2I7DA

Structure of human cytosolic deoxyribonucleotidase in complex with deoxyuridine, alf4 and mg2+
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
193
structure length
193
Chain Sequence
RSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase, cytosolic type
publication title Structures of Human and Murine cytosolic deoxyribonucleotidase: Insights into substrate specificity and catalysis
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 65
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature ec 3.1.3.-:
pdb deposition date 2006-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 2i7dA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2i7dA01
2FUCA 1L7PA 3B9RA 5AKLA 3MN1A 3DV9A 4UU0A 4BNDA 4JB3A 1CQZA 4F72A 2I54A 1U02A 3OCWA 3QLEA 2IYEA 1TJ5A 4CF3A 3E8MA 5AKHA 3L0CA 1RMYA 4HGOA 2G08A 3WK9A 1YDFA 4MWOA 1FEZA 4XOUA 3R9KA 3L8FA 2WF9A 2GMWA 2NO5A 3QXGA 3U7EB 4IG4A 3U7GA 3AR2A 3FZQA 5T41A 4XPZA 2IOHA 1YS9A 2BDEA 4DFDA 1QQ7A 5AM0A 3MC1A 3I6BA 5FP0A 3FVVA 5AK5A 3BA6A 5AW4A 4KN8A 2GO7A 3ET5A 3QUCA 3QX7A 3AR5A 5AHXA 2W4MA 4ZEXA 2WHEA 3WK6A 5AKYA 4UAVA 2NYVA 3ZWKA 3ET4A 3VAYA 2C9MA 1XVIA 1RLOA 3ZX4A 5AK4A 3NALA 3QUQA 4KNWA 5ALEA 3F9RA 2Q4RA 3CNHA 5AVXA 2YMMA 2OA0A 2ZG6A 2O2XA 1KYTA 5AW8A 4KX3A 5AM1A 3W5BA 2YMQA 2JARA 3U19A 2FPWA 3EF0A 2EARA 3WKAA 3FPSA 3QYPA 3QU4A 4CNQA 5AKKA 3B8EA 4FE3A 4EX7A 4HGNA 3U26A 3QU2A 5ALJA 3ZUPA 3AR4A 2ZXEA 2AMYA 3MMZA 3QNMA 4OFZA 2EAUA 1Q91A 5AI0A 3E81A 2HOQA 4UAUA 1RKQA 3NAMA 3NANA 3AR9A 1O03A 2MU1A 2YBDA 5AI6A 3OCZA 4C4TA 2ZBDA 2OBBA 4YCMA 1EK2A 3ESRA 3ESQA 2B1RA 3CZ4A 3M9LA 1VJ5A 2W11A 5AW9A 3ZVLA 3DAOA 2D2VA 3QU7A 2W43A 3WK5A 4Y2RA 1NNLA 3W5CA 1RRCA 5ALHA 5IS2A 4AS3A 2HEGA 1NF2A 5E0OA 5ALRA 3FGOA 3B9BA 1QYIA 2G0AA 4Y2QA 2WFAA 1RKVA 2C4NA 4GIBA 5AW7A 2G80A 4UMVA 5AVVA 1WVIA 4EZEA 2GHTA 2FEAA 3P96A 5AW6A 1K1EA 1WZCA 3L8HA 4EELA 1QQ6A 3R4CA 4Y2UA 4NFLA 5ALMA 5AKXA 2G06A 2B8JA 3QGMA 3N8GA 3N5KA 4O8CA 2HF2A 1S8OA 3KOOA 1RMQA 2O9JA 1Z4JA 1Z5UA 2B0CA 1T5SA 1WR8A 3L1UA 3WKDA 3FPBA 3U13A 1N9KA 3N1UA 5ALTA 4OCZA 3SKXA 2DQSA 5AI4A 4JDPA 4UMEA 1Z4LA 4HGPA 1L7MA 2CFRA 5AVTA 2WF5A 3AR6A 4B6JA 2FPSA 4L6CA 1YNSA 2YMPA 3OCYA 3NIWA 3ZTYA 4E88A 5ALVA 2OYCA 5AK6A 3ZTWA 3UM9A 1Q92A 2B82A 2G09A 5AKIA 5ALOA 4BX2A 3SD7A 1PW5A 4L6AA 1ZOLA 3OPXA 3W5DA 4BX0A 1U7OA 1NRWA 1YV9A 3N28A 2C8KA 1IWOA 3KDPA 2P27A 3SMVA 1RLMA 5AKJA 3OCVA 4L57A 3R09A 2JAWA 3L1VA 3L7YA 1RKUA 1LVHA 4Y2VA 3L5KA 4YCNA 3DNPA 4MUMA 4YGYA 3GYGA 3EPRA 4HGQA 4UARA 2X4DA 2Q5EA 3A3YA 1QQ5A 1ZJJA 1ZD3A 1ZD4A 4Y2JA 2NO4A 1O08A 4FYPA 1ZD5A 5AIAA 3S6JA 1RQNA 4YIKA 4G9BA 5AM3A 4RESA 3OCXA 3WKCA 1Z88A 4UM5A 1F5SA 2P69A 2JAOA 4ZEVA 3WGUA 4BEWA 3W5AA 4YIHA 2HHLA 4PNHA 5AM5A 4C4RA 2G1AA 5ALQA 4BYGA 3AR3A 3I28A 4KNVA 2VKQA 3IJ5A 4CF5A 1ZD2P 3OTQA 3L8EA 4J2TA 5AM4A 1YMQA 4UU1A 2YY6A 5ALIA 2ZBGA 3IRUA 1VFPA 5AI8A 4CF4A 4BEVA 1RQLA 3I1YA 5ALXA 4OD0A 3I76A 1U7PA 3QU9A 4QQFA 5ALZA 4KX5A 1L8OA 4I9GA 2CN1A 2ODAA 4OHFA 4IFTA 5ALLA 3PDWA 5JJBA 2PKEA 2ZOSA 2AGVA 4EEKA 2C88A 2GFHA 2B1QA 2CFTA 3M1YA 2HDOA 5ALKA 3OCUA 1U2TA 2RAVA 4Y2TA 4UATA 3UMBA 4FFDA 3EWIA 1Y8AA 3FM9A 1VJRA 1U2SA 5ALPA 1SWVA 3PCTA 2WM8A 2HX1A 1Z5GA 5AW1A 3TLMA 5ALSA 3ZI4A 4BX3A 1EK1A 1ZRMA 1T9ZA 2P11A 2PQ0A 5AVSA 2I33A 2BY4A 4UMDA 2HI0A 2RB5A 1L7NA 1J8DA 3J7TA 4H1WA 1L6RA 1JUDA 3E84A 3WK7A 4DW8A 3HLTA 1ZRNA 1CR6A 1RMTA 5AVYA 5ALGA 5AI5A 3K1ZA 2HSZA 3KD3A 3UMGA 4RETA 2IA5A 4EX6A 5AICA 2GHQA 3ED5A 2AH5A 3L8GA 4NABA 4XQ0A 2R8EA 5AKGA 4BBJA 2I7DA 5AIBA 4GXTA 3SLRA 2HO4A 1ZS9A 4UMFA 2YJ3A 2PR7A 1RLTA 1L8LA 2QYHA 2I55A 4Y2YA 5A3SA 1Z4MA 5AVRA 4QJBA 4DWOA 1Z4OA 1XPJA 4CE6A 4BKMA 5AVZA 3U7FB 4Y2SA 1N8NA 4HGRA 2FPUA 4C4SA 2AUTA 2IOFA 5AKEA 4HYTA 3HYCA 1LTQA 3SHQA 1Z4IA 4Y3UA 1XP5A 5AW2A 3U7HB 1T5TA 2FPXA 3L0YA 3ZX5A 2WF6A 2ZBEA 4NV0A 3ZVNA 2BDUA 4XE5A 3ONNA 5AW0A 2R8ZA 3NRJA 1S2OA 1RC8A 2WF7A 3L0BA 1SWWA 3SKYA 3WK8A 3PGVA 3WKEA 2FUEA 5AK3A 2B30A 1RPZA 3MPOA 3RFUA 5AVWA 5ALYA 2YMLA 3DDHA 3EF1A 1Z4NA 1MH9A 2WF8A 5A3QA 5ALDA 5AW5A 2YJ5A 4DCCA 2CFSA 4KYTA 2FPRA 4AP9A 1AQ6A 2EATA 3A1CA 4I9FA 4NAVA 2Q4TA 5ALWA 3D6JA 3AR7A 5IT0A 1Z4QA 2C8LA 2R8XA 5A3RA 1TJ3A 1WPGA 3ZWDA 4HAIA 1L7OA 2I6XA 5ALUA 4YCLA 5AW3A 4YH1A 2YN4A 3RF6A 4G63A 2HF7A 2FDRA 2QLTA 3BWVA 3ZVMA 3SF0A 2JGAA 2MSNA 2ZBFA 3QU5A 1QH9A 2YJ4A 4UASA 2P9JA 4UM7A 3A1EA 3A1DA 1Z4KA 2RBKA 3NASA 2R8YA 4UW9A 1X42A 3WK4A 3WKBA 3E58A 5AESA 2G07A 2OM6A 1YJ5A 2JAUA 4EENA 3IB6A 2B8EA 1TJ4A 4F71A 5AVUA 2YFYA 2HCFA 5ALFA 3PGLA 2YJ6A 2RARA 3ZU6A 3ZW7A 3QUBA 1TA0A 3KC2A 3WGVA 5AVQA 4BNDB 3KZXA 5AI9A 5ALNA 1TE2A 1Z4PX 3N07A 3QUTA 4J03A 4NWIA 4Y2PA 4ZEWA 4AS2A 3AR8A 5AM2A 2IOFK 2I34A 1RDFA 1SU4A 3NUQA 1J97A 3UMCA 5IT4A 5AKZA 3KBBA 4Y2XA 2FI1A
chains in the Genus database with same CATH superfamily
