 3DBLB 4FDMA 4H27A 4NAVA 3GLTA 4EI9A 3TTSA 1OH6A 1RPAA 2AE1A 2Q5LA 1R4MA 1BO6A 1KYTA 1PEKE 2EGGA 3A3KA 2Z43A 3B9BA 3LOUA 5DYTA 3S28A 4YT4A 1N33B 2L0XA 1TUIA 3G5UA 4J7CA 2AN4A 4WZBA 3GEDA 3J7TA 3SSAA 5FV4A 3U4QA 3IV6A 5DP2A 2JKYA 2WUDA 4GMFA 1MA3A 1UM9A 1EP9A 2EKBA 2HK9A 3KYBA 3CR3C 3O03A 4C7BA 4CKBA 5GJVC 1XZDA 4B3TB 1XRQA 5ABPA 1N5OX 1K8QA 3EVGA 3TSZA 1ICIA 4B3HA 4JJ4A 4GS5A 5REQA 5J47A 1QOPB 4HVAA 4P2GA 4X44A 3UNXA 1QRUA 3VVBA 3NAGA 4Z54A 1MZVA 1FUKA 3LX6A 1NNI1 2PHZA 3TJZA 3N2KB 3CRW1 2VXBA 1C7QA 1DO2A 2E4VA 4HCJA 5D1NA 3TPCA 1JKJA 2OGSA 2WTMA 4RE6A 3G8YA 3VDMA 4EA7A 5BN4B 4B8YA 4B31A 5ELXA 2W58A 1K88A 5ECWA 1VBNA 1U6KA 1G18A 4IOLA 5A7FA 4A7PA 1V3UA 3QJYA 3KVRA 5TPZA 3OLQA 2YV5A 2OBXA 5AI4A 1GPNA 4EG3A 4Z3KA 4E3WA 3HC7A 5FYQA 3KE9A 3KVVA 4GXNA 1FY2A 5FTWA 4JMPA 1T26A 1Z6YA 1T9ZA 4XR9A 4KHZA 1CF4A 2HHJA 2XH8A 1PUIA 3W8NA 1J9EA 2PXXA 3C5WP 3W2EA 3ZJUA 5EWJB 4UU8A 2VF5X 4PW0A 2JRLA 3MJDA 4CMIA 1LPAB 3VOSA 2ZYIA 3WKDA 3DNFA 3U31A 1TCVA 3FETA 3QVSA 4L3VA 2D6FA 2FPWA 4ALLA 3DS8A 2C59A 4KMSA 5DM1A 4RY9A 4FYKA 1D2AA 2DKOA 1KR2A 3M33A 1T10A 2HADA 3ON5A 5C3UA 1KK0A 3ENQA 1KY3A 1XQ9A 2FETA 1XTSA 1HMYA 1DBRA 1LY1A 5D85A 2FF7A 1YQDA 3K2QA 2XAUA 4IDNA 2GAJA 4M0EA 2IF2A 1X1DA 4IUCS 3D7NA 3GLRA 1GYQA 2VVTA 3UKDA 1WV0A 4KVZA 4CG0A 2UYYA 3EMBA 4DDKA 2I6UA 4DBLC 1FRQA 2BC9A 1SZJG 2LCIA 4PHTA 3GFOA 5AOBA 1N75A 1O8CA 2OMKA 3VKFA 5C80A 3K5HA 3NO9A 2JD2A 1NVEA 4LS3A 5ALLA 2E89A 2PFMA 1K7EB 1RE1A 3DAYA 3LM8A 2DB3A 4KIJA 1P2UA 3RUCA 5TEVA 5C4IA 4OATA 1MD9A 5CAEA 3CVUA 5AW8A 1X9IA 2XVMA 4MDFA 1BVRA 1UMCB 3KKLA 2BAGA 1BA3A 2VSQA 2BGIA 4MYCA 4V0ME 2A0XA 1R64A 2Y0PA 4QU9A 4B1FA 2WJZB 4Q5IA 3ONDA 4KBYA 1PRYA 1E2MA 1OV6A 1FX0B 4PC3A 5DBGA 1H1LB 3DOUA 1RC0A 3SS7X 4CODB 5LZ2A 5BV8A 4RTJA 4RCYA 3LX4A 4PSDA 1QYRA 1K75A 2PZJA 3D9QX 4BHTA 5BSVA 1MXFA 4QLAA 2ZUFA 3CRZA 1KYIA 2QDXA 1LVGA 5B1HA 3OQOA 1GZ7A 2ZRCA 3O95A 2NWQA 3WWEA 1K92A 1V1RB 3SZRA 3PG5A 1O9HA 3PEVA 1DQRA 4S2EA 4GU5A 2P2ZA 4XA8A 1R6XA 3C16C 4RK5A 1J70A 3L4BA 1BA2A 1KBQA 1DKPA 2QX7A 3F97A 3OCYA 5LD2C 4FQ7A 4PR0A 3E1GA 1XRMA 1N2EA 5E9QA 3RS2A 5DBHX 1RBYA 4R3WA 5I01A 2RH9B 3IPCA 1KA9H 2ZUCA 1U8CB 1NLZA 3KZVA 1SRRA 2WAYA 1XA3A 4LY3A 3D4OA 2ZE8A 1IB0A 3D59A 2PXAA 2JAHA 5NLLA 2A0FA 1O57A 1ULUA 4ADMA 3AI2A 4OJKA 3NVKI 1QP8A 3SC2B 1TEZA 3DBIA 2XWPA 2YY5A 4IDFA 4JGIA 1K5DA 1GKIA 2PT9A 1Y4SA 2N46A 4PHCA 4ZCLA 4PNEA 5EJMA 4FLEA 4LYFA 4DR2B 4AYTA 1RXSA 3VPDA 2FR1A 1JJ7A 2VSNA 4P6VF 4ZALA 1E2IA 2PO5A 2QI9C 5GJCA 4LTNA 5HJ7A 4XFJA 1G20E 1UBOS 3OCCA 1V35A 2FPMA 3RM3A 5A1TA 5I8ZA 4EWLA 4OH1A 5LXTA 4P33A 1IMOA 2FKNA 3RRPA 5LB4A 3RS3A 2F8TA 3OZDA 1CP3A 1NPDA 3IBTA 4ZK2A 1J21A 1RWMA 3WLQA 3I92A 4DZRA 3UJ9A 4N7MA 5E8JA 2FMFA 4RD0A 2HPAA 3MJVA 2XMRA 4PIVA 2VBFA 2ZQYA 4OHYA 2EF1A 4MINA 4L51A 1I6LA 2C4KA 2Y8EA 2J3LA 3JQPA 3JD1A 3UMGA 1NWCA 4ZOLA 3SR4A 4HWOA 4E0BA 1U7OA 4KN5A 1FRVA 2ZSAA 3BMCB 