2I7DA

Structure of human cytosolic deoxyribonucleotidase in complex with deoxyuridine, alf4 and mg2+
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
193
structure length
193
Chain Sequence
RSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 5'(3')-deoxyribonucleotidase, cytosolic type
publication title Structures of Human and Murine cytosolic deoxyribonucleotidase: Insights into substrate specificity and catalysis
rcsb
source organism Homo sapiens
total genus 65
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature ec 3.1.3.-:
pdb deposition date 2006-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 2i7dA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2i7dA01
4KX5A 3WK6A 3DNPA 1YV9A 4YCMA 5AKJA 3KD3A 4HGNA 1CQZA 1RLTA 2C8KA 4NV0A 4Y2UA 3PGVA 3AR5A 3NANA 5AHXA 2HOQA 3QNMA 4UU1A 4EZEA 2B8JA 3WGUA 1RQNA 3DAOA 2BDUA 2YMMA 4L6CA 5ALRA 2CN1A 2B8EA 3WK5A 2PKEA 2Q4TA 3U13A 3IB6A 3VAYA 3ZI4A 1L8LA 3ET4A 2HEGA 3R4CA 2IOFK 5AI0A 1U2SA 2RBKA 3U19A 2MU1A 2WF5A 3B9BA 5JJBA 5AK3A 3WK9A 1FEZA 4RETA 5AI6A 2WHEA 2QLTA 4G9BA 4Y2RA 1RKUA 3QUQA 4HYTA 1Z5UA 2W4MA 2WF8A 4ZEXA 2ZBDA 3NIWA 3ED5A 4ZEVA 3NASA 4L6AA 1QQ5A 4AS3A 1J8DA 4Y2JA 4FFDA 4EX7A 3OCYA 2YJ3A 2FUEA 1IWOA 4Y2YA 2HI0A 4UARA 2G07A 5IS2A 2YMQA 2ZBEA 3L8EA 4Y2VA 3L1VA 3ONNA 5ALJA 3P96A 5AVVA 4BNDA 2ZBFA 3E84A 4EELA 2YJ4A 4BBJA 1TJ5A 4UMDA 1Z4PX 1K1EA 4CF5A 5AVZA 4OHFA 2C4NA 4DWOA 3WKCA 5AM3A 4EENA 2WF6A 3AR7A 4OD0A 4AS2A 2BDEA 1RKQA 3QLEA 5E0OA 1S2OA 2YJ6A 4BX2A 4Y2XA 2HHLA 1ZD3A 5AM1A 5AIBA 3U7HB 5ALNA 3ZTWA 3B9RA 5AM5A 2HF2A 3WGVA 4O8CA 1N8NA 2JGAA 2FEAA 3OCWA 3KDPA 1RDFA 3ZU6A 3NUQA 3ZVLA 4EX6A 2I6XA 2WM8A 1QYIA 5AVYA 4KN8A 4KYTA 3I76A 1QH9A 2W43A 1Z4NA 3A1CA 5AW9A 2YMPA 3I28A 3KBBA 4G63A 1Z4LA 4UU0A 2R8XA 4I9GA 4BNDB 5AKHA 2GHTA 4F72A 3AR3A 2W11A 3AR2A 3M1YA 3UMGA 1Z4KA 4UAUA 3ZWKA 2HDOA 2WF7A 1RQLA 4Y2QA 3MPOA 3IJ5A 3AR9A 1WPGA 1ZS9A 1YNSA 3NRJA 5FP0A 2ODAA 3FPSA 4C4SA 1T5TA 3QU7A 2YMLA 5AW4A 4UW9A 3U7EB 2G0AA 3U7GA 2IOFA 1T9ZA 5ALMA 1N9KA 3QGMA 2AH5A 3I6BA 3WK7A 3QX7A 3RF6A 5A3SA 2YBDA 3SHQA 5AW2A 1S8OA 1ZRMA 1WR8A 3QUBA 2HO4A 3OCXA 3R09A 2JAOA 3NAMA 4QQFA 3PGLA 3OPXA 4UM7A 2PR7A 2EATA 2GO7A 3UMBA 2ZBGA 3KOOA 5ALZA 3ZX5A 2C9MA 1RKVA 3L8GA 2Q4RA 4RESA 4YH1A 2O2XA 1L7NA 4UAVA 2OYCA 1L7PA 1O03A 2Q5EA 3L0BA 3U26A 1VFPA 2GHQA 3BA6A 1MH9A 4XE5A 3E8MA 5AI5A 4YIHA 2B30A 1EK2A 4ZEWA 5ALPA 3KZXA 3UM9A 1XPJA 1SWVA 3EF0A 2P27A 3FGOA 5AIAA 2JARA 4DW8A 2HF7A 4XOUA 5AW7A 4BYGA 3S6JA 5AKGA 3ZWDA 4UASA 2RAVA 5AI9A 3L0YA 1QQ7A 5ALLA 3QU2A 3ZTYA 5ALVA 1LVHA 2WFAA 2IA5A 3EF1A 5ALDA 3FPBA 3CNHA 5IT4A 3QXGA 4BEWA 3UMCA 3KC2A 2G1AA 4NAVA 4HGQA 2FPWA 1RMTA 1XVIA 4BX0A 2R8ZA 5AK4A 5ALXA 2B0CA 3ZVMA 2FPUA 4HAIA 1Q91A 3OCZA 1U02A 1TJ4A 4F71A 2OM6A 4Y2PA 2G08A 3F9RA 4UMEA 3AR8A 3OCVA 3WK8A 4DCCA 5ALEA 2EAUA 3L7YA 2NYVA 3WKEA 3AR6A 4XQ0A 2GMWA 5ALIA 3BWVA 1L7OA 5AM0A 4E88A 3W5BA 4KNWA 3NALA 4UATA 2AUTA 5AKXA 2I7DA 3ZW7A 5AVSA 4OCZA 5AICA 1Q92A 4MWOA 1L7MA 1TE2A 4FYPA 3QUCA 4Y2TA 1JUDA 3ZX4A 3L1UA 1KYTA 1RLMA 2HX1A 4HGOA 3OTQA 2AGVA 1YMQA 5AK6A 3SMVA 2CFSA 2FDRA 3I1YA 2YFYA 1NRWA 4J03A 1PW5A 3HYCA 5AW3A 5AW8A 5AVWA 2FPXA 5AK5A 4UMVA 2P9JA 4UM5A 4NABA 4C4RA 1XP5A 1Z4OA 3L8HA 4Y2SA 4QJBA 3ZUPA 3K1ZA 1RPZA 4BEVA 1F5SA 1U2TA 2QYHA 5ALYA 5AM4A 5AKIA 2ZOSA 3ET5A 3WK4A 4J2TA 2RARA 5ALTA 1AQ6A 2CFRA 2G09A 4FE3A 1TJ3A 4YIKA 1TA0A 1Z5GA 2FUCA 5ALUA 1VJRA 3FVVA 1YS9A 3A3YA 1RMQA 4KX3A 5AKYA 2JAWA 3DDHA 1QQ6A 2GFHA 1SWWA 3W5CA 4IFTA 4H1WA 1RC8A 3N28A 4GIBA 2NO4A 2B1RA 4YGYA 5AVXA 3EWIA 4IG4A 1YJ5A 4C4TA 3SKYA 2NO5A 1Z4IA 3QYPA 1SU4A 2R8YA 3E58A 1O08A 2AMYA 2P11A 3PDWA 3WKAA 1L6RA 3MN1A 5AW1A 5AKEA 3A1EA 5AVUA 2BY4A 2ZG6A 4B6JA 4NFLA 3W5DA 2P69A 1EK1A 2G80A 4YCLA 2VKQA 4YCNA 1U7PA 2I54A 3N5KA 3L0CA 5A3QA 5AW6A 4JB3A 1NNLA 5AW0A 4BKMA 3MMZA 2I55A 1WVIA 1L8OA 4NWIA 1ZD4A 3L5KA 3D6JA 4L57A 2PQ0A 4XPZA 3R9KA 3ESQA 4PNHA 3FZQA 1ZOLA 5ALGA 5ALKA 3B8EA 3E81A 3WKBA 3GYGA 1RRCA 1Y8AA 3HLTA 5AI4A 3ESRA 4I9FA 1WZCA 2MSNA 5AKZA 3RFUA 2YN4A 4MUMA 1YDFA 1Z4QA 3QUTA 1Z4JA 2HSZA 1RLOA 3WKDA 4BX3A 4HGRA 3FM9A 1NF2A 1T5SA 4CE6A 2D2VA 2FI1A 1CR6A 5IT0A 2CFTA 4KNVA 2YJ5A 3TLMA 4AP9A 4HGPA 5AESA 1ZD2P 1J97A 5ALOA 3QU9A 2I33A 5AVQA 5AKKA 3AR4A 5A3RA 3M9LA 2EARA 2G06A 3ZVNA 2C8LA 2YY6A 3SD7A 5AM2A 2RB5A 1Z4MA 3L8FA 5AI8A 1U7OA 2O9JA 3MC1A 3N1UA 5ALWA 2B82A 2OA0A 5T41A 1ZRNA 5ALSA 5AVRA 3SLRA 5ALHA 3U7FB 4CF3A 4DFDA 4CF4A 2WF9A 1RMYA 5ALQA 3N8GA 2R8EA 2X4DA 3OCUA 2ZXEA 3SKXA 2B1QA 1ZJJA 3DV9A 1ZD5A 2C88A 4EEKA 3A1DA 4JDPA 4CNQA 2IYEA 3J7TA 2I34A 1LTQA 4OFZA 5AW5A 2HCFA 3W5AA 5AVTA 1VJ5A 5ALFA 3IRUA 3SF0A 2OBBA 3N07A 3PCTA 4GXTA 1X42A 2JAUA 2DQSA 3QU4A 3QU5A 1Z88A 4Y3UA 3EPRA 2FPSA 3CZ4A 2FPRA 5AKLA 4UMFA 2IOHA