3TQTA 4HSGA 4R6XA 1QO9A 7REQA 5LP6F 2IYZA 5HIKA 3EGXB 2YV4A 3GRRA 3QLEA 4GPAA 4I5EA 2VDQB 2EZTA 1RYNA 3DCNA 3LPMA 1NTRA 1PNRA 1HRDA 1XRJA 5K3SA 3SQDA 1MG5A 3DPSA 3OJFA 1L7QA 2EJWA 1RMYA 2NG1A 3KKNA 5CT8A 4ZTUB 5EC8A 2O8FB 4YP9A 2GXQA 5KVCA 1NAHA 3TQQA 3ZIAA 1K6JA 5FEUA 3HCRA 4F92B 3BHJA 1VB3A 3PXCX 4UAGA 4BV9A 3KB8A 3R3XA 3C3MA 1ORVA 4G4GA 1IIRA 5T6BA 3DVRX 2KLBA 3OFVA 2AJTA 3H5NA 4DFDA 3OFSA 2IXTA 3LAWA 4GU5A 4RPKA 2ARKA 2HRBA 4YJ3A 3RH0A 3DWGA 1UEIA 3OZFA 2V7BA 4FR5A 2WD7A 4NY1A 4DLVA 4TUYA 3ADKA 2JS7A 4KN8A 4L08A 3D4PA 4NHOA 3UUWA 5HZKA 5AHRA 1SUPA 3BGVA 4LXIA 3PBKA 1V5EA 3OPYA 3ELYA 4JHXA 2WY2D 1P72A 2O2ZA 4ZT2A 1XMQB 2GCPA 4HN4B 4D9HA 3WE7A 5JQGA 3WJ1A 3GP5A 3IUNA 1OXXK 2PWBA 4OHVA 1WG8A 3TNJA 3QUQA 1GZ3A 4INAA 2GERA 4XWWA 3STXA 4BFSA 3CNHA 3HKEB 1UEXC 3HU3A 3K09C 5F5XA 3VNSA 3Q7SA 2Y0BA 4G0XA 4O1MA 3CRRA 3GGPA 4N48A 2A67A 2QKYA 2XNHA 5EIWA 1A88A 1OXVA 5TDHA 1IM8A 3C8UA 3ML1A 4G6ZA 3ONFA 2UVDA 2XCSB 2C3OA 3QA3E 2AQHA 2JBHA 2R8PA 1K5GA 2OSBA 3FFXA 5DOVA 2EU8A 4BVAA 1DWUA 3VPDA 2ZWMA 4M7RA 2JAHA 1E1YA 1O57A 3SBXA 1YK0A 2X0NA 2OQRA 2HMSA 1XTUA 5JQGF 5CYFA 3K2QA 2HSJA 1TM5E 3VR0A 4E09A 3ORHA 3PRKE 4JUAA 1PJ2A 3PHGA 4AY4A 4I6JA 2F4VB 1I7LA 1N5DA 1W4AA 1ZKMA 2RONA 1Q1BA 2F3TA 1Y5IA 2WUFA 3A9SA 3CXUA 1MA0A 3JVUA 1N2SA 4NCHA 3RWOA 4Q01A 4OMFG 5IH3A 3QVJA 2A9VA 3HDVA 3JQGA 4NENB 4XB6B 4BMOB 4DQKA 2RGWA 4L2IA 5CDGA 2OBBA 3EQ2A 2P35A 3L01A 4P54A 3W5SA 4ZGBA 1P1KA 3CZ4A 3RQSA 4FI3F 3T5DA 1ZAYA 3AEKB 1DXOA 3MWLA 4J1QA 4N3NA 1DAEA 2W11A 5PGMA 3AP2A 5DWQA 5LBTA 3ZWQA 4CG1A 4ARZB 1XDUA 2C78A 2QLNA 3PJGA 3D0RA 3AILA 3K0EA 3I1FA 2IYVA 3UHAA 4A5OA 3T5AA 2CVQA 4P38A 4DVJA 3GJ5A 3PR3A 3F4RA 1T26A 1PNTA 1HF3A 1P7YA 3R40A 1GRCA 5FHRA 3HDGA 4CFZA 2FN9A 5K8IA 1JIXA 2H1RA 4A1FA 5FFNA 3EA0A 6ADHA 4CLDA 4LVOA 3HR7A 5HK8A 5I5GA 4OO3A 4BBAA 4F06A 1NM5A 3IMGA 4Q7LA 4DV5B 3DUFA 2D2XA 1GLGA 2Q1SA 1UZUA 3DCYA 3NOXA 3R41A 16PKA 1BJKA 4FSHA 4TWZA 4DEYA 4HZUA 4DPLA 5J2TA 2ABWA 1PWXA 2XUKA 5LMUB 5ECGC 4CHTA 4BVEA 4D8TA 2VR1A 2XDYA 1PZMA 5M2QA 1ZNXA 2BI8A 1HXHA 4GE0A 2JFZA 1ZA2A 1KWKA 3G2IA 2PU7A 5CA1F 2QD3A 5FOSA 3N5KA 1SFRA 4P33A 2GJ4A 2BCGY 3U4MA 2Q0XA 1JSXA 1T9DA 1YB7A 4CLOA 1L4BA 2H2WA 1CQJA 4D3XA 3E5NA 2HJRA 4Y67A 5NLLA 3TSWA 4Q7QA 3SNHA 4EJ2A 1EDDA 3HV2A 3KDAA 5A7HA 3WL5A 4QEZA 2XVAA 1MX3A 3KKZA 5C34B 2G5TA 3N1UA 1YMVA 3HRKA 3N2EA 3HKBB 1H42A 1AF4A 1E1MA 4NMLA 3GZHA 3CF2A 2SECE 5I6DA 4ADMA 2FEWB 2ZREA 3ZLTA 4EF5A 3CUVA 4YQFA 1H9BA 3BSWA 4KQWA 2B3DA 3IAAA 1WA5A 2XPCA 2DUMA 1OFTA 1WSWA 3OD5A 3PNQA 4UU1A 2FHPA 3TE6A 1D8AA 1H0KA 4JC4A 3RJTA 4H7FA 4ZVPA 3BSSA 2QVXX 3C7KA 2JHAA 3IILA 5ITZA 2VDWB 1ULTA 2H54A 3AL2A 3MS4A 4L7QA 4MR8A 1RXWA 2VF8A 4GF5A 2PD3A 3SDBA 4E88A 2A3NA 2I6SA 2YHIB 3KQSA 3QF4B 4LQLA 1M0SA 5LZ2A 1AXEA 3U61B 4B2YA 1JQ3A 5K4GA 5LZ4A 2PAAA 4PN3A 3KSUA 2WIJA 2R4TA 3QG5A 3VUEA 4F4HA 1DLJA 2E4XA 3OZGA 3KKOA 2W2XA 4OL9A 1P4AA 2CYAA 1MGOA 1CSEE 2E5LB 2OP0A 1U6KA 2I76A 4NAUA 3QPVA 4M9ZA 2H17A 1JHQA 5KQGA 1Y4DE 1YU6A 2AG6A 3JZFA 2WINI 3ORSA 5C5DA 2Z2ZA 1YFKA 1RKUA 4EEZA 3BH6A 3KKMA 3SY8A 3UENA 5C7YA 4E11A 2VAMA 4Y9SA 1SEPA 1GRVA 1RQ2A 3C3YA 2Z9DA 5DLEA 5L7YA 1Z2AA 4YAFA 5DZSA 2BFBB 3IMFA 3U5ZB 2ZCUA 1KR5A 1P62B 2ZEJA 1W36B 3C0KA 1GYQA 1XZQA 4BU0A 1PKEA 2X19A 5LP1A 2FR8A 1LPBB 2LCQA 2FFAA 2R48A 3AFNA 2OO5A 1Z5PA 3GMIA 4U7PB 4KIFA 3HWX1 4BKUA 2QN3A 4OHOA 1MX1A 1F38A 3B70A 4LOLA 4NZ9A 5EJMA 3ZKAA 1M7GA 3I42A 2ZSFA 3G2JA 4H7PA 1E7RA 4MXDA 4TS3A 1H9AA 3HKEA 3STYA 3N2KA 5LJLA 4KE8A 4XASA 1QGZA 3VH1A 4A82A 1S7CA 4PSAA 3R7BA 3SDZA 1EE2A 1IB6A 1LI5A 4CDMA 5JYDA 2O4UX 1V7PC 1XF1A 1HDOA 2WJ6A 4QQKA 1BN6A 4M3NA 1XDSA 1HMPA 3E9CA 4FVTA 4I14A 1RYEA 1JKXA 4L0CA 5ALQA 4DANA 3K2BA 1TM7E 4UEWA 4RGYA 4KNVA 3OX2A 2VKQA 4BO4A 1ZD2P 1L0BA 1H93A 2G9ZA 5CA0B 2PXAA 2GZ1A 3KVOA 2OSVA 4ROTA 2MYPA 3A3PA 3PUWA 5C5IA 3H87A 1D1QA 1ULAA 2ERXA 3LYUA 1IATA 3QKRA 1JGTA 2H11A 2LTAA 3GPCA 3IE2A 3KYJB 3PC7A 3UWSA 2A9OA 3SSMA 3MUNA 1QYCA 1HYGA 3HY3A 1UJ2A 3I76A 4CMBA 4UTVA 2J0QA 2ZUUA 3EDMA 4I4TA 3HB0A 2C2MA 3M4JA 3HI4A 3OAAA 3OZRA 4LTNA 4MPJA 4XSHA 1NW6A 4CMHA 5H80A 1IVNA 5K6RA 4JR0A 2DLDA 3A2MA 2ICAA 1MC8A 5L3VA 4HNVA 4MNTA 2UVPB 1LY1A 3CEMA 2X6TA 1WHTA 3TR5A 4JLOA 2A9QA 2QN2A 1SBCA 2C88A 2PH7A 4Q1EA 1UWVA 2X3UA 2YXDA 4Y1FA 5DIFA 4N6OA 5EFOA 3TEMA 2NVUB 1KFKB 4O2AA 1EB9A 2QLFA 1QQTA 5T8KC 1OWLA 4UATA 1WZIA 1MPTA 2G1KA 3GJSA 3UMBA 1IQUA 3T4UA 1YA8A 1QHFA 3EGDA 1LPOA 4JOCA 5CNJA 3CZPA 3AKZA 3FM9A 4M53A 1H5UA 3LNCA 3EXHA 5LBIA 4EKIA 3FI9A 2WFLA 3OPNA 4DUGD 2GR9A 4I3FA 4TYPA 1XNHA 3UXHA 2CZCA 2BEUB 2CB0A 1Z25A 2K2QB 3N58A 3EVNA 2XF8A 1XRNA 4E2WA 4I4TF 2GZMA 1PTJA 3NYWA 3WWZA 3O1JC 1NBHA 2XMPA 5IJAA 5DULA 5JRJA 3EUFA 4B4VA 2G9NA 4HVLA 5CVEA 4KTTE 2ORWA 3R7LA 3CQ9A 3IDAA 1OGIA 3KEFA 2I6FA 1ATIA 1LXCA 4LRXA 4ADLA 1AF7A 4ZT3A 4DCPA 2W2KB 2PS0A 3DCJA 2AHOA 2OBNA 4O2AF 1UFVA 2X41A 2Y8EA 3OUZA 4X60A 4PG4A 3EEQA 4JBGA 3T38A 4JXXA 2I1VB 3HLTA 2QQGA 3DFUA 4GOOD 2LPMA 4I36A 4PW0A 2QRUA 2X14A 2OHIA 1M34B 1RAEA 1ESDA 2HQSA 3LC0A 5C18A 1YTUA 1C5KA 1SQGA 1QVAA 4EFNA 3EAGA 5BSHA 1E1QA 5ES3A 3WNDA 1AUQA 4BU1A 3CVXA 3RUPA 3OZCA 1IXRC 5EXPA 3AJAA 4W9NC 3F90A 4U2FA 1CJSA 3EMDA 1CQWA 1GVNB 3EY4A 3M1AA 1RIFA 1MC5A 3EFOB 4GPEA 4XM0A 3ZIDA 1T4BA 1VCMA 2XA2A 4LBZA 2FEMA 4BNNA 3A4MA 4IIHA 4BXOB 3L9WA 2CXQA 2G5CA 5DFAA 4JWTA 4ZOAA 1P1FA 4TWJA 2X7XA 3HP1A 4DL9A 2DU8A 2Z83A 4IQ0A 4FR0A 4BLOA 1CWUA 4O4LB 4DCNA 3GTDA 2A78A 1OYWA 