2I7DA

Structure of human cytosolic deoxyribonucleotidase in complex with deoxyuridine, alf4 and mg2+
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
193
structure length
193
Chain Sequence
b'RSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase, cytosolic type
publication title Structures of Human and Murine cytosolic deoxyribonucleotidase: Insights into substrate specificity and catalysis
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 65
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature ec 3.1.3.-:
pdb deposition date 2006-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 2i7dA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2i7dA01
1NF2A 1VFPA 2NO4A 3NASA 1YDFA 3EWIA 2R8EA 2OA0A 2FEAA 1RLTA 2ZG6A 3WKDA 2WM8A 5AKZA 5ALZA 2PR7A 1Z4OA 3KBBA 4IFTA 2R8XA 1RLMA 3M9LA 4EEKA 3QU5A 1ZD2P 2JAUA 2WF6A 2HO4A 3PGLA 4Y2TA 4XOUA 4Y2XA 3U7FB 4Y2UA 5AI0A 4J2TA 3J7TA 5AVYA 1J97A 3ZWKA 2HDOA 5AK6A 2YJ4A 1XPJA 1Q92A 4UARA 3ZTYA 5ALOA 4UW9A 4ZEWA 2HSZA 3IJ5A 1N9KA 2RB5A 3FGOA 3KDPA 3P96A 3SLRA 5AKKA 3ZX4A 3B9BA 4HGOA 4UMDA 3SD7A 3I6BA 5A3SA 1LVHA 3FM9A 3N8GA 2NO5A 2AMYA 2ZBEA 5ALGA 3AR8A 3S6JA 2WF5A 2G07A 5ALEA 1XVIA 1L7MA 4UATA 2D2VA 3N1UA 3N28A 1Z4IA 3L1VA 3NRJA 1T9ZA 1WVIA 4J03A 4Y2YA 5AVVA 5AI9A 4PNHA 2IA5A 3I28A 4OFZA 4FE3A 3A1CA 2IYEA 5AVQA 3QUCA 5AM2A 1SWVA 4C4SA 2BY4A 4MUMA 4I9FA 1WZCA 4YGYA 4XE5A 4L57A 3OCUA 2O9JA 4MWOA 5AKGA 3AR5A 5AI6A 4ZEVA 3WGVA 2JAOA 4CF4A 3QU4A 4JDPA 3OCXA 4XQ0A 2W43A 3WKCA 2YBDA 1Z4JA 4HGRA 5E0OA 4Y2VA 2RAVA 3WGUA 3HYCA 4NWIA 3FVVA 1FEZA 3PDWA 4GXTA 1RLOA 4YIHA 1QQ5A 2G0AA 4ZEXA 4CNQA 4BX0A 3EF0A 3L0YA 2B30A 5AI5A 2HI0A 2GHQA 2RARA 3WK7A 5AM1A 2ZOSA 3RFUA 3OCZA 2HHLA 3QUQA 4Y2SA 3QLEA 3SMVA 2X4DA 4YCNA 3F9RA 5ALUA 1RMYA 5AKEA 2G80A 2GHTA 5JJBA 3B8EA 3L5KA 4O8CA 3IRUA 3UM9A 4UAVA 1CQZA 5A3QA 4C4RA 2QLTA 1TJ4A 2WF8A 4L6CA 4KNVA 2FPUA 4UU0A 3ET4A 1YS9A 4UMEA 4RETA 1L7OA 5ALWA 2EATA 3WKAA 2YN4A 2HX1A 2YMQA 3AR9A 2HF2A 5AK5A 3ZI4A 1CR6A 1MH9A 3SHQA 3AR3A 5ALNA 3AR6A 2IOFA 5AW3A 4UU1A 4NAVA 3QGMA 4BEVA 1Y8AA 2WF7A 1RC8A 4YCLA 2C9MA 5ALKA 4OCZA 3WK6A 3WKEA 4BX3A 3OCWA 3CNHA 2YY6A 3NANA 2FUEA 4F72A 5AM4A 5AVZA 3ZX5A 2Q5EA 3OTQA 1Z4LA 2YMLA 1U2SA 5ALQA 3QNMA 1LTQA 1YMQA 2CFSA 5ALMA 1RKQA 3ZVNA 4F71A 2JGAA 5AIAA 4UM7A 4Y2RA 4YCMA 1Z4NA 5ALPA 5ALIA 5AW7A 5AHXA 4EZEA 5AW5A 4UAUA 3U7HB 2FUCA 5AKLA 3ZWDA 5AI4A 3BWVA 3CZ4A 4KX3A 1ZD5A 3BA6A 3I1YA 4EENA 2HF7A 5ALXA 4KX5A 4UM5A 1Q91A 1RMTA 5ALFA 3M1YA 2YJ5A 5AIBA 3PCTA 1ZD4A 4E88A 2EAUA 4Y2PA 2OBBA 1T5SA 3ZUPA 1TJ5A 5ALVA 2FPRA 1Z88A 1TJ3A 5IS2A 2HCFA 4YIKA 1ZOLA 2NYVA 2ZBDA 4BNDB 1WPGA 5AK4A 3U7EB 5AK3A 2C4NA 4HGNA 3L0BA 5ALYA 1RQLA 2G06A 1SWWA 4Y2JA 2AUTA 2P69A 3QYPA 2GO7A 3E58A 3WK8A 4HYTA 3RF6A 1EK1A 5AKXA 4OD0A 4NV0A 1L8LA 2PQ0A 5ALRA 2BDEA 2YJ3A 5AESA 2C88A 3SKYA 2P27A 4L6AA 4Y3UA 3EPRA 5ALDA 4I9GA 2I34A 5AW9A 2VKQA 3IB6A 3L8HA 2JARA 2WF9A 3L8GA 2B82A 1ZD3A 4RESA 3AR2A 2AH5A 4BBJA 2W11A 3WK4A 5AKHA 1ZS9A 4CE6A 1TE2A 5AKIA 4DFDA 2QYHA 2I7DA 1O08A 4BKMA 2R8YA 4DWOA 1YNSA 3NALA 2I33A 2O2XA 1QH9A 3ED5A 5AI8A 1Z4PX 2W4MA 3MC1A 5AM3A 3MPOA 1U7OA 2I6XA 2ZBGA 1RDFA 1ZJJA 2OYCA 1U7PA 3NUQA 1QYIA 2MU1A 1YV9A 2MSNA 5AW2A 5ALTA 4BNDA 5IT0A 5AM0A 3ZVMA 5AM5A 2ODAA 3AR4A 1T5TA 2YJ6A 2FDRA 3SF0A 2Q4TA 1Z4QA 4Y2QA 3L8FA 2IOHA 2G09A 5A3RA 3D6JA 2CFTA 1IWOA 3L1UA 2HOQA 4BEWA 3ZW7A 3FZQA 4QJBA 1F5SA 5AW1A 3W5DA 4YH1A 2YMPA 4UMFA 2GMWA 4CF3A 5FP0A 2YFYA 3L8EA 3UMBA 1RQNA 1J8DA 3ZVLA 3N07A 5ALSA 1VJRA 5AW0A 1RRCA 1YJ5A 4OHFA 4KN8A 3KZXA 3QUBA 3K1ZA 4FFDA 5AW8A 5AVRA 2EARA 2P9JA 5ALJA 3W5BA 2FI1A 2G08A 1O03A 1Z4MA 1S2OA 3DDHA 4QQFA 4EX6A 2I55A 4UMVA 2Q4RA 3ET5A 2WFAA 3L7YA 3E84A 3W5AA 1NRWA 1RKVA 3QX7A 3OCYA 1U2TA 4BX2A 2C8KA 1JUDA 1Z5UA 2B0CA 1K1EA 1X42A 3R9KA 3L0CA 3SKXA 4C4TA 3GYGA 3WK5A 2PKEA 1PW5A 5IT4A 3KD3A 4EELA 3AR7A 4IG4A 2WHEA 2B1RA 1RKUA 2RBKA 3UMCA 2B1QA 2GFHA 2B8EA 4XPZA 3E81A 2DQSA 3ONNA 1N8NA 1RPZA 4G63A 1QQ6A 1WR8A 3NAMA 2YMMA 3EF1A 1QQ7A 5ALHA 5AVXA 4DCCA 4DW8A 3KOOA 3E8MA 3FPSA 3PGVA 1RMQA 5AVTA 4AP9A 4NABA 3U7GA 3ESRA 4AS2A 1L7NA 3MMZA 3W5CA 1Z4KA 3A1DA 3OPXA 3WK9A 1S8OA 5AKYA 2HEGA 3N5KA 3R09A 2FPXA 3HLTA 4B6JA 4NFLA 3QU2A 4HGQA 5AW6A 2ZBFA 4AS3A 3QU7A 3WKBA 3FPBA 3DV9A 5ALLA 2IOFK 4CF5A 5AVUA 1KYTA 2CFRA 3I76A 2P11A 5AVSA 3UMGA 3A3YA 1L8OA 3ZTWA 3TLMA 2B8JA 3A1EA 3QXGA 3ESQA 2G1AA 1ZRMA 2ZXEA 2BDUA 1VJ5A 5AVWA 2R8ZA 3DAOA 4UASA 3U19A 1Z5GA 4JB3A 2FPWA 2FPSA 3MN1A 1EK2A 5T41A 1L7PA 1ZRNA 1XP5A 1NNLA 2I54A 5AKJA 1SU4A 3U13A 5AICA 4GIBA 3DNPA 3VAYA 3QUTA 3KC2A 3R4CA 2CN1A 4FYPA 3U26A 1U02A 1AQ6A 1TA0A 2C8LA 4HGPA 3B9RA 4HAIA 4BYGA 3QU9A 5AW4A 3NIWA 4G9BA 1L6RA 2OM6A 4EX7A 4KYTA 3ZU6A 2AGVA 3OCVA 4H1WA 4KNWA 2JAWA
chains in the Genus database with same CATH superfamily