1VCHA 2IK8A 4HZUB 5K4AA 1F0YA 3KB2A 5CYGA 4TKMA 1DTWB 1WD7A 1Z6QA 4Y6OA 2LNDA 2OM2A 3IE2A 3DZFA 5IU6A 5JXWA 3PFIA 2ZRGA 3TXXA 2GN6A 3VYWA 2J3HA 4IHJA 4RGQA 4PAGA 3BL8A 4S3MA 5CPBA 4BKRA 4O4JF 4LJAA 3O4IA 4E2WA 3T9BA 4YRLA 1FTYA 1DQZA 2F4NA 4RGVA 1CJTC 3I58A 5AIBA 2Q1SA 2QRNA 3I04M 1PJBA 1XZHA 2A59A 3KKOA 4Q1BA 4QBTA 2H0QA 2BV3A 1E62A 1PR3A 4PIMA 4ETNA 4NCBA 3PDUA 4AO8A 1U3UA 1IMJA 3OMLA 4NBWA 4TVSA 1IWOA 1OX6A 2OAQ1 3MD9A 4LW8A 1B3BA 3ENWA 3DXFA 3AKEA 2GN0A 3FSJX 1KSHA 3I1YA 3OF5A 2IRWA 1RFLA 2V3VA 3I1FA 4HTFB 1THZA 1ZD3A 4FHDA 4JUCA 4MA0A 4BLUA 4W9MC 1ZCZA 4Y67A 1ZXBA 5DCWA 3TNLA 5F78A 1GAWA 3BK7A 3D1VA 5CNKA 5I9LA 2FJ0A 4FTWA 4OTZA 3I6MA 4C2AA 3BBLA 1Y37A 3ADKA 1FYFA 4LJ4A 2FH5B 1PBTA 2ZYGA 4RKYA 4ZT7A 3OF2A 1R3DA 1P4HA 5HRCA 3MCZA 4PZLA 3T7KA 4TSFD 4RK1A 5LP6C 1L4KA 1YH3A 2EWMA 1AX9A 4GQIA 5KVAA 5T41A 1IWBB 1E6CA 3HCPA 3IAM6 3QUBA 4P3PA 2W6IA 3K0CA 4CQMB 5TQ2B 2XDWA 3EFOA 3QYFA 5BRJA 2JLSA 2YVKA 4UW9A 3GBPA 1ZJ5A 2FX2A 3ONVA 3RG8A 3H1TA 3GLFE 1BMDA 3TVTA 4EZIA 2XNHA 3TYXA 3OQ6A 4YX9A 1FRNA 5ALUA 3G9QA 5TT1A 4B34A 3CVJA 1E1KA 4DMFA 2HXSA 1K2WA 3RC1A 1JDUA 2WQ6A 4IMIB 4MI9A 5EKTA 3BD8A 1YFJA 4Q00A 4OQNA 2BH2A 1DWQA 1JI3A 1GKLA 2V7PA 4XX1A 3QBJA 3WWDA 4AMBA 5FEUA 1Y3CE 2CXTA 2EJUA 3EEOA 1QRAA 1TJ7A 4FDAA 2FEAA 4WT7A 5E7MA 1YFKA 2YMPA 2ONZA 3NXSA 4BP8A 2GTHA 3PWKA 4KXFB 4L57A 2HF9A 3U4MA 4F6CA 4XX0B 4KDRA 2YXDA 2H5LA 2XOKD 2VHJA 3QU2A 4CM4B 4WCFC 2W2VA 1D4FA 3K9NA 4DRXB 4FB5A 2IFTA 5K8CA 4O2RA 5EZYF 3UOGA 1AKNA 1FDRA 2X19A 1P80A 1V3VA 2XNDA 3SXPA 3V2GA 3WMRA 3R1IA 3FUWA 1MG0A 1OLXB 5NULA 3M6FA 4QJ4A 1JT9A 5L7YA 3ZG6A 1SBIA 2WAMA 4CL2A 4A1OA 2FXIA 3N2GB 3B13B 3GRRA 4Z7OB 4KWIA 4MKHA 1DJMA 1CZRA 7MDHA 4FFLA 4L76A 4J0FA 3EZNA 3B3AA 4NDAA 5DISB 1D1SA 1E5VA 2OKGA 3IR5A 3WA6A 1OH5A 4RXUA 3TW4A 4S12A 1POXA 2D5LA 4R69A 1BJTA 3GQBB 4Y6GB 1U02A 2PVSA 2ZJ3A 5T4FA 3TTWA 3A0RB 1MRZA 4RLSA 3O4FA 5IVIA 1TUGA 4NSLA 3FOBA 4FUQA 2VO1A 5HFAA 4FFSA 1AMUA 1EXNA 1WVIA 2VDNB 3BN3A 3PJFA 3TEMA 2C92A 4E6PA 4EFMA 3WRYA 3QHPA 1CDEA 2GFQA 5LWQA 4IS2A 1H22A 1GOTA 4QDTA 3V97A 4GX0A 5SY4A 4ZEWA 5EQFA 1B43A 3R4VA 3X1XA 4IY1A 4MH0R 3V2HA 4GM1A 3IE1A 3HR7A 1Y48E 1C8BA 4AZVA 2Q7OE 1T3SA 5ALTA 3DDZX 4G8JA 5HE9A 1K8YB 1NBHA 4R0NA 5KJ6A 3II6X 2D7JA 1TMOA 3IKVA 4KIWA 3WK5A 3TQQA 3MLAA 4JWTA 3I73A 3RVKA 4BQOA 1RXCA 1Z26A 3TZQA 3L6UA 3F5DA 4X6LA 2ZJ4A 1L7VC 2IOHA 4ZVTA 1UZUA 3A1DA 4H18A 3DE1X 2HMWA 3VXKA 4IHAA 1KC1A 4C22A 1K98A 3CKMA 3IAS1 2YJ4A 1TK9A 4H7EA 5E0OA 4GQBA 5ICMA 1CY4A 1N92A 2XMDA 3H9QA 1G7RA 2WSLA 1K8ZB 4I1VA 5BYAA 2ZIFA 4HLQB 3WWOA 1JKFA 1JA9A 2AOXA 2WUEA 5KSWB 1TJ5A 2ATCA 4P3YA 3QF4A 2LTAA 1CUUA 4RY0A 1U1CA 1YB7A 1E1CB 2WUVA 4B43A 5I48A 1UC8A 5KB3A 3ZGZA 1PFVA 1QX4A 1OTHA 1ULAA 1YR6A 2J3MA 1HYGA 3NIFB 1L1QA 5BSUA 1CQZA 3CZMA 4BNJA 5DWVA 1CQIB 1GAQA 2G77B 4YJDA 2A94A 1YVPA 4ZK6A 3J7AC 2FPGB 2JHAA 2NP6A 2A9QA 1C41A 3U0BA 4YCDA 5EY5B 