chains in the Genus database with same CATH superfamily
3W6PA 3CI0K 3R5SA 1QHGA 1AGPA 1Y9DA 1YSCA 2DTEA 3PDUA 1P0QA 3HJUA 4JKYA 4XWOA 5CFOA 2G0TA 4ZC1A 1GAXA 1L5LA 4B48A 1N3LA 3CG4A 5AHXA 4TYYA 2GBPA 3STTA 5CBPB 3EXIB 3LQQA 3NHMA 2ZJZA 4QPZA 1VBKA 1UR5A 5C2JB 4BPRA 1M1YB 4A8HA 1FUEA 1A8QA 1UMKA 4F2WA 4ZREA 3OIFA 1MXFA 1SUPA 3FOBA 4TX1A 2RKWA 2VT7A 5FBVB 1K8XB 3T3DA 4B0OA 2PAFA 4NPCA 2RAPA 1E79D 1OF1A 3IGFA 3RLFA 5I9BA 1RYBA 3TD9A 4RFSA 2IE8A 3BXZA 3ANNA 4IEIA 1UMBA 3R3ZA 1KP9A 1D9ZA 1N7GA 2JD0A 4Q7LA 4GX5A 2H00A 5AXBA 4YQFA 2ZBUA 5BP7A 3L1KA 5C5IA 1QRAA 1N1EA 1QM5A 1V3TA 1YZLA 1IONA 2JCYA 1BQ3A 4RQUA 5MGBA 1WP4A 3X0DA 4GMDA 1RLUA 2C1XA 1RD4A 1TX4B 1A9QA 1ODLA 4WOCA 6YASA 3NWEA 1KETA 1YZGA 1DDOA 1CY6A 1NC3A 1UBOS 4K9SA 2WQ7A 2P40A 3RANA 2YXBA 4CI9A 3VU9A 1JEYA 1VB3A 4QG3A 3ILHA 3OQIB 4AYWA 1UPUA 4NECA 1F0PA 4KRFA 1FUKA 1KI4A 4YBRA 5TDHA 1J07A 1XKXA 3AOGA 3HB9A 4NOLA 5HF8A 3A05A 2MSLA 4PO3X 3O4IA 3VNQA 4TMFA 3ZY4A 1KBQA 3D4NA 3OWXA 4AZ0A 3A28A 1GADO 1P4RA 4ITUA 4ZVSA 2O2JA 4ERXA 5BOSB 1TVKA 3DCJA 3AVOA 1PL8A 2A5JA 1Z6TA 1SD1A 1L5YA 1ZH8A 3LDAA 4NC9A 4TWBA 4X1IB 3A37A 3IMGA 1JPJA 4GMGA 3AU8A 3ID6C 1UXJA 2E5FA 2VPWA 1U04A 1TUEA 3FFXA 3KCNA 3MWYW 3WHKA 3S2UA 1O95D 4HB2A 4PO8A 5J2UA 2QRUA 5DW0A 1PFYA 1QE5A 2C5LA 3OM8A 4EELA 3F1LA 3IBSA 3P0JA 2ZSDA 4GMFA 5LQCA 4N0DA 1AS3A 1R0SA 2X1HA 2LKDA 2AK3A 1K1EA 2C4HA 3PWSA 2YNMD 3ZJUA 3NBMA 4QT0A 5ENDA 4TYPA 1QU2A 3C16C 1X1TA 1DUVG 4I08A 1NQ5A 4LC0A 1YVRA 4LRXA 5EUBA 3LF1A 3MWEA 4PX9A 4QNRA 1L5GB 1SIBE 2IZ6A 3I9V1 3O38A 2VZ8A 4JB0A 1KEVA 4NDZA 4S1WA 5IJAA 2OUKA 4AY3A 3ASYA 4LJSA 1Z0SA 2PZLA 2ZAGA 3HY4A 1T1EA 3C5WP 3L06A 1P2UA 2XQIA 5JD3A 4EO4A 4JD5A 5DWDA 3AFOA 3DZBA 5JDCC 5JRJA 1DAEA 3GRFA 3NOQA 3QLTA 2CL0X 3FIJA 1WCYA 1IPEA 2FPPA 1EG7A 1QH1A 1YCGA 1ZKMA 2XNKA 2Y1XA 3EXEA 1CU1A 2PU5A 1SULA 1V9SA 1MB4A 2ECFA 3LU1A 4MGHA 4WK4B 1L5WA 4RFVA 4C0LA 4OLAA 3M6AA 3RW9A 1P1IA 1CUFA 2I6XA 2OZEA 1UQRA 1D2MA 5DHFA 2O8BB 1YRWA 3IDSA 1V11B 2X5XA 3HLKA 3HO8A 4PV7A 4WVLA 3SHOA 1TFRA 3NMUF 2IEZA 3KOZA 1EBUA 2WPNA 3QEMB 2Q0HA 1GGHA 2NYAA 2R65A 3RODA 1J8MF 2PHZA 1L4KA 2O2SA 4L51A 2GLXA 3EAFA 4NV3A 4KV7A 4RL4A 4L2IA 1OYOA 5HX7A 4R1PA 1OT3A 2L17A 5JZBA 4OK5A 3OF2A 4L8WB 1EK6A 1SVIA 4W9NC 4CCYA 1XTSA 3LA8A 2P2NA 1T1RA 1I4OA 2F8MA 2QRLA 3H04A 4TLMB 1PFKA 2E7ZA 2W11A 4Y1RB 5IT9A 3M1YA 5G53C 4TN1A 4DUYB 1SA0A 1RXYA 1P3JA 3GJ4A 4R2HA 1S7GA 2OK7A 1A5ZA 3P2JA 1DUSA 4FXPA 2ZSIA 3D6HA 4F1KA 3GJYA 1NI4B 4RSRA 4UZFA 1DBRA 3WDMA 3NJ8A 3GG2A 3AR9A 4E5PA 4MWCA 4KXMA 3T94A 2JJMA 4DQLA 2FP3A 4JLOA 1RI5A 1U3DA 2NSDA 5FBQB 5FBRB 5C7LO 3LWNA 1XKLA 3TLJA 2QE6A 2EP8A 3R5XA 1GZUA 2PWYA 4GP6A 4BQFA 1NVMB 1UWCA 3N74A 1BGXT 3ZY2A 2YBEA 3H1TA 4A10A 3C8DA 5BSVA 1TI7A 3WK7A 1DEXA 1GITA 4E22A 5C9ZA 2I0FA 2XF8A 1C3VA 2TECE 3P2KA 3PD7A 5LXTB 1NXXA 1BNCA 3CKKA 4PR0A 2Y0BA 4BV3A 1MAWA 5ICMA 5K8JB 1YA6A 3EW9A 4QQFA 1IMJA 1WXIA 2IDZA 4HF7A 3RUFA 3D6AA 1F2VA 4UVHA 5B6PA 2BPOA 2XTMA 3WA7A 4UQOA 3SXUA 5ALZA 3NAGA 4BUZA 1VLLA 4CLOB 1R74A 3H8VA 1ZVMA 2PMCA 5IBQA 4XRGA 4HWPA 2VP2A 4MUBA 5EYPB 2C2BA 3K9BA 3K92A 2BFEB 1J20A 3DD1A 2BE7A 1UJNA 2ATVA 3JR7A 3Q88A 4LK3A 1KH3A 1KIFA 1SCBA 2DFVA 1UBNA 2I7TA 3ACCA 1T9AA 3E35A 3HP7A 1SZJG 3LCCA 5IRCD 2NWQA 5LQSA 3G2QA 4EG4A 3NBUA 3DJYA 1KVTA 4O4LA 3ZGOA 4D4HA 3GN1A 4WNYA 3UH0A 1A27A 2XX3A 2CLDX 3KPJA 1A4XA 4QLOA 5G0VA 1QVRA 4Q1FA 3KXDA 1AE1A 4DCSA 4GF5A 3JY6A 1E2HA 2OHIA 3EF0A 1P7YA 2J30A 4LWZA 1BAPA 5FT9A 5SYNA 5E2BA 3LC0A 1LBHA 4XOUA 3K6SA 2OKCA 3WIDA 1S8NA 2G9UA 3DZHA 2HWKA 3GNSA 2XBMA 2QNRA 2GO1A 5DM2A 5AYVA 4WJZA 4FJ0A 3O4RA 4I9HA 1K8QA 1EFKA 2ECKA 3P7MA 4FFSA 4F5DA 5EZYB 3AP2A 1CETA 3PXAA 2JLXA 2CNWD 3RWMB 2QMUA 3B2NA 4D41A 1K0FA 1UC4B 1GGVA 2E4WA 2QX4A 4X6UA 1WP9A 4R69A 2YZ2A 4H31A 2UYHA 4DNXA 3EBOA 3FXAA 3B51X 5DEIA 1B15A 3UUEA 1KYYA 4FW9A 1D1PA 1CRQA 1HE8B 2XB8A 3LWZA 3T06B 1ONOA 5IVHA 3FCXA 1N5KA 1VIVA 5CIQA 1BJTA 3HSYA 3BRWD 4YP1A 1PDWA 2GRJA 4B35A 3HYLA 3KPYA 3ECCA 3EVZA 2FN4A 3BDIA 1GQSA 4LHEA 4M9RA 2QUBA 1NKVA 5IJ9A 5AUNB 3WGIA 3H16A 4BLQA 1ZD9A 4UMEA 4C4YA 4ND5A 3AR8A 4JT4A 4J0HA 7MHTA 3KL2A 1M2GA 1DWOA 