1E2JA 3PSAA 3I01M 2BJHA 3VNUA 2J0VA 1U2DA 1AE1A 2OA0A 2POQX 3MMNA 1C7EA 4WFIA 3MWEA 3EHEA 4TMTA 4M9XA 2CNWA 4LMPA 5C18A 4LOLA 4OAQA 2IU0A 1WPRA 3F1KA 5AKZA 2PKWA 5KTOA 2EL7A 1F8FA 1R8QA 4V03A 4EPWA 3AL0C 4CFSA 3NONA 3GDFA 3HI4A 4UFNA 1TC2A 1P6QA 1XA3A 1A8QA 2JVKA 4WERA 4R9SA 2HRZA 3IBYA 2VG8A 1CTQA 2OGUA 4MRAA 5FRDA 1BEZA 1GZ5A 1PFVA 1QIHA 1Z0JA 2P6MA 1CUSA 3JZDA 2O2IA 3UO8B 2F3UA 4CVNA 3U7FB 3HB0A 3L06A 5JS7A 4E6EA 1TA9A 3LLCA 1VBNA 4J2TA 1CQPA 2G3YA 4IQ4A 1LLQA 4LTMA 4Y7DA 1AKWA 1P1HA 2BFCB 2C98A 2OG2A 1HI9A 1YDWA 1EE2A 1Q12A 2YYAA 4TWZA 1QFJA 1J25A 2Q99A 2H8KA 2ZRCA 4OVKA 2ZUCA 4B45A 1NF8A 2I4RA 3ECCA 4CT5A 4QDOA 5G3ZA 2JIZD 4DPLA 1IQPA 5JMPA 4NCBA 2QUAA 1QKIA 1SUCA 3PPXA 5JRDS 2E4XA 3DOFA 2FPIA 1T4BA 2YWXA 1TI7A 1CEXA 2BTOA 3K9CA 4D9CA 2ZUBA 3ESCA 2RI6A 2ODTX 1PZMA 5CW1A 7ADHA 1XKLA 2PMEA 3SZGA 4AJEA 1X38A 5EXEA 4F2PA 5EZSA 2OK7A 3FCUB 3VR4D 1H69A 3G02A 1JDZA 2PRIA 2VP5A 3ZXYA 1AGPA 4YMIA 3PPIA 2FGJA 2CL0X 2YXLA 3I6IA 3IH5A 1DG1G 5FKJA 5I7OA 1O0BA 5KQPA 3LT1A 4BMDA 4YRKA 2QT9A 1PDVA 1FP6A 2OESA 2NVUB 1X8LA 4D6PA 2W6ZA 3QLUA 4RY2A 4KREA 4QGHA 2XCTB 4C06A 3DT9A 3IIKA 4QNMA 5AVVA 1CF4A 3WQSB 2HNBA 4IJQA 3M9WA 5KNDH 3CH7A 2GD0A 3KUCA 4TXJA 4PHGA 4PNHA 4IH4A 2PUJA 4V0SA 1NW7A 3PUIA 3EC7A 4ZARA 5EHZA 2I4NA 3RIMA 3J80A 4DV2B 2HA4A 3VNSA 5JSHA 2C5HA 1L3CA 1Y82A 3KUKA 4AJHA 1U5CA 1JE1A 4EDHA 3HTXA 2X2PA 3OZFA 3T4PA 3FXAA 2C7QA 3CLSC 3IA2A 1YZYA 2KS6A 2VTKA 3EIEA 1D4ZA 5BSGA 3GJ3A 2RGDA 4XWKA 5KNBH 5P8WA 4X63A 1UBCA 2EP7A 2OCKA 4QU0A 4D1YA 3REQA 4MWOA 1CUHA 2DQZA 5AKGA 1DIHA 1D4FA 1Q14A 4M9ZA 1XEXA 2O4UX 5HF5A 3SFTA 4W1PA 5C8VA 3VNRA 3H2JA 5HKLA 5C31A 1OHHD 3LCMA 2PGIA 3I1JA 3F9CA 3HFGA 3I04M 1X7ZB 3SICE 4ZJZA 4LF5B 3WLPA 2QV0A 1XWIA 2VP6A 3VX4A 3QPAA 4EFLA 2DPYA 4HGRA 4FD2A 3ZHXA 2A33A 1JGTA 2ZSHA 3KP1A 2D2XA 3UBTA 3IURA 3QOFA 2SCUB 5HJEA 1JHUA 2WG0A 1FDUA 1N8TA 3RAEC 3EGVA 4PGFA 3CG0A 4XARA 1D0IA 2GAAA 3HR8A 3VDMA 1BGVA 4BX0A 3D6MA 4CZ2A 5CFLA 4Q05A 4EA8A 2EKZA 3NYRA 5F2KA 2GHQA 1F1BA 4MUBA 2ZVQX 5B12A 1IXSB 4CPDA 5JAHA 4R2LA 4AZSA 4C87A 2G4LA 4G5RA 4HS4A 3RLFA 4XRGA 4W5QA 3REFA 3DNMA 4BNUA 3GR6A 3QLEA 4I1YA 2HA3A 3JQ8B 4NQRA 4YCNA 3F9RA 4IVNA 1E20A 5CPFA 4FFOA 1GWNA 2MSCB 2GHTA 2WU0A 2MSWA 5IP5A 1NQOA 3ZWNA 2X42A 1L5VA 1BEEA 2HMSA 2PMKA 1M75A 1NUUA 3QELB 3TVYA 3T5PA 4INAA 4S2UA 1W36B 4DDHA 3DKPA 4M0DA 2IBTA 2VJNA 1QZ3A 1KMQA 3GRKA 5KVVA 5J2UA 1IBRA 4RPCA 2HCTA 3W4KA 4DJAA 4F7DA 3M7IA 4R31A 1RBMA 1SXJE 5HEKA 2C0QA 2CV1A 1X3SA 1QG6A 3BCSA 4QZVA 4KAJA 4PS1A 3GNTA 1S2MA 1WOMA 1SQSA 2VT3A 4FKZA 5F2EA 3RVRA 1N0WA 1QIMA 3D6FA 5B1EA 1BFDA 3WXBA 1NUSA 3UXYA 5KYGA 3DHEA 1GZVA 1F12A 1N2CE 3L9WA 1JIIA 4ZALA 3TL6A 3D0RA 4LX0A 2XYVA 3QGMA 4JJ8A 5C37A 1TJPB 1KDOA 1GA6A 4WXYB 2XNHA 1P5HA 1V25A 3IQWA 2CL7X 1JILA 3RBVA 4A10A 3QW2A 5TSDA 1CY4A 4GOXA 5IKMA 3C8MA 1PTKA 1KJYA 4HQKA 5F3DA 1E6EA 5DIZA 2HIAA 3PWZA 2ZRKA 4CIWA 1DTWB 2CHQA 4DS3A 3FWPA 4OAOA 3QMWA 4Z1OA 3A1UA 1KTIA 1N2BA 3LMKA 1OZGA 4EY3A 4MCIA 2FN4A 4GGMX 4IMRA 1R0BA 1SQFA 2DQYA 3H9UA 3VYVA 3EVGA 2O05A 1SHZA 3LBHA 1F9AA 1DJOA 1E4YA 2HNKA 2OV4A 3RTAA 4XCQA 1N6RA 4FSDA 3G13A 3T94A 1PGQA 1VP3A 5ARCA 3V1UA 4JLWA 4Y2RA 3T5BA 3WL8A 3F46A 3PC4A 2V7BA 1R0CA 4GMXA 4JOBA 3W2EA 1F4PA 1FDVA 4CMAA 3PA8A 5FTLA 3BWBA 1I51A 4H7PA 4CIDA 5IWAB 5F9HA 3PIDA 3V32A 2YVUA 4Z2AA 5H80A 2G67A 1NVDA 2DPLA 4AZ0A 1X9GA 3WIBA 3W5JA 1XDUA 4C2AA 1Y7LA 2B4RO 3BB4A 4IWYA 2O3TA 5CDFA 2I5PO 5JD6A 1RYHA 3C87A 1N3BA 1ARZA 2OO3A 2QENA 4W9NC 4F6RB 3FWHA 1PJSA 1Z12A 3BA6A 3URKA 1PEDA 4BKOA 2PKCA 4U9IS 1D2CA 4RACA 3R3JA 1JG6A 1YR8A 1XMSA 4TL7A 1UBNA 3V2UA 4EAQA 2EWMA 4DWVA 4E88A 1LCIA 3G5AA 5LMNB 1G9TA 3EZFA 3LP6A 1TD9A 4D4LA 1EWVA 3RVDA 3H42B 2EHJA 3CLUD 4EPYA 4DGSA 3ZVRA 1PEAA 5LL6P 1N8SA 1NBHA 3GGCA 4I55F 3SHVA 3WOVA 4L2IA 3QVMA 1MQSA 4F1WA 2UYQA 2H1VA 2IOYA 5H81A 3KVRA 3FHLA 2BKEA 4NBUA 4JBWA 4IIXA 1F6DA 2WDZA 3MWGA 2B37A 4DR7B 2P6OA 3MINA 2PSJA 4RX1A 1XPUA 3TTTA 3CNQS 3PHHA 1Z63A 1FVXA 2PCLA 3EIXA 3G2LA 3L79A 2VF2A 3ED1A 2P91A 4Z3DA 3UK7A 1ZAYA 1LX7A 1QHXA 3OZGA 1SPBS 3PL1A 1VJTA 1U0BB 4MV5A 3ZBPA 5ICSA 1EHIA 2Y2VA 3BWMA 3CWCA 3E5HA 4IQ0A 4IIYA 4TT3A 1DC4A 4URUR 1AZSC 4LJRA 1RWVA 4CJXA 5CA1A 4R9UC 4WESB 2O14A 3CLRD 4Q03A 2JLAA 4EHIA 2HSDA 2NIPA 4CIBA 3PXCX 2R65A 3NTVA 4WOCA 2W93A 4RV9A 2XOKD 5AMXA 1C3OA 5AOBA 2PZGA 3E82A 4MITA 3OPNA 1RR6A 2ZJFA 2A9QA 4BAZA 2GUWA 4XDHA 2B7CA 1DO0A 1FNBA 1M54A 4YLGA 4ZTBA 4BGIA 1NZFA 2O2CA 3I12A 4D8XA 1AQJA 3LLUA 3RRMA 3HMQA 4X1IA 2UKDA 3ANSA 4IKOA 3HCCA 4KBFA 2GM5A 5LU8A 3K7EA 1YUNA 4FUQA 2OYSA 2VJYA 4MDYA 1RZRD 3K16A 4GEKA 2WSSD 2CDAA 2X9GA 1ZS9A 3TZKA 4DUPA 4K1XA 2HK9A 3EIUA 5JSQA 1H2BA 3QQ5A 2WJ6A 1NNI1 5CAEA 3N6RA 4V0ME 4O4HF 3PP8A 3G59A 1E66A 3ASZA 1L2TA 3DV0B 4QYTA 4RJTA 2Z6UA 2JKYA 3BGSA 2YZKA 1EA5A 1R37A 4GLOA 4MV0A 1I4EB 5EJ8A 3K0HA 1OWNA 1UPBA 4QG3A 5EZYF 4MWZA 4KK4A 2P4UA 1U7PA 1C0IA 3V4SA 4IVQA 2FWAA 5EWJA 3H8JA 5GP1A 3KXLA 3MS2A 1Q7GA 3HA5A 2J5RA 5IDXA 1CUDA 2B94A 2IPNA 1E58A 4R2HA 4DEVA 3DOHA 5AM5A 1QANA 3OLYA 4DQDA 1BCSA 5IM4F 1JZSA 1NLFA 2F43B 4YAUA 2XUKA 1QRDA 3AOEA 3TINA 4KPEC 2RFLA 1YFLA 4FB4A 3G2KA 1J1IA 2DWCA 4UHDA 1M6YA 2R79A 4AJ1A 3ME5A 5EN4A 2PDAA 4L27A 2ASEA 3ABOB 5DE3A 1DKQA 2HGSA 1KXZA 1ESMA 1AS0A 1MDBA 3D6JA 4NPAA 3NEYA 3CZRA 1NOKA 2PN1A 1P72A 2Q0XA 1OFHA 4RVHA 2HOQA 1CK4A 1JWLA 4ERXA 2A84A 3FMGA 1LK7A 1H3EA 4IKPA 3D6TB 3T4UA 2NQ8A 5A9TA 1ZVQA 5E6SB 5FLKA 3TG8A 4WBNF 