1TYZA 3CNLA 4P92A 5DYIA 4DNOA 4NMWA 3KHTA 1X38A 2LKDA 1WW3A 4B4DA 3IBCA 2ZJBA 3QMPA 3KSRA 4P93A 2IU0A 4AMUA 1A72A 2H59A 2IUSA 1GKUB 1KERA 1M34E 2G71A 2O3QA 2XMCA 3HDYA 1U0BB 2ZJ2A 5CTAA 1N7JA 2C5AA 5EP2A 2LBPA 1MGPA 1I3CA 4MVJP 5JW6A 4OYYA 4K6KA 3GNSA 4HYTA 4Q0MA 1ECBA 2KE5A 3DP7A 3BCRA 3Q5DA 3ZZ0A 4XD7D 1R6XA 1FXUA 2PA3A 3EDYA 4JGGA 2MSCB 4OHWA 5T4FA 1MCZA 3RYIB 1ZH2A 1R8YA 3GQBB 3W5HA 1W7AA 4PQEA 3WQRA 5EMKA 1DPGA 4NU5A 1NHWA 1Y5MA 2ZTHA 4JA0A 3ZHVA 1EM8B 1U7UA 4M9CA 3R7DA 1MDFA 2HWWA 4GYKA 1F9EA 1BVYF 5C8YA 2VYVA 3DE6X 3K05A 4Q00A 4RZIA 5FI0B 1KK3A 5K3DA 5AMXA 4PG8A 4PHGA 3HVKA 5L4SA 2R6HA 4PEVA 2XE4A 5AK3A 5FR1A 1KWGA 3TKAA 1V16B 1P9RA 2I8AA 2J3KA 4CIWA 5JSQA 4D4LA 3ZJUA 3CGGA 2IWHA 4QNNA 5AXAA 2HPHA 1D2RA 3H18A 1ZUWA 1RJ9B 5CLGA 2VPWA 1NPTO 3S4YA 1Z15A 2XWQA 3FTNA 1Y3FE 3Q5GA 3R7WB 1RI2A 1OJLA 3FETA 4YDSA 2J0SA 1MB2A 3NWPA 2HFKA 1L5GB 3ZDEA 1ETHA 1M2HA 4FD3A 2E7ZA 4ZU6X 2XQIA 3AV3A 3FSGA 4MAFA 4RSMA 1HFKA 2VUUA 1V3TA 3X0DA 4K2AA 1J8MF 1MKYA 3UB4A 5M34A 3MJ4A 4BV8A 3WNCA 1C1DB 3TLXA 1LSUA 2BN4A 3QMMA 2R8XA 1OWMA 2CKMA 3PPVA 2ZQYA 1HDXA 1WPGA 3UJ3X 5C8YF 4CEIB 1EVJA 1P73A 1HG0A 2GJ9A 2UUOA 1QG0A 2OG1A 2C1ZA 4DCGA 2I6XA 1PKXA 1VYHA 3EOAI 5ALUA 4R31A 1Q17A 3IVRA 1S96A 4RZ3A 4M54A 3WGKA 4AY5A 4CMCA 4R1LA 2YN4A 3L0IB 3HBLA 5GJBA 1Y1QA 1Y8RB 3H99A 3LF1A 3ZGZA 1W73A 3NV9A 4XTCS 4Q93A 3WRWA 1OH8A 3ZWNA 4A03A 4E21A 1XK6A 3AHEA 2HQ1A 1T1RA 1YS6A 3FB4A 4L50A 2R7KA 5KYXB 3NKVA 4NMXB 3R8XA 4LQDA 4Q19A 1RT9A 1SAYA 4ETMA 1M6VA 3WK4A 5FQOA 1FU4A 3GRYA 3MGKA 1WV1A 1OLOA 5EN4A 3TRDA 2JH3A 2I99A 2ZI3A 3HCDA 3PJEA 4FYVA 2HKIA 1R12A 3ZWAA 1RAFA 6ABPA 5TEWA 2YRFA 5G53C 2JFWA 4Q82A 1NBMD 2Q6IA 4RF5A 5JAQA 4BUZA 1MJGA 4H3VA 1ACJA 3LQFA 1ENOA 4X6LA 4MR9B 4YJGA 2CHVA 4HAVA 1KOLA 4MI1A 3JQ8A 4LZWA 1X3LA 5DMHA 1I13A 2OZLB 1X8LA 1JFFB 1NKSA 5EKDA 5H70A 3A9TA 2YJ6A 1IH8A 3QNWA 3OZSA 1KEZA 1SBHA 3GCZA 2V9CA 3NM6B 4HH3C 2I3ZA 3QHAA 4JCOA 4RQAA 1PCXA 4AJPA 3NIFB 3GUZA 3ORQA 3INGA 3USZA 5L7TA 5D3KA 1KYVA 1J90A 2HQOA 1NZJA 4Q9IA 3U7QB 1ONOA 4R83A 3VPGA 5AI9A 1T1SA 1G9SA 2BBTA 5IMBA 3T9FA 3VYUB 5KTYA 3BFVA 1JU3A 3JRXA 3SICE 4A6PA 3ZWMA 5KMGB 4XWTA 1KDPA 1Z82A 1QHXA 2EKLA 4K3UA 1SGWA 2HXSA 2X1VA 3CEHA 1CTQA 4P4GA 4Y2XA 4ECAA 3TZBA 3U9LA 4YAKA 5AKLA 3ZZNA 4A36A 4KGVA 4ETNA 4X1YA 4IVRA 4K9NA 4OJQA 4QFBA 2H3EA 1T6BY 3KE9A 3QELB 4FKBA 4HFMA 1QO0D 2RJOA 3FTPA 4J0KA 4ZGGA 3UN1A 5DBIA 4IUCS 3L0CA 4XDYA 5GM1A 1A9YA 1ZD1A 2Y1OA 4MX8A 3IP8A 3GGSA 4B46A 3WDMA 4RD4A 1HT0A 1GZHB 2PANA 2EFDB 4D25A 3CIOA 2Y1DA 3U7GA 2H51A 3CZCA 3DO6A 5I5EA 1MJNA 4HLUA 2CMHA 2VXBA 4JBWA 4ML3A 3C70A 1VI5A 4MUGA 3RTGA 4W4TA 3VDRA 3QVOA 4BASA 3EPHA 3VPSA 2ZDGA 4BLPA 5CMLA 5C2JB 3GBPA 5AK5A 2J59A 2JFQA 2XX3A 3HBMA 4GKVA 4EMTA 2H4WA 1JJFA 3UAXA 3DLBA 4Q3OA 3B7WA 3ROMA 5JD5A 1F60A 4EY6A 1E0SA 2VNHA 4H60A 3HGMA 5D3QA 4QT0A 3ZJYA 2P7IA 5LZ8A 1Z73A 1UMBA 2NYVA 3ZWKA 4B6FA 4X97A 4EGAA 4D9JA 3SHWA 3TLJA 1X39A 4ZYXA 5DNAA 2GZ3A 1WEHA 3K9BA 4U8HA 3M6WA 3VYRB 4D8VA 4Z4QA 3WAKA 2IYFA 3N7TA 4OKIA 1H1LA 2ZIUB 1QYDA 1D2MA 3RS5A 2H0AA 1SR8A 3HSSA 4ZOBA 4B2LA 2I5PO 2P1RA 3SKVA 2P9ZA 2C5LA 1G5PA 2PVCA 5L3QB 1B2RA 2EARA 5K0ZA 3MOIA 4ADSG 1XMJA 3VNBA 1PL6A 5IDVA 3FNRA 3G9ZA 4HDAA 3QU4A 4MYCA 4WXHA 3B1YA 3BHGA 2ONZA 3OO0A 2IHTA 2PEZA 5BURA 4WMLA 1E96A 3AR4A 3TF5A 1C0KA 3VSEA 2QENA 2WIDA 1GPWB 4S1WA 3WHLA 4RSRA 2V58A 4K1XA 2F62A 4CEHA 3MIIA 5H0IA 4WLOA 5T5QA 1DO8A 3QJ5A 4JJIA 4KLNA 4B4OA 2Q5CA 2XIJA 4M9UA 4PBRA 3RS4A 3AJ9A 1RKQA 4QSHA 3GIWA 3AR9A 3FF4A 4PTZA 4NX2A 2X9GA 3B1JA 5JR3A 3ZD7A 2TSYB 1EFVA 4ZVSA 1M2VB 2W98A 1BD4A 4HEJA 3V2HA 3CRNA 2IZOA 4JR1A 2QP9X 4G0YA 3JATB 5K0GA 3RJMA 2LDXA 4ZALA 2HK8A 3DAOA 1PQWA 3OLVA 4R1SA 4W8HA 3R5TA 3S2IA 4P4UA 3OZBA 4F8YA 4ER7A 5EJ5A 1HQYE 5EP1A 1IFXA 4JJ8A 1RRCA 1J8FA 4MB6A 5ALHA 1BEUB 1DAPA 1P7CA 2VDMB 2V0CA 4FYYA 2QRVA 4JNCA 5AJWA 4D45A 5IJWA 1HDZA 1X8KA 2DBZA 2OGUA 4JUDX 3F4BA 1MN6A 4A7PA 1AMOA 5T4BA 4G65A 1IOVA 4M1KA 1MTOA 1G7SA 1M6NA 2BAGA 2I6QA 2NZJA 3HBJA 5DBFA 2DJ5A 1XWWA 3PQ7A 2GHTA 2R9VA 3LUJA 5FPHA 2G5GX 2NU8B 3ZBUA 1O6ZA 2FW1A 1SZCA 1XCJA 1HT2E 1KO8A 1WZCA 3JD2A 5FD8A 2A0WA 4R2MA 1RP1A 3AF4A 5FYQA 3TD9A 5LDDC 2Q9UA 4QBKA 1YB2A 3ADCA 5LD2B 3Q7IA 5DYNA 4Q1DA 2WYWA 4LNUB 1E3MA 3CT6A 2WJGA 4D98A 1ZH6A 3EGIA 2Z1MA 3W7AA 3K1AA 4MR9A 3C15C 4FFSA 3PXXA 2ONJA 4XUEA 2PUFA 1VLVA 4OLAA 2OZLA 4YWJA 2X0DA 5KYGA 1GD1O 4IUYA 4QRDA 3VVBA 1KK2A 4PR3A 3E7DA 1FBNA 3SAJA 1B14A 2YX1A 4DV1B 1SXJB 2EJCA 3IULA 5AHKA 4ABYA 3JVDA 3SLKA 1NUUA 3QFCA 1VGVA 3CTMA 4ZFNA 2IS6A 1WKVA 5FL7A 4Q16A 5KNDH 3FOEC 4UE2A 2DQSA 2XCIA 3OICA 2B3TA 2D1FA 2ZJ0A 4EARA 3RSLA 5JIBA 1SQ0A 1UT5A 4NU8X 5HBGA 1R74A 3VNAA 4H7JA 3H9CA 5AOBA 2FSGA 3KZNA 3O8LA 2P5UA 4E5DA 1QG2A 3TRHA 4MK4A 1CVIA 1F0YA 2V6MA 2FPGA 1M10A 2OHHA 2ZR7A 3F4LA 4ZTBA 1JYFA 3GI1A 1GPYA 2Q5LA 4BIIA 1VI6A 3T9CA 4BNZA 1BCSA 1HZZA 2PRSA 3F97A 2WK1A 3X1DA 4B17A 5JY6A 2WB2A 1IQPA 1A50B 2Q4BA 4P0TA 1KKMA 2J0EA 3FKSA 3A1WA 2C00A 1YRQA 2G09A 5AUPB 5JJIA 4K9MA 2QN9A 5AKIA 3EGVA 1CY8A 4TS9A 4D6YA 1L7XA 1U7DA 4J4TA 2DFVA 4HYYA 2AF3C 4CYMA 3J81A 3WGYA 3UGJA 1CIVA 1UBUS 1E9VA 