2QMEA 3DBRB 3T7EA 3VC3A 3DEAA 3U56A 4C2UA 5BOSB 3OWXA 1KRHA 3W8EA 1COWA 2OTCA 3EF3A 5GVSA 2DKFA 2BHSA 2R8BA 4BN4A 5BMVA 3OX2A 3Q0EA 5DW3A 3L1UA 2R62A 4RABA 4ZCQA 1MCZA 3H04A 2DTEA 2IZOA 1A27A 2DVMA 2KHZA 2QU7A 3OJ0A 1PWHA 1KJIA 3NKLA 4EB6A 1I0ZA 1JU4A 1SOWA 4B80A 3I05A 2NT4A 4YV1A 1TM5E 1REQB 5C51B 1HE4A 4F7DA 3QE3A 5IXJA 1SCNE 2VHYA 2FW6A 2G08A 4MVXA 4NJOA 4FQ5A 2WJ3A 2X9LA 4TMKA 2R87A 4Q9JA 3GCZA 2ZE7A 2HV9A 1VL8A 3OLWA 1RMYA 3AVPA 5DRTA 4W9RA 1CZNA 4XB2A 1H0KA 4UZSA 5F7ZA 3TQIA 4WKPA 3WGQA 3WMFA 1UPTA 4LN1A 3W6UA 2COEA 2AMYA 1AGNA 1ZH0A 3QI7A 1LD3A 3WNCA 4DA9A 1JWLA 2X13A 1P4GA 3I30X 3HB7A 3LUDA 3Q9NA 5C18A 5LVAA 2VP9A 4XIYA 5KSZA 1P18A 3E5MA 1JE0A 3EXAA 3FSGD 1VHJA 4LMBA 5M2QA 1VJGA 2CL7X 1ORRA 1GPUA 2WWFA 3DTVD 4KHPB 1LZLA 2Z1DA 4OL0A 2L69A 1XSEA 4QA9A 2G3YA 1Q44A 2G7MC 1P7ZA 2O8VA 3DEKA 3GRUA 3JWEA 3DBHB 1HDYA 4KAXA 4N5MA 4OGFA 1LKZA 2DSTA 4Q1DA 2D1TA 3CKKA 4MUJA 3RANA 1JU9A 4OFWA 3HQ4O 1QYIA 3HZRA 1QCYA 1RM4A 1WMFA 9MHTA 1OWNA 4EEZA 1SXPA 2ZVQX 1WHSB 1JTEA 2DHRA 2UUAB 1RAIA 4KYVA 1ZD1A 1J33A 1UBKS 2FUKA 1V5WA 2IDJA 2JCVA 1D2MA 3Q8WA 2F43A 3AIKA 3TX2A 5JBNA 1XRSB 3MG9A 3RE1A 4EF6A 2JRCA 1W581 2NO7A 3ZDFA 3CYFA 3GZ4A 2R2AA 3Q3VA 3VHRA 4YPOA 2HI0A 3D7SA 3F8WA 1UOOA 4N54A 4RYLA 5BUSA 2I4IA 5BW6B 2GA9A 2GLTA 1ILWA 1PLJA 2NTEA 4A6DA 1UMBA 3EIXA 4D4LA 5LMUB 1BXZA 1DGQA 1Y8QA 1NW6A 3ZHXA 3FN4A 3GJ6A 2R7AA 4W8GA 2GBPA 2IQIA 3NRJA 1LTKA 1W0JA 3VPAA 4JBHA 5HKOA 1L1EA 3VNAA 3FOZA 2DSNA 3O8QA 3C7KA 4MCJA 4XYBA 1ZI9A 1PFQA 1NJ8A 5ED0A 3CH7A 4O3FA 1I2BA 1Y8RB 4ETMA 4EL0A 3OZSA 4IXNA 5HQJA 4QSHA 4RSHA 3NKVA 1KOLA 3ZHCA 3AFHA 3N0WA 4GXRA 4UNSA 3H84A 4CIVA 4WH0A 5G0SA 4ZDIA 5AVXA 5JBQA 1SQFA 4DUZB 1Z6GA 2N9UA 2BSAA 4W5JA 1ZY2A 2XQIA 4XPIA 4UU0A 1M1XB 2R44A 4PAOA 4K3VA 3G9XA 1B93A 1L5FA 3JU3A 3NYRA 1WDLA 4RF2A 5ALDA 4EO9A 3JQAD 3ZCTA 2VLBA 5C7LO 1DELA 2EFYA 3GVXA 4MUKA 1ZSNA 3O83A 4L22A 4C07A 5KWVA 3M49A 3E4CA 4JI0B 4V38A 5KYWB 4MYSA 2NUPB 2MMCA 2QTBA 1PBNA 4OQDA 5KBYA 3GQVA 2R8RA 3TRIA 3Q8LA 4F5DA 3NO4A 1LSOA 4Q9AA 4MKRA 4RHCA 3TZCA 3U16A 1VTKA 4CIAA 2HWYA 1Y81A 1MAWA 3FWPA 1H8HA 2EFJA 1BDJA 2WTNA 4HNQA 5DEIA 1IY2A 1PZEA 1XG5A 4QDKA 3FPCA 1N4AA 1PJAA 2WF7A 3DL4A 4B4UA 2GLUA 4C88A 2Q2NA 1T13A 5LP1A 4D7AA 1Z28A 3JRWA 2HK7A 1TRKA 4TV8B 3DF7A 4KK4A 4CI9A 4TOIA 4HB3A 1RXYA 3STWA 3PNVA 2EDAA 1ZICA 3PUIA 4FIDA 4G5HA 3WFJA 3WSVA 3I9V6 2JKVA 3BMNB 4BWYA 3TL2A 4YGYA 1QMGA 4NE9A 5FTLA 1Z36A 3NBFA 4J2OA 2ACWA 1AZLA 3IMGA 2WV9A 3HBMA 1T29A 2DBZA 4PX2A 4V0NA 3A1TA 4WXRA 5P8WA 4CR7A 1T1RA 3JQEA 3SHFA 1S3SA 3K9LA 3ONFA 1EVZA 3OPYA 3TVYA 2WU3A 1XVIA 3W2GA 1AQYA 2QGAB 4WACA 2W6OA 3DV0A 2ZSJA 2IX9A 2ZBPA 1VBKA 1JAYA 2ZCUA 5DM0A 4GKBA 3S68A 3DTNA 1UT8A 2XZLA 5CB4B 1UXIA 1RP7A 1QGAA 1GSIA 2IW1A 3UH1A 5JH7F 2ZSIA 1SOMA 2LKCA 2HDNB 1QFZA 4CM8B 2XCUA 1USWA 5E6RA 1BEEA 3TZLA 1KWGA 3ZVMA 3ERCA 2J3QA 4TLAA 3WLTA 1GUZA 1HLFA 2A5LA 4TWRA 