3C98A 3RQIA 3OAAD 4CTNA 3EJ6A 1OYOA 1UDAA 1U0SY 2JCBA 3KDSE 4IRXA 4KWEA 4CKCB 4XD7D 1PK8A 1QZXA 3WNCA 2G8LA 5A0TA 4DNQA 3KDAA 5BR8B 3DQZA 4HVAA 1T5LA 4P7GA 1G21A 2CV0A 4OQXA 1DXQA 4HP8A 1Z74A 2C4HA 1KGDA 2HBZA 3IPYA 3O83A 1I2CA 5K3EA 4IX1A 3ONEA 3OEHD 1BGWA 4M55A 4C6RA 1LDBA 1DSSG 3CPSA 3COPA 1PV1A 4A0GA 1J8FA 2IEDA 4IIJA 4RJIA 3T06B 2FUG1 4DMCA 3WS7A 4DBLC 1DRUA 4ZICA 4O1MA 3KPUA 2OV6A 5FAKA 4LVOA 2ZS8A 3RWOA 1A4UA 3B1FA 3EAQA 6CHYA 5IC6A 2R25B 1NXSA 2IXBA 4RZXA 4ZQCB 4NZYA 1TIBA 1E6MA 1R9MA 4CEHB 1EP3B 3FPAA 4OHMA 4US2R 3AHFA 3R9KA 2PKEA 1E1KA 2BAGA 3C6ZA 1XF9A 1L4YA 4YJDA 1I9CA 2VJQA 3O3MB 4OHZA 3RU7A 1D6JA 3HEAA 4HBGA 4X1YB 3UMCA 1G9SA 4XGRA 2DYKA 4IX9A 4LJ8A 1OI2A 1KK2A 1F4VA 4B35A 3BJEA 4KBYA 1RZUA 4XRRA 4UD6A 3O4IA 1EQUA 4YV7A 1BW9B 1C1XB 2CB0A 2ISCA 2XCSB 4OLHA 1FUKA 2R0QC 2YMMA 1KYWA 1QQ7A 4G4SO 1M5RA 3LUJA 5GPBA 1U4OA 3I2FA 4L8FA 3DE0X 3HYLA 3LDAA 3HO8A 3DS8A 4X93A 4RQBA 3ICVA 5EE3A 1K66A 2Q5QA 4ZAXA 3MMZA 4L15A 1T13A 3KQTA 2OMKA 5KQLA 4UOZA 2GTHA 3KVOA 3C6KA 3FYDA 3FDIA 3SSAA 5CCBA 1HZZC 4DLRA 1J2UA 4WOKA 3LCCA 4OLFA 1F0PA 2VA9A 3S7ZA 1YRAA 3COSA 4MAAA 2FR1A 1OXBB 2Q5OA 1IVNA 2EGHA 1XKTA 2VPYA 1NKSA 4ZQEA 3KOXA 3BQNB 3OF3A 3UV6A 2UUCB 3QNUA 1DXYA 3HB5X 3GLHA 4PQGA 4HXGA 1KVUA 4MW9A 4EKGA 1RAEA 1TVCA 5DM70 4IQ8A 1LW7A 4Y0AA 4DVJA 1RRFA 3I9JA 1DXOA 1XZJA 2FEWB 2YR0A 3DKVA 3ESQA 4ACBA 3D8SA 2MOKA 3O1HB 5FULA 1YI1A 4CKEB 2PV0A 1FJXA 3L7CA 5EIHA 4IIHA 5JAUA 3Q6NA 5JZMA 4EGFA 5JLJA 4CLOB 2R11A 4I4TF 3FSRA 3UPTA 3AY3A 3F4SA 4ADSG 2ADOA 2WFMA 4ZAWA 2MMGA 3PCXA 1NGSA 1Q1AA 2VDRB 2ZUEA 4Y0NA 4L8GA 1OV6A 3DE2X 2Y2UA 3IVXA 4LA4A 3WDKA 3CPHA 1AS3A 4N5HX 5EJGA 3BVPA 2F2TA 2ZBQA 2BYTA 2EU8A 3TMKA 5DCUA 1TA0A 4FHFA 5A62A 5JNSA 1A1VA 3DZIA 4I5EA 2PR2A 1G16A 5JG7A 8MHTA 2C31A 3TW4A 3IBGA 4GUDA 4CODB 2WD9A 1P5FA 2QV7A 3GEBA 3BE4A 3ONDA 4LV6A 3M3HA 3D8RA 5FI0B 3LOUA 3ZZ0A 2AOUB 4FFLA 4KNWA 2AOTB 4DUZB 1GGMA 2AUMA 5F7ZA 3DMFA 2ZJ1A 3H2IA 4YI5A 2C77A 3PR3A 3DFFA 2VIIA 3HKBB 5KS2A 2AS0A 5CW2A 1M7BA 1UEJA 4N41A 3HRIA 4WQMA 4OBWA 4XEHA 1HGXA 5CXXA 3C8TA 1ONBA 3WAJA 4N0QA 4M0LA 4RKYA 3M9LA 2QP9X 2QJWA 4XB2A 1HRKA 1ML3A 1S2GA 1FX0B 1V8ZA 2OT3B 2YW2A 1W48A 2BVNA 4Q4DA 5EIEA 2J3QA 3UB4A 3NT5A 1AJEA 2D13A 1SG6A 4MVJA 1RI3A 3KCQA 2DT8A 2NYAA 1NPYA 5AI0A 4G67A 5GV8A 5JSKA 4DA4A 1FVFA 5DRYA 1A96A 1U8AA 1J97A 1QHFA 4M0KA 1YQ9A 3PNSA 4K9QA 5EXTA 4JC5A 5F78A 4YP0A 1UKEA 2J0UB 1CETA 2QE7A 1YRYE 2JZNA 1SELA 2HZ7A 2J1LA 2ZSUA 4RH0A 5JDIA 5T64A 4QJ5A 3C70A 5IK2D 3EQZA 3H1FA 1FRNA 1M83A 1EXVA 1RAFA 1PFUA 2JJQA 1QQTA 3L02A 3QOXA 1DAFA 4GPZA 4N3GA 4O2AB 4TTSA 3G6WA 4EECA 3UMRA 4YXFA 1ZNYA 4PPGA 1QORA 4NLEA 4KAXA 4YONB 5I4CA 1VA5A 1Y63A 3FIUA 5AQEA 3WO1A 2NP6A 2AF4C 4GHWA 2Q9AA 3MBIA 3SD7A 3I6BA 3AHJA 5EIBC 1Y8QB 5A3SA 4EF4A 4EG3A 2WIBA 2QLMA 3F8WA 4ESEA 4Q3LA 3SF8A 4BIMA 1DNPA 3Q15C 3S6JA 5L3RA 3WHKA 4OM8A 3E22B 2C7BA 1GQFA 2G07A 4MNTA 5JH7B 3F2VA 4Z5XA 4B4DA 2O3JA 2Q3BA 4MINA 5KOHA 1LW6E 1XRQA 1UIRA 2A9PA 3O1LA 4IRMA 4NH0A 4O4IB 3VSAA 4XCXA 2Z2YA 1C4XA 3DHNA 3WGGA 1SVIA 2F00A 2V9ZA 3A9WA 4Y2YA 1XTTA 3UKOA 4FVTA 5BURA 3U4MA 5DYWA 4A5SA 3SP1A 4CEIA 3I28A 4QYMA 2Q4OA 2C83A 4FDLA 1V71A 3A14A 4HDNB 3KLBA 4RH1A 5E9AA 4WECA 3E48A 1D6SA 3M89A 4XYEA 4JI4B 5H83A 2FQQA 3QX8A 8ATCA 4ABYA 3O8DA 1ZL2A 3GNSA 3JQFC 1FP1D 3P20A 4G6ZA 2ZJOA 1WUIS 4XKJA 5EIOA 3GO4A 2EDAA 1YWGO 2QRLA 4QYXA 1NMEA 3N0RA 2VJLA 4E2ZA 3DXZA 4GPIB 1JR6A 4IWNA 1QH0A 5GVRA 3HN2A 2AJLI 4EDFA 4D9BA 1SKMA 2IP1A 3NHKA 3EFHA 3WKCA 4EHLA 2QRNA 1L5YA 3RVLA 1GITA 1S8FA 3M4YA 4B73A 4EJ6A 3W3ZB 3A7EA 4EYEA 1R4AA 3HCWA 1KAQA 3L84A 5LXTA 1E6LA 3RC3A 3CVXA 1JXMA 2VXCA 2HMVA 1A9PA 2GCPA 5JVDB 3WIVA 1LFAA 2D54A 5FPQA 1QHEA 1HYEA 2Z8XA 3OIFA 4EF5A 4M88A 4JR0A 1UT5A 1P0CA 4ZXFA 2ZRAA 3BREA 5AI5A 2WPDA 2I87A 3LW7A 3OZCA 1GUAA 1TRKA 3A25A 1GNSA 3FKJA 3C3WA 2IE0A 3AI7A 4PPYA 1K8YB 1LLCA 2Y93A 4X00A 5PGMA 3PTZA 3R3WA 4A73A 3D64A 3ZBQA 3HBJA 1K9VF 3C2QA 3IUYA 1GT91 4N5NA 3SMVA 4ODIA 3ZE2B 3ZXUB 5LQNA 3ETEA 1UPCA 3DWGA 3EVZA 4NZMA 4MK4A 5JALA 4GE0A 1Z28A 2NACA 1ONNA 3G89A 5DISB 5A5EA 1LBEA 2W2XA 1GYQA 4RK7A 4C01A 3JAWB 5K0BA 2AVNA 5D87A 3G7UA 3VR5H 4IGFA 1Q17A 4LZNA 1QG2A 5KDOA 2JLXA 3IMKA 1JSRA 3Q0IA 3B5EA 4RETA 4CM7A 1L5OA 2DFLA 2FFHA 3QU4A 4BNLA 3S1SA 5KMGB 4R68A 4JI6B 3M82A 4RPIA 1MJ5A 1PSDA 5DZSA 4A1OA 2R2AA 1R74A 1CHNA 2ZR8A 3V8EA 3RGGA 2O2ZA 3WYGA 4FDUA 4A3SA 1Z06A 1AGNA 1KI7A 2P5YA 4GOJA 4TLEA 4TWRA 3FVTA 2PRSA 3SHQA 3R5SA 1S6YA 2J9ZB 2KI5A 3HZRA 1YB2A 5KX5A 3M6XA 4DLYA 1VG8A 3L4EA 3PNLA 3SC4A 3W34A 5DBEX 2FB9A 1AZWA 4WNAB 2QD3A 2WA2A 3I32A 3KK0A 3DLPX 4G5FA 4KVZA 2NUTA 4MA0A 1JG7A 4ZJUA 4H7DA 4X84A 4U63A 3V3KA 4PX3A 2M2IA 3FOBA 4JHXA 4RXMA 4ZQHA 4ZTZB 5C81A 3N74A 4AZTA 3IMFA 1CZOA 2VRWA 1XEWX 1CLEA 4M49A 1DKPA 2F1OA 3GPCA 3WJ7A 3L7NA 1Z7YA 3EMKA 4KN5A 1Y1TA 5D5HA 4Q39A 5GJCA 3NANA 5FTWA 2WWIA 2TECE 5AVZA 1ZJZA 1IUNA 3HB9A 5DN6A 5IKEA 4YP7A 1J42A 1P4SA 2I9PA 4ER3A 1U2SA 4HD8A 1WX1A 2VNSA 3D31A 4TM8A 5FR1A 2NPFA 4BVEA 4DA9A 3RM3A 1KP3A 2JIQA 4B47A 3VH1A 1R4MA 4YCSA 1DU4A 1A5ZA 3SIRA 1NF9A 1PJZA 3P4UA 4YACA 4HK4A 4CQMD 1UUFA 2PQ2A 3IEXA 