2I7XA 1YV9A 1UPUA 2AUMA 3PFCA 5CFQA 1IY1A 1RXYA 3A4TA 4UQOA 1D5WA 4PX2A 5BR7A 3ZWCA 1O4VA 4MQBA 4DPKA 5H81A 4EY5A 2FY8A 3ZYCA 4LF7B 5ILOA 5ERYA 1NUQA 1PS0A 2PBLA 3L1VA 4HNQA 5BQOA 5KC8A 1SBTA 2V4UA 2QVYX 3HZOA 5JDCA 2LW7A 5AJVB 1VXRA 2QTCA 1M3SA 5FAKA 5REQA 1BVRA 2J85A 1XTTA 1SCUB 4ZQCB 1FCJA 3EB9A 1VZ3A 4PINA 2CUKA 5HJ5A 1KC3A 1NFFA 3ZK9A 3LMKA 1MC1A 4ZJUA 4HNTA 1YZGA 1XZJA 4J0QA 4O4HB 5EWLA 2OO7A 3JQEA 4Q03A 2JHGA 3U1VA 5DLDA 3C43A 2PKYX 1U1FA 2ZUWA 3S6JA 4CFSA 4QFMA 4G9BA 4ZCSA 4BFVA 4IIVA 5F9HA 1H2RS 3HBFA 3LUBA 2JKVA 1KORA 5BMVB 2P6NA 3UJ6A 3E6AA 2V5VA 1C81A 3IX7A 5E1OA 2QSUA 3DBLB 1N6KA 1HNWB 1PT8A 2WAOA 2WA1A 3HJGA 4MH0R 2GRJA 2XNKA 4JX8A 1I2DA 4CL3A 5KQLA 5JY1A 5HF6A 1TNDA 1HZJA 4CGYA 2UXCB 3M9WA 3ITEA 4CKBB 3RS7A 4E94A 3EG9A 4RELA 4D9KA 4D92A 3VO1A 1I0LA 1U8CB 2JGKA 2ZBGA 4IEIA 2JATA 5HG0A 5IJ9A 2XMZA 4OBBA 5JTUA 1GADO 3M5DA 1UKVY 3LHFA 3EW7A 3VDXA 1T34A 3CLTC 2G77B 4ESHA 4DJEC 2GM9A 4ZRMA 4NMMA 2HBQA 1IM5A 3QU9A 2J7PD 4N5LA 5FL3A 5BR4A 4MTLA 3D3WA 5F1PA 2R6GA 1VYTA 1WO8A 3L4JA 2CMDA 3IBTA 4MCHA 3RROA 2QZ9A 4IFTA 1O97C 4LG1A 3KL2A 1YSCA 2ZOSA 4HNAB 2IF0A 3PR1A 3D3NA 5DCUA 5ITWA 4A8JB 3N2GB 1UKAA 3QKIA 2HDOA 2HWKA 4NLLA 4W1SA 3REGA 1R2QA 3OBIA 1G20E 4HX2A 4K03A 2WU3A 4BKPA 1EGQA 5JECA 4B45A 2OV6A 2R47A 2ZYHA 3AVYA 3KJXA 1VJRA 1X94A 2NSDA 1R0BA 1FX0B 1D2AA 1HSOA 3WLQA 1UMKA 2HUPA 5FPQA 2NU8A 2V6GA 1W30A 1VG8A 1Z5GA 3N53A 3VR3D 4XWOA 4C5BA 1QG4A 4KU4A 2HMUA 4FJ0A 1TPYA 4DDUA 3ZI4A 3RAPR 2DHRA 3RTDA 1J09A 2GPAA 2RGNA 3RSQA 5AVSA 4CTOA 4LNUA 1C8BA 2ET6A 1R6UA 2I33A 2JFBA 3ENKA 4U8GA 1VIMA 4K9SA 1PGNA 2CL6X 1L7NA 2NU9A 4PZUA 4MS3A 5JD4A 2IS2A 2QG4A 2BR3A 4RY9A 3OT4A 3E84A 4E4YA 1Z6ZA 3T34A 3IUSA 1XAJA 3K32A 1UDWA 5AXCA 3OT1A 4RE5A 3VOAA 1V8FA 3IDOA 2W2QA 3PNPA 4EX6A 4HQNA 5K0JA 4RGBA 3L7LA 4KR0A 4NKRA 4LC9A 2QMHA 2WHPA 1N2CB 4FP9A 5AJZA 4N8SA 1I4TD 2WUGA 3UMJA 4C4ZA 4S35A 2HWYA 1XZBA 4UNNA 3RVLA 5A9RA 4OK5A 4QDXA 1MW9X 3LL7A 4JLUA 2Y93A 4M7WA 4YQEA 1ODLA 1R8JA 4OLFA 2YN0A 5I9TA 4G8JA 1WTAA 4B3GA 1EZZA 1AQUA 3BWYA 2QYHA 1X70A 2VJKA 5TQ0B 4PYRA 4PU0A 3QK7A 2DTDA 2C5HA 5G41A 4JL8A 1ZC4A 4DWOA 3VMFA 2WHQA 2I9KA 3IT2A 2R79A 3S2FA 1YQUA 3T8YA 2BE9A 1J9GA 2M32A 1ZGBA 4PZAA 2I03A 2C7GA 4YQZA 3U4QA 2AN1A 2SHKA 4IV0A 1SB9A 4ZDWA 5CD1A 3C5WP 3EEOA 1T8YA 4EFKA 1QH8B 5LP6C 2F3SA 4S0ZA 5J2UA 2IPXA 4GO1A 4X3OA 2GK6A 4FYMA 4BP1A 1ZMXA 3BGIA 4D56A 5BOSB 1A98A 4HYQA 2AR7A 2AMVA 1IE3A 3MCWA 1ECJA 4HADA 2ZTVA 3T52A 4PCAA 4UNPA 4KPUB 4DLWA 4LY3A 3H5OA 1E2JA 4DRYA 4JOQA 4TSRA 2A57A 1N57A 1NUAA 3OFNA 3I1JA 5CX4A 3ZU3A 4I1SA 1ZM4A 3KQVA 5LNK1 5B7NA 1GLVA 3PFHA 4RA6B 2JAXA 3TD2A 4DR7B 3GARA 4KFRA 3OFKA 3Q7EA 3LCUA 5BQPA 5B3AA 2RC5A 3NJ8A 4MQLA 2GHRA 1Z6TA 1JTVA 1GFSA 5J2UF 2B30A 1I9CA 3GPDG 4O4HA 2EVWX 4WCFB 1TAHA 3CLHA 3RFUA 2VDJA 1F2UA 2WHRA 4D3ZA 5AVWA 1OMOA 1DKQA 4WFIA 4A2WA 3LWZA 2PX0A 1URPA 1H6AA 4FONA 4IO1A 1F1JA 4Z2YA 5ADHA 2Z4RA 4L5BA 3UKJA 4AF7A 2P2YA 4U5QA 1MAAA 5CDYA 5F78A 2UUPA 1X1CA 1SJ9A 3GRAA 4PXAA 4BLTA 1UXJA 4KV7A 5IJXA 3IPAA 5KX5A 1UBLS 4K26A 5KYYB 3NH6A 1Y8CA 4HRVA 2HT1A 4GBED 4NE9A 3ASUA 4LX8A 2OV4A 3FFWA 3KZKA 3RGGA 4B6EA 1JQAA 5DTQA 3GMDA 3OLQA 2UAGA 1G20A 2Y1LA 4MW0A 1NXWA 1L7OA 1WIWA 2BH9A 3DL7A 4LOAA 5EMJA 2F4NA 3EQ7A 4IIUA 5AXBA 3BMQA 1ZW1A 1GUDA 2JCXA 2HF7A 2VI5A 1W2WB 3C3JA 2YIJA 3NG1A 3WDSA 3WOVA 1TU4A 1ZG3A 2PZMA 4UFOA 3QKWA 3TQFA 2EXXA 3N8KA 3WV4A 4P0PB 3EH1A 1YB1A 2JCVA 3VU9B 2ZU0C 3P9QA 3N6XA 1C1YA 4OUDB 5KX5F 4DHEA 1AKEA 3WLFA 3IIJA 2IHNA 2QORA 4NSLA 5IUJC 4QUHA 1ZGGA 5TIIA 5DXFA 2ZXUA 3DEFA 4FJ2A 2FU5C 3AC0A 3DTVD 4JBLA 4G1EB 2DM6A 2X7HA 1T4DA 1UZNA 5LLDA 2B6NA 5DWVA 3JVIA 3A10A 4HH4A 3BJEA 4RA9B 3G2MA 1U8UA 4FI3C 1L1FA 3WZMA 2O1SA 4GOLD 3ZGVA 1KRWA 3LWNA 4EMSA 4R98A 1THZA 5FPPA 5HW0A 3IBYA 4MA5A 5KNDA 4O3MA 3AGQA 1ULHA 2NNWB 3LA6A 4II7A 1FYXA 5SZHB 1OYOA 1N6PA 5KPDA 3CMCO 2WMOB 1TEHA 1KYWA 1SH7A 1UZAA 4EAAA 1MX9A 2ZSBA 2DEUA 1SD5A 5DM4A 3U48A 3CLRD 2X6RA 4QEDA 2YIMA 5KPJA 3I4CA 4DIBA 4RU1A 5MFPA 5AJUA 3T3EA 1Y3HA 1YC2A 4TXLA 2HNAA 3K6KA 3ILYA 3Q11A 4ZANA 1GWNA 3CNNA 3OLYA 1KMNA 1M9NA 2VSNA 4NS4A 5EYPA 4DZZA 4TV9F 3VKWA 2Q6TA 4F5WA 2IXAA 3G5LA 1V1RB 4PLPA 5BWCA 4S1OA 5H9WA 3FKJA 3RJ5A 4Z54A 1M5RA 1DG9A 4MRNA 2YWXA 4PCUA 2BJWA 4NSNA 3IMEA 3ETHA 3RR2A 2UZ0A 3RVMA 2OAQ1 1U80A 4Y0AA 3UOWA 4NYJQ 1ECLA 3JTEA 3K16A 2DUJA 3VO2A 3O1HB 3OEYA 1VM6A 1HDGO 4HGOA 1K2VN 2QPAA 3SHFA 3E1KA 3H2HA 1BCRB 1PFYA 1VLMA 4EL5A 1A7UA 1KARA 3QEMA 3R9KA 3JALA 4LJ9A 3TS1A 4HDMB 1M7BA 1O8CA 4WVLA 1EUQA 1Z75A 1FX1A 3R9XA 2EEZA 3AGPA 3H2SA 4FN4A 3JR7A 1M2GA 3ZLVA 4HDSA 3MCTA 1FMCA 3WZ2A 4NYIQ 4HNRA 1NM5C 5CIYA 4TMYA 4N4AA 2HL6A 2QN7A 1Z34A 2H5LA 2R5WA 3MRXA 4QC2A 4ZP1A 2N42A 4U1RA 2QRJA 4DDWA 4MIKA 1FJXA 3M6UA 2XQKA 4CU2A 1M67A 3DG9A 3MFQA 1ZM2A 3O95A 4KAXA 3O7MA 5DM60 1N4AA 2IWRA 5WRFA 1FQWA 1QYRA 2ZSJA 3DLTA 4JYPA 4HP8A 4R1QA 2IYRA 2NO9A 2XTAA 3I9LA 3O8QA 1LPSA 1PT9A 1ZNWA 2JVJA 3O2SB 2H1IA 3PEFA 3UHJA 4BO5A 4UM9B 3GLKA 4M0LA 1L7EA 3TBFA 1ZICA 2ZQ5A 4UFPA 3NBQA 2NZ8A 3IQDB 1TUGA 1XA0A 1VDZA 2QAGB 3BH0A 1XTVA 2XCLA 3OIWA 4KN9S 5FOWA 4AY2A 4C0AC 4GC5A 4L4ZA 