2VCEA 5TLSA 4ESHA 3F6RA 1E5TA 1L7OA 1DOZA 3AYXB 3LGXA 3QIVA 3VMFA 3W5BA 4S3MA 3WLHA 4MYSA 4BJ3A 4Y6QA 4E12A 1AQIA 4RTOA 2JJ8A 3R5HA 1OV4A 4C43A 1KFJB 2I66A 4ZV9A 1Q0TA 3BJRA 1KDOA 5FAXA 1XG5A 3X1KA 3HDHA 4E09A 1SQFA 3W79A 3ZX4A 3M4NA 4I1SA 1V7PC 2P4UA 2WU1A 4IJ5A 2ZRKA 5C5EA 5EJ4A 1PX0A 2IHJA 1DAIA 2KLBA 4JMLA 4B9AA 4B82A 1MHTA 1Y6FA 3VDXA 1C0LA 2JA2A 3DBHA 3M4ZA 4O33A 1G2OA 4YJGA 3DV0A 5AK6A 5EFZA 3SMVA 2XJ9A 2C58A 4WXEA 5CVDA 3TOSA 1E98A 2DPHA 2XUQA 4BNGA 4DYVA 3QX8A 4PQYA 3PE3A 3AOEC 4BNUA 4C2BA 1XQXA 4KPUB 4TV9F 3RARA 3K1AA 1C0EA 2FPXA 1XWIA 4BWVA 4BX8A 3I42A 2IVFA 1M6HA 1G6HA 2CNOA 3FOCA 1DG1G 3PNYA 4R1NA 2ZBPA 1U0LA 1EFRA 3CKLA 2ZTMA 1N75A 1Z4OA 2V5VA 4KIFA 5C8YA 1ZY2A 1QMGA 2XD4A 3LK7A 4OQMA 4PCLA 5EMNA 3TD6A 3G0CA 1CUYA 3BWXA 3NYIA 1X80B 3HCFA 3B20A 4V2IA 4K9KA 3OJXA 4R68A 4YP0A 5TPWA 3PQEA 4ZDIA 4XYMA 2C0PA 3GUYA 4FUQA 3JVIA 2IOYA 1T6YA 1V48A 2O2ZA 1NW8A 2LTAA 4DV0B 4YP6A 5ALUA 4O4HB 4RDXA 4NLEA 1U3CA 1E9EA 4ZA2A 3FWZA 5AUQA 1T0HB 2LXNA 2VP9A 3HKCA 4QATA 4FU0A 4CN8A 2IPOA 1EVEA 1JF8A 2RC6A 3FCEA 4M46A 4E32A 2QEQA 5J3JA 3BMOA 4DMRA 2OB2A 2FHPA 3TXXA 2IYNA 4JI4B 2CY0A 3HRHA 3P9SA 5EZSA 1QGOA 4LI3X 3GIWA 1VC2A 3EWIA 4ALLA 4AZTA 1HLFA 2AJ8A 2FRXA 1ENOA 3GUCA 5B7GA 5FBKA 3JWIA 4YFYA 2QRHA 3QF4A 1XHEA 1PV1A 2C57A 3F4RA 1LI4A 2YWDA 3G8CA 2AMYA 4FC7A 1ZIDA 2AG0A 2EKLA 4HNHA 4X85A 2UVPB 5H3CA 3CSDA 2V7QA 3B1VA 5F98A 4EEXA 4E21A 4F6RA 1AD2A 4F3RA 1I6MA 4NFLA 2V7GA 3QG1A 3P4UA 2P2LA 1IU9A 1KWGA 3CC8A 2O8DA 3KQVA 1YT5A 4L3OA 4C08A 4AG6A 3KZOA 1U7PA 2HA6A 3U6BA 3S2EA 3LCVB 4DLYA 4JB3A 1MXHA 4TV9A 1C3XA 2O3RA 2PYIA 4H60A 4BKMA 4N4AA 1Y6JA 1K27A 3M1IA 1L8OA 4NEHB 4CLRA 4CMAA 5EKXA 4H08A 1CS0B 3KFXA 3LBNA 1N9GB 2BMAA 4MWBA 4QC2A 4PSKA 2FUNB 4JUDX 4UNNA 3M4JA 3UC9A 3SEAA 1DAGA 3PQ4A 3E8XA 1RJWA 2DPMA 4EHDA 1MOQA 3R9IA 2H1LA 1FYFA 2WAOA 1A96A 1L5SA 1UBCA 2OO5A 3DPUA 3PITA 4JBHA 1XCGB 3L7MA 1M7GA 4KP7A 3WS7A 5EMLA 2QQFA 3ADPA 3NUZA 4MUMA 3ZI7A 4YRGA 2UKDA 2OV1A 3P9PA 4FS3A 3A11A 3HV0A 1RLOA 3QM1A 4BWFB 4IJKA 3TNFA 4ND8A 4OMCA 5DP2A 4IDCA 3S3TA 4EVQA 1ZA2A 2W83A 1Y3CE 1ZXXA 3H18A 4R1TA 3FJ1A 2X9GA 2DZDA 2H9YA 2HK8A 4I1UA 4E15A 3VNBA 5G3YA 1NMXA 1B3RA 3TLEA 2QYSA 3NBZC 1YL7A 4D9GA 1BXKA 1EX7A 3FB4A 3F3MA 5LDHA 2NYUA 4Q47A 3AM3A 5JD4A 1JB9A 1PR6A 3DDZX 1AG9A 1RPTA 4U63A 2XQGA 1L4MA 1E2UA 3EVCA 1KGDA 4BN4A 5L53A 2H1SA 2W2KA 1M0TA 3FTQA 1UMCB 5H70A 1I1HA 3E1SA 1UXIA 4BJHB 2JZNA 4JLNA 1PT6A 2B20A 1L1FA 4F4HA 4C6TA 3B2QA 1KSFX 2AYZA 3ORHA 1GOTA 1V1JA 2ZB2A 4FQ5A 4G4GA 2OA0A 3TB6A 3D3EA 4UBKA 1E9AA 1NU8A 4MINA 2FWPA 2PLAA 5EIHA 5DNYB 4C7BA 1I3LA 1KO1A 3INRA 4ZAYA 1BEUB 4JI5B 4QXQA 1HSOA 2HV8A 3G17A 4G5OA 3WIUA 4AECA 7MDHA 5LBTA 4P5DA 2OT3B 2AZMA 1A9OA 2R66A 4J2OA 4CKEA 1DKNA 3KYJB 3SKXA 3X1WA 4A0QA 1ITZA 2ZJYA 1MFZA 1QANA 4I1YA 2P30A 4MS3B 4KQJA 1U94A 2HIHA 4WIAA 4HLNA 3UHOA 4DUPA 2AI1A 3B12A 1XV5A 4DRYA 5DHUA 4Z9YA 4E2YA 1X86B 4KCGA 3MZ0A 3P27A 2X5KO 5FUWA 3G85A 3IQXA 3WJ7A 3OKFA 1NBHA 1QDLB 2I34A 2Q8QA 4NNPA 2OV2A 3F3YA 3NO4A 3ZGNA 3RYCA 3BYZA 1M6EX 2PS9A 2JVKA 2W2NA 3BMNA 2JH8A 3HDJA 1AS2A 4N12A 4ZT3A 3I1IA 5A71A 1A69A 1EP1B 3QJGA 1B76A 2FE4A 1FTYA 4K05A 1GVNB 4L95C 2FWRA 4QUIA 4R8SA 5FWAA 5K0TA 2F8LA 2JAUA 2J8ZA 3T1OA 1QIGA 2QTTA 2J3JA 4CUZA 4X65B 2IHNA 3A9RA 4Q4AB 3ROMA 4QXAA 3VU3A 1QG4A 2Q6LA 5KJFA 2Q6OA 5JFOA 1TEXA 4IH4A 3I62A 1D6MA 2Q2QA 3LP8A 3Q9NA 4ANFA 1CUCA 3DNPA 3FUUA 2FR0A 1NXOA 1EBFA 1O5OA 2OXCA 2X0IA 3DP7A 2RH4A 4HRXA 1B4DA 1PZGA 3H13A 1XTJA 2G82A 4AIRA 4NV0A 2BRUA 2GCEA 3UA3A 3EMDA 4P34A 4D9KA 4OM8A 1UZNA 3KEGA 1EZ4A 3IMKA 4OYRA 4CMIB 2FEMA 2QIOA 2Y6VA 2ONJA 4G0WA 5H4HA 5K0BA 3W05A 1KR5A 2H4XA 2PX0A 3FTDA 5A4IS 4BGIA 2WSIA 4LX8A 3CVOA 3VC2A 4N8EA 3DAOA 4XYGA 1CUDA 2P4SA 1BU5A 3RQIA 1AMUA 3ESZA 1YFMA 3PHIA 5IM5A 4JC4A 3OA0A 2J59A 5DGTA 1V2HE 2OXRA 2PKEA 1LQ2A 1FFXA 4YXWD 2NLOA 4WN3A 3VAYA 1ENYA 2A0KA 2IYOA 1U1EA 1Y9JA 2JLRA 4ESOA 4GOMD 5FLKA 1QV9A 4XR9A 3AY6A 5K45A 1RBMA 1AF4A 3NT2A 5C35A 4XAQA 4BFVA 4AQYB 1JA1A 1N1DA 5A0VA 3EISA 1AK2A 3NNSA 4IDHA 4I81A 1H69A 1NYQA 2QLNA 4YJ2F 2QTAA 3K05A 5L3ZA 3JPYA 2CHQA 3O9VA 3AHCA 4ZODA 4CDNA 4Z2AA 5EIXA 1GR0A 3W2FA 4BO0A 2QX6A 1GZHB 2QJTA 4PYKA 4HDSA 3NASA 1U4OA 3E6AA 3EJWA 1JXOA 3H6HA 4O25A 2WW8A 4X8LA 5KNBA 3K30A 5HA5A 1D03A 1NC1A 3UN1A 4AZSA 3CJQA 3OSUA 4FN5A 3RC3A 4HWGA 4MAFA 4PTZA 3AWDA 3K72B 1JEAA 2RKBA 3RYHA 3PA8A 5KTRA 3TXYA 3OWHA 3OZAA 1UKEA 4HGZA 5FPPA 3GWGA 2ZBEA 4PHTA 3JQAB 3L1VA 