4O08A 3NEPX 1FXUA 1Z4NA 2DECA 2VYVA 4FNOA 5CTAA 3NCTA 3MS7A 4BS9A 2SKEA 4ADLA 2WOJA 3FNQA 3G0BA 5BXYA 6PFKA 1Q11A 4RTKA 3RBXA 1PU2A 4Z0TA 1TCVA 1SXGA 2PU7A 3S27A 2BGGA 1O6GA 1FU7A 4IDEA 5LP1A 5FWXB 1M2KA 3UJCA 4MCAA 3LX6A 3TFQA 4U2BA 2C84A 3I1YA 4EENA 3VYUB 1C9KA 1COZA 3PXEA 4ESOA 1FUUA 4DCPA 2A0XA 3VKUA 3NGXA 4URVR 4HDSA 1KSHA 3PCTA 4X24A 1JR4A 1ZQ9A 2VPZA 1VBMA 3K1YA 3T4EA 4NL4H 5BY2A 2NO7A 1XPOA 2EAUA 2BL4A 3ZUPA 2YHUA 3CPEA 3N05A 2ATCA 1GPWB 2FPRA 3TOXA 1PWEA 2IKSA 2WIKA 4HG2A 4RSHA 4U02A 2UVPA 4HQ6A 3R7SA 3MERA 4W9NA 1UBHS 2YCLA 5H82A 1JVSA 5K7SA 4C14A 3KWMA 5CX4A 1BKYA 2ABWA 4JJ7A 4LHXA 3FWZA 3HVJA 5ED0A 2OKGA 5D01A 4LIPD 4Z3KA 4D3YA 2HRCA 3EA4A 2ENUA 3KQQA 4HNHA 2HHAA 3ZV7A 4KR6A 1PHPA 3D3EA 4B7CA 4DIBA 3ER9A 1WP9A 2NO9A 1G8HA 5KNDA 2PX6A 3A06A 3JY6A 3A9VA 1SOVA 2FNAA 3QFSA 4R9RA 3HS3A 2ZRFA 3ELDA 2PX0A 4QEKA 1ZESA 3JVDA 4W6ZA 2Q8NA 3G7SA 3ID6C 3UT5B 1LTHR 1EK1A 3AOGA 2YXDA 1GQQA 1TM5E 1XD9A 3RYHA 2FKNA 1MMFB 4BVLA 5HM6A 3WYCA 2HQ1A 1SQ6A 5LZ2A 2REQB 1V26A 3ONWA 4NJEB 3Q8WA 3CW9A 4A6XA 4EATA 1TQ2A 3KIPA 2C4VA 2PA0A 1JR3A 1JFFA 1T3TA 4ER0A 1OH6A 4BZWA 1WZNA 1CHDA 2VK4A 3AQIA 3IALA 3JQ7B 5SY9A 3TQIA 3IR7A 3VPBA 4RULA 1A8PA 2WF9A 3HWSA 4F5DA 2D8MA 1MNQA 5HQJA 5EP3A 4RESA 3UFBA 2EDCA 2HPHA 4CI0B 1O6BA 5DGDA 1V47A 3PQ7A 3BQ9A 4ME6A 3NH9A 3PT5A 1V0JA 4IZIA 2O8FA 1C1HA 4ARCA 1JI0A 5A3JA 1J3UA 1EDEA 1QWOA 3JQAD 4HQOA 1UZNA 2DUNA 5I9TA 2QM0A 4EA7A 2JK0A 2I33A 4J0IA 5AVKA 5ERGB 1NJSA 4B76A 1QCYA 5AI8A 1Z4PX 1QOPB 4Q3BA 5A03A 3FFTA 4NIMA 2LKCA 1ZK1A 3NAQA 3O1JC 5GJBA 1AQYA 2QR3A 4FW8A 3LT2A 5EE9A 3RE1A 1O7JA 1XI2A 4FU0A 4DQ0A 2XNKA 1KS2A 4M1WA 4WKNA 4BNDA 5J5AA 4FZVA 3RUPA 3R3YA 3EFBA 1K98A 2WB2A 3VSEA 1KI2A 3IB3A 4KRXA 1RXSA 1JAHA 4J7CA 2EFGA 5L7YA 3FMFA 1VXOA 1PLLA 1L5WA 2QQEA 3FI0A 3R20A 1EK6A 3Q5GA 4HPWA 1ZEMA 3TQRA 4M98A 2QMHA 1M1ZA 3I2IA 3M8KA 3L0PA 4YJFB 1VQ1A 5D3MB 2HA0A 4H7HA 1K06A 2VJMB 4URXR 1GPH1 5CA0F 4NYMR 4KHZA 5E9JA 2C7RA 3SZOA 3KQKA 4O25A 1IWOA 5AOCA 5EMNA 3C3JA 4Z0PA 1Y4DE 3KPYA 3UMBA 3PKIA 2JLBA 1YI0A 4MVJP 2NVUA 2OCXA 3F90A 3KT6A 4QJBA 2V1XA 3ZIAA 3IL2A 2E4YA 2WKPA 3HYTA 4OGWA 3AFOA 4U8HA 2Q6KA 1GRQA 2QJRA 3KTOA 4ZI2A 1EFPA 1TVKB 1CE8A 3TQTA 1PK9A 1R0SA 3SJZA 4HY3A 3UV7A 3ZVLA 4EZBA 2P5UA 4D57A 1UP7A 3BAFA 1WABA 3CXUA 4GLFA 5A06A 5A3VA 3VGJA 3ACDA 3K1ZA 1Y6JA 4N39A 2ZJ5A 3WWYA 4C0AC 3CEHA 4ZC1A 2GJKA 2QZ4A 3B6KA 1LX6A 3KKNA 1NM5C 2WBLC 1DS6A 2YUTA 3V1TC 8OHMA 5ADWA 2IUFA 2XT6A 2PFMA 1WSBA 4C78A 1XNJA 3TJMA 1NW8A 4MKFA 2AFVA 3RG2A 4DUGD 5DHAA 2IZ6A 4WY5A 1KIAA 2H65A 5ALJA 1PTJA 1P9LA 3ZKWB 5BQPA 5U4QA 4CMCA 2YDYA 2XUIA 3MFQA 3EPJA 4B6SA 1WOYA 1WM1A 2FW9A 1T8WA 4H3SA 4DJEC 3DPUA 2H1CA 4YCDA 3AF0A 5THKA 1KMMA 4TKZA 3SR3A 1WZ2A 4YLYA 5IARA 4PHTA 4RABA 3NH6A 1YCFA 1C30A 1RKVA 3VZQA 1Z7WA 4HUJA 3RIXA 1WZIA 4OPMA 2AFIB 3CSUA 1I3NA 3GV0A 3G79A 5LA6A 4B75A 2Q5CA 4OJQA 1RJWA 4YJ3B 3HXPA 4U2FA 3ODGA 4P5EA 3H6HA 9MHTA 3KSMA 4CKYA 1Q44A 2JEZA 1YHYA 4R7TA 1PG2A 1E5XA 4IDPA 1UC8A 5H4GA 5HQ3A 1BX0A 1E2EA 1I5RA 5FNZA 3SZ3A 1JIXA 4NAHA 3DE7X 4HLQB 5JSZA 1FXSA 2JIPA 3KSRA 4NOMA 2ZK7A 4G56A 1WKCA 1GADO 1Z56C 4W8OA 2NU9B 1EZ1A 3ZQ4A 2OXIA 4HEQA 2B3DA 2RGCA 4RA6A 2ISSD 2OVBA 3RRXA 2F67A 1KYXA 3LVBA 3CXRA 4G1CA 3CX7A 3RS7A 3UFXB 3DOEA 4LJ7A 4X44A 4YRGA 3K09A 4E21A 2WUFA 3KSBC 1Q1QA 4X1KA 4NYIR 1GCGA 3EE6A 2W8ZA 3VH2A 3KUDA 2QPLA 1E3LA 2VATA 1RXWA 2BRUA 4I5DA 4O6VA 3THRA 1WDWB 4JEHA 1JHOA 3LW8A 2XTAA 1NU6A 3EARA 2BFBB 4CTMA 4N0PA 1VJCA 4LXTA 2X9VA 3LYUA 4EPXA 4WCDA 3KFVA 2P35A 2ORYA 2FPXA 1RPJA 1JG3A 4F85A 4B6JA 3DMTC 5KTMA 4JA2A 4NMHA 3TWOA 2OCYC 3ZJVA 1XJWA 1M6VA 4IIFA 4AN0A 4D43A 3HE3A 3OZSA 4IKEA 5EVJA 5DEOA 4GUAA 2IU4A 4IEIA 2D4HA 1QO7A 3C5HA 3HV0A 3OQJA 5AHWA 1T9KA 3CZCA 1B0PA 1OW3B 1ZH8A 3R76A 3U81A 4GPAA 4X8HA 3PT9A 1Q83A 1GZSA 3K15A 4MW4A 3SJUA 2QN6A 3G0IA 2I3BA 2INGX 4RK0A 4X8MA 4FE4A 5G4KB 1X1TA 1EG2A 5LP6B 1GPNA 1JDUA 1Y3BE 3PHJA 3QKSA 5T4BA 1KQFA 3UN1A 1FMJA 4KMOA 4TRMA 1SHUX 5GGXA 9ABPA 2W6IA 4UDXX 2Z4SA 3CF4A 5CJ2A 3FIJA 4KJZA 4FDMA 1ADBA 2EC5A 4J9UE 3G8AA 3UXEA 3WDMA 4C6SA 1JKXA 3LP8A 1Z7GA 5DGXA 5T41A 3IV7A 3E70C 4XUDA 3RSQA 1HF3A 2PS1A 3KKMA 2I71A 4N40A 1U1IA 4XEUA 4PG8A 3BL8A 2ZS7A 2ZI3A 3DNPA 3OKCA 4HNTA 1NVMB 1T1SA 5L9AA 2JKVA 3P52A 4G89A 4BU1A 3T3GA 4TUYF 5IX8A 2G82A 2BEJA 3OQMA 1YAJA 2W2KB 1Z07A 3B9RA 4DVGA 2G0TA 1G5QA 1Y3HA 3AX6A 2H48A 1VKRA 1U0FA 3G0GA 1USVA 5GONA 2CJXA 4H1WA 4G0VA 2W6NA 4ID3A 4XOIA 3O2SB 3NBAA 3WBJA 2PG3A 2KX7A 2Q8PA 5KC9A 4MIYA 1SVKA 2RGXA 4QXQA 4XH9B 3ZHZA 5CDGA 1UAYA 2DUJA 2QSZA 1CVLA 1EUCA 4OKNA 2WVGA 5CR9A 1GUZA 1TUIA 4CR6A 2H1OA 3INRA 5DOZA 3CO0S 1AK9A 3KXDA 4D02A 1MUUA 5E2AA 1GAJA 2YWEA 4ROTA 4ZXPA 4QQ8A 1E77A 3VDXA 4BKPA 1UBRS 2CXRA 4AFNA 3OLZA 1E94E 1GUFA 1SCNE 4LK2A 4ALKA 4CF6A 2OFWA 2PGAA 5E38A 4UEQA 2XRFA 3CRNA 2HDNB 3G3EA 4IIBA 4MX8A 3AVQA 4PO8A 4DPKA 1NW9B 2GKGA 4NDZA 2RC5A 2PZJA 2ZI5A 2YVKA 1P1FA 2HAEA 4XM2A 3OQBA 5CLIA 2BEWB 3BQMB 1FMLA 2O3SA 3IP6A 2BFOA 3C1AA 2KBFA 1H66A 1QFZA 1B6TA 2ECFA 1GZ4A 1E79A 4X45A 2QL6A 1XPJA 2ZSAA 3VYSB 4B80A 2NMVA 1E6WA 1Z83A 3HUUA 5E7IA 5E3IA 1UMCB 3X1JA 4JVNA 