3IH5A 4KPUA 1OILA 4NOLA 4ERXA 5BVHB 2VRCA 4RKRA 1C8VB 1GKLA 3F71A 1IONA 4K46A 2ZUTA 4TRJA 3SDSA 4CKWA 4EQZA 5AUQA 3E7PA 3TSCA 3E3LA 1GN8A 3EZ7A 3LX8A 2J4CA 3VKGA 3FPFA 4C7XA 1Z16A 3W8NA 1K8QA 1RTKA 1FVHA 1HDIA 4DMRA 5I9BA 2CV2A 3H7AA 1KP9A 4X0EA 4JJ6A 2J0VA 4MUJA 1FSFA 4M6WA 4URWR 2QEQA 2ZI5A 3PC8C 1UL1X 4ZI2A 2FQ1A 3CHYA 1GGEA 3Q6MA 3RKRA 1CZRA 4WW0A 1FFGA 1A7KA 3H6HA 4P32A 4Q7MB 2WHYA 1AKWA 4HXGA 1E8NA 5KWEA 3AJEA 1SIOA 2QSYA 1L3IA 3NAMA 3UA3A 1X14A 4HD8A 1NQUA 1GTL1 2C5GA 2HA4A 2IZ1A 1JLSA 2O0KA 3GHHA 2BL4A 3DDCA 3H1EA 1Z28A 5H9VA 1WXQA 5TGTA 1F6BA 1VJ5A 4KG7A 3W6OA 1CX9B 2D2VA 2FMHA 4QELA 2W6JD 4FCCA 1D4FA 3H9JA 1NOKA 3SZRA 4ZA2A 2IL1A 5AOAA 1JFTA 4IKEA 5DRYA 3CIFA 5CDFE 2BF7A 1KDVA 1N92A 4AS3A 3I8OA 2FGKA 4MRAA 2VZ8A 4H0CA 1I51A 3FGOA 3CH5A 4MA0A 1W1IA 3V7NA 4OQLA 3HCCA 3BC1A 1L4LA 3CFYA 2WFAA 5CLLA 1TF7A 2G80A 5AVVA 1PL0A 4ENTA 1KI1A 1ACMA 1ML4A 1X87A 5LUBA 3U4HA 3W3AD 5LQCA 1P5JA 5DCWA 1CETA 2FR8C 3H84A 1AUXA 3EPPA 2BM1A 2OO5C 3NGMA 5EIBC 1DCTA 1CRPA 1E92A 5IZ4A 9GPBA 2QZSA 1WXWA 4MZDA 3F5DA 4KRFA 4P5DA 5EJ2A 2ONCA 3ZD8A 1MQ9A 2YWGA 3N87A 4R41A 1YUMA 4JVMA 5CLQA 2PV0A 2G06A 1A7JA 5EIEA 4CM3A 1YVUA 4RHEA 1GGKA 1JPNA 4MWSA 4X5OA 4HVTA 3LXUX 5BT8A 3HCPA 5KYUB 1PG2A 4KB5A 4BVFA 2VTDA 2WNHA 1U9YA 2PMBA 3QTLA 4KIGA 4H16A 2HRCA 3FWPA 1H8HA 4LYEA 4CJXA 3MINB 1Z4JA 4N0DA 4BWVA 3DHVA 1UMDA 5K3AA 4MTCA 2G1JA 3ZLUA 2P78A 3CUTA 4J29A 1U8AA 3U13A 3G8CA 3EXG2 1K8ZB 2UZIR 2ZE6A 1YE3A 4EHLA 1KZYC 2R25B 4YY3B 1V7QA 3TIGA 4BLWA 4D9IA 2V7EA 2E5FA 1DIOB 1QGDA 3AERB 3UMVA 1EVIA 4M9XA 1JG2A 3IELA 4MV0A 4OK3A 4UU8A 3WFJA 1A9RA 1U3WA 5E0KB 1Z17A 4BP9A 1GT91 2KB0A 1FDTA 2ZYTX 4C0WA 1U0OC 1U7TA 3ABRB 3U16A 5F2KA 1X8JA 4OGWA 2R6ZA 3KUDA 4OP1A 5IABA 5KNBD 3FRHA 2Y4OA 4Y7DA 5FTJA 1TGVA 1B8UA 5G02A 1B8OA 1RPNA 3G1TA 3R3ZA 1X1EA 5EUQB 4PYLA 2QAJA 4H3KB 5TT0A 3BJRA 3GAAA 1X7YA 2R84A 3NYQA 4ZOLA 3GV0A 3A7DA 4EQ6A 3QTBA 3UM9A 3CUWA 4GL4A 3U80A 1Z2CA 1NI4B 2EGUA 3AFOA 1KFEB 3VGPA 4BX2A 1ZDMA 4F85A 2NZ2A 3OQJA 3JAWA 1VOTA 5TNXA 3GBSA 3KT6A 4O33A 2R4UA 3CH4B 1GL6A 4IJVA 4KFTA 3R8FA 2BUCA 1LSSA 2QZ4A 3T99A 1R16A 3ZK8A 4G0OA 2R62A 1KZ7B 2AYYA 4JS0A 1U1CA 3V4ZA 3MD0A 2PWPA 4MV4A 3EXHC 1G5HA 1DKNA 3MLBA 1K62A 3I83A 3SMVA 3NB0A 1RLMA 3N76A 1E58A 3OCVA 1HE8B 1ABEA 3ZZ1A 2ZRCA 4ZKEA 1UPTA 4DC0A 5JZOA 4HX9A 1DEAA 4V39A 1U9ZA 4YAUA 1HY0A 4OP2A 4XRGA 1XTPA 3M3HA 4G5OA 4IFBA 1WSAA 4G0MA 2PKCA 5KSYA 5FB3A 2PRKA 1M6WA 1R3UA 2E1RA 2F2TA 3DFFA 3I73A 4CM6A 3BL5A 2OD7A 2YS6A 4QYSA 3MIZA 4XIYA 1KO1A 3GNLA 3I12A 2F64A 4QXMA 3UQZA 3PFWO 3ZV7A 3D4BA 3ESXA 1ZD4A 4D82A 1Z7GA 1TMGE 3HQ4O 4HB0A 3KSBC 2MHCA 3CA8A 3T4EA 2X42A 4MHTA 3IV7A 1V71A 1IK4A 1GYRA 1QIMA 1K5HA 4J07A 1WV0A 1N0HA 3REQA 3LHSA 1D2EA 2QAGA 4TYMA 3ZVKA 1UWKA 5HVNA 3KPVA 3CW2A 4Y6SA 1TVEA 3PUKA 4TYQA 1PK7A 4UZSA 4EYKA 2Q5HA 2JJMA 1B6RA 2O5RA 1P0MA 2JEYA 3LFHA 1ONNA 1SG0A 2IHYA 2WU8A 4YVFA 3VOTA 4ASUD 1PR2A 3S1AA 5CA1B 5F2NA 3FWYA 5LQRA 4TLCA 1ZM9A 4WL0A 4JYMA 5CDFA 4D9EA 2WM9B 3IJ5A 3HP7A 3CN7A 5B1DA 5BRJA 3GWGA 4P4NA 3GDOA 1E7SA 3IKVA 1CQXA 4ZV7A 4C4YA 5ELXA 3FWZA 4D0LB 4R2KA 5K0SA 4RORA 1AZTA 2IBMA 1I30A 4AKSA 2YUIA 3LUDA 4GS5A 4ILKA 4QOFA 2P2GA 1VYUA 2YZGA 4B0PA 1SVMA 1H3EA 3AKDA 2PJZA 4KQ1A 1JH8A 4LISA 4JP1A 2HXYA 3A6HA 3T5CA 5HK9A 1N78A 1L6IA 3CZAA 1E1RD 4HDKB 2X4LA 4OM7A 4XB2A 3EXAA 5EWMA 1T9GR 1VMKA 1W34A 1HEIA 2JBAB 1A1SA 1JIUA 3MJEA 3DOCA 4MDYA 5ALLA 5JJBA 5BUZA 1F5NA 2EQAA 4BMSA 3FHJA 3OLCX 3TTTA 4X7RA 2PEYA 3RIMA 1ZHHA 3VU3A 2CXUA 2E0IA 1GZUA 1VIVA 3OCUA 4PSDA 1FMFA 5HF8A 1P7ZA 4KL8S 4N18A 4RHUA 2OQ2A 5J5AA 3T1TA 1VC2A 2RHHA 1Q50A 4QGFA 1V9SA 4E31A 3P2JA 2AW5A 3NORA 2QXYA 4JB2A 1E1LA 4P5EA 3VZBA 3GLGB 1PF7E 3L40A 3MRSA 3ACDA 2WM8A 4EI9A 1YZYA 2B20A 2O8CA 3COSA 4M87A 1T29A 1Z6QA 1V47A 3S7TA 4EI7A 2R8BA 2E82A 3DZGA 2GVZC 3LO8A 1N75A 3G1UA 1HC7A 1WDWB 2DPGA 3ROFA 4BMZA 5KOYA 2RHOA 1UT8A 4FGZA 3S2ZA 2GJSA 1T4MA 4BVHA 4Z1MD 4MHSA 5DI3B 1LVGA 3RRXA 1PRYA 5ILGA 3LRTA 5FO0A 3H1FA 5A2GA 5JXHA 1C9NA 2O2YA 2CE2X 2PFKA 1SXIA 1SXPA 3IE0A 7ABPA 1OBVA 1Q20A 5DN9A 3ZHXA 2VS1A 4RKQA 3AUKA 3WLOA 2QOEA 3K4QA 1U7ZA 2HSZA 2IYUA 2VJYA 4INPA 4ZQGA 2CHGA 3NLLA 1U9JA 3EEBA 3TB4A 1K9VF 1IMOA 3WIVA 2QF7A 5IM4F 5AICA 4DGSA 2AI2A 4GM1A 4WNIA 5FTKA 1Z63A 5EEGA 3JAKA 2QX8A 5A1JA 5E1DA 2RB4A 1WMBA 2C4UA 1ACLA 1BEZA 1EFRA 1WCV1 1B16A 2VP5A 3WYBA 1TEZA 3FPAA 1FP1D 3LUAA 4LZJA 4W1QA 1Z5NA 2RHGB 1OB5A 3PD1A 3QKTA 1ZS9A 1HNXB 2ORED 1E9CA 4B85A 4BVGA 1IAQA 2PHZA 1P31A 2PRYA 3H11A 4FT4A 3TXYA 5GVRA 2AVDA 2WPDD 4G07A 5KVSA 1J0XO 1UJBA 5KJCA 4PLYA 5ARCA 5B12A 2PLFA 3FUWA 4CE6A 1N33B 4Q7EA 4P7KA 1XMPA 3BKWA 1R4NB 1ZNYA 3U1BA 3Q5EA 5CCEA 1Y3DE 4UDYX 1GQQA 2GJAA 2J46A 4EPXA 1N8NA 4H6WA 1CLUA 4J0CA 5DDIP 8GPBA 1A97A 4MW5A 1OZFA 1G21B 1FZQA 3CSSA 2LXNA 4L22A 4PLCA 1J5EB 2IOFA 4RF3A 3P2YA 5EPEA 3ZY2A 3P9YA 4C0XA 2CLEB 4ZV9A 3H2GA 3LYAA 1RM5A 3QVWA 3AIKA 4WNAB 4DMCA 2XYRA 1HY3A 1UZLA 1T5TA 2CL7X 2NZVG 5GONA 5LXTA 2QU8A 2Z5FA 1KETA 3AONB 3KPYA 4K7JA 4QPNA 1O5OA 2C20A 1IBLB 3OZUA 1AD2A 3AZOA 1JG3A 2VFAA 2YVQA 2H1VA 1OY1A 2CLMB 2BZSA 4FX2A 3VYSB 2J1LA 1XRSB 2BFAA 5SZKB 3K35A 