1I8TA 3PQ8A 2AKEA 4C04A 3MGAA 4FT2A 3B53X 3KVVA 4FD3A 4OATA 4PZLA 1A9SA 4TL6A 3ANSA 3C98A 4TVOA 4ESEA 1YAJA 1QHNA 1JSZA 1EAMA 1SOVA 1E1RD 2A94A 3B3GA 3P0FA 1DQRA 3KUUA 1P0MA 4HNRA 5LWHA 1JKJB 1ONNA 2O48X 1UDRA 1VI6A 3GIDA 3TR5A 5LQKA 3ZZMA 4JYZA 1KAOA 1T91A 3A26A 3AUUA 5AVZA 1YONA 1EDBA 3I64A 1MFPA 4G97A 2ZUSA 4FYKA 4UXJA 2XT9A 3RU2A 3RUEA 4A6PA 3SDSA 2N47A 3B9QA 4R1QA 2C4NA 2FWJA 4ALIA 2GF2A 4DM4A 1EG2A 2MINA 5K0LA 3AR7A 3BK2A 1DJMA 1UZLA 4PC2A 4QE3A 2EQBA 3RKSA 5E0OA 5EJ8A 3ZQKA 2DWQA 4BTLA 1RC0A 2XMQA 4HUQB 4AKHA 4K6GA 1IEXA 1YRQA 5D3MB 4M0EA 3D4BA 3OIUA 3HFGA 4KWIA 1P4JA 1AQNA 1X13A 4J3FA 1U6IA 1EP3B 3VKWA 4BUCA 5JV5A 4P5PA 3WQBA 3DONA 3FIUA 4BO8A 5LQDA 4Q9LA 1YTLA 5E4FA 2WIDA 4NZZA 1MIOB 2QD1A 1QVWA 1TQDA 3BTOA 3PF8A 5FOUA 3G5UA 1O4WA 1R6AA 3LBIA 4P31A 4D2IA 1VA4A 4ZRMA 3ORRA 1WEKA 3NUQA 5EI5A 4WXHA 3D0OA 2ZJ2A 2ZTVA 1G8JA 3PUJA 3ULKA 2J1LA 2QYTA 3IHTA 4KYTA 5CDYA 1SXJC 2VJCA 1US8A 2RHMA 3O21A 1Y4ZA 4EB3A 4G1VA 4A91A 1XZAA 3DGEC 1U9IC 5CB4A 4ETIA 5GADl 4U3JB 1KAHA 2VYQA 3QPVA 4ZANA 3D1VA 3NH9A 2XLCA 5BSEA 2CDAA 1NT2A 1CTQA 3PGXA 1K86A 4IXTA 4BNDB 1RZRD 1JR3A 1UWKA 4KQEA 2GHTA 2QAGC 3BN3A 3G5MA 5C8ZA 3K09C 2YKGA 3HZOA 3BF8A 2J9XB 2YHUA 3GBVA 5KTTA 2IV2X 3HJRA 2JFXA 2I80A 3HEBA 2FZEA 5DRTA 3J80A 4KLNA 1VSTA 3BCUA 4UAUA 4UXIA 4OQLA 3ZWKA 2ZSBA 1C29B 2PGJA 4L9RA 5TJ9A 3TIIA 3OHPA 4OH7A 1ZW6A 3MT8A 1XZQA 1UK7A 2HXSA 1V26A 1VPDA 3H5AA 1T2UA 4FDMA 2IWRA 1TEVA 4JIGA 3C15C 2X22A 3NHLA 4IMJB 4U8HA 1FDRA 4RJ2A 3K0SA 1U7DA 4P32A 4JLDA 2L42A 1O9BA 3EZ2A 2EXXA 4HPWA 3AI2A 1GL9B 4RW0A 3U4CA 1XD2A 1OX6A 2BKXA 2C98A 3CRQA 3MWLA 3OLZA 4R2KA 1C7FA 3DE7X 1YQWA 3IT0A 1TEHA 4PIPA 4ZQHA 4P8RA 3SQMA 1JIXA 2JCVA 3N2YA 4EVRA 2JLBA 3L4KA 5JSUA 1OKKA 4OUDB 1NFRA 1PWHA 4RQTA 1GAQA 3EX7C 2R6ZA 4R1MA 2Y66A 4E94A 3CUVA 1JKXA 1UJ5A 1J9GA 2IYFA 2VJDA 3RK1A 5JVDB 1P7WA 3GCXA 2II6A 3GFGA 1P0PA 4N8SA 5HKOA 2ZCJA 1B6SA 4WEOA 1IL0A 1LPBB 3QVGB 1KO7A 2A7XA 3UMYA 2ZBGA 2ZYTX 3LHKA 1P1BA 3RS4A 5A06A 1UBHS 4N03A 3HJFA 1PFQA 2VC2B 3PI6A 4LJLA 2EBFX 4DR7B 2MYPA 2Q6KA 1TMOA 3JSXA 2XNCA 1YBVA 5B3JA 1IEVA 4RWZA 2Q62A 1PSWA 4J94A 5DT2A 2EOAA 4F06A 1W48A 1KI6B 3L8MA 4RZXA 5EXXA 2FUKA 2I8CA 3UW1A 4XWWA 2VDKB 2WTNA 4FINA 4KC0A 5T4EA 4BNHA 2QK4A 3T12A 2VT2A 4Z9XA 4DLZA 5J4VA 1TJ7A 2IELA 4V0MA 1XNHA 1KXJA 2PJDA 3EVAA 4RKQA 4KMOA 1DG3A 1BXRA 1PL0A 2BEWB 4IXNA 2O8FA 2DP4E 4TSKA 1L5FA 4ZEWA 1BMFA 5ALPA 2BE9A 1O94D 4MYRA 4OLBA 1YVEI 4UJ3A 4KWHA 4WK6A 3G0DA 3EPHA 4JLSA 3LFTA 5AW7A 4UNQA 4W5HA 3RF7A 3JQQA 1QNFA 4UASA 4CWAA 3TOXA 1H9AA 5AI9A 3VPDA 3FPAA 4A8JC 3JQ6A 1QX3A 1RWNA 4DANA 1M75A 4ZIRA 3QWBA 3X1YA 2NP6A 1WCIA 1MGPA 4DJ5X 2XZLA 3VR6A 2AOUA 5KREA 4FGWA 1VMDA 1TM4E 1UCFA 2WTEA 1IY0A 1LRLA 3BIXA 3UMCA 1INLA 3L43A 5JAZA 2BEVA 3COYA 1JHZA 3KC2A 1RHKA 1JR2A 1J56A 1WEHA 2GR9A 3T1YB 3HO1A 1AHNA 2X4LA 3GUHA 3HN6A 1UEJA 4GUDA 3V9PA 3WYGA 3IDAA 4JXJA 5AK4A 4HDAA 3UHJA 3VZRA 3ZWOA 4GDMA 1ULBA 1DKLA 1KAMA 3C3XA 3RSZA 4FM9A 5J2TF 1HYEA 1U1GA 4IGAA 5FR1A 1U5BA 1KEWA 2B2CA 3RROA 2FZVA 1C50A 1V8DA 2XW6A 5TQ2B 3UICA 1NMYA 1NYRA 1FYXA 4I7EA 2CW5A 2DG2A 3W2HA 2R00A 3S8YA 1W75A 2RK6A 3KZCA 3L0ZA 1Q95A 2IYZA 4HEHA 4DWJA 5C5CA 2PMWB 4P81A 3AUAA 1LBQA 4CM1A 1HE4A 1XEFA 4CKCB 3QQPA 2FQXA 3DAGA 3A0RB 5CITA 2I6QA 1IVSA 3JU3A 4KUHA 3PYLA 1E59A 1IZYA 1GNVA 3JD3A 1TD1A 3MRXA 3NV7A 4JP1A 1OQAA 2OC4A 5AKXA 5K8UA 2J5BA 1D5WA 3ZKWB 3GAZA 3EEIA 7REQA 1GRVA 1ORRA 1NJFA 1IN1A 2DFNA 1O8BA 2PPVA 4Y2TA 1UAYA 1KYTA 2OCYC 3L1UA 5TEVA 5KYKA 1A7UA 2HX1A 3UB4A 2FXIA 4I5FA 3SWWA 3T3NA 1EKXA 1OH5A 4C0WA 1KJJA 2D3TA 1FU4A 1MZVA 3T3IA 1XJ0A 4KR3A 1ZGBA 1TCVA 3ZOZA 5GJBA 2B4YA 2WFZA 4Q3CA 4R5MA 2J9RA 3TCXB 3BXPA 2HRRA 1G21E 4N49A 5AW8A 5AVWA 4D3SA 4DN6A 1FB5A 1UBUS 1XFAA 3AV0B 1U2DA 1Q7TA 4UMVA 4Y6OA 4ZMBA 1XNRB 4DC9A 5AR1A 4NENB 3WGKA 3UT5B 4UUOA 4DTIA 1P9LA 3I34X 3TZLA 4ZHQB 2J7PA 2FSVC 2EFJA 4B4UA 1D6JA 5LZ8A 4W1SA 3GLIB 2GZDA 4BEVA 4UVEA 3ELUA 2HSDA 1U2TA 1FDIA 2QYHA 3TTVA 4O2AB 5EWJB 3O3OB 3HHEA 5B53A 3RAJA 4IGIA 1O77A 2P3OA 5TS2A 1I7SB 2CUZA 1M9NA 3QXSA 2WJ4A 2G6BA 4UE6A 5C7OO 2PX6A 5ER6A 3TIVA 4BQSA 4ZI7A 4BLUA 5J2TA 1CVLA 4FVTA 1KAGA 5JXGA 5F2NA 2ASVA 3NJRA 5CCDA 5D2CA 3VBEA 3O5AA 3HDVA 4KX3A 1ZFNA 4L8GA 5SZIA 1NVTA 4MQMA 4CG2A 1QQ6A 4NHOA 3E4CA 4EUNA 5HZMA 2Y0PA 1L7EA 2GESA 5IAEA 2XNDA 1M6VB 5H16A 3ASVA 2HU5A 2IU0A 5FNVB 3QH4A 1CRZA 4KSYA 2VUSA 3ND8A 3I5AA 1RFLA 4BFSA 5K0CA 4IDGA 1UF9A 1XMSA 2H29A 3CF6R 5FR2A 