4JEIA 3TBKA 5IDQA 1XCGB 1IQUA 1WBJB 2ZCVA 4IO0A 5ITZA 5ECWA 1D9XA 5I48A 1CR1A 2J9XB 4RPLA 3U3XA 1XMIA 3A1SA 2R1TA 1U2EA 4D80A 1ADYA 2FMKA 3KV1A 1SXHA 2CJPA 4LDRA 1CIJA 4N01A 5FLYA 4EHDA 1E0JA 5E7MA 1YOBA 3PQCA 3MQ2A 1MEOA 4N3BA 4W1QA 4ZVSA 1CQJB 1E3MA 1CCWA 3AUUA 3N8GA 4DILA 2C7PA 2TSYB 3PUYA 3BXFA 4L75A 1WF6A 4C07A 1DADA 3AJDA 3ZJ4A 2PTSA 1J8MF 1YT5A 1UBLS 1Y5NA 4FZRA 4MRRA 5ALGA 5J63A 2HM7A 1XVIA 1MHPA 3AI3A 3IE1A 1NW3A 2D2VA 2EWVA 5DHTA 4AO7A 2VPQA 2BGRA 2CF5A 4RS4A 5EP4A 1R6AA 2YTZA 1QOQB 2JCXA 3E4CA 1B2RA 1XU7A 2NNWB 4Y9DA 5BR1A 4ZVRA 3EISA 5TPWA 1G60A 1L4NA 4TSFA 2Y1LA 4FGUA 4G1VA 2WHRA 5K3FA 4YUVA 1YOVA 1NT4A 4K9SA 4PS0A 5BN4A 2VFAA 3O1IC 2O4CA 1A8SA 3PYXA 3QPBA 2XOXA 1OWMA 1R0LA 3OZAA 4I6JA 4B3XA 3L8DA 5EXXA 1V1JA 5J2TA 3A3NA 4XE5A 5D1HA 1P73A 4IS3A 2I2XB 2DF8A 1KU0A 5F7JA 3MAAC 4KI7A 3TS1A 3INGA 3DVRX 1ZIPA 2Q28A 3UZUA 1K5DA 1BWSA 1TFUA 5FJIA 5I9IA 5ER6A 3T54A 4BGEA 2B34A 2P2GA 4JDPA 1E1LA 2HJSA 3NYWA 3QYJA 3PQ3A 4Q19A 5LSAA 4UUBA 1G6KA 4OHVA 2Z1DA 1DC6A 1RRMA 3HB4X 2AZXA 3G2HA 3P0RA 1U7TA 4WW0A 2FU5C 5CK4A 4Z4HA 2Z5LA 3FVVA 4IJWA 4K5QA 1AV6A 4CEJA 3F3SA 1LKZA 4JODA 4NFYA 2B25A 2FXVA 4RVNA 4U2GA 1U0HC 2NP7A 2OUIA 4KQ2A 4MV7A 2AYXA 2ZBUA 1DIOB 1Q7BA 4TM7A 3UV3A 3WK7A 4ITRC 5HZMA 5AM1A 3GCXA 4DSUA 3ESBA 2ECQA 4C7MA 3AFMA 2Z4TA 2PZEA 4RMGA 1O87A 1M8PA 2IPAB 3UAVA 4HWTA 4DA0A 4RIGA 1XHEA 3ZZ1A 2DERA 2YV5A 1USGA 2X4DA 2K7ZA 3K8OE 4M37A 3AVWA 5JXHA 1C0KA 3MB5A 1GRVA 1DBIA 2H2GA 2O2HA 5AOAA 3BORA 5ED4A 1CJMA 2IUYA 1Q57A 2GQ0A 4DT1A 1EDDA 1VSUA 3AFIA 4PYJA 3R8FA 2CJWB 4UNIA 3TSZA 1ELOA 1GRNA 1QV6A 4G1UC 4J1SA 3IUMA 1VKOA 3MJFA 4H31A 4UDNA 4UMEA 3JQ9C 1GEEA 3TJRA 4DL9A 1JDBC 2IYNA 3C3EA 1NN0A 1GTL1 3FNGA 5KYWB 2G76A 2YMQA 3IEUA 4IRUB 4F04A 1KO8A 4Y8VA 3H0EA 4LE1A 3OT1B 4XSVA 5CM8B 3W1WA 3QG5A 3S3TA 4S12A 3LUBA 4HZIA 5FOTA 3MJEA 5JAZA 5TX7A 5L3SB 3RAFC 1BD3A 2XAAA 4BAGA 5EJMA 4P83A 3GEGA 4EB6B 4KQEA 2HCBA 2R00C 2BEVA 2YWCA 3NI2A 3P9PA 4TVOA 5CX1B 1MC1A 4PRZA 1N0HA 2ZCJA 3JWEA 3SHFA 2X4GA 2O2YA 3AL3A 3EXAA 5TDHA 1DC3A 5KMGA 1DC7A 4QD3A 1WF3A 2WLTA 2IH4A 1P2TA 3A11A 4KNYA 3EW9A 1J5XA 2IL1A 1VG9B 1JFSA 4MTLA 4P7KA 3TSYA 4BN4A 4JJKA 2Z6QA 3MCZA 4PZAA 4YYEA 2ZZKA 4LF7B 1QIIA 4JBGA 1G9XA 3D3QA 1ONOA 5JUWA 4I8DA 1SXJC 2P0EA 4EYGA 4WN9A 3LBYA 4F8EA 3IR5A 3EGXA 5IMSA 1FFHA 6LDHA 1REQB 1R8XA 3W8FA 4GLJA 2AN3A 1PI3A 3LWZA 4MVYA 1QP8A 3HCRA 5KKCA 4HNAB 1JFVA 5ALQA 3VZBA 3DTVD 4NJMB 2CNNA 2FRVA 1NRJB 3FR8A 3RSOA 2YWDA 1QFSA 4E12A 5HKKA 2GTIA 2Z57A 4JLOA 4WXPA 1FB5A 3CBGA 5ITVA 3VC1A 4MICA 3GGOA 4QAJA 3WP0A 3AF5A 1D1QA 2PLAA 3PG5A 2E4AA 1CERA 2ODPA 2ZREA 2BGJA 5DLPA 1BX3A 3CYFA 1WXGA 1EM6A 1ODJA 3B6ZA 2AKYA 3MCVA 2EG5A 4NP6A 4MW7A 4PICA 5AO9A 5AKLA 3SHTA 5B7QA 3CT4A 3WY9A 2QU7A 3IPLA 3RYIA 4BTVA 1DFIA 3B5JA 3U09A 4U2CA 3D2AA 1O8BA 1UWVA 1ESNA 1I7NA 4OJTA 2VVTA 4E3WA 1XDDA 1Z73A 2VAXA 1ULSA 5LMZA 1BRMA 2JLCA 1UKYA 4R3NA 1VKHA 1KQ3A 3WFIA 4DSZA 1D09A 3H5LA 2PKQO 3FLAA 3H4IA 3HQ4O 3WLNA 4KDFA 5AIBA 2KLHA 3K0FA 1Z26A 1B74A 3AEKA 3SZRA 2RHWA 3BWYA 1Z16A 3R6DA 2JATA 1R88A 4YRJA 1QGYA 5JPIA 5ELMA 1LEHA 2O07A 3RFXA 4E4RA 3MWFA 3HJFA 3H13A 2BDTA 1P0MA 2EKPA 1N75A 1JBQA 4HJXA 2FZEA 2X5JO 4N0EA 3CLTD 1W0KA 5IEBA 3WBBA 1D5WA 1V95A 1UZLA 1H93A 4G25A 5TQVA 3UAXA 2D5BA 4QBFA 2PUVA 2RAUA 3A0UA 4AROA 4OHOA 2VF5X 1PX0A 1RYYA 1U0GA 3PS9A 4UC0A 1AH2A 1UPUA 4J0FA 1WUKS 5E4JA 4Y2JA 2DHRA 1GXSA 2ERXA 2AUTA 2J4FA 2P69A 3DXFA 5K51A 3PDIA 3UC5A 4BX8A 5JWRA 3E58A 1GARA 3GU3A 3ZWWA 3NRBA 5HJ5A 3KL4A 4OREX 4U1RA 5FUXA 3CEPB 3UH1A 3GC6A 4QECA 4ZEMA 5HCUA 2IF2A 3KUUA 5FBHA 4P92A 5KVQA 4EF6A 4FGJA 3EIQA 1E3WA 1JDJA 5E7QA 2Z2ZA 3HNOA 3DM5A 1A9TA 3K9NA 3STHA 1KJ9A 1HE5A 1FL9A 3UJHA 4L6AA 1Y1PA 4K8RB 2WA1A 4S1NA 4YK7A 2W6MA 3AHHA 1AT1A 5HSGA 1WMSA 5CT4A 1RM5A 4OXNA 4Q18A 4AU1A 4DLAA 2X0IA 3RVSA 3TOZA 3LXUX 4BIIA 2B82A 3NBZC 2JFYA 4JFRA 5K2OA 1CRLA 2RAFA 1UJMA 2CUTA 1LPAB 2WHPA 4EKIA 3I8XA 1W8DA 1N9GB 4QDJA 1VIDA 4M3NA 2J33A 3SJAA 4F4CA 2L18A 4B2PA 2J9FA 3MT8A 1PE0A 4KPGA 4KXYA 2HCRA 5CH8A 2O6LA 5FWYA 1HK7A 2CXPA 1DAGA 1MENA 1VL6A 1XALA 2YV2A 3DVAB 1E59A 2C94A 4C7VA 5K8LA 1CEEA 3L7MA 1F20A 1GGHA 2XHEA 2ZBGA 4GPEA 4LZOA 3RS9A 1K2VN 4QASA 1JEQA 2A5GA 1S8NA 2G5CA 3SSMA 3NHZA 3LQ4A 5CH5A 2JAXA 5KSYA 2PZKA 1F48A 1NBMD 4ZP1A 3ZD6A 4C3OB 3W7BA 2QEQA 3TV2A 4HUTA 1GTVA 2WYOA 4JI1B 4P3OA 4D9KA 1G6OA 1EFTA 2W98A 3A3PA 5ELXA 3AVYA 3ORFA 1JF8A 5HKOA 3VR5A 3HKCB 1IPFA 4ZGWA 5BVHA 1C8KA 2H54A 3W2IA 4F6CA 4A36A 3OA2A 3G2IA 2XRYA 5K1ZA 3P0HA 2YNMC 4Y2QA 2V58A 5TVKA 3F4LA 2FPLA 4Q3CA 1Y6FA 4QQKA 1X94A 3L49A 2PTRA 1V39A 5A3RA 4WTOA 3VPHA 4BQPA 1K0UA 4WX2B 5NULA 5ILOA 1IG0A 1KVQA 2QMUA 1NL3A 1Y37A 4KPUA 4DMFA 1W1WA 2P6NA 2ZUVA 1QK5A 2QA5A 4F4DA 2Y71A 3VSDA 1H1LA 1NTRA 1RJEA 1YQUA 3A26A 3G2JA 1IHUA 2AR9A 2QTFA 2EJCA 3IPAA 1ZZGA 4ZREA 1WQ3A 3ZNOA 3QE9Y 2XJ9A 1LWNA 4JUIA 2RH9B 4KFTA 7MDHA 1L5SA 1TF2A 2I4MA 2YOGA 3DOOA 3KV3O 1SD5A 1QM5A 3EY4A 2VUIB 4QYWA 2VDPB 3LFTA 3RK1A 3OIGA 4ER7A 2WNSA 3HO1A 4Z99A 4HXYA 2AK3A 4IP0A 3G0HA 2VTVA 3I2JA 3E04A 2GZ2A 1PNQA 3M5PA 3NBFA 5KJEA 1V5FA 1Q19A 3RADC 2BKXA 1BHSA 1E9CA 1S01A 1JJFA 