1V5GA 1T9KA 3TTVA 4DLTA 3O0DA 2JJ1A 1HDRA 4UVHA 3VPBA 3QMVA 4CZ2A 1MJGM 3E5MA 1U5BB 4HNGA 5LYYA 3NBYC 3S8EA 3N9IA 1LC3A 2GBCA 4WIAA 2D0OB 2GD6A 3BGDA 1G1AA 3D4OA 4NBVA 1M2KA 5JNWA 2GDZA 1OJ7A 4BWGA 3W5IA 1N1EA 5F7ZA 1ZYUA 4GLFA 5GONF 4Y6OA 1ZD8A 4X95A 2RI0A 2IITA 1P0FA 3R6QA 3F3KA 3KPJA 3Q98A 4YRDA 4RZXA 3WO1A 4DRZA 1JR3D 2EATA 2NGRA 2PLAA 4I9FA 4NYJR 1GVHA 4X24A 2ZCJA 4OXIA 3Q8MA 4F3TA 1YUNA 1FP4B 1R8QA 3GUHA 1NVMB 2PQMA 3M81A 2PBRA 4HLUC 4JQOA 1R6TA 4UDNA 5BRAA 2PT7A 2X58A 1OX4B 5GIPE 1KVUA 4NDNE 5LPNA 5HJ2A 3DOJA 1RC0A 1VJGA 1E18A 2AEJA 4GMXA 4BCCA 2ZYIA 5C7OO 2AMFA 1G291 3WBBA 2JVKA 1GFZA 1TZCA 4H1VA 2H5EA 3SC6A 3T0IA 4QJ3A 4JVNA 3C4QA 1A2BA 5IMSA 5LIPA 2RH5A 1NV9A 1IULA 1HLFA 3CY6A 5ARBA 4HLDA 5B1HA 4JGIA 3P9PA 4B09A 1PK8A 3CWZA 1T9CA 3QKSA 4JLNA 2VT6A 4UW9A 3BM5A 4LRUA 2V9PA 4MJ7A 2XSZD 3K2EA 4LWPA 5AESA 5A0VA 3SCZA 3K9CA 2XOXA 5HUHA 3KXKA 4M88A 4L9WA 3BIJA 1IG3A 3Q8WA 5HILA 1ZJ4A 4C6RA 3IEXA 1E3QA 1JALA 5K8CA 2JAUA 5JC8A 3CNBA 4YRTA 2V03A 3SR0A 4YN3A 5MHTA 1OKKD 1DFIA 1V11A 5KTTA 4J7AA 1MNQA 2RJNA 5L4NA 4JENA 1KY3A 3I53A 2RH4A 4UTRA 3PGLA 3PPWA 2WYVA 2VWQA 2YWDA 2FSFA 4NIMA 2Q1WA 2ZVPX 1EP9A 1YRAA 2GA9A 4FBMA 3AF3A 4TLEA 4LF9B 2I4NA 1J4AA 2HMAA 5AVQA 1XPRA 3FYCA 1QB8A 4ZHQB 5CG1A 2IJGX 4O2BB 1F48A 2FK8A 5BR8B 1G6OA 4YCSA 1WEKA 1XZPA 2XE7A 2Q27A 1U0RA 2VJLA 4ITRC 4L0DA 2I34A 4E3WA 3HXQA 5CM9C 4YT2A 4OM8A 1SQ5A 1SU4A 4HFNA 4YP0A 2ERCA 1VLQA 3PFGA 1H8EA 4KMOA 4RIGA 4NCIA 3W5UA 4D43A 3JASB 3KQTA 3ER8A 3RSOA 3X43A 3L84A 5EVJA 3WMEA 2PKQO 4MKRA 2JLYA 1J25A 5F1KA 5IVKA 2FRXA 1XQWA 4RVDA 3HA5A 3IVCA 5CXXA 4CT4B 2BEJA 1NJSA 5E3JA 3RYFB 3TSZA 1BW9A 5KNLA 1E2LA 3HSKA 3NKFA 5JNSA 4RLQA 2Y1XA 4BKRA 2OCBA 1W1UA 2KSQA 2FZVA 4ILEA 3LKDA 2CUTA 4AIRA 1PWEA 2G08A 3N2LA 1VG9B 2WWXA 4CM1A 2VTKA 1B15A 4IHJB 4WXRA 2ZUSA 1G8FA 3JSXA 3P0FA 5ETJA 3ZHQA 4CKCB 4MDEA 4GKKB 5CPBA 5BXQC 1KEEA 3AVXA 1Z08A 5DE3A 1JPJA 4GQBA 3C87A 5DIZA 5FTNA 3ICOA 4L8WB 3I92A 2HCJB 1P39A 2TYSB 3O5AA 4K9KA 2CNKA 2WJPA 3EGWA 5KWJA 1B26A 2YHSA 3TSOA 2VNSA 4EH1A 1DHTA 3FFBA 2GZRA 2E6UX 3WWOA 4RTQA 2FR0A 4MCAA 2NSYA 4N6GA 2EWMA 4XDZA 3H2BA 1YF3A 4JI2B 4E12A 4Y9TA 4HPWA 4TMXA 2DSTA 5ICMA 4EBBA 1U31A 5HQ3B 5CGQB 4PPYA 4QARA 4QDKA 1K8YB 4HDCA 2A4MA 1VHWA 2PZLA 3BDIA 2IU4A 4W7HA 1M1XB 2A9PA 2IE0A 2VT2A 3BGSA 4FDUA 5I7AA 3F7MA 2PBZA 3I6MA 4XAQA 4ZCPA 3CLSC 2H29A 2R11A 2CVFA 5AVXA 4JB0A 1KZGB 4L07A 2F1JA 3H5TA 4LGYA 3OC0A 4M49A 3LPAA 1SUEA 2NUPA 2Z1NA 3ESYA 2DYKA 3ZHYA 5K0TA 2QNRA 2JFVA 3NHKA 3PB3A 1V41E 3R6WA 3T3HA 1E3JA 2JARA 4I1PA 2OOSA 5FUXA 1D2CA 3UT5A 3EF0A 5HP4A 4OSEA 4NXNB 4MHOA 1PUXA 1FPMA 2CNDA 4AKHA 2AC7A 2ZROA 1GJRA 2VQEB 1SRRA 4U63A 1Y1SA 2ZGVA 4LJ5A 3GOHA 2EP7A 1TAQA 2PO7A 4NH4A 3GHYA 5G0TA 1RM0A 1R0LA 2EV9A 2G6TA 2PGXA 3AFGA 1HZZC 3NCHA 1SNYA 3WQSB 3CJTA 3C6QA 3EY9A 4LDZA 3MCVA 3R77A 2J9RA 2DB3A 1WKBA 2C0QA 1H05A 1DX9A 1I2ZA 3LTEA 4KREA 1UBGA 1Z2PX 2QX7A 1KQ3A 1Y7TA 4UDXX 2NV2B 3V1MA 1ADJA 4C30A 1JWAB 3I9FA 1JDUA 3GLVA 1EK2A 2P9CA 1G6Q1 2IXFA 4RHFA 1CRZA 2VUIB 1KI8A 4RAQA 2BELA 4PNZA 1UC9A 4R68A 4LFCB 3ZVLA 4TXMA 3BAFA 3CU5A 2YVKA 1EDOA 1FDOA 4KWCA 3FF1A 3H9EO 4LJSA 4PAWA 1JHPA 1CS0A 1PSWA 1IWBB 3AVPA 1Y8QA 4H7HA 4M0DA 2IQIA 1MNAA 1DTWA 1F0NA 2EL7A 3TQRA 5JDCC 1LD3A 1SCNE 2VDLB 5TB5A 3S29A 2Q07A 5DHPA 4G81A 1E6UA 2H2HA 1QFYA 1GPDG 1XVVA 3JTMA 3O4FA 5FTLA 2Z3ZA 4A6EA 1G6KA 3SXPA 3D4LA 3NV7A 3OJOA 4JEMA 5CITA 1M1NB 2B37A 2HY7A 4QYXA 3U7IA 1KXZA 1T0BA 3ID6C 3QE9Y 1ZK4A 2AWNA 3FGNA 1II0A 3AOEA 4FTWA 4LWQA 1E3SA 2AZTA 2GX6A 1K1EA 2PGLA 3DFMA 5CUQA 3W90A 2QHXA 4C05A 5IHXA 2JK1A 4IIJB 3VSBA 4NFLA 1BX1A 1UJMA 3F6EX 4XDHA 4LJRA 2Q3MA 3NTRA 1RRMA 5HWSA 3I62A 2GPYA 2Q9CA 3AP3A 2IIVA 4QLOA 3T0GA 1EBBA 1ZUHA 1O0BA 1P61B 2X1LA 2AK2A 5TPZD 5K0BA 1SVKA 4EHAA 2ATVA 3I9KA 2FMIA 3LVBA 4ZODA 3M8KA 5SZIA 4V0SA 3UXEA 3R5KA 2I1QA 2OB1A 3DD5A 3OMWA 4IGEA 4BTLA 3C7CB 2GHIA 3EDRA 3C5HA 2AE1A 3HXPA 5KSZA 3Q7TA 2HLDD 1ESZA 4S2UA 1MH1A 1Z6XA 1GSOA 3ZDRA 2WJIA 1FJHA 4ZHQA 3H83A 4O2BA 3J80A 3DT8A 3HL4A 4ND3A 1HEYA 1L7DA 4MUEA 5AI4A 2B92A 3A6JA 2PMCA 4MQEB 4XPIA 5A7FA 2SNIE 2K7FA 1G64A 3L7OA 2OC9A 2VJMB 4B43A 2V7GA 2IDKA 5IK2A 4GYWA 1JEYA 2OY0A 2UYQA 1QGED 4EPVA 2ZB8A 4ZIRA 2H57A 4OEHA 4UUBA 1S1MA 4KRGA 4HGYA 3PQ6A 1B0AA 4HUQB 4XQCA 2EEPA 2L0XA 1T36B 2Y76A 3TLGB 3TGLA 4YT5A 1X92A 3ESBA 5EXXA 3WHPA 1HE5A 1O87A 1U9IA 2EP8A 3NWBA 4LN1A 1AO0A 1KZ1A 1I5RA 4UXJA 3F73A 3H1PA 3AIMA 3N0RA 3ND5A 2I6TA 4RABA 2RK3A 3TRKA 1EVZA 2W6MA 3D1LA 3ES9A 4PX3A 3H3FA 1R9NA 2IHBA 1DRKA 3KTAA 1O58A 2ZRDA 3DO8A 1BXRA 3DXFA 4Z9YA 4ZARA 4BLRA 5I45A 3DR5A 4DR5B 1EHYA 3QBEA 1AUOA 1MUUA 3AETB 1FTYA 4RLHA 4IILA 1PJ4A 3OE7A 4UBIA 5CT4A 5F3DA 3GD7A 2H7VA 3OJXA 3VR6H 4KITB 3G9TA 1ETUA 1CYDA 2BRUA 2UKDA 3KEQA 1WSBA 4MCIA 1OHHA 1W0JA 1W48A 2WIKA 5HGJA 3RB8A 1HTWA 2F00A 2OP1A 2QP3A 3KDSE 2IDMA 2MYUA 2C54A 1KJJA 3LBAA 4L16A 2BUBA 4AECA 3K70C 3VSCA 1Z2DA 3UOGA 2YZMA 4BB0A 4DAOA 2GCOA 1RR6A 3QFRA 4H9GA 2PV7A 2C77A 5A3VA 2W2OA 1R6AA 2RGNC 1YWGO 4BAGA 4CCSA 5A5VA 4V1CB 2ZM6B 1NN3A 3FR7A 1GSIA 4TTTS 2YWHA 3CCBA 3JR3A 1MD9A 1EVYA 1YJ8A 4M8KA 3DLCA 5JDIA 