1UK6A 2CWDA 2XB4A 4O1MA 4EHHA 2P9JA 1JFTA 2E48A 1X80B 2G8LA 1T8WA 2IT1A 5ECGC 3C4JA 5A4AA 2GD2A 2PMDA 3NG1A 1EXDA 2YMMA 1VIDA 1U9JA 1WCIA 1OH8A 2R7KA 2ZWVA 3LUAA 4BJ3A 2AFIA 3W90A 2ZBVA 4TN1A 1X86B 2A5YB 4OHCA 4HG2A 4D41A 3IALA 2B9EA 3LBYA 3STXA 4KBFA 5CA0B 4JI6B 4NZMA 1MG5A 1GTMA 3HU1A 3AVWA 2PUGA 4DCCA 3ILHA 2FCAA 1GDDA 1EGVB 3B6MA 1EMDA 1SD5A 1OI2A 2P6OA 3I9KA 4M6WA 4QOSA 3TSYA 2G6BA 4HUJA 1Z3CA 4WW0A 2IJGX 1G291 2CVHA 1U9IC 3IT1A 2KBEA 4CV0A 2BGNA 1QQ7A 1PGOA 1M72A 3VJLA 2VJAA 3DAHA 2B1RA 3WR5A 2O5VA 1R0ZA 2P3QA 3CVYA 3UMSA 2OLJA 2CDBA 4HN2A 1DC6A 1WKCA 3GP5A 2JJQA 4FJ0A 4IQFA 1OB2A 1GXSA 3H4IA 1HDOA 4MGYR 1BX0A 5EHQA 4D99A 1XQYA 1PNVA 2QMQA 4XARA 1VPDA 4XZ3A 3VZQA 1VA4A 4W6ZA 4C5CA 1NKVA 1E2BA 3E81A 1B0AA 5JWRA 3EPHA 1SUEA 5JHHB 5J9FA 4LDNA 2F1KA 4ESVA 1VLMA 3MF4A 5A4DA 3IQIX 1P6QA 2ASEA 3T95A 2PKEA 1NVGA 1TO1E 2XF8A 4KI7A 4BQFA 2V7TA 5J1SB 4P3NA 2P27A 4FWTA 1EK0A 1ECFA 1JR4A 1MC8A 3QP9A 1FDTA 2XX3A 1G0OA 2Y0CA 3COWA 1RIFA 3QU4A 4ZO6A 3RUDA 3F4SA 1AUXA 1DXYA 2B78A 2VJPA 3DE2X 3T35A 2IXGA 2D00A 1CC1S 4MARA 1VG9B 2QLTA 3A26A 4RWZA 4LXQA 2G0NA 2QR3A 4LJ6A 5JVDA 4LDRA 2O8CB 3KQQA 3PKZA 2ACEA 4JCOA 4Q4LA 4TKUA 3RV3A 2O8DB 3JQCA 4GMDA 1RCTE 3R4CA 4LCBA 4YJ2B 4DS3A 1H42A 5F52A 1JIVA 3AEZA 4LGVA 1AQJA 4AMUA 2I34A 1TDJA 4IIVA 2XITA 1Y4DE 4RK7A 2C7BA 1N2IA 3A05A 3ID6C 1EH5A 3PQEA 4J1SA 3VH1A 5HOEA 4EY4A 1PL8A 2GEKA 1I3CA 2HHCA 4I6GA 1UP6A 5KWIA 1L3CA 3ZGYA 4OQEA 3G0IA 1Q7TA 1OZGA 4AC9A 2NGRA 4H31A 1Z17A 3ZWAA 4QVGA 4PR3A 3DONA 1SCDA 4D56A 4LFCB 2GNPA 4XFKA 3GTDA 4Q24A 3SF8B 1V41E 1YAHA 2YWCA 3QE0A 4KQIA 1GARA 1N2JA 1P9LA 2V03A 2VQFB 4NY1A 4KN9S 3ZVRA 4OXYA 5JAHA 3N0RA 1WZNA 4JLWA 1G41A 2WYVA 3AO0B 3L04A 3N9IA 3EMDA 3LKZA 5JLAA 5K0EA 3JARA 1Z4KA 1OAKA 2Q41A 3BEOA 3QVVA 4ZOBA 4CV1A 5I7OA 1NG1A 1PKEA 3TIFA 2YYSA 4GVXA 3TM5A 1C0IA 4RA9B 1OGJA 3BFPA 3COYA 3HMKA 4MJ7A 1E3WA 1MB0A 1KMNA 2F1JA 1NVWQ 2ID7A 2XQJA 2DH6A 3EQ7A 1T2FA 5ARDA 4Q3AA 3DXYA 1WW2A 1BVUA 1T1JA 2AG6A 3G85A 1GV0A 3BXGA 1G1AA 1SA0A 2XWBF 1FFXA 2CVFA 4FNAA 3M4XA 4X3CA 3TG8A 3QIAA 3PC3A 3E22B 4OQYA 1DRJA 1M9NA 2FP3A 1U3CA 1A82A 1NU6A 1ZM2A 2E49A 2BGMA 2I99A 3AKCA 3E35A 3B1YA 3GJ3A 4IUYA 4Q7MB 3TMYA 3U7EB 1O08A 3EC7A 1L5NA 5ITVA 3A9RA 4F3KA 3E5NA 5HVNA 3CSSA 4OI2A 4F4HA 5AM3A 3RSZA 2D2XA 2HRRA 1KPHA 2X9QA 3ZY5A 4M8NE 3FRJA 1ND6A 3WE7A 5EWLA 1QONA 3WICA 3QLJA 1XWIA 5DEOA 1HZZA 1G1MA 3JYHA 4KWEA 1MHTA 2BKLA 4LHEA 2LWIA 4TTRA 2I9PA 3CCCA 6GPBA 3B5EA 2PAAA 1VE6A 5LQRA 2RGCA 4EX6A 1I4LD 3QPAA 2CD9A 4NOJA 2BHTA 4AKTA 5HQ3A 2QHXA 5LKRA 5CA1A 4XGNA 3ZU2A 1V1MB 2V7EA 3JQAB 4FNOA 5H1YA 5CVEA 5HUJA 1S3GA 2G4VA 1C29B 4AJNA 5J23A 1Z33A 4Y6RA 4PC6A 2RIRA 3KJFA 2WE8A 4NFLA 1WMBA 3BSSA 5LQAA 2NXEA 1QB8A 3G6WA 3TSWA 4K05A 5K0TA 3ZV3A 2CJWB 3M6XA 4IPTA 1P2FA 2ERCA 1E3DA 5C2JB 1M2FA 1RXIA 1U5CA 3I23A 1R0LA 2ZJ0A 5HFJA 5TMBA 4ZKDA 1N6RA 3D6VA 4EARA 5I4IA 2GDZA 3VO2A 