1I2CA 1HI9A 1E3JA 1M34B 1OU4A 2V65A 2VRWA 4EBFA 3D5EA 2WYOA 1QG2A 1H94A 5HMMA 2E4AA 1RAAA 1GNTA 3RRZA 4E5KA 3GEMA 4V0RA 2Q5QA 2A5FA 1MDFA 4EK9A 2DAPA 1W46A 4YMGA 4QUKA 4CW7A 1AA6A 3KQNA 1KKLA 3OY2A 4KTVE 4Y2HA 4HZIA 2GPTA 1Q0LA 3E7PA 3REFA 3ZHSA 4MKIA 4HAVA 1KOGA 4TROA 4L3VA 1VLHA 4R9SA 2IHYA 1H4SA 1H2EA 3LCRA 4FEEA 3MCVA 1Q0SA 2EG5A 4TTQA 2W2TA 4D6XA 4EPYA 3W3AA 2FX5A 4NFHA 4L75A 4YCJA 1E20A 2P6MA 3HP1A 2RK3A 2AW3A 3TTUA 5IABA 3EXFB 4MQ6A 1PSZA 3LYUA 3WHPA 4Z5XA 3LZDA 2YV5A 2LV8A 2WWVD 1U1DA 3JWEA 1CY0A 4N6NA 3KKZA 3IDZA 1SQ0A 4LBZA 2IX3A 3V5NA 1A5SB 1EWVA 3ZHUA 4XWTA 2P2GA 4XPZA 3U4QB 3P9CA 3FJOA 3ZIAA 4YP7A 1OTHA 4XM0A 2OD9A 3ABSB 4XDGA 1WUIS 1P45A 2Z1MA 1RXVA 4REQA 1SEPA 1Z33A 3VZDA 4I9FA 3F7TA 5FEUA 3U1TA 1HT2E 4JBIA 1TAHA 4DSUA 5AKZA 1F1JA 2YR0A 4CL0A 2D2IA 2H57A 4KH1A 1NBIA 1MX5A 3UJDA 5ADWA 5DYNA 4GKKB 5A03A 5KINB 2HSEA 4EH1A 1M6YA 1UFQA 3S0JA 2PO7A 2D2VA 3CE6A 4QDXA 5TF4A 1E3QA 1ZBDA 2C77A 1XRJA 3I5UA 3KHUA 5DV9A 1UBKS 3A10A 1L5HA 3TLMA 3HFSA 4X3CA 1BW9A 4KGDA 2QY9A 3JZFA 2GCIA 2GI4A 3N3BC 3I6IA 2QMEA 1VSVA 2ZROA 4XCVA 2ENUA 2Q7DA 3G0IA 1SUAA 4FHDA 1RJGA 4INJA 1AZSC 3RYFB 4A2CA 4Z4QA 5J1SB 3ZS8A 5CB4B 4IIDA 1UBTS 3OZGA 1A4IA 4GBED 1K2VN 3UENA 4OHYA 1Z7GA 1JQKA 1VG8A 2OFOA 4LXIA 5AOVA 4HNGA 2X3YA 5FWYB 3RYTC 1V6AA 2CKMA 2PL1A 3NP9A 4C7MA 4MVJG 5IT5A 3WC4A 4CQMA 1QGED 4C03A 1D0IA 1ZN8A 2G9ZA 2ZDQA 3H5VA 1Q22A 2OSBA 1CUIA 1Z12A 3VC1A 1JKFA 5JC1A 3DPSA 4DFDA 4EQ6A 1T2NA 4MJ3A 3S70A 1W34A 4OHCA 3CRVA 3CW9A 2BGMA 5EIWA 3DQZA 3S1AB 4JBWA 1YASA 3JQGB 3PSHA 4I55A 2RGUA 4K6KA 1L7RA 4R9VA 1ZJJA 4FGKA 1G8FA 1NRIA 2MHCA 4FXOA 1HE5A 3MT0A 1YZKA 3TSCA 3X2EA 1EVIA 4ZO7A 1KJ9A 5L7TA 3MTIA 5JS2A 4H17A 4FHCA 3HTXA 1LUAA 2AFHE 3QYJA 4MVYA 1EQUA 4UBOA 4K87A 4NMWA 1Q1ZA 3GX1A 1LTQA 3BE8A 1ZVQA 2CNKA 4TVBA 2GZRA 2XUKA 1U2EA 1O6GA 2PX8A 4B76A 2EW1A 3IRUA 2AMJA 3SF0A 1THZA 2Z6QA 4NL4H 3PJDA 3X1ZA 5LQRA 2YN2A 5A6SB 1M54A 2DKFA 2P5SA 4ADSG 5JMTA 4QUHA 3T5BA 1ZL0A 1KVRA 4MR9B 1TB4A 4Y3UA 2JLUA 3FNBA 4O1IA 4TKLA 1T25A 2QJOA 3BERA 3SZOA 2G7ZA 2W8BB 3G6WA 5CM8B 3AGPA 3EIWA 1TVMA 1VE3A 3AEKB 3VISA 3GLKA 1GL3A 3QJ5A 4LZAA 2DBRA 4YAWA 3UGTA 2D8AA 4B84A 1AOXA 1O9GA 4CJXA 3MLEA 4XXHA 3Q40A 2QAGB 2P79A 4RA9A 5KUTA 3OESA 1RLTA 2AR9A 3BD6A 3QHQA 4I4NA 1WHSA 2RJNA 3UOAB 2ISSD 3CRZA 1N0UA 2B99A 2E4XA 3QNMA 4U02A 2EJUA 4U7GA 4YRJA 3SSNA 3G79A 5E3HA 3WTCA 1M1NA 4ZOLB 1VLMA 2FK8A 3D02A 4H3VA 3VTAA 3NHUA 3COPA 1YR9A 3L4BA 1Z6PA 4MZXA 3H2JA 1W4RA 2HMYB 2I22A 2F7SA 2O3TA 2PQMA 2OD7A 1ODFA 1WUHS 2IOFK 2A9JA 2XCIA 3GXBA 4II3A 4NYJQ 1YIDA 2FY8A 4JODA 2W6PA 4JI8B 1KZYC 1MTOA 3ZJVA 3SCZA 4E0BA 4EKEA 4Y2RA 4G9BA 1OLOA 2WU3A 2Y1OA 4P4SA 4X1IA 5ESDA 1ZI9A 4D45A 5DYYA 3H0EA 4ZVKA 1BWPA 1PGQA 1DADA 4F4CA 4QHTA 4U9UA 3SZUA 2JEOA 5AOCA 2QN2A 2UXDB 2VJBA 3ZCTA 4WN9B 5EIEA 4DJDC 3DT6A 3NM4A 1BS2A 4G1UC 2WUEA 3DF9A 4EMUA 1GKLA 1E8MA 2Q7OE 1IWOA 1ECJA 4JQSA 4UARA 4ED9A 4WX2B 2B21A 4AF6A 2G07A 4DNOA 5IS2A 4O4IF 2NNWB 4N5MA 3IQFA 4GMHA 3A2MA 2WKWA 3EA0A 3ITEA 3D8NA 2IE0A 1I01A 4JROA 5T6BA 2YWRA 3FDZA 3REQA 1SG6A 1FUIA 3M8KA 2E18A 1DO8A 2V7PA 3EGXA 3FNRA 4EMBA 4XM2A 2IP2A 1TJ5A 5JNLA 2VH5R 5IULC 1LD3A 3HUTA 3K31A 2WUGA 4LOJA 1E2EA 3E0QA 1RJ9B 3CCFA 2NVUB 1FNNA 1N2CB 5DBFA 1A8SA 5JADA 3PFBA 5LUBA 5JQGF 3U60B 2WYVA 4REMA 4KNYA 4APAA 4RDHA 1WUJS 2X2PA 4WD3A 3BFPA 1C0PA 1IQUA 1RWOA 2D62A 3ZWBA 5HUJA 4OD0A 3JQCA 1RKQA 1X6VA 4ZVLA 3T54A 2YJ6A 1DCFA 2AC4A 4JYCA 1NJ8A 2E4YA 3LWBA 4PINA 1W35A 2UZ0A 3G8BA 2W71A 1RYNA 1EXMA 2BBOA 4J0JA 1LPSA 4MRAA 5ALNA 1EWQA 4KSBA 3GK3A 3P97A 2NU6B 1F51E 4DQKA 2Q5CA 2JRCA 1G2IA 1T9CA 5JBQA 3VH1A 4PHHA 3KETA 1O6FA 1J2RA 2QZZA 5JJIA 3HYRA 5HQTA 1L3CA 2QSYA 4Y6GB 1PS8A 2ZB4A 5KSOA 4PW0A 1Z63A 3I2YX 4PSDA 1O0CA 3QOWA 2AFIE 2I6TA 3KR1A 1I7LA 1ATZA 3LRPA 3T7JA 1OMOA 3FMGA 4TM8A 1CUXA 4Z6KA 5JH7B 2P90A 2MSDB 5CEEA 3KKKA 2BKEA 1TJWA 4ZMRA 5KYWA 2H2FA 1F6WA 1L8XA 2HJVA 2PFKA 1FFAA 5T4FA 1Z4LA 1ZW1A 3STYA 2QWXA 1JT2A 2R8XA 4IG9A 3TQCA 5J47A 1UWVA 3TSAA 4CM4B 4GLLA 3WJAA 2A2ZA 2CLCX 4RH3A 1HDRA 2V96A 1Z0JA 3AR3A 3HMQA 2GYVA 3SYRA 3WJ1A 1GTMA 2ZSKA 2ACVA 5HCIA 4N5DA 5AJZA 1GYRA 3A6LA 4RM3A 5JPIA 5B3LA 3WMEA 1N0IA 3RWOA 2AJLI 4CDMA 3GPCA 3PWKA 3FF4A 3UMFA 4UHEA 3KLPX 2RH8A 4Y2QA 1Z47A 3CBGA 2XEXA 3RS3A 3IJ5A 1E3WB 4OQEA 4FFOA 3KUKA 1WBDA 1FZQA 2G88A 4P93A 5DMXA 1CX9B 4RK1A 3ZWCA 2VJOA 1LU9A 3PPXA 4GI2A 5JQGA 1NF8A 2GEBA 4GPIB 2HN9A 4JJ6A 4Y6RA 2H4WA 4R31A 1C8KA 4GL2A 