3R0QA 4BO3A 1G5FA 1WZ2A 4J75A 3VFDA 4IQ4A 1Q7BA 2V7VA 4HVAA 1GZ5A 3GUVA 5BNIA 1GG2A 2CVZA 5DCYA 3HB1A 4GZ3A 1CY4A 1CU1A 5B4TA 3CZMA 5HRAA 2QE7D 1BC5A 1TLTA 4X71A 4CM7A 4CMKA 1X80A 1I36A 1P2SA 3RUDA 4XYGA 3SHOA 3TM4A 4YMIA 2P69A 3CZRA 3O3NB 1KSJA 3Q3GE 2HNBA 4DJTA 1FU7A 4XGKA 5B2EA 4OK6A 2FP4A 2I22A 1PJRA 2H7XA 4M86A 2KHZA 3UT0A 3KR2A 3MQ4A 3LC7O 3V46A 5ITSA 5LIRA 2F1IA 3AUFA 2HHLA 1BRTA 1GZVA 1OVMA 4C4RA 3AI7A 1B0PA 1T5DX 3LY7A 3CI0K 2DQ4A 2I2WA 3QX8A 4BWFB 1OIVA 3E03A 2ZSEA 2AD5A 4QGSA 5JMWA 3U09A 1IBRA 1WZEA 2BBOA 1QZTA 1ICIA 1Q0UA 2D1QA 2DKOA 3AHJA 3ZE9A 3RV3A 2X5NA 1XKXA 3P27A 1DKUA 3OZXA 4RYDA 5KTPA 4EA7A 1Q16A 5DSTA 3KKLA 3IRUA 3RD8A 4IAOA 1AKMA 4UD6A 4WOBA 4CQMB 2BFFA 4DR3B 1Z8DA 2CB9A 2B94A 4CTJA 4ZAZA 2A0UA 3A27A 3BULA 3NGXA 1PUIA 2EW8A 3TZKA 4WJLA 2VK2A 4CKXA 1R15A 3L6BA 3GFPA 5DYTA 5ALZA 4L51A 3VR2D 3CZQA 2ZAOA 4WAUA 2IW1A 5HKAA 3EFHA 3MOSA 2OV3A 1P4GA 2R6JA 2Z2JA 4R2WA 3PDWA 2PKEA 1OBCA 4MZXA 3MJRA 1QS0B 4RFSB 5JFTA 3GJTA 2K5UA 4O1IA 2FAXA 5ESRA 2O8BA 1NF9A 5SYNA 1RZVA 5IASA 3KR9A 2RAVA 3HJNA 1OBFO 3EZLA 3MYRA 2O6LA 3KYDB 1IHYA 4G25A 3OP1A 3CVUA 2VZEA 3EFBA 1I3MA 2VDOB 3WSWA 1IZ0A 1YA4A 1T2UA 2G36A 4AJ9A 2PKRA 3EULA 1IG0A 3OO1A 5BW6B 4KR2A 1PAUA 2WYHA 3GXBA 5JZVA 1C3XA 3SSNA 2G40A 4RJLA 2Z30A 1O6CA 5AHWA 3AB8A 5D85A 4DHWA 5BQ3A 3MMXA 3IQFA 1TA9A 4YRGA 1EK1A 1F2TB 2AFRA 3TECE 3TOCA 5AHOA 3TBKA 5AJTA 1X7WB 1MRNA 1UC5B 1LEHA 1E69A 2OILA 1CW2B 5ARDA 3ZI0A 3INRA 3OJWA 2CCJA 3O03A 1V1JA 4A2CA 4DSOA 1D8TA 3SX4A 4PC1A 5ER9A 3ZE6A 2Q5IA 5AVYA 2DLCX 1H0SA 1NQOA 4KQJA 2DFLA 2NXEA 3RSHA 2HA3A 4FCTA 2B69A 3KVVA 1XUOA 4C9BA 1D4AA 4BO6A 1T8PA 1SXJD 4RC9A 1N2JA 2XWPA 3DMPA 3PX2A 1VBFA 2R8EA 1NSTA 1A0OA 2YNMD 1KH2A 3DAPA 4Y1RB 1BMTA 2C4HA 3R3SA 5LQJA 4JYZA 4L4XA 3QXSA 3WSVA 2B4RO 3EIEA 1CJVC 2GAJA 2VHQA 2PSHA 4GI7A 1K3TA 1ADCA 1DX6A 3A9VA 4MLZA 4DJDC 5A3SA 4F2HA 1I1QB 3DCIA 3NXKA 4TMVA 4DQDA 2INGX 3G0BA 4QOIA 4RXUA 1XKQA 3D6HA 3ZCTA 1JRLA 2LRHA 2X86A 3KOXA 1JHZA 1SUCA 4X1IA 4FFBA 2ISCA 1USKA 1Y4SA 3KTFA 4JU9A 2WA2A 1E5TA 4LDQA 2AUTA 4GMHA 5EPOA 5JNLA 1XNQB 4YMHA 5JAZA 4D02A 2JGLA 4CQJA 1KTIA 2CDRA 2POQX 3JY6A 4R1PA 2HB6A 4XIFA 2J32A 6REQB 5JBQA 5HOEA 1GPUA 2VBFA 2ZRQA 1RYDA 4XGNA 3FZGA 1BEEA 4ZCIA 4EM6A 1EFUA 1R9JA 4PFJA 3OU2A 2FPXA 1U9CA 1CF9A 3ZX5A 1HQCA 1NPDA 1XCPA 2WZQA 2YWJA 1QLHA 3FD8A 4BCBA 1KY2A 2ANBA 3MD9A 4N0MA 1YI0A 3ELBA 4D0RA 5JZBA 3ZVNA 1FFBA 3AM1A 4XEHA 4XE5A 1R5NA 3FHTA 3F2VA 5KAMA 1PT5A 1BHO1 5LA6B 4ARVA 4WKOA 3E7WA 2MT9A 3HLYA 3MQ2A 4KRYA 3L92A 2X8JB 4BV2A 2QZZA 5MGBA 2QZJA 5C1PA 3GCDA 4YNBA 4BB9A 1SU7A 1RACA 3IEMA 1BSVA 2XUGA 1AE1A 2ZATA 4XARA 2O6HA 3D5QA 3TSYA 5A06A 1V2GA 4R2LA 3KQUA 2R86A 4UCFA 1QIKA 3ECSA 1LX6A 2O8DA 1V9LA 4HEA6 3G89A 2HEIA 1IXYA 4FIDA 1C1XA 4FSDA 3ZDQA 1N3LA 4HEHA 1EK6A 1OI3A 3ZWOA 4FFNA 4CLEA 1Y3CE 2J0UA 1OREA 1DKOA 1Z37A 5K8JB 4YJFA 3C3CA 1KKLA 3AH8A 4BB6A 5DT2A 1SC3A 1ORIA 1SKYE 5E4YA 1R64A 1W6RA 2QV0A 3RU3A 5CVJA 5TQ2A 2X8WA 2CD9A 2UYCA 3LTNC 4NF2A 1XYYA 4OA5A 3RVKA 4KAJA 1DJMA 1A5BB 3HE3A 4OATA 5DO9A 1LB1B 3CO0S 5I7EA 3K6SB 3C74A 5CXUA 4XQEA 3RHFA 1ISFA 3WQQA 3KEOA 1P2DA 1M33A 2BGKA 4J0DA 4G63A 4X8OA 3VC7A 3R6TA 2C99A 4FWIB 5KTRA 1DCKA 2V74B 1YZUA 3COVA 4RV4A 1TCUA 4FHDA 4RMNA 2P1DA 2QN6A 5ADWA 4BV3A 4UUAA 2R8YA 4BL5A 1AU9A 3BJIC 3G2OA 4Q4DA 2CD7A 4DXHA 4H0NA 5E2IA 1FQOA 2JD0A 3ROKA 4TV8F 4BGUA 2HUNA 2ZIAA 1NVDA 1V6AA 1W5BA 2QVBA 3LC2O 1U1GA 3IR5A 1VBNA 3K0AB 5FNVB 1V8BA 2JFNA 4GOXA 4WK4B 1JAIA 1OD6A 1SBIA 2ADOA 2VIIA 4AJJA 3UWPA 3HJRA 5KNCH 2B8EA 3LP6A 4EPWA 3P52A 2OYRA 3QHPA 5CAEA 2PCLA 1USGA 2OMEA 4FEAA 3FPJA 4GE3A 1JIQA 2HCFA 4WFJA 5AVKA 4C7KA 2VHVA 3TX2A 1UP4A 3QUBA 4UTOA 1IN4A 1AKRA 1YGPA 4GLJA 3SP1A 4EECA 3KC2A 3UK7A 5ES4B 3W5VA 3B89A 3ND8A 1BHJA 4JWKA 4FM9A 2JCGA 1NWCA 1A9OA 5ALNA 1TE2A 3GJ8A 4MGZR 3AYZB 2QLMA 1EZ1A 1O95A 4AXBA 4DWVA 3A36A 1VE3A 2IOFK 3D6MA 2GLUA 3HPRA 2O2IA 1OE0A 2WE8A 3WLIA 3LK7A 4FKZA 4H77A 1RXCA 5FWDA 4ZAXA 1I0ZA 1AGRA 2VHJA 4AI6A 4DA8A 4DV6B 1WL8A 3QENA 4G01B 4NARA 4OY3A 1T4CB 1SOVA 4MVJH 2P6UA 2FUCA 5ED0A 4WESA 3GFSA 1YOBA 4LKRA 5AH0A 2BSAA 2P8SA 5TV2A 4QPCA 2YL2A 4TT3D 2FE4A 4EUHA 1G5QA 3JRNA 2C2GA 1TB4A 2VPQA 3G2KA 4KXFB 2C9CA 1LBSA 3LA8A 2JCBA 3WFZA 4DBVO 1UANA 3TFOA 3S5JA 4M0KA 5CLIA 5EMHA 1PK9A 2ERYA 2ORIA 3GLHE 1QQBA 3SFVA 2R1UA 4QLBA 1V43A 2GBLA 2R60A 3DOHA 3GZTB 3VR6A 5P21A 3WYNA 1WULS 4R1NA 2BI7A 4XIIA 5C31A 5A4MS 1FEZA 1AG9A 3ENVA 3HKDB 4BQIA 3RS0A 3DZBA 3SZOA 1XQ6A 1AGYA 1KI6A 1MB0A 1MABB 1XQYA 2QDXA 2XHZA 1QO7A 3KAJA 3NO4A 4MV8A 3ZQ6A 3FNGA 3FZQA 2Y4NA 4ZYTA 4FYXA 2PUCA 3I04A 2BDEA 4F93B 3U17A 2H4FA 3I6BA 5AQ1A 2HIHA 3LQRA 2ZIXA 3CRVA 4B6SA 2QTNA 3PZBA 3C1UA 1UOOA 4Y2GA 2FDCA 3O4GA 1A4XA 1NRJB 2QXTA 2VEOA 3DW1X 4BC0A 2BFDA 1SOUA 4A15A 4YJ2A 2R6AA 3BE5A 2OUIA 1RAGA 4GKAA 4F6RA 3RV4A 1E2MA 1QLWA 3ZDFA 4S2EA 1G19A 4TLLB 1HKHA 3NNSA 1SIWA 4JLKA 3JWGA 4DIFA 3R6DA 1B4DA 1D0SA 4B7UA 1M74A 3HWWA 3PGJA 2M98A 4UFNA 1KO4A 1X6VA 2UXDB 1O94D 2GZSA 4KWTA 1OT3A 1EWQA 4U0JA 1ZONA 3UB3A 3ROEA 4Q4AB 4OU5A 4JBXA 4MS1A 5IN5A 4FDMA 1UPCA 4MWCA 2EG5A 5GINE 1VLZA 3EZXA 2WWRA 3AVVA 