3S2YA 5EKSA 2XQVA 1L4HA 3RTGA 4I55A 4E31A 3AXSA 1KAHA 2Q1UA 3UANA 1S2OA 5EUBA 1RRGA 2PFKA 3W5VA 4TQ9A 3QV1A 1NMZA 4I5GA 4L76A 3EY9A 3COZA 1M34A 3T5TA 4X97A 3U49A 4BWVA 2L2QA 5HRCA 3W5AA 1NJ5A 1NM5A 4B5LA 1L5ZA 4I9HA 4MUEA 4QTTB 1HYBA 1LS1A 3HNRA 4BB0A 2GZ1A 3QFTA 3TR6A 1S0UA 7AT1A 2H57A 5CLFA 3K3PA 4R01A 4QUDA 2X9NA 3QNWA 1GG2A 1Z25A 4A91A 4COKA 2XQKA 3I39X 4YDQA 2GRUA 1IHXA 3KSDO 3GGGA 4QIHA 1IXZA 4NENB 4RCZA 1T2EA 1DKOA 2IS4A 1RHRA 2B8EA 2O5VA 2Q4BA 3JSXA 3MRXA 3UG7A 4M9UA 1PFKA 4MMYB 1C81A 2KPOA 2XDWA 4UPVA 1QQ6A 1VIYA 2HU2A 2G6BA 2PEYA 4Q6BA 1ILEA 2QVYX 5KOJB 4B7UA 2JHAA 4OH1A 3X1XA 3PC2A 3LAWA 3AU8A 3O4HA 3ROXA 3VR3A 1XZQA 4MS3B 3D6UA 3RRPA 4BV9A 1MDFA 3BB3A 3QWBA 2PS3A 1LD3A 4Y9UA 5IT5A 1XJ5A 3EUAA 4ONEA 1OKKD 1Z4KA 3Q12A 4RU1A 4O4HA 1FTYA 3HLTA 3IP5A 3EUEA 4HGQA 3IJEB 3FGPA 1XOIA 4X6YA 3FPLA 3H5IA 4R9NA 4EHJA 1QNLA 2Q49A 3QJ5A 5TF4A 4CF5A 5EZYA 4G0QA 4URHA 1PF7E 1HDZA 2YIJA 3QSGA 5ILQA 3IX7A 4BNFA 3I76A 4A27A 3U60B 1PGPA 1V4VA 5HS6A 1ZI9A 5A5DA 3CCFA 1L5GB 1T3SA 2IIQA 5L3QB 4K6CA 5LJLA 3ZVNA 3QE0A 2COUA 3GCWA 3WMWA 2C5EA 3OIYA 2IEYA 3NO9A 4WSOA 3HJGA 3UJ3X 1U9YA 3A1EA 1NV9A 5EKDA 4I4IA 1YR2A 2XUGA 3KB6A 5KYKA 2HJWA 2WC1A 3W7VA 3FWNA 3F5QA 4B3CA 4RKRA 3U19A 1SZCA 1WKVA 1Z6ZA 3BAZA 3BSSA 4IHKA 4UNNA 3ORSA 4PE5B 4OHXA 2WY2D 1FJHA 5BSMA 4YUYA 5LOVB 4Z4IA 4UQPA 3O0DA 1EIWA 5AICA 1T8YA 2HWUA 4EI9A 1CR2A 2WTEA 2CN1A 5C8YB 1HLPA 4BVFA 4C0KA 1K08A 2I78A 4WBNA 1R7RA 4FFVA 4FHDA 1P33A 2IW1A 4MUAA 3QVLA 4ZGGA 3K8QA 1MFZA 3T7CA 2JLUA 2VJBA 3NRCA 5KPDA 3THWA 2DVMA 1UK7A 3FCOA 3QOWA 4GSYA 3CEMA 4ND8B 5I7AA 3VQTA 4UVEA 4Z0NA 4W8HA 3LPDA 4FEAA 4F11A 2IV2X 1LLFA 1JECA 3EPLA 4D0RA 1X80A 1FU8A 1ZOOA 3BF8A 2OGWA 3GJ5A 4TTVA 2FP4A 4HNSA 1Q0PA 3PLRA 2F90A 1TC1A 4LJ6A 2NTVA 1Y4ZA 4L4ZA 1DFGA 3B6IA 1Z5PA 3BMQA 4ZKEA 1JQKA 4J7AA 5ALZA 2ZE5A 4MUXA 5TGDA 5C9ZA 2WPDD 1KJJA 4PGHA 3OTWA 4ZRMA 1YKGA 4QPJC 2EJUA 3BCHA 1J2EA 3ENNA 3ETJA 4PPQA 4XOUA 1XCMA 2EFHB 3AV3A 1QPGA 2IK8A 4LWPA 2EZ4A 6REQA 4L4YA 4X65B 1ORIA 5FFMA 2RH5A 4KQXA 2WWHA 3S2UA 2VDWA 1LSUA 2VNKA 1X2BA 4YMSA 3WRXC 2IBSA 1N2GA 5LB4A 2TMGA 4KQGA 3ZTYA 1ZC4A 1RYFA 2UXBB 1V43A 1IPEA 2IDJA 3SE7A 3QEAZ 2V7TA 1ZSYA 2E5WA 2ZVPX 3ORQA 2YWGA 4FC6A 3OPQA 2P9YA 4OMUA 1R6DA 3UB3A 3F5DA 3FFXA 4HI0E 1V7PC 3BCUA 1ULAA 4V0LA 1VE1A 4X54A 5BSRA 5I45A 4B3SB 2CHVA 4TQAA 4FT4A 2ZCUA 3KT3A 4O33A 4ZCLA 4GAEA 3ZX4A 1NLZA 1F0YA 1RQ7A 2WMYA 1UMBA 1R4ZA 3C97A 1I0LA 1THGA 2VTDA 4KH0A 5SZIA 1A9XB 3VC7A 2ASVA 3OE7D 1UFVA 4ZYWA 4S04A 3R0XA 4D3FA 1MJNA 3OEED 2PUGA 1PD1A 1V1RB 5DNCA 2H3EA 3OQNA 4I4LA 1OXMA 2R4UA 1GL7A 1E1RD 1KY3A 2AFIE 4DB2A 4URYR 4G5SA 4ZYUA 3NWPA 3MCWA 2ZJ3A 1E9VA 3IJRA 4TRNA 1H4QA 1QBKC 7REQA 1BX1A 4CHTA 4RTMA 3CUWA 4IF6A 3FWKA 5JT1A 1T6YA 2P4HX 1CKEA 1SU6A 3EDCA 3C14C 4CU2A 4HNUA 4XAQA 4BB6A 2XTNA 2FUNB 4N8DA 4FE3A 1OQAA 4XTRA 1TUGA 2X8WA 4OJYA 1QF7A 4B40A 4YHHB 3D8TA 2C3UA 2WMDA 5K01A 1K7SN 3QE4A 4BV8A 2BGWA 1W1UA 2QB5A 3VV3A 1Y7HA 3GG9A 1SWVA 3ZPXA 4CKWA 5KBYA 1XNHA 3M4NA 3ELWA 3R3XA 4XX0B 1FNMA 1H6AA 2O9JA 2GBFA 3PNYA 1ZK4A 4M36A 3R7WB 3ICCA 5BPHA 5U9CA 1YJBA 3OC0A 1WXFA 3TQHA 5I5EA 4OU4A 5KWSA 3PX2A 3QPDA 1E2MA 4I4TA 4LYEA 4ZD6A 2VYVD 5C4IA 3MT7A 2ECPA 4CU5A 3DCIA 4MXDA 2C5FA 1TJYA 1E5LA 3OESA 4MWTA 1NR5A 1CZNA 1RWWA 3GLVA 3S1AA 2GAIA 3VFDA 1DV1A 1FU4A 1XXHB 2LR0A 3PU6A 4TTIA 3K72B 1LDMA 4XVHA 4F38A 3MSCA 2WAOA 2GS9A 4PN7A 1BMFA 1V37A 2O1XA 1Q0HA 1YH3A 4C4ZA 2C20A 1KI4A 1VYHA 4I46A 4M54A 4UJ5A 2G0AA 2YUIA 4A6PA 4M1KA 2OHIA 1RI5A 5FBWB 3R7FA 4V0OA 3MOSA 2WJYA 3LGXA 1OUMA 2JANA 2HI0A 2YHIA 1V16A 6AT1A 3FHCB 4QA9A 5MHTA 2VAMA 2JGKA 2K5UA 1TCAA 2JDIA 3KWJA 1MB2A 2DBYA 2UUOA 1Y7PA 4DIDA 5DX8A 2PGXA 3K30A 2XVMA 5C5CA 1GHTA 2GK3A 4O2AF 3EAGA 3B8EA 1FSPA 4C03A 4XGNA 2KSQA 2CJFA 4FFPA 1C3VA 2C9OA 2E1PA 2CBGA 2FN3A 5E6UA 1IB6A 4KL8S 3VR6D 1GTG1 1BWPA 3VVLA 4ZZ3A 5JPCA 1ATIA 1HNNA 5G2OA 4F2HA 1L7OA 5ALWA 2OWDA 5BRJA 4I99A 2YY7A 1CNMA 3GN2A 4OQMA 4WXMA 4ZK2A 5E9WA 4Y67A 5KNDD 1M1UA 3H8SA 3KLOA 2L19A 1VLZA 1JG4A 1JLKA 1SBIA 1ZISA 1Z6YA 2CFOA 2WTBA 2XNDA 3D54D 4Z8YA 1A9SA 4CMKA 5JH7F 3MAJA 3S2ZA 1K7WA 3KNZA 2W37A 3V4LA 1DBPA 3H8WA 4K26A 4L0MA 4O4IF 1JHPA 3E3OA 1V1MB 4HDMA 5EA2A 3ZZUA 5EIWA 1Z0IA 1EFCA 4EI2A 4NYMQ 3D7SA 1XTKA 4KQMA 3NO4A 4JUDX 3W8DA 4EITA 4FBLA 2CL5A 3C43A 4JVOA 2Z8ZA 3N75A 5TS2A 4MVCA 5KEIA 2XBMA 1UADA 1JR3D 2C96A 2WJVA 1OBFO 4P1ZA 4PTLA 4F84A 5B7GA 3TGPA 1IBCA 3I5XA 3U17A 2YKGA 4G0ZA 1APBA 4AXBA 1ABBA 2QGNA 2H5LA 3WKEA 3ZHOA 2ST1A 3C48A 4ZEOA 2Z83A 2EXXA 3QVGB 4C6TB 3QXJA 5AQ1A 1Z2OX 2XADA 4RF3A 4ED9A 2N47A 2XYPA 2H6EA 5AHKA 1N25A 3ZX5A 1YQEA 3D8NA 3KZMA 3BK1A 1BDIA 1PYGA 1FFAA 3HYRA 1IOVA 1IVYA 3D5QA 2IYTA 3GFGA 4M1QA 4BLPA 2PT7A 1XTUA 3QNMA 3R6GA 8ABPA 2CCKA 4OKIA 5KU1A 5ALMA 1T43A 5BV0A 5JTUA 4F1JA 1J22A 2IYXA 1MGOA 3CW2A 5EE5B 2H7XA 4DSOA 3HY4A 1CD5A 4HX2A 2GZMA 2RHMA 1NWHA 5BQ3A 1SXJA 5BSEA 4WH0A 3ZJYA 5JVDF 2FX5A 1AUVA 3GA5A 1L5NA 1AKUA 1ZD1A 3ER8A 3LJKA 2C78A 2FZLA 3E15A 1CV2A 4E6PA 5CFZA 4OIMA 1TAUA 3W9BA 4J0GA 1QG0A 3WLIA 2IXEA 5KSPA 1F4LA 4XQ9A 3RW9A 1UJ5A 2E4ZA 2PSHA 3K4HA 4CKBB 3STXA 4RY0A 4YJHB 