4FNMA 1G5PA 3ZWYA 1OT5A 4KXLA 2NU8A 3CX7A 3FTNA 3Q7TA 3FZQA 5FFFA 3TLZA 2HF2A 2WWHA 3DYVA 3TINA 1FW8A 1KMMA 3ND6A 1Q0QA 5CVTA 1NSFA 1X39A 3EZLA 5BNZA 2O54A 3G8AA 1W88B 3C7DB 1ZVMA 1E99A 4MR7B 4RENA 1SG6A 1OBVA 1ANKA 2I4TA 3L0IB 1G2OA 4O4LA 2ADFA 3CNOA 3R7NA 2B4QA 4ZQEA 1EFVB 4OOFA 1NURA 1X92A 1XC7A 4LTMA 4AKEA 4LWOA 1IBKB 2O8FB 1G9SA 3NUZA 2C1XA 3NC4A 2EW8A 5DWDA 3KXIA 3S8YA 2FUG6 2O52A 2FSGA 2H11A 4GPIB 3L4KA 4ZTZB 1RS0A 2HEIA 3KTAA 1TF5A 3ED1A 3MT7A 4QKQA 1JJBA 3RF6A 3V34A 1AUWA 2XTNA 3QPUA 4X1YB 1RYFA 3UGQA 4B09A 4A0RA 5D84A 1J22A 1DOHA 4PTYA 3L1KA 4UD2A 5SZKB 2JLAA 1QVRA 5BNWA 1YCFA 1ISRA 2J09A 3IQGX 2R4QA 4G85A 1KZHA 5LQDA 4YC7A 3UJPA 3C24A 1OXSC 1U2ZA 4OKIA 3CIOA 4IH4A 4RK6A 4Y0VA 1XF9A 1DBSA 1IEWA 2IPNA 2REQB 2CZGA 1ETUA 2VHCA 4ZVKA 3IQXA 4PU0A 1V96A 4F9EA 4RTRA 1GPKA 1ZMXA 1GIAA 2V55B 2Y1KA 1IN4A 1Z7GA 4K9QA 1E2JA 4BLQA 1TO6A 2UZAA 3PICA 3A7DA 4M53A 4B76A 1ZK4A 2C2GA 4E2XA 4CTMA 1ZNZA 1H6BA 1NVVR 2XHEA 4BNTA 4KR2A 3KV3O 5H9VA 3BCSA 1XDBA 4C0AC 1O0CA 3F3KA 2BGTA 4IQ8A 1HEYA 5EMHA 1VL0A 1DFGA 2ZYHA 1YT5A 4MP3A 5D6NA 3CWCA 5TB5A 3FBGA 5CNJA 3Q8MA 3EFEA 2IU0A 1FLAA 4RTPA 3I04A 4X24A 5JXGA 3DNMA 4LVNA 3R6TA 1P5HA 2EX1A 3QBDA 3RTBA 1NVMB 2R1VB 3DKVA 3W06A 1Y5IA 2QRZA 4EX7A 2H1LA 3B51X 3F4LA 3ROZA 4PC7A 2OHFA 3LP5A 4JBLA 4QUBA 3EEIA 2BCJQ 3K92A 4CIWA 2WM3A 4YJHB 2PX0A 2CXQA 1U0RA 1C7JA 3OM0A 2QSYA 3C3EA 4XYMA 3ADPA 3COSA 3DLBA 8ADHA 3HUUA 2ZANA 1VKRA 1CZLA 5DBIA 3T1OA 1YE3A 2X3UA 4FCWA 2AYYA 4W8HA 1XQVA 2YIVX 1JR3A 1Z0JA 2BSXA 4YAUA 2XQFA 2XDYA 3W9UA 1NVAA 3LHSA 1RSZA 1L5YA 1W49A 1G5QA 2HGSA 1ZONA 2JGKA 3FKJA 3GJSA 3IR7A 3HVIA 4MIEA 3MOGA 5EVCA 4HB0A 3SJZA 3WDKA 4BNYA 4BVEA 4NC9A 2OGTA 5J59A 4C0WA 5JXHA 3C3AA 5E9AA 1J1ZA 2HGZA 3LT5A 5ALQA 1K86A 2P11A 2X14A 4O2BF 2JGDA 4XFDA 4TWZA 2GDJA 5ERYA 4M88A 1Z45A 3UAGA 1UPCA 3FNGA 2NN3C 3THSA 1DCTA 1RQLA 2OFWA 2P1DA 4AF7A 3CW2A 4L4SA 1EFDN 2VDMB 3BSYA 3AM3A 1EVQA 1L7RA 3C1OA 4TSKA 5IEJA 3B9PA 3TLYA 1BFUA 4DPMA 2Q6VA 3E9EA 3KL4A 1FFDA 1AG9A 5KKNB 4JT2A 3HEAA 4EJ2A 3KEMA 3FBTA 1XZAA 2DWUA 3PHCA 4PV7A 1NBAA 4H1HA 5BQOA 3R74A 4AO7A 5IZCC 1NVVQ 3A6KA 3M3PA 4JC8A 4BWFB 4E7OA 5CXXA 3RVBA 3ZWDA 2FMUA 3K9BA 4LDZA 3REQA 3GH3A 1Z18A 3S29A 3STVA 3UJAA 4EW2A 3PUJA 4I46A 5B6IA 3LYHA 3ML1A 1JR2A 2AX3A 3M4JA 4Q3BA 4UXJA 2PMWB 4YMWA 4ND4A 3U9TA 2G71A 1KEPA 3TXYA 1UM8A 2QVBA 1J8FA 3H87A 3NEJA 3K9FC 3FWHA 2XODA 3TS1A 1A7AA 4WLEA 4B2IA 2CKMA 2WUWE 5IAOA 4EECA 4KMRA 4RVNA 1IZ0A 3DFKA 3V1KA 3V4PB 2O8CA 3TO5A 2ABWA 1TM2A 1BDBA 2GAAA 3KJEA 1L5KA 3ZU3A 4BMZA 1S9HA 3PA8A 2WKSA 4TGLA 1E1DA 1G8HA 2CFOA 2QSZA 1TQ8A 3A1CA 5JQGA 1GU0A 1LRLA 4HZIA 2YL2A 2J31A 4OYHA 1DKRA 3KAPA 4Y2XA 4PQRA 4R51A 4QRIA 4DF3A 1J8YF 1Z8DA 4DWVA 3HPRA 4MAMA 4CNQA 2GASA 2QTFA 1DRVA 2V5AA 2IEZA 5EXDA 4WZBE 1Z37A 2R4TA 1TT5A 2YMLA 2ZJ7A 4H77A 1ST3A 4P4SB 4C4YA 4WBSA 4EOGA 5CLGA 3NP9A 2YHAA 1T0UA 4DMLA 1JLLB 1J5XA 3M6MD 