3PXAA 4V0QA 1W5FA 3BDAA 3OIYA 1V8ZA 4FS3A 1HYEA 1N9ZA 1L5HA 2W8BA 3FPSA 2QM3A 1XEXB 2O57A 3IIMA 4ND8B 4IXDA 3GLIB 4YJ2F 3M6AA 1JVNA 3MG9A 5BRNA 1JSRA 4WINA 3V3TA 1C4WA 1VE6A 4OKSA 2FUKA 1G0OA 4EW6A 4E5KA 2AXNA 4CEJA 1ZEJA 3HJBA 2V96A 5CLJA 3AVWA 1CYEA 4UNIA 4ZI5A 2XE6A 1EWKA 1TCAA 1L5VA 2GFQA 1Q91A 1DIHA 3P94A 4FGUA 2FWMX 3IVAA 4IYJA 4Z49A 1R7RA 1YQEA 4ARCA 3H1GA 3GLFE 3PRYA 1T25A 2IEYA 2PYZA 3LX4A 1SVNA 4LRSB 3I2HA 1ZUNA 4QOHA 1P2FA 4IGKA 4YUZA 4PVCA 3Q3IA 5EJ7A 2H4HA 2HCRA 4JROA 4H35A 3L0PA 4NU6A 2JD2A 4YCMA 4D80A 1C2YA 1F14A 3QX3A 5L95A 3PNMA 2IYYA 1KL7A 1MMFB 1WMFA 121PA 4L5IA 5LP6A 2XAAA 1PWYE 3GQVA 4E6EA 2Z6AA 3MAAC 2D8MA 3HKCB 3AK4A 4GC9A 2W43A 3BMOB 3PITA 4QBFA 5E38A 4IJKA 4QNRA 5C0OE 5TT1A 3WV5A 4OXNA 3GA0A 1N32B 2QD2A 2R0QC 3NNDA 4FZJA 3RBAA 4L74A 1L8AA 3RI3A 5HKLA 4KQIA 4AQ7A 4M0UA 4MV1A 4UHDA 2ZVJA 4FDTA 2VWGA 2XCUA 5A03A 2QBYB 3RTAA 1RWQA 3AM3A 3OQIA 4UBNA 4V0OA 1B6SA 4EF4A 2WTXA 2XXAB 1DT5A 2JIDA 5B7PA 4NULA 1V4NA 4HGZA 5HS4A 1FMLA 1X1AA 1LBQA 2OD2A 2ID7A 3N2ZB 4URVR 1SN7A 3L8HA 1J0BA 4BRWA 1QQ6A 2DHEA 3FYUB 1JKJB 1W9MA 3R4CA 4FOLA 1CG6A 4Q34A 2O5CA 5F23A 3CUEF 1JHVA 5DSXA 5B4UA 3THRA 1RBZA 4XCQA 3ETJA 3F1KA 2QAGC 3MJFA 5FNVA 1SUFA 4Y6GB 4B3DA 4QWMA 3OJLA 1UBOS 1LRKA 1WUKS 1JQ5A 5BNFA 3T7CA 2C2OA 3F2IA 3D81A 3OIVA 2HF2A 4DLZA 1HOXA 5I48A 5LNK6 2VP9A 4I5GA 3SIPA 3DDUA 3GLHA 4AMZA 1WPXA 3OU6A 2DMRA 2OCXA 4GZLA 1I1HA 3I6ZA 3DE0X 4I50B 4U9HS 2DPMA 1KQGA 3AIOA 4MUFA 4KQKA 1N9KA 3RYCA 2E4YA 1U3TA 2FMFA 2WDZA 3M3PA 3TNYA 3LDUA 1EWRA 4OCZA 1PG5A 2WQ6A 4BQNA 2A1TS 3FZEA 2QUKA 1HTTA 2ZJYA 4KBGA 4O4IB 3KWLA 3JWIA 2XNDA 1SA0A 3HS3A 5A4FS 1U8ZA 4EI8A 2OWEA 4ZC1A 4DDHA 4JCCA 2O7QA 3GYBA 4MVJE 1KY4A 3EQ9A 5EZ5A 2Y2VA 3C7AA 2R66A 2H4XA 4LOIA 1KPIA 2Q2NA 3GC6A 3MTIA 4LYYA 1YJXA 5DHFA 3C5EA 2I71A 5EQDA 3SQOA 2PNFA 4E0BA 4X20B 2XYVA 2IYLD 5ALVA 3PIRA 2VQ6A 4H18A 4RDHA 4Z3OA 4L72A 3E3OA 2OCAA 1L5NA 3CLTD 2GF2A 2EBUA 1N9GA 4AJKA 1DCFA 3PEYA 1YAHA 4B33A 4L02A 4L6AA 2FUG6 1EA5A 3CVJA 4EPYA 4LYAA 3ISVA 4NJMA 4ZWNA 2A5GA 1L4NA 1E7MA 1O97D 4C5AA 3CKYA 4LYJA 2X2OA 3F4KA 4YAEA 5LQSA 3KP1A 4FWTA 4X8MA 2ATCA 1BGVA 1PG0A 1FLNA 1WPQA 2SCUB 4UBLA 1L2TA 1BE6A 5EKUA 3RUCA 3NOOA 3WYFA 3FNQA 3M6FA 3RO7A 1HEUA 4CT0A 4AS1A 1JAZA 2GETA 1X1RA 2OFOA 5JBIA 2PQ6A 4GI2A 1GGHA 1KQPA 3UJDA 2WB4A 4Z5XA 1NY5A 3GRUA 1Q0SA 2QLJA 1MAUA 2ZBQA 3C3PA 1YR6A 2MSLA 4TVBA 4HZIA 4ED9A 2CHEA 1QX3A 3GT7A 5JNVA 2NLOA 4BNFA 1TLLA 3GLFA 2OZPA 4NQRA 3MAGA 1XYGA 2DVMA 1K68A 3P2IA 2QYSA 1H4VB 2V4ZA 2VZ0A 1NONA 1VHJA 2XOKD 4NXMB 4D4HA 1X74A 2W4IA 4ZYLA 2JDID 3O91A 1NYTA 3LHKA 3FDZB 3UK1A 3BS4A 1BH6A 1GGMA 1WW2A 1R50A 4GPIB 5EQTA 5BPFA 1TVCA 1OCEA 2A14A 2FNAA 4TOIA 5FJIA 4EGCB 4ZAWA 2J3QA 3EXG1 3OA0A 3E15A 1AURA 4JQZA 1TUBB 4CMIB 1IUKA 5BN3B 2NN3C 1Z0JA 3CR7A 1LWOA 3O74A 2ZTMA 4LXXA 4JLAA 4FJ1A 4DTIA 5C5EA 5FULA 2XVMA 5KYNA 1Y7IA 3E53A 1X2BA 1JX6A 5JATA 5GV8A 2V7QA 1N6NA 4CR8A 1YMQA 1UQTA 1OX5A 3SG0A 4MINA 3RS8A 5CNMA 1P1JA 4LFAB 4C6TA 1CVLA 2ODWA 3G7UA 2NADA 1UM9A 1ZITA 2HV9A 4F4UA 4W5RA 5JBNA 5TLSA 2V3CC 3EVZA 2FFQA 3I1YA 3JQCA 3LT0A 3EMBA 4B3IA 1QYVA 2GTHA 2E9SA 4G5RA 4LC1A 4QQFA 3T12A 4JVOA 2YYAA 1E8DA 5IXJA 1QOPB 4CG2A 3RKSA 5FWXA 5KNCA 1L8OA 4DIOA 3K30A 3V55A 1ZAKA 4ZVLA 3O92A 1U3DA 3ZU5A 4Z4GA 4EG0A 5D6OA 1DZIA 5CB4F 1ZRHA 4J94A 4G3XA 4ZGWA 2WMNB 4WA7A 3JQPA 3CXRA 1JJBA 3LW7A 4GPD1 4YRCA 3SVTA 1LI4A 1H0HA 1U2TA 3DC2A 3MJDA 5K3CA 2CVOA 5EE1A 4Z9BA 2BGRA 3BD6A 2OXTA 4B3HA 3ZJ4A 1UBTS 1F0PA 4H7DA 4WVFA 3GX1A 2GNOA 5LYJF 5TSDA 1ZNQO 3R2JA 1DIRA 2ST1A 3O31A 1J20A 1GCOA 2WOJA 1OPRA 3THXA 4K9PA 3TDNA 2YZ7A 1L5LA 3T3NA 2IRWA 1DBWA 3KFXA 3RAGA 2HX1A 3ICPA 2GK4A 2O0HA 4DA0A 3MTBA 5D3MA 3TLMA 5BSGA 1Z0DA 4TTAA 1IY0A 2RG1A 1TQ6A 3WZLA 1REQB 3Q2OA 1DBPA 2D13A 2YV2A 4MVJA 3M1IA 3NPAA 2WUVA 2NPIA 1TEVA 1Z8NA 3DNFA 4WACA 2WP0A 3M33A 3WGOA 4JEHA 4UE6A 4H1WA 5K3FB 1KI9A 4MVWA 2QRGA 2VPYA 1JQDA 2ZAYA 1C80A 4JBHA 4PONA 3GPLA 1RMTA 1LPMA 2F8TA 2J9XB 5AI5A 2ZAIA 4I6EA 4N5DA 1CJKC 4BGEA 3D2BA 4G1MB 1UKBA 1OZAA 2A86A 4H6PA 3DBOB 4I50A 4DCUA 1FFEA 2V59A 3RE1A 1DMRA 1U2RA 4N1AA 4X7BA 2K4MA 1V3VA 1CD5A 1FLAA 2QD4A 1UDAA 2VKTA 3DVAB 3IESA 1L5WA 4YCDA 5AKGA 3ZIAD 2WAXA 3IT1A 5I7OA 1QRSA 2DZDA 3LRPA 4UMFA 2WWVD 2Y0CA 2AEEA 3OJCA 2BM8A 4WBNB 4I46A 4LDRA 3SFZA 2OGSA 1LRJA 1JI0A 1YRYE 2OQIA 2VHWA 3A9UA 2YXEA 3O3OB 4Y2YA 5CHEA 5AVRA 2LCIA 1K4KA 2QVZX 2WT9A 3P2OA 1Y6JA 4NBLA 4RY2A 1DRWA 1Z4OA 3IKJA 5JWHA 1WCYA 2W37A 4C0KA 2HZBA 4U6NA 3I64A 2XZOA 1XL1A 2FPPB 3VSDA 1XCLA 1T10A 3HY6A 3PF9A 4EG5A 1H65A 3VC1A 5M7EA 4MDHA 4YRPA 1UQUA 2QL9A 3LH5A 3ZWWA 2HMTA 5FWYA 1UJ5A 3MCZA 2PLRA 4HLCA 1RXEA 4YCJA 1O0CA 3E5HA 4CCWA 2Z8YA 2E4WA 3P9RA 4HR7A 1DAHA 1E9DA 2JIOA 1RZUA 3F98A 4C22A 1S3GA 4V02A 1I2CA 3E9EA 2OK8A 1VBKA 3KSMA 3VOSA 4QJIA 5E6UB 1NXSA 1WTCA 5IC5A 4HVCA 5ICEA 4UD2A 1KIFA 2KS6A 2WJHA 2ZBVA 1Q0ZA 2ZETA 4GGPA 1QH1A 5FX2A 2HLNA 2FQYA 1LZKA 2QTBA 4TSFD 4NV0A 5C8ZA 5JAIA 4DB4A 5HMLA 3DQQA 4BLUA 3OJ0A 3B6JA 4Z9XA 3H17A 1QF9A 3WDKA 1E2QA 4L4YA 1EESA 3I09A 1CIPA 1F7VA 1Q12A 4AZ0A 1OR8A 1YK1A 2P0AA 1XA3A 5CK4A 3AEUA 5LSAA 2XD4A 3TQIA 4GGOA