3HKDB 5CJJA 5LNK6 2M6RA 4F45A 1TK2A 3ZS9A 5A4JA 4P4UA 1X7WA 2ZWIA 2A1UA 3CEAA 1C3EA 2PRKA 1N2CA 3GXBA 4IPTA 3WE7A 5H3LA 4LYDA 2FFAA 1RQXA 1ODIA 2HF7A 2GLXA 4N9WA 1KEVA 1SPXA 3WHPA 3GEPA 4ZMBA 3U7GA 3IQEA 2J7PA 2P67A 1RBZA 2B1GA 2J41A 1P61B 4HEA1 4IJ6A 4O2RA 4PSUA 4GO1A 4QUAA 3V2IA 1KOLA 3V4FA 9ATCA 1SN7A 4K40A 1TJ5A 5CLJA 2CYBA 2WVAA 2MHCA 4BMZA 3KVVA 1U8ZA 2PKYX 1VHLA 5IAOA 4AJOA 2NU7B 4CFZA 5IBPA 1IMOA 2NYVA 1J9ZA 1X70A 3R0IA 1IIBA 4IHJB 4NYIQ 3AEUB 3JS5A 1NUHA 1NW5A 4NU5A 1P44A 1JMVA 4I50F 4DXDA 1WUHS 4CV3A 5HOQA 3HZOA 4AQ7A 2Z2KA 2EKLA 4ARZA 4PR3A 3U7EB 4G97A 5E7JA 4YRIA 1P45A 3N53A 5I9SA 1WU8A 1HDEA 2HMWA 1A7KA 1WMBA 3QLJA 2HY7A 3GJ7A 5T67A 2VP0A 5JYCA 2XGJA 4R84A 3HKEB 2I1VB 4JD5A 4C0BA 5ESRA 1N32B 2NXJA 4JLUA 1J0DA 2PX5A 4ZZ0A 3ITKA 5ICGA 2V45A 2EBFX 2WIFA 3KYCB 1KE1A 1ISGA 4MR7B 1K89A 3FLMA 5JSFA 3QIVA 3L7OA 3V8NA 4EUFA 2OCLA 2V9CA 1QTRA 2R1VA 4JB8A 4WA8A 1M6NA 4WMLA 3EVEA 2WM3A 3PQFA 2HO5A 4M1MA 3R3ZA 3C8UA 4ND2A 3P9ZA 2HIHA 2NPIA 3KXIA 1WDKA 3SEFA 3JQGB 2ERYA 4JOCA 4HAUA 3WMXA 5EWMB 4PCUA 1AHIA 3L43A 1EYZA 2D4AA 2R48A 4LJ5A 3WIUA 4QOEA 2OORC 3BMXA 4TWIA 4FB5A 1ID8A 3DE3X 4WPGA 2JGRA 1W5BA 3AUFA 2GTPA 2KHZA 3RUAA 5FOVA 3HB7A 3WGQA 3ZBUA 1N8KA 3LCJA 4B1FA 3KSAC 1J0EA 3WK4A 4DF3A 5M34A 3JV7A 4C3ZA 4GLBA 5JBQA 4KC0A 4RD4A 1VRVA 3VM6A 3ZGOA 2JLRA 4DAEA 4C05A 2ZQYA 3ZU4A 1UOEA 3U4HA 4PZZA 1NSYA 2Z2IA 1WLSA 1YNSA 3KG2A 3UA4A 1JMKC 4CLDA 2O2XA 2PRYA 2VYND 2XOEA 4J9VA 1PFWA 3FBWA 3VTFA 1V2HE 1MJGA 2XR1A 1DBSA 1DC8A 1CUVA 1T15A 1EU1A 1NXQA 1NY6A 1O3YA 4RTPA 1FTQA 3HRKA 2IEAA 1FK8A 1IIRA 2XKAA 2C3YA 2IDMA 3FSJX 5GTDA 2LE0A 2IWHA 16PKA 1Z3CA 1O6CA 2A30A 2QX4A 3NW9A 4OXIA 4X7RA 3ZHCA 3TD6A 5AM0A 5KTSA 1NXXA 2VHJA 4ZV4A 1SB8A 2EF0A 5HKBA 2GWRA 1DEHA 2QMZA 3C3AA 2QTCA 1EFHA 1KAGA 3LPCA 2L42A 3UQZA 4AMGA 3D59A 5EE1A 1UDWA 1BRTA 3NHYA 1YGYA 2FSSA 4FSXA 1X86B 1SBHA 3D8BA 4OGFA 2X7XA 2UYCA 4IV0A 3CRW1 3LKZA 2A4KA 3IO5A 4PF1A 3EGCA 4N6GA 3NM5A 2X2FA 1DKMA 4Y1GA 2ZIZA 5AJVB 1A82A 3X3HA 4QT4A 1PKEA 2G1UA 2VWHA 3EDYA 5HTKA 5U4XA 1IN4A 2I67A 4E3ZA 2C2YA 1XTPA 2CVPA 2NSYA 2Q3MA 2WWRA 5CVDA 5DYNA 1A3CA 2HNAA 3MXOA 4JQCA 4OXYA 4PU0A 4A4DA 3H5NA 1WDTA 4CM4B 2TS1A 4MVJM 1JEAA 5E1OA 5JAOA 3ML1A 2RI1A 4YAFA 1VA4A 3Q87B 3OEYA 3PRKE 3B9QA 1W36C 5FP0A 3RDPA 4J94A 3BMNA 2ODBA 3A9CA 1MO6A 1ODSA 1QIJA 3FNRA 3L8EA 1QHSA 3OX3A 2YNMA 2ZSFA 2YV1A 3AGPA 3R9IA 1G2OA 2N42A 3GPDG 4V0MA 2X0EA 4S0XA 3R7LA 4D6XA 1AY0A 2X2EA 4FGLA 5MDHA 1YZLA 3KSZO 4IF4A 3AZQA 4EARA 3GRCA 1XRPA 3V1MA 2X1LA 3MTIA 1D6NA 3HDVA 5JWHA 1R0RE 1TKAA 2YWFA 5F92A 3FLBA 2X58A 3EIWA 1Z08A 3G2QA 2UAGA 3GEDA 1ZR2A 1Q1BA 4MUJA 4B71A 2ZYRA 2VAWA 4MLPA 3JARB 1RZVA 4IILA 5FL7A 4YRLA 4HKTA 4HMOA 1KNXA 4K6KA 3OPYI 1U4SA 4PIPA 3GLFB 1Y42X 3DE1X 4Q4AA 4CL8A 2QE6A 1W9MA 2G6TA 3DCYA 5LCXA 4MQFA 4BO5A 1SQ0A 1ZHHA 3NUGA 4FOSA 5DXAA 3UYLA 2H2AA 2RHCA 2Q9UA 4KQWA 3A6LA 1YAHA 1YDGA 2QG6A 2WK1A 4FLMA 2VDJA 1I36A 2DH5A 3ANTA 4J0QA 5IBRA 3TW6A 4I2NA 5LJIA 3Q2KA 4MDHA 3AVVA 2HLDA 3O8OB 2RIPA 3GW8A 4DTIA 1XAIA 1AA6A 2DX7A 3LLMA 1WZUA 2NXCA 3MT9A 4RSMA 1Z5UA 2B0CA 3H87A 1C3JA 2IX9A 3EXHB 3KSUA 4OGLA 4GP9A 4DANA 4RIHA 3EPKA 4QOGA 2B1RA 5C0OE 3Q9UA 3CNLA 3FGZA 2HSWA 4ZHQB 1BE6A 4P8RA 1DZIA 4R51A 2CNLA 5HMLA 1AGYA 2DQSA 3TLAA 3E0QA 2QT0A 2PH7A 3B78A 4KXWA 5CT9A 5AXDA 4EFNA 3TO5A 1MO5A 1S7GA 2J3KA 2OPBA 3AW8A 3BH6A 2WLSA 1QH1B 4WN3A 2A8YA 2BFWA 3L93A 3NWEA 4IUYA 5GMOA 1Y80A 1GZUA 2PSSA 1KJZA 2VWGA 5IJAA 2O8VA 4BZQA 2AC7A 2E48A 4TWJA 3HHEA 5HDBB 3GY0A 2X86A 1NFRA 3AETB 4EI8A 4HVCA 1QYXA 3R09A 1ZMOA 1LDEA 2AWNA 3NVMB 2BMAA 4TTRA 3U39A 5J1SB 1KVTA 1T2VA 2D06A 3A3KA 4K81B 1S3SA 1L0BA 4I4NA 4JY7A 4QXMA 3ZLTA 3ZCRA 1NYLA 3EVFA 3QVJA 4TKUA 4WLNA 5FBKA 2RMKA 5LC1A 4BLWA 5HNKA 1UM8A 3OY7A 2C5BA 3AK4A 4DIMA 2DEUA 9LDBA 4GZ5A 4GKAA 3KX2A 1MC4A 3CN7A 2R5NA 5JR3A 4Y9SA 5K3BA 3QEBZ 1G4AE 1U65A 4EHKA 1FQOA 5DM2A 1WEKA 1XTSA 1PUXA 1P7YA 1L8OA 5EEGA 5IYZB 2GSWA 3J7AC 3QH4A 4OBBA 4KKXB 2A35A 3O4RA 4RFSB 3HXKA 1B6GA 1L8QA 2B61A 2QTTA 2W6JA 2BDUA 2GD2A 2HA6A 2AMFA 4MLDA 4M89A 5EIBD 4HYQA 1MA0A 5EMKA 3GJYA 5JQWA 5KAMA 1YGPA 3DAOA 4HAOA 2CGEA 4KODA 5FV4A 3RPEA 5L3VA 5CA0A 1J49A 1DX6A 1X1BA 2LGJA 3K9LA 3PQ6A 5BWCA 1W49A 2AC4A 5MN4A 1LDYA 3EBLA 1HE4A 2NUBA 2Z2XA 5HILA 4EW3A 1ANKA 3M49A 4BGUA 1WP4A 2AFHE 2MMCA 5BW6B 4MGIR 3KC2A 1CY6A 1X7YB 2MDTA 3A9SA 4P4NA 2OYRA 5C1PA 5JZSA 4TLLB 2A67A 3U26A 5BSWA 4FFMA 4BNKA 1CJUC 1N3LA 3IE2A 3D0QA 2ORWA 5KYUA 3PVCA 4KUEA 1TT5B 3GROA 5JSYA 2X8JB 3I8OA 4HAIA 4MI9A 3GEMA 4P5DA 4N7RA 4MVWA 4EX7A 2E5FA 4Q1DA 4RVFA 4YJ3F 2GFIA 3OCVA 1LQTA 2QUIA 3A04A 3WAGA 2Q1XA 1E8NA 2GEFA 3L4BC 3EC1A 4NV3A 4TLCA 2GILA 2NO4A 4Q1CA 4C20A 1YDFA 5EHNA 1J70A 5DSTA 3P4YA 1G4HA 5GZ6A 2CKDA 3NIFB 4NR0A 2Q41A 1DHRA 1V5WA 2W00A 3D6VA 4PBSA 1G64A 1EX9A 3KYJB 3GBPA 3P45A 1NNUA 1DV2A 2J8ZA 4EEZA 2IT1A 5I7VA 3WLJA 4FS8A 1DEOA 3W2HA 2PR7A 1Z4OA 4JT9A 1MT0A 5HWSA 4DDUA 1JBKA 2XE8A 4NHOA 2ATIA 2Q29A 2QUJA 1NOIA 4IMIB 5EWLA 3ZYCA 1M33A 1TGVA 3U7QA 1U5BA 5DW3A 3N3BC 5BRNA 1XLWA 2R5FA 3MGCA 2IELA 4BQRA 1PD0A 2AI3A 2PWZA 2B2NA 3CVYA 2Y8EA 5L6MB 1XYGA 1Y4AE 2R6ZA 