3HWRA 4UTXA 5KCMA 3H0KA 4DIOA 3JYOA 4UVHA 5DBFA 1PJCA 3PEFA 3SSMA 2H18A 3P96A 5DTEA 3O2SB 3WAGA 3RC3A 4UUPA 5E8RA 4JQOA 3E58A 1OXKB 3FR7A 2ZI3A 4F71A 2JL1A 1ORWA 4NEQA 3D8BA 2VWHA 1P77A 3G2MA 3HEMA 5E6SA 5K0LA 1NQ5A 3D2LA 2IOFK 5GOZA 4J07A 5EJ5A 1J4AA 3IMCA 5KU1A 1KSJA 5GP1A 4GPD1 5IBCA 1IJBA 2IYSA 2FHSA 4ZQHA 2PANA 2PUEA 1ST2A 4L5CA 3ODGA 4LXTA 3L7LA 4GRDA 3UFXA 3WXMA 3IDZA 2V7XA 5TARA 1NGSA 4CDGA 2JHFA 2P4HX 4HYQA 1CNFA 3F73A 1Y42X 1PK8A 4HXYA 3OD1A 4E7PA 4HRAA 1C3OB 1M8PA 3IQZA 2Z9DA 4IV5A 1UKBA 3BAFA 4AF8A 1JIUA 3MWYW 3QGMA 4G41A 4R1TA 2M6KA 2O2CA 3HBLA 4X41A 2PR7A 5KC9A 1UKZA 5HNKA 1CFJA 5F3RA 1MO2A 4OA8A 4F9GA 4WJLA 2I1QA 2X42A 4BMDA 1GQOA 2TRSB 1JLMA 3G13A 5EFOA 3NETA 4MZXA 3A2MA 4NF2A 1QLHA 3DPSA 4CQLB 1GKUB 4X3PA 1A7UA 4XDYA 2LPMA 3FVTA 4K1XA 4DPLA 4BNDA 1S4MA 3C6YA 3K0BA 5J4LA 2O2JA 4R1PA 1I2CA 5CYOA 1TCUA 2BJWA 1L4HA 3ZD8A 2EWWA 3S1AA 3RVLA 2H4ZA 3NHKA 5IMSA 1W5AA 1Z0AA 2HA6A 3EY4A 1E98A 2G63A 1DAIA 3PVCA 3KVYA 5EUMA 3ZD9A 4MJ3A 1BRMA 4CF6A 4TTAA 4I50A 1LEHA 2Z0MA 4CLEA 1DOFA 1R18A 1KI6A 4UE6A 5B58T 3NTRA 5ITZB 5J2UB 3H8VA 1XAHA 1MB9A 3NDRA 4TUYF 1I4EB 2R0QC 4M54A 3W5IA 3ZQKA 1ODLA 2WJ4A 3AIOA 2ATXA 5EEGA 4ZCRA 4G5OA 3L92A 1G0NA 2XUPA 1PFWA 4IDOA 3NS7A 3ANLA 3NGMA 3AEUA 1GPBA 1TJWA 4BJ6A 4WGGA 3HWSA 2PQ2A 1K89A 3HCAA 4QDOA 4H7HA 1P4JA 3A6DA 5A9SA 1V7PC 2V6BA 1Z74A 3AEQA 3CCFA 3JD0A 4IOKA 2CB9A 4NATA 4BY9E 1ZC4A 1QH8B 5IXSA 3Q1KA 2H4FA 2ISSD 3SM9A 5F35A 3ZHVA 1SU7A 3SNKA 1LPMA 1Z9BA 2QQ0A 3V8PA 3V4VB 1N77A 2AE2A 4A8JA 1YUNA 2QVGA 2D06A 1H9CA 3DEIA 4S1NA 5FL7A 4XJSA 4CRWB 5CFMA 4AP6A 4IQJM 2WWGA 3F9RA 4YI3A 1GCOA 1R5NA 2IH2A 4QM7A 3ZOZA 4R3UC 1G60A 4RZ3A 1JEQA 3QW2A 2XHZA 4PCUA 4M2LA 4MUEA 3WMEA 1XXHB 2Q07A 2CF6A 5L6MB 2Q3LA 1DFHA 3I8XA 2D2EA 2QN3A 5HM6A 1L7MA 5IT9A 2LBPA 3NASA 4FLFA 2R8PA 4M8IA 1XEXA 1Q0LA 5IS2A 1HDEA 1G3RA 5CTJA 2Y05A 1XRPA 3FRIA 5IEBA 4OI1A 1KMCA 4DSTA 1QHIA 4HAUA 3SOPA 2WSBA 1Z6ZA 3FKSD 4R83A 2XKBA 3EXFA 2YJNA 5CW2A 3GO4A 5FUBA 5BWBA 2ZCVA 2EBWA 1KDYA 4WJZA 3VPBA 3O4HA 4K9SA 4YBZA 4XXHA 2QTMA 4XDHA 3AVTA 1HQCA 1JFFA 1T2CA 1T9GR 2VNIA 3G2KA 3IX7A 1G6OA 4NYMR 2B7LA 5HCIA 5SICE 4DQKA 5J43A 1F8XA 2G5PA 2ETXA 3OEHA 3TL3A 5FD8A 3WDMA 3KQWA 5AXDA 3NM6B 1LDBA 4DANA 4ZIRB 3HVKA 1WCXA 2FPUA 2VTDA 4Z53A 2IU4A 5JUWA 3PVSA 3QKTA 4H3KB 4YFYA 2A9VA 2AUMA 3WGZA 4D0GA 3LKDA 4BMCA 2BGLA 4UNQA 2O59A 3V3KA 3LAWA 3AJ8A 2AFHB 4WAUA 1P9RA 4GMXA 4M0MA 5EHNA 1ZBQA 2OYRA 2QRQA 4Y2HA 1J99A 3IEIA 3CLTD 1MO6A 1SB8A 4BLPA 5DN6D 3AVOA 1Q5NA 4Q6WA 1QIEA 5DCLA 1KQ3A 1G8SA 3VYRB 5AVQA 1RTKA 3IP7A 1XV5A 5I9MA 1Y3AA 3BRQA 1VG8A 4G89A 1E1RA 1H69A 2FEPA 3AQ4A 4ZVUA 4EUHA 5CEJA 1UXHA 5LDGA 3VZSA 1G17A 3C2QA 4DLYA 1XB2A 2FR8A 4AZ3A 5I8PA 2FG7C 13PKA 5FBQB 4NZYA 4ODIA 3RS0A 2ZUEA 4HGYA 4CDMA 2J4FA 2M1ZA 3D7RA 2WF8A 5IJZA 1RZVA 1OAAA 4XDZA 2A7XA 6ABPA 2L18A 2EOAA 3OE7A 3ITKA 1JDTA 1OF1A 3F7OA 1LVHA 1ZWLA 4LV8B 