2APJA 1SFRA 2AG5A 3VBCA 4KR2A 1M66A 2OGUA 2V6JA 3V7NA 2HL6A 3B7GA 4TRNA 1CV2A 3OOEA 4KL8S 4L50A 1JG4A 5CLGA 2WJJA 3MEQA 4MA4A 4UEKA 2ON6A 1UM9A 2BFMA 4QRHA 3QUBA 3RC2A 3OCXA 4UFNA 3PTAA 1TM2A 1TVEA 4B3HA 2GB4A 3EHDA 4HADA 3HM9A 3PGLA 5C8XA 5IDVA 1DAMA 1OA1A 1ZBQA 2R85A 1V4VA 1ZCJA 2YNMC 1CB0A 3QWHA 4FYVA 3L0DA 2NG1A 3E0XA 4UPDA 1E96A 1ULSA 4DPMA 2COKA 5KOYA 3R9XA 4RADA 4EG5A 3G5LA 4EA7A 4TTRA 3ZK8A 3P9XA 2Q7XA 4XLZA 1GQ2A 2EBWA 3BA6A 3EGDB 3E8SA 3AFIA 1J33A 5DBIA 4IF6A 3C5EA 3AP1A 4AK9A 1ZNWA 1GPKA 4INAA 5ADHA 1EUQA 2GAAA 1UL1X 2AG6A 1FFGA 5E6SA 3IHWA 1OBOA 3SXJA 1EJ2A 1YR7A 4OHMA 4FX5A 1SVWA 4U6QA 2X9LA 4HCJA 4IDPA 4D0SA 2W2PA 1Y5RA 2F59A 4C2AA 1EJ6A 3KPUA 3IP6A 5IXSA 4PN7A 1GDDA 3CO0S 1XX6A 4AAYA 3JYHA 3NO9A 3DEZA 4QVKA 1AURA 1MG0A 2NU9A 1COZA 2ZUTA 5IM4A 2OCBA 4BMOB 1G5TA 1PHPA 1KH2A 2I1WA 2WFLB 2YHSA 3O8NA 3GLHB 2BFDA 1IZZA 1QIFA 4ZQIA 1H05A 3IUPA 1XJCA 3KKNA 4GYJA 4IWYA 2PN1A 4TKVB 2I9KA 3EDQA 1VZ2A 2G9RA 5DX8A 2YQ4A 2FN3A 4CMBA 4RTKA 5D84A 5DNVA 4EYQA 4UD6A 4FFBA 1GY8A 1KBZA 1XA4A 2OG1A 1U8AA 2QGFA 3MAAC 1YZVA 3RVRA 3ZHVA 5BV2P 2VATA 3BM5A 3DOOA 4CR7A 5ALXA 2YHIB 1RXWA 1MOSA 3A4MA 4GLBA 2BEUB 1GFIA 1TJ4A 3SOPA 3RJTA 5A62A 2Y99A 4DLLA 2A0UA 3OCVA 4OQ4A 4AJHA 4RIIA 1KY5A 2VF7A 2XUDA 3Q6IA 2RHLA 3QW4B 3DEFA 2BISA 1IBCA 1BA3A 4ER3A 3S5UA 3QOXA 3SXPA 1OZAA 4DARA 1ZR2A 1EI9A 1I0ZA 3KT3A 1PD1A 1YHNA 1M2JA 3R76A 3RRFA 4E1BA 4DB4A 1CS4C 1D2RA 2Y0EA 1NQAO 3LC7O 5K3CA 5BN3A 3T35A 1R3UA 5ISMA 4TYNA 3LP6A 1M2OA 3ZW7A 3F6SA 5DZSA 1VCOA 1T2AA 3UBMA 4NAUA 1P19A 2B0JA 4X93A 4D80A 3QUCA 1Q11A 2FYTA 4DEXA 4IKPA 1BKYA 4AURA 5L7WA 4CCWA 2QTCA 3G0OA 5FLYA 4K2HA 1Q20A 1SB8A 1VYUA 4Y67A 4I1OA 4JQCA 3GJ5A 4PF1A 1YB2A 1K88A 4J0CA 2OMEA 2A5GA 4XLTA 4EDHA 2Y1WA 1KYIA 4QU8A 3RHTA 5LKRA 1TU3A 4P4NA 4YCBA 2FSPA 2JJ2A 2ZI4A 2Z98A 1ML3A 4J03A 3BWCA 1OE0A 2XJ4A 5DI3A 4L8LA 3M89A 1TIPA 2V55B 3FROA 3ZGXA 2PBZA 4M6WB 2R87A 1G1AA 5AK5A 5DYWA 3S28A 4C06A 1RBZA 1DMSA 1T34A 3VR5H 1XBTA 1C41A 2EKBA 2ERXA 3A1UA 5ERXA 3KHTA 3LUHA 5CT8A 5G0WA 3O2JA 1Q50A 1Y3FE 3P5SA 1QCCA 4KUEA 4YASA 1F5SA 3W4IA 2B98A 5F78A 3EPLA 3OJLA 1FURA 5AM4A 2ZOSA 3ET5A 3LPDA 2CNNA 3HCNA 3K6KA 2L69A 1AQ6A 4TWAA 5ABPA 5LQJA 2V97A 3Q5GA 2GETA 2ORIA 2VPZA 1M2FA 4MHTA 1S2IA 2O3UA 1W8DA 3A7DA 2BKUA 4AN4A 4IQFA 2JK1A 3A3YA 1E6UA 1PBNA 3NOOA 2OFWA 2GWHA 3PQCA 4KXNA 3Q8MA 2RGAA 4QRIA 1J1IA 1Y1TA 3HWWA 1BRTA 1MG5A 3R4VA 5ITZB 2I03A 2FU5C 2P8JA 4FNGA 4PIMA 4RQAA 3BJIC 2IXAA 4P82A 4H1WA 3TNJA 1DEKA 1X7ZB 1WE2A 5EL0A 4DAOA 2Q3BA 7ADHA 2A30A 2NZXA 4QD3A 4MVJH 4PO1A 3OD1A 4BGUA 3PR3A 4DCUA 1SNYA 2FDCA 1QFXA 5AJWA 4FYXA 1JHUA 5I7HA 1OAAA 1GA4A 1XMVA 3G8DA 3LPMA 4BN5A 4EJ0A 1Y5LA 4BBAA 1ZJYA 2WG2A 4ISBA 4J4TA 1ADBA 4GMXA 1W4ZA 3UXYA 1ZCFA 2FWAA 3NX4A 4XJXA 5ARCA 5HE8A 3WKAA 2X42A 2RGGA 5FWXB 1NBMA 2XQFA 1EVJA 4EHAA 3CWCA 2XWQA 1JDVA 3URKA 3WLQA 1H6AA 3IJPA 4RVSA 5BT9A 1ZAKA 3JVEA 2ZJ5A 4FBMA 4K9OA 3LPLA 5AVUA 2Q5HA 2DECA 1ULTA 1Z0DA 2NV2B 5BORA 2LIVA 1K66A 3E9RA 1N5MA 1PQWA 4BQQA 3E53A 4YCNA 2F8TA 1E1LA 1QHYA 2N1BA 2OSVA 2NTYC 2Z1DA 4G2TA 2WPDD 3IUQA 4CCAA 3DAHA 3UAZA 4Q4JB 2C0CA 4U00A 5J4LA 1QF6A 2I55A 2I3AA 4JL5A 4XTRA 1BMTA 2X75A 4I9UA 1F2UB 5HFAA 4WSOA 3A9UA 4Q12A 2QL5A 2E4VA 4W9RA 5TMDA 3TGLA 3DE1X 3FRJA 1QTRA 3UFXB 1WD7A 3A8TA 5AJXA 3U7QB 3T5GA 4I4IA 1N6RA 2B2NA 2AJDA 2W4IA 4CIYA 3U5TA 2ECOA 1YFJA 1IK6A 2A6PA 2FPGA 2D1RA 2QN6A 2FFAA 2ZJAA 3UH1A 2WKSA 1W85B 3IP9A 4REOA 1C1XB 2VHTA 3I39X 4BVBA 2LCIA 1I7PA 3I2JA 2RHBA 2BHNA 3LFHA 5D3ZA 4EW1A 3WLAA 1G59A 2H2GA 1YE5A 4G6ZA 1W76A 4QU9A 1DAPA 3ZCQA 1YUNA 3MVEA 4CE6A 5JROA 3ORFA 3ZXUB 2I91A 1DC7A 2JAQA 1PG0A 4ZZ1A 1YB7A 1XT6A 4DG8A 2A5LA 1B8NA 3VHRA 4U7DA 3FB1A 1N9ZA 4G5XA 2FV8A 2YJ5A 2DSTA 2Z95A 4FFNA 2QNBA 9LDTA 2VNKA 4R40A 2JLVA 4PG5A 4CM5A 5TMPA 2YZGA 1ZUWA 2GCOA 1W0KA 4U7FA 3E05A 1YBFA 3AR4A 4W8HA 5EJMA 2JGIA 3KYIB 3O7MA 1K97A 1JDPA 1T8WA 2G06A 1XRNA 3GDOA 4NG4A 3ZVNA 4GZ5A 4EHNA 1GARA 1Z6YA 2DLNA 4XB2A 2Q21A 4KR6A 1PJTA 1NQUA 2XRFA 3WQSB 1QFYA 4W99A 3RRYA 3ZQ4A 1LVGA 5K03A 4LGCA 5EEHA 4D0NA 1X8LA 3C3MA 2ZW9A 2XXAA 3W8NA 4H0CA 2V7WA 2NO9A 2EQAA 5EP3A 3DYIA 4K86A 3VJRA 1KEKA 3E9NA 2HKIA 1Z5WA 1OILA 3SHTA 3QI2A 1Y8ZA 2VUUA 2WAYA 2QD2A 3T5DA 3MSXA 4I8IA 3Q8XB 3KKQA 2BN4A 3N8GA 1C9JA 1GT91 3WY9A 2W6QA 4TZ0A 4URWR 4RNDB 3THWA 4U2BA 1QO0D 4TS4A 4BZZA 1P81A 4WNAA 1FRNA 4DJEC 3DV9A 1JV2B 4DSOA 5EWLA 2W6NA 1NDQA 3QMPA 1I9CA 4BZXA 4ZGWA 1U0HC 4HY3A 2HB6A 5GQSA 