3Q7SA 1G66A 1PCXA 1Q2XA 4RLSA 4AZWA 2CHFA 4GH5A 4DMMA 1VI6A 1YK0A 1T1RA 4NKRA 4ZT4A 1R6VA 4E7PA 3KAPA 2X22A 5C51B 3GLGB 2DFVA 4CQNA 4Q9JA 5HE8A 3WGIA 3AVXA 1QTNA 3BB1A 3DYVA 4AO8A 5C1DA 2WWVD 4L3OA 4G81A 3R4VA 4BP9A 3LCRA 3IUBA 2D2EA 1KI6B 3FUXA 4GNRA 3MUOA 3RT7A 3E9MA 4DLWA 4EEIA 4RA9A 3WDSA 3OY2A 2PVPA 3DL7A 1W44A 5AKKA 3UPUA 4J7XA 2BFMA 1Z6TA 2IHUA 1P2FA 3IOEA 3WRXA 3ANYB 2MR6A 3PFKA 5LP6F 4NU6A 1K8XB 3ZJTA 4FDTA 3RJ5A 3M0EA 2QROA 4JYMA 1NG9A 2GZRA 3IAFA 4WI1A 4GR5A 2VJPA 1JQ3A 1YZKA 4PGMA 1WCXA 2WKRA 2XUHA 3GAFA 3PPWA 3AKEA 2AOXA 4X7PA 2CJYA 2NUPB 4CYMA 1K3UB 1EVYA 4G85A 1K4MA 1XCPA 3N39C 4KAAA 3GFQA 1FYDA 2ZYWX 1F1JA 2VNJA 4MUNA 3IERA 2ZYTX 5K3AA 5ECYA 4YRMA 4YXWA 1PGOA 3S0JA 5K0EA 2HU5A 1EI9A 1NT2A 5F23A 3BXHA 3NATA 4UTRA 3G23A 3EZ2A 2RKWA 3VZDA 2QVGA 5L45A 3L6UA 4TVBA 3ZI7A 4UXHA 1SC4A 3FYUB 4P3PA 5H5JA 1XF1A 1H0RA 5AM2A 4TWAA 2Y9MB 1V7ZA 5A05A 3Q6IA 4MRVA 3KAQA 1Q1NA 3LLVA 3QPCA 5DP2A 2XMCA 4L57A 3OCUA 1HNXB 3E9DA 5HKKD 1Y5LA 2OMEA 1NVBA 5EEHA 3A6KA 2D59A 4J4HA 4F60A 2ZIGA 1PGJA 3GARA 3TNJA 5JYDA 2JAOA 1CUCA 1FXWF 5CP8A 1Q7EA 4PW0A 1L5HA 3LX8A 4UNSA 3A1VA 1DG9A 1TQHA 1VJDA 3OCXA 3DWIA 2MR5A 1NFQA 3K92A 4JYCA 4KYIB 2X0JA 4ZYVA 2ZIVB 2EQBA 2EW1A 4G5XA 5CVEA 5CM9C 1O96A 3HYCA 1BH2A 4JSTA 4GOMD 4JUFA 4TUYA 3EK2A 4P81A 1LXCA 4M0FA 2C3MA 4MJ3A 1NIJA 4EO9A 4MDFA 5JXIA 1JA0A 2BFFB 3EF0A 1VE7A 3H4VA 3R5TA 4TXMA 4C29A 4YMLA 1AG9A 2HTEA 1CDZA 3IJPA 3OMXA 4FFRA 2ZYSA 2D5CA 5EZ6B 3WIEA 2VTBB 4KFSA 4EPVA 2RC6A 4R5HA 4DSAA 3EYWA 1FY2A 3AHGA 3JRNA 1U6IA 1W93A 2B20A 1NLUA 2POCA 2NX2A 1QGUA 2LBPA 4KQKA 3HXLA 3B53X 3IRUA 3VR1A 1PJAA 4MW2A 5JV5A 3OJWA 4BKQA 2O1SA 3TTWA 4E5SA 2WFLA 4TZ0A 2QOEA 1Q3HA 3X1WA 3VH3A 2HPAA 4JWTA 3OKAA 4HDRA 1XEAA 1FW6A 1YS9A 3T3OA 3FCXA 2ZR7A 3KOMA 4RK6A 3WP1B 1XLTC 3RKSA 4A23A 3HJHA 4ARVA 4BQNA 5TY0A 4A8JC 2I6GA 1ZBDA 2JD0A 3GUYA 3HPQA 4BRUA 4EHFA 4EG7A 5CFQA 2BR3A 1ZVMA 3L77A 3O73A 4FWTA 3H2GA 1UPAA 5ERYA 1CNEA 3IC5A 4HWGA 4OFXA 4DRXA 3FBTA 3OI7A 4F96A 3H1AA 3I3OA 4OOFA 1QC5B 1L7RA 5C80A 1WW2A 4PFQA 3PJRA 2XEXA 4NI5A 1FLDA 2QRKA 3PNMA 3RS2A 3R6TA 1YZGA 2FMHA 4JNKA 3H99A 1PR1A 2QIPA 2R6R1 4GI1A 4AJIA 3IAS6 3E2IA 4MGZR 5FTJA 4H2DA 4L0QA 4OUKX 3LH5A 5F3RA 4ZI3A 3G0CA 2RHRA 4BX3A 3FUVA 1TU0A 3PXGA 1M2HA 3VC2A 4B4VA 2V7UA 3FOZA 4Y6LA 4XTCS 2ZE6A 4ILKA 4HLDA 3G5MA 1EX1A 4BFVA 2MIIA 5TGTA 3DL0A 4LDJA 2E4UA 1Y7IA 3NHUA 2A9KA 3I9V6 4H08A 4EK9A 1EM8B 2R62A 2QX9A 4C5BA 4TZ6A 5CNMA 4JXJA 1YMQA 4JX8A 3GP8A 2AEMA 421PA 3N86A 1PFYA 3UMJA 1DRJA 2LIVA 2P7IA 2YS7A 4CLRA 4WJZA 1VDMA 2X3FA 5FD8A 4WWHA 1SA0A 4RTJA 3OLCX 4RHFA 4LUCA 2BHNA 4H27A 1WV1A 4YN3A 2CWWA 1M67A 4MSUA 3HJAA 5AHXA 3IAHA 4DLLA 4S0ZA 1WWKA 4JJIA 4DLNA 1GFZA 2Y0PA 2YXPX 3IIJA 4Q4HA 4BVHA 3OLWA 2FUCA 1Q0SA 3CC8A 3BHJA 3NIDB 4HNQA 4K0RA 2PYZA 2X0NA 3OE5A 3VR5D 2FHSA 1WNTA 1CFZA 4GGPA 5H16A 1BU8A 1L4KA 2Z3VA 2QSUA 3JQEA 4NATA 1IMJA 3TAHA 4Q37A 1XK7A 3W1EA 1IHOA 1OFIA 1IDOA 1ZMBA 2RGUA 4IDHA 1HY0A 1HLGA 3OPYB 4OAPA 4UBJA 1RMTA 4YMWA 2PAFA 5CBKA 3S81A 5K8VA 2X6QA 4KB5A 3SQNA 2EW8A 1AHNA 5K0SA 1W4AA 2IHVA 2KB0A 4E2WA 1IUOA 2CLDX 3ISJA 4LQ4A 1YASA 1I0IA 3HZHA 2FEKA 1ESZA 2ZT6A 2RSLA 3CW8X 5JJKA 4YQEA 4MHTA 5L95A 1M1NB 1U0TA 4CQMB 2DSTA 2C7OA 2ESRA 4ZCMA 4KQ9A 5IXSA 2BFCA 3VUFA 2QG4A 1C9MA 5FTMA 3PTAA 3CUSA 1YBFA 5AK3A 4UFPA 1WVMA 4I1PA 4MR9B 4QFCA 3ZQKA 3KQPA 3X2FA 2Q1SA 2NSHA 3F4KA 3GHYA 4R3WA 1CY2A 2EP5A 5EJ4A 2DFTA 1U81A 1N1EA 5LQMA 1CY0A 2MCFA 2DG2A 2P90A 2REBA 4IDBA 1B0ZA 3L7JA 4P31A 5HW0A 4G23A 2VRCA 4M6WA 1HE3A 3I9NA 2GN0A 2FQ1A 2AG8A 3R9XA 1SBZA 4UM9B 5EQFA 3ENZA 3ZXSA 3P97A 4MS1B 4C0HA 1KDZA 4ZT6A 1OI7A 2QWXA 5ALRA 5H02A 2CLMB 1VDKA 3G1UA 1W59A 3SKYA 3N2GB 2PMWB 4N7BA 3DEZA 1TPYA 2WINI 4OJKA 4AJNA 4NICA 1N0IA 4K9MA 3PC7A 3E8SA 1OGYA 3ZCXA 4AG3A 1J2TA 3DDNA 1UAGA 2XKKA 4JI7B 3ZBTA 5ENVA 3L7KA 4U7TB 1RP7A 1IOWA 1Q0RA 1XQ6A 4JBIA 2HRBA 3CO5A 1VGRA 1R1DA 4R1SA 3AJ8A 3JR7A 1T9GS 5BNZA 1W0JA 3U3RA 5JU6A 4GI2A 4RVDA 2QYHA 4N9QA 1FUIA 1KFBB 4PINA 4P7FA 3R7NA 4AW9A 2DM6A 2GM3A 2HD4A 2DXIA 3R6QA 2FGKA 3FRIA 4EJ2A 3EXIB 1NKTA 2WE7A 2VI5A 2ILVA 2DGDA 1N7JA 4G5YA 1RXVA 1NI5A 1T1IA 4V0RA 3BSFA 2X3YA 3MBKA 1MO3A 2NWQA 2OORA 2W2QA 4PR0A 5TMEA 2J3IA 1QTIA 1I7DA 3C1UA 1RPNA 3QVKA 4QPPA 2F64A 1XTZA 4FTWA 1UF9A 4BO1A 3ZJUA 1JSLA 1CIPA 4ZKDA 3O2QB 2IU3A 5E4TA 2JAQA 1W6UA 1PT8A 2J5BA 3IFSA 4F3YA 1WVGA 4QJIA 1Z62A 2QG9A 1FFXA 5TQ2A 3U40A 2XTZA 3PR1A 3GLRA 5I4BA 4NBLA 1R3DA 4HWRA 1RC0A 1X7ZA 4CKZA 1R0KA 1T2AA 3P0JA 1GPYA 3LIPA 1F6WA 3LQ1A 4POAA 3OQ1A 3KJIA 1OBCA 1OROA 3A32A 4EG4A 2SCUA 2J30A 4XVQA 4EABA 1SIOA 4RIEA 4OH7A 1Q22A 2GFQA 2CNOA 1E0AA 2TRSB 2DHEA 3TIFA 1JAXA 5DRTA 5DLDA 4QULA 3JQAB 1G20B 3UAWA 4FZ3A 2WJGA 1LQUA 2XA9A 1GDHA 3W5DA 4YH1A 3W9YA 1U3GA 4H16A 2YV3A 1WXQA 1D2MA 4TL6A 3BHGA 1IY9A 2PUTA 2XGMA 4APBA 2E2WA 1E60A 1SQ5A 2PZLA 3F5SA 4DMLA 3VTAA 1RQNA 1S02A 2NAFA 3D6AA 5JC1A 2O8CB 1ZITA 3B2NA 3E0XA 3JQ8A 1RFLA 4HTFB 1TUBB 5M2QA 1N0UA 1W5TA 4BKUA 4UBMA 4UXIA 2EYQA 3E61A 4MJ7A 3JYPA 1RTTA 5CLLA 2OXFA 4YRPA 3C8ZA 2ZSJA 1N2XA 3LXRA 3QELA 1JS1X 5HZHA 5LIPA 3EZ9A 3ICPA 2PA3A 1KHTA 1D4AA 4WK4B 5HF9A