1DCFA 4BBPA 4D98A 4WDRA 3MT0A 1GSHA 3NVDA 4MKFA 2NTYC 4V24A 1PL7A 5AKKA 4A2QA 4B9EA 2AOWA 1FOEB 2FZLA 2Y93A 2QU8A 3HVUA 4JBWA 5TQ0B 1D4ZA 1LBEA 3C8ZA 2DFKB 3JAKB 3RHZA 5HGXA 1JJVA 2ZFUA 1O2DA 3QFHA 1SQ5A 2C96A 4IGKA 3WKAA 4KQWA 9LDBA 1KYYA 2O19A 3VHXA 3DHNA 1M83A 1EHCA 2ZWMA 3NAZA 4P4UA 4DN6A 4ZQIA 4G5XA 3G8DA 2PVPA 1CXZA 5EE0A 4NYMQ 3GGGA 3LFHA 3UHAA 3ZYCA 2HIGA 3PGMA 4BQPA 1U28A 5J5VA 5K0SA 2Y67A 4I4IA 4HWTA 3TM4A 2W6QA 4F45A 5C5EA 2QTZA 4YJGA 1SBNE 2AI2A 3UWOA 2GS9A 4OLJA 5DNAA 3J81A 5DK4A 4ZVMA 4RKRA 1DO8A 3FHJA 2ORVA 1UL1X 5A0FA 3UHPA 1P33A 4M9SA 1O95A 5AK0A 3V1NA 2VA8A 1TQDA 4LJKA 1JNXX 3JXEA 3W5DA 1T2AA 4KWTA 3G1TA 1F2VA 4QTTB 4F3YA 2YH2A 1NW4A 3AQIA 4ZYXA 4PLZA 1DC5A 2R68A 4KO8A 1H2XA 1TD9A 4L27A 3SEZA 1GZDA 1RWBA 2JA1A 4ZI2A 2M98A 5KVVA 3FTFA 3T1YB 3JY6A 2O5CA 4MULA 3TD9A 4DM7A 3HXOA 3QE9Y 4IIXA 4MV7A 1QU3A 1J0BA 4MVCA 1U5AA 3DOOA 2I54A 3M70A 4PX9A 3WLAA 1OMOA 3BCRA 2AN1A 3H9BA 1ABFA 2QX4A 3GY0A 1CUSA 2Q5HA 1I1QB 4RFVA 5L45A 2FY8A 4IMPA 1IRIA 2JH8A 4ZEMA 1RRVA 4JUDX 2EYQA 2J4DA 3C3PA 4F92B 5KTOA 3CUUA 3RAGA 2L42A 3M5DA 1GWNA 2W6NA 3WJ1A 3CX3A 4JSTA 1Z68A 1MNQA 4B8ZA 3S2SA 3EGXA 5ALIA 1CUDA 5B7GA 2V7VA 2VPWA 2Q4EA 2R6JA 3A58B 1P0CA 2JJ2D 3P2JA 1Y3FE 2AXQA 3R0ZA 4FFBA 1TYDE 2QZ9A 4REOA 4ZO8A 3V7YA 3CISA 5L40A 3VISA 4GPEA 2TMKA 1DZIA 2HA5A 1IQRA 2QTVB 5KX5F 4IOJA 2IXFA 1RYBA 2V3WA 2VJOA 4J9UE 4NDNE 4MUNA 4L9RA 5FADA 1EB9A 3PPYA 4JVLA 4NBKA 2P5SA 3W5SA 4HHEA 2E5LB 3H9UA 3LKBA 1IHDA 3V1LA 4XEUA 3KJHA 3U4IA 3U9LA 3CZ5A 5FCDA 1W48A 4H3VA 4NECA 1NKSA 5EPUA 3Q8XB 3SS9X 3VU0A 4PYRA 4TWJA 1VSTA 1JIXA 4FGWA 4M9UA 3WL6A 4OAOA 3D6AA 3L05A 3RC2A 1V7QA 1ZS9A 3H9CA 2GK6A 1S5PA 4IINA 4BVHA 1E58A 5L3RA 1KERA 2FWMX 2VUIB 5CJJA 2FWJA 4J4TA 2ZQ5A 5BSKA 4DMGA 2PIDA 1D8TA 2HSJA 3KT3A 1UJ2A 2I80A 3CF4A 3MGKA 4AQ7A 2XDQB 3WQBA 3ASVA 4OX9Y 4QBHA 2YVAA 4UJ5A 4DIEA 3P94A 4KZPA 5ESRA 2DCUA 3PPXA 4Z99A 2REBA 3KPWA 3RT1A 2PXHA 4O2AF 2E9FA 4EAQA 2IEGA 2R96A 1YUMA 2GT1A 3C15C 3CONA 5EVJA 3G9TA 2WY2D 1A5BB 1JQJC 1Y9DA 1LDNA 2RGXA 3PNLA 4O4JB 1S7CA 1SIOA 2JGLA 5AKIA 5IH3A 2XTZA 3I0ZA 2PYDA 1D7OA 3DNPA 3DWGA 3LUCA 1O0SA 4YXWA 3WNDA 1ZM4A 3LWNA 3IAAA 1CB7A 2ZIZA 2PO7A 3E03A 1DAPA 2JDIA 3ISJA 1U28C 1M6VB 4D4GA 5FWYA 4RPKA 1H2YA 1QHEA 1NRIA 4FZ3A 1BD3A 3HU2A 2ZJFA 3OHMA 2XYVA 4GECA 4BGVA 2PX6A 3AUTA 5FPPA 1V4BA 4IDHA 5ALFA 2CB0A 2RBEA 3HB9A 1ZR4A 1O95C 2V7BA 2Z8XA 4R2IA 4FCTA 2YKGA 1N8SA 4Q21A 2E37A 3C3MA 3HCDA 3ZQUA 3MK31 5BQXA 2J9YB 2V97A 5A3RA 1M1UA 1NONA 1YC5A 3A4IA 4IIUA 3AHFA 3EVTA 2EQ5A 2VQDA 2ANBA 3G2PA 1BYUA 1P4AA 1V6CA 2D3WA 3OJEA 4OREX 4ZVSA 3VR5A 4K9KA 4F0JA 2ZP1A 4KGVA 2GEVA 2H2FA 2PT5A 3K0EA 3NUQA 4Q18A 5CLHA 5E2IA 4CBVA 2QZJA 2R7LA 3JWGA 1SCBA 1L4MA 5CB8A 4HRXA 1TX4B 1BU5A 2R66A 5JDCA 1H0RA 2X9GA 3DDNA 3GLVA 4QYMA 5TQ2A 3SYTA 1RM3A 1YACA 4UFNA 2ZVJA 1JYEA 4MW7A 4B3JA 3FCUB 4FX5A 4C0LA 4DMRA 1H3FA 1Q11A 4MW2A 5CB0A 4TQAA 