4CM8A 2PJRA 1JYSA 3OEEA 4BEJA 3ESDA 3SK0A 4PN3A 1H66A 5DF1A 2CXOA 5SY9A 1XWOA 5DTIA 2H7VA 4KYIB 2QTGA 1EFAA 3VOBA 1JIIA 1RAGA 2ZI5A 3L7LA 5FKJA 3RK4A 1XEXB 4NHEA 3FUCA 1U4SA 1ZGGA 4WFQA 3CXRA 1D2HA 3DM5A 1QHEA 3CZ4A 3MMXA 3TGPA 3HP4A 3WLJA 5BNZA 4UMFA 1TKBA 2PMEA 3SQWA 5DHRA 2CXPA 3R6DA 3TLGB 1FMFA 3BIOA 4CM6A 1HGXA 3IEUA 5HS4A 4CR6A 3KD3A 3TMYA 4F1WA 2H4HA 4HGNA 1KJ8A 1UP6A 4Y2UA 3NANA 4ZRDA 4C4PA 1QE3A 4ZALA 3I9KA 5FLEX 1A98A 1XRMA 1AUVA 2P9HA 3IXMA 1ZCZA 1SGWA 2DY0A 2QMHA 3IE0A 5AVJA 2EKDA 4FOTA 4RFLA 4CT0A 1QXSA 2VTEA 1TK9A 4JJ4A 4OIFA 2JBHA 4EZEA 5JDIA 4ML3A 5IJ0B 1PBTA 3F3KA 4LISA 5GM1A 3WLEA 1XTRA 4ZAZA 1P2SA 1X8KA 1SD5A 3PUYA 1TD9A 1X94A 3B6MA 3PS9A 1D4OA 3EQ7A 2NU8B 1JQJC 3WLSA 5K3SA 2VJMB 3AX6A 2FQ1A 2CN1A 1N0WA 2NXJA 3KAJA 2NZVG 4FS8A 4HWRA 1D4AA 4OVKA 1GPH1 4PG7A 2XDYA 2WIKA 3B1ZA 5FOXA 3E2PA 3GQBA 1DBQA 3X1JA 4TS1A 5KMGA 1UKVY 3HU2A 1RE5A 3ZWMA 2ZIFA 4XUEA 2RBKA 2HO5A 1VKHA 1IW7D 5AFSA 3ZV6A 1ZI8A 2HMVA 1SKUA 3K0CC 4G5SA 2D3WA 3O4FA 4KW7A 4CPDA 4LYHA 2B9VA 5B2ZA 4WBNB 1D5CA 3P9NA 4LE1A 3BTUA 2NAPA 3L9WA 4Z4CA 4KRYA 2WOOA 1OFVA 2O3QA 2C1EA 2IXDA 2D2XA 2N1MA 4I5EA 2X0NA 1DTWB 3MWJA 2Z9CA 1OC2A 4JENA 4DLXA 1Y34E 4K5QA 1N8TA 3MUFA 4BP1A 1SG9A 2PZAA 5KSWB 3MELA 1PTKA 2B94A 2HCBA 4XIIA 4G01B 1GHTA 3EC7A 1ORTA 4M53A 3OJOA 3Q7PA 4WA7A 3TSWA 1LWNA 2GVZC 1BTOA 5CAEB 1MOZA 3AKCA 1T0JB 4E3ZA 2JATA 2R4QA 4RYLA 1DUIA 1TF2A 2FP4B 1F6DA 1JP7A 2C0QA 2HQSA 3L8YA 2H1CA 3MSCA 3TTSA 5IEBA 1PEYA 1CUSA 4WL0A 2VK1A 2MR5A 3IR6A 5HIIA 4QDKA 4MVJP 1Z08A 3E84A 2QN1A 4V3CA 5CFQA 1HX7A 3AVWA 1G2PA 5K0JA 3Q7RA 6PFKA 1EHIA 2X2EA 1S1MA 2YDYA 3NAZA 4DG9A 1QBGA 2YCLA 5DLEA 3RASA 3RSSA 4DB2A 1ADGA 1G3RA 4ZICA 3JASA 4QSHA 2XB4A 1FSSA 1SC9A 1V5FA 3PGA1 4ZOAA 3UHFA 4BNDA 1YFKA 1KQPA 4Q01A 2PV0A 2JHGA 4J43A 1REQA 1LJ8A 4KKXB 4CTKA 5C1DA 1GN8A 4E6PA 1P61B 5BSGA 4A23A 2Y67A 3KZVA 3RVKA 2AB0A 3U16A 2BDEA 3HU5A 4LHWA 4WASA 2MSKA 3C1OA 1GGKA 1XEAA 4PONA 4HL6A 1DBVO 1GZ7A 2J5RA 2OO5C 2XOKA 3OJCA 3NKLA 2CNLA 4CEIB 1EFLA 3RAFC 1E6CA 2Z30A 3LCMA 4JSYA 2X1VA 1LLQA 1WX1A 2RHJA 1JEYB 4XWKA 3GPBA 3ZTWA 4AZ3B 1KY2A 4OBBA 4YXFA 1X1AA 3B9RA 4HB0A 4OFWA 2HA0A 5C34B 2VCHA 1YVUA 2X6TA 3MYYA 3CZ5A 4P4LA 2QPOA 5H81A 2W8ZA 4KZKA 1RQPA 4YUAA 5JI3E 1H2RS 2VT3A 1B41A 1HC7A 1VLQA 1T9DA 1CQJA 2ZI3A 4NMXB 3KB8A 1CHDA 4XARA 5JSZA 1NRXA 1Z5OA 4EGFA 5AT1A 1QYIA 4IDEA 1UXKA 5HIAA 1R8QA 4LY9A 3IESA 3PE4A 1UPBA 4QXRA 4JJKA 1Z82A 1BN6A 4K0KB 1DEHA 1H4TA 3NIDB 1E2FA 3UJ7A 1ZU5A 3RVLA 5JPCA 3EQ6A 2HA5A 3LV8A 1Y3BE 4TS3A 1XD8A 2H4JA 4I9GA 3O8RA 2ZPUA 5FYDA 3KQSA 3BXFA 2DT5A 1QORA 1UMDB 1NXTA 1A71A 2AN9A 2CJWB 4BP3A 3IOBA 4ENQA 3OEHD 3SEZA 4C87A 2Y05A 3OZWA 3AY7A 2QSUA 3UMGA 2K7ZA 1UJMA 1ADFA 2WR8A 1QIDA 2MDTA 2O2DA 4YO7A 4BP8A 1K7SN 1AKMA 1C30B 4BFTA 3BK7A 1QVAA 2JFBA 3RVJA 3DBRB 2HLNA 2R4UA 3EVEA 4MRMB 3FLAA 3VYUB 3GMIA 1LSOA 3H7IA 1IIBA 4GI1A 5KYYA 3FYUA 1WPGA 4GBGA 5A05A 1I2MA 5BNWA 3RSQA 1M3SA 2XKJE 3WZLA 4IIJF 1NW7A 1ZXLA 1RI2A 2HXGA 1V5EA 1N57A 3MWDB 4UHJA 3CZCA 1G98A 2I4TA 1DAHA 4JBGA 4RE6A 1ZSVA 1HT1E 4BKQA 1M0SA 4XB6B 4XIJA 2JH3A 3U7EB 4RZIA 1FQJA 5CLQA 1T9ZA 2OR3A 3CKYA 5FOVA 3WL6A 3ZU4A 3ZW9A 3U7GA 4LJAA 1YQQA 1DDIA 1L7BA 1QH1B 3I6BA 5KU7A 5L40A 3IDFA 4FJ2A 2JKVA 3AZPA 3OUZA 1R18A 4UJ5A 2ACKA 5AW2A 3E82A 2DLCX 2ECQA 2ZZKA 2V3WA 4LNUA 2D1SA 4NBUA 1WAMA 1QRDA 3C7CB 1P9RA 4N7RA 2HWUA 5TGZA 3QLVA 4HFMA 1AU9A 3R7BA 4FOSA 2QSZA 2W7TA 4FEYA 5EESA 1W581 1CY2A 3P2MA 1JLMA 1FSPA 3OICA 1PL7A 1C3OB 1YULA 1EB8A 2O2XA 3NBXX 1L7NA 3ICEA 1HQYE 1D07A 1H5QA 5GOTA 3AESB 1NVVR 2YJNA 2WKPA 4Q0MA 4DV3B 3LPCA 4MP6A 5KWIA 3SBXA 1T8UA 4NE9A 4E13A 4MAAA 5A0TA 2W6OA 2I6GA 2CCKA 4WXPA 1DNPA 4O8ZA 2ORWA 2GD1O 3KZXA 3AY3A 3CF2A 3U9SA 4K0RA 2JGFA 3IEPA 2J45A 5DP1A 1IPFA 2B7BA 1A7KA 4OB8A 3PXGA 1R10A 1UPCA 2JI7A 2D5LA 1L9KA 3AB7A 4II2A 2VQSA 4WY5A 3G5TA 3L7OA 4K6FA 1JIKA 4PAGA 1YGPA 2X14A 1ZGAA 3ETGA 3LX5A 4G0YA 1PJRA 3ABZA 5CLLA 3RSLA 3LGSA 4S12A 3QMMA 2DE0X 1M76A 4Q3OA 2A9RA 4YLEA 2B8TA 3VGPA 1R4AA 4EYOA 2X2FA 4HUTA 3KQMA 3MTQA 4N0EA 3NHZA 4AUNA 3ENQA 4OKSA 1O97D 3FWYA 1JHMA 2OBLA 3CU5A 1Z2NX 4HR7A 5HG0A 4C4OA 4YRZA 4OY3A 2IUUA 4RIHA 1MVNA 2VN8A 2OAP1 4B73A 1QONA 3K70C 3T9CA 1VGRA 1I51A 3WYBA 4AWBA 1PVOA 1R37A 1TA4A 4BO4A 5HOQA 4WKBA 1GGNA 1M0WA 4MUFA 1TF7A 3NTLA 5TXGA 1N6KA 2WU0A 1U0OC 2VHXA 4R2MA 3CEMA 4JYPA 4CHTA 1U8EA 2XCLA 2CCJA 1NTOA 4RXUA 4F71A 1EEXB 3K9HA 3V4VB 1JIVA 5G1PA 3VGJA 3LVRE 1VPVA 1LDGA 3MJFA 4UQLA 4XSGA 3KKEA 2A9OA 2GTHA 1W87A 4LFAB 1E64A 3ESAA 5BN5B 2LGJA 3DBLA 2ZRCA 1YBHA 1V3VA 1UEXC 3UTCA 3WQRA 4YT8A 5L4NA 2TSYB 4EG3A 1KARA 1Y98A 3ROQA 3D0RA 1K63A 2ES4A 2I7DA 4RK5A 1D2CA 1JG1A 2O0LA 3PUVA 4YAFA 3O4JA 5K3DA 3G2MA 4PXYA 1E4EA 3C74A 1WF6A 5CBPA 1L7MA 1TE2A 3EXIA 1TCUA 2R60A 3NVDA 3WHLA 4HATA 4PR3A 1M1YA 1X9GA 3HNOA 1MA0A 4HVAA 1C3LA 4DLAA 1FP6A 3KQPA 3QFSA 4OXQA 2NSHA 3I3OA 4RCZA 1IWBB 2GBLA 1JNYA 1FQOA 2PKQO 3HB1A 3K0FB 1TZBA 3WISA 1COWD 1RZ3A 2VDJA 4MPJA 4WZAE 2VSNA 4UZEA 1MW9X 1YRLA 3GEBA 3OZRA 2Q50A 3LXXA 4CKZA 4PFJA 4URVR 5KJ1A 2BEJA 5TARA 2IYLD 3I72A 1OWMA 3IYLW 4QYSA 2AD1A 5LZ9A 2XZPA 4WKGA 1FA9A 4G4IA 3NHBA 3TLKA 3M81A 1UOOA 1XP5A 3BKWA 4F9GA 1IHXA 4OYYA 1EFUA 2CLOB 3SVTA 2R7AA 2YQ5A 5DYGA 2W2QA 5EKDA 4RHEA 1VIAA 2B5OA 2XRMA 1RRGA 1P1JA 3OQIA 3TRHA 5H83A 4KR7A 2VTDA 3TUZC 4QNNA 5AQ1A 2IEIA 1KAEA 2RARA 4AJEA 3SJCA 1DEAA 1SKAA 4X63A 5F77A 3NDBB 3HRIA 1ORDA 2IY9A 2CD7A 4JWTA 2DUNA 3UJBA 3QWAA 1NI5A 4JLPA 4COOA 5BOSA 4P58A 4Y98A 5ECDA 3WI7A 4J49A 4EMTA 1Z6AA 3TPZA 1KYZA 3IEVA 4Q3NA 3O93A 4F21A 2V6FA 1X1BA 1AKRA 3RV4A 5BQFA 2V6GA 2B61A 3P19A 2RGRA 4MYUA 2P4HX 4KDRA 3HCRA 1C9DB 3AYZB 4Q7EA 4HD8A 4YRPA 4DF3A 5DXJA 4EPXA 5AVXA 2VZLA 5GWXA 4ISCA 1ISSA 4FLMA 3EGWA 5FI5A 3W6NA 2C4UA 1EWRA 1GV0A 1RTTA 1VPLA 3BXEA 2Q1WA 4X7BA 4YJ3B 4GPBA 5JATA 1G17A 1GJRA 1CR1A 2JFOA 4D4MA 3H3JA 1GU7A 2OCIA 2EWMA 2ZXFA 3DXXA 5BVHB 1HNXB 1ODSA 1DAFA 1XN1A 1BD4A 4N3GA 1UKCA 1X87A 3DC2A 3AHHA 4CEJB 3HDQA 5LB4A 1WOYA 5CP8A 1EQ2A 3A9SA 3VTFA 5BMVB 2G9VA 2Z5LA 2BTOA 4J90A 1N5OX 1UH5A 4U6NA 3TK1A 3M6LA 1M0EA 1G0OA 1Y8QA 2JS7A 3R1IA 4TN5A 2F9MA 3AXSA 3L0CA 5LXTF 2LP4Y 2J5QA 2V7UA 2V9ZA 5CJPA 4HWTA 3MMZA 4E6EA 2W2LA 1JWBB 4GM0A 3H5RA 621PA 1OZ0A 3DE3X 1L4YA 2OZLB 2P9YA 3GPIA 3O83A 4IZ6A 1EWKA 2HHJA 1FVOA 4MO2A 3PEYA 3L5KA 3OPVA 3QXHA 1YMUA 4LHSA 4MOWA 4WADA 4WLNA 1WULS 1Q3KA 1A5AB 3LUPA 4JX9A 2AQIA 4KPFC 3WKBA 5B3JC 3C7DB 5KQMA 2YXLA 5I7EA 4QTTB 1A76A 1V11A 2ZATA 1CY1A 2X5JO 5KWJA 1L4LA 1LY1A 3Q3VA 1T6BY 5EE3A 2VDRB 3QEMA 1LJUA 4MQFB 3QUTA 1QVVA 4H3SA 4IXWA 4IIGA 4PGHA 2V54A 2Z1NA 4LOKA 5GM2A 1MEEA 5I01A 3V1NA 3C3DA 4YRMA 1SIUA 4NCIA 3MCUA 4BYMA 5TB5A 3CXUA 4OJTA 3HXQA 2G28A 1X9HA 1J6UA 4LC9A 4Y1RA 4DABA 5IT0A 1ARZA 1MVOA 4DRXB 1ZQ9A 3KPVA 5KDOA 4OU4A 4K88A 4POAA 1SVUA 1KDVA 3IX7A 3TJRA 1ML4A 2ANCA 2B9EA 2VDWB 4PG8A 2BSQA 1EK0A 4NZOA 1I6WA 3QFTA 1XO1A 1PZHA 1NI4A 5F92A 4JITA 3T38A 2FE1A 5BW4A 1QGDA 1PCXA 5EZYF 2EARA 3EN0A 5JI2E 3M3HA 1BCSB 3NIFB 3BMXA 3SD7A 1ZSYA 3FBTA 4Q6WA 5GP1A 3SM3A 5L3VA 3L8FA 4DV4B 1R6DA 3D6FA 4W5OA 2WSSA 4G3XA 1U7OA 1DKPA 4JLMA 4LHXA 4ZXFA 2QR2A 2A7QA 2J3MA 1BMDA 3RSGA 4AY5A 4DXDA 4YMUA 1K8RA 4JKIA 4AJIA 1QYRA 3NEAA 4R0NA 3DTVD 5HZHA 3CVXA 1OBHA 3GNQA 4LS3A 2EKQA 5COBA 1QP7A 1IJBA 3RFFA 5ALQA 5BQXA 1ZYUA 2Y8EA 5CRIA 4FTWA 2WM2A 3WBJA 3ZNNA 3ZWNA 1S3IA 4F45A 1JG2A 3C6QA 1Y5MA 2MYTA 3S29A 2LZ0A 2R00C 3E5MA 2C88A 1IM5A 4FNOA 2VOJA 3ELWA 2WJZB 2M9MA 3KTDA 1XMIA 4O02B 1PJ4A 1V39A 5EZ5A 2QZ4A 5TQ0A 4CLOA 2J0UB 3L9XA 3PQ2A 5EYPA 4IICA 4WRRA 5CG2A 3TRDA 4WXRA 2BFEA 3PGMA 1L4NA 3ADKA 1GPLA 5AVTA 1V16B 4UHHA 3L46A 4PYRA 4WKCA 4F7WA 4W7HA 3NC4A 3R3HA 5JNVA 4P5EA 3SBEA 3R3WA 4ARZB 1I33A 2JGEA 2WLTA 4DUGA 3PCTA 2BGTA 2IHTA 1MJNA 2YYYA 4V39A 5TGDA 3V4SA 5JMWA 4O4JF 4IMRA 2PG3A 4N0PA 2VUTA 4NDAA 4QFCA 3C3KA 1M74A 4LJKA 4YALA 1XLTA 2ZYAA 1XC7A 1NKSA 3RUHA 1K89A 1NJ5A 3D59A 1C3CA 1I4LD 4PPQA 5FB3A 3O47A 4NJEB 4Y9SA 3IA2A 2VHWA 3I52A 2IOHA 3GH1A 1RRVA 3RAEC 2I99A 2TRSB 1FLVA 1GZ3A 1TMYA 3IQGX 4NK5A 4RM2A 3GF4A 4YCMA 2JI6A 5I7AA 4HQOA 1LDYA 3A58B 2NQTA 3AR5A 3RAGA 2JANA 4K81B 1U2DC 3NGLA 1AMOA 2LCFA 2OQRA 5EZYA 2CZQA 2N46A 1MH1A 2ZU0C 4S05A 2JHCA 4XTCS 5EJGA 4CMGA 1Q2XA 4IQ8A 5T8KC 4AN0A 1M7BA 2IU3A 3L7NA 3QVJA 4QBGB 3SAJA 1RI4A 3KX2A 4Y7DA 1RQNA 3H0CA 3P9ZA 2RHRA 4FMDB 3KXKA 4Y9RA 3VC7A 5FBWB 1SCKA 1LF5A 5F3DA 2C2HA 4PQFA 5K0NA 1GG8A 4CKEB 1W59A 3WK5A 1ZITA 3G0HA 1UKYA 2ZP1A 2W6ID 4YS6A 1Z5PA 3GJTA 4AROA 5IF3A 3E5NA 4RCVA 1G20E 4I36A 3ZI4A 5JQWA 3E9QA 3OAAD 3H65A 1OLSB 1YR8A 3NJ4A 4PLVA 3U19A 1IHOA 1CBUA 2MU1A 2P0AA 2YW9A 3GYBA 1SUBA 2F3RA 3R7FA 1JDBC 2R2GA 2EGUA 2Z43A 4A0SA 3QITA 5FUQA 4OQXA 3WRYA 3W4JA 3IC5A 2R25B 5CA0B 2IIQA 3SZLA 3PQ5A 5EJIA 4X6LA 4ZCLA 4E1AA 1QO7A 2O20A 3IIJA 3LGAA 3PTZA 3DE5X 5IFLA 1ST3A 4YPFA 3C14C 3KJFA 3UXMA 5ECWA 5CB6A 1KDYA 1J8DA 1E4YA 2QDXA 2QGZA 2QXTA 3FHCB 1C9MA 1GLVA 4FFDA 4JIMA 4Y2JA 3WP0A 4MDEA 4YACA 