3HFRA 4NBLA 2CLFB 1WBBA 5HGJA 1KDVA 2AKAB 2CFTA 4B5KA 1C9DB 2MSEB 2BHLA 2VT6A 2XNJA 4YMGA 5FDFA 2I2FA 1QV6A 3DKKA 4UULA 5FH9A 3N2NA 3RVMA 3AC0A 3U3XA 1SKMA 3WIEA 1JAIA 3RHSA 1GRRA 5HSGA 2W0MA 4X1OA 4DEYA 4RU1A 4NABA 3NHYA 5GMOA 3RADC 2E6KA 4YCNA 1T0HB 4G5YA 3N2LA 1U1DA 4M8SA 1GR0A 5JPDA 3THYA 1UQUA 1PT6A 2X2FA 3R6VA 1YNOA 2FN7A 2YN2A 1NE7A 2AXNA 1G8MA 3LUHA 5GY7A 4ZYUA 2YFYA 5U9CA 4HNVA 2VZ8A 3HKCA 4E2ZA 2X9VA 4XSGA 5EZYB 4R41A 4Q7JB 1O3YA 1SWWA 1WCYA 4HEA1 1Z5ZA 1Z0SA 4GOOD 4HGRA 3V33A 5EEHA 2GA8A 1J2TA 3SIPA 5CBPA 2JEYA 3RAFC 4M0KA 4N76A 1JG4A 1LNZA 1V9CA 4U7HA 2GEJA 4MW0A 4ND2A 3TR5A 4W82A 2R97A 3KB8A 3B70A 4MVJP 2B8JA 4YWJA 3D2BA 2M32A 4PG6A 1GGKA 4IVPA 1Z25A 3KQPA 4MIOA 2HJVA 3MGAA 4PYIA 3SY8A 4NYIR 3T52A 3T7DA 2UYOA 3DTYA 3GQBA 3VDRA 4ILKA 3DDCA 3A31A 2A3NA 5F5NA 3PPIA 2XTJA 2O1XA 1YHNA 4HPXB 1EVLA 4YRRA 4BNLA 4D5EA 2RHMA 3Q98A 2IUTA 1Z5VA 2JANA 3AKZA 4DA4A 5K0GA 4B6RA 4PG8A 1LC3A 2H7VA 1GA6A 4G4SP 4N0DA 5LN1A 4AKIA 4RAQA 4EPVA 1GNLA 2YW9A 5HJ5A 4ZAXA 5HW2A 1WX1A 4XUDA 3RSSA 1XRJA 2P77A 1WSAA 3RRFA 3VGJA 1XFAA 3EZ7A 4KXMA 1KDOA 2C5LA 1NPTO 3FMVA 3QUCA 4G24A 4MYHA 5FLEX 3KQUA 3SVZA 1UFOA 2DT5A 2F62A 3PI7A 2FW8A 3T0GA 3U3ZA 1YR8A 1F0NA 2P8JA 3H3FA 3WYEA 2GXQA 3Q3CA 4URXR 4LE1A 5DBOA 4TWBA 1A97A 3HKEA 3FE2A 3SIXA 1Q3HA 3RHTA 2QVXX 2ZAGA 1KZ7B 3GJQA 4LQDA 5K20A 4I9GA 4M3NA 5BO5A 4ER3A 2ADMA 2DLCX 4EVQA 4BV2A 4J75A 2GZDA 4AF6A 1VIMA 3ZGLA 4UOEA 4YRFA 2AGVA 2WM2A 3OC6A 5TPWA 1D3AA 4EO7A 3WLRA 4QPJC 2VDQB 5HCUA 3MWLA 1N3LA 3WBJA 6LDHA 1CKEA 4XSVA 4JA0A 3ZI0A 4F46A 3EDMA 2HTFA 3QK7A 4AP5A 4K0RA 2VNKA 5JDCC 4AG5A 3UWPA 1RZRD 1V3QE 2QM7A 4ZAFA 4ZEXA 4K6CA 3R75A 4KOAA 3C4QA 2ZUWA 3ROMA 2DETA 4H6PA 1D1TA 5ES3A 4MSUA 1XCMA 1A96A 2FQWA 2GEDA 4EKDA 2XCSB 1L5SA 4DV3B 2H1WA 1K0UA 3EW7A 2JFPA 2CSXA 3IO3A 2NU9A 2W6PA 3F2IA 3AEKA 3JVDA 1FP7A 2RHDA 4NYIQ 3TDMA 3HXQA 3WIUA 4MV9A 3ZC3A 1CF9A 4LK3A 4EA6A 3LW8A 2AK2A 2GGSA 2OHOA 4XEHA 4L4YA 5AKYA 4A2CA 1VIVA 2BFPA 1GUYA 1AKYA 1IWPB 2CFRA 2PAFA 3RNLA 1KI3A 3DOJA 3EW9A 4RC9A 3P0RA 3RS4A 1Z29A 2HO4A 3LQQA 4M7RA 4DR7B 4TTQA 5FWAA 1GAXA 2PU7A 4KIGA 4XCXA 2AFIE 3E27A 3A36A 3OPQA 3SC6A 2X4IA 4JEMA 1R9NA 4BCDA 2EKQA 3UT5B 3D3WB 2DBRA 2H07A 1Z73A 1GRQA 1W5EA 4HS9A 4JJKA 4Z51A 1EESA 2VCYA 5CLQA 1XA4A 3M9XA 4MI1A 4R7TA 2CNWD 4YJKA 4E5PA 2QT1A 2REXB 4KH0A 4L4XA 3ENZA 1M2KA 3MAJA 1FFSA 3O8BA 4G4IA 4Q4JB 4UHEA 3K94A 5KJCA 4RVHA 2VZEA 1EVYA 3ZR4B 4BDTA 3FPBA 4QXAA 2P62A 2IPXA 1KYWA 3ETLA 4QOIA 1CF2O 4R3NA 3TZBA 3CA8A 3ZE6A 4BTLA 3L0CA 1G8AA 1I7PA 5KCZA 1PP4A 2X8JB 2BM0A 1T36B 2FPKA 2VTKA 5MGBA 1GUAA 2O0LA 3HSSA 3LWBA 1GYRA 4MR9B 1HFEL 2IXDA 1JIIA 4BL5A 2CNOA 3K6RA 4XB6B 1YIDA 1ZXLA 1F8UA 4KAJA 2ZT7A 3VZBA 4KPYA 5B58C 1XPUA 3ROEA 3W34A 4KX5A 4M21A 2WHPA 2HZ7A 4GFDA 4UJ3A 4KNWA 4S24A 1TYZA 4WLVA 4BAGA 5LJLA 2O23A 2JJ8A 3UA4A 1M5RA 1FW6A 3DA8A 2D54A 4L5BA 1OZ0A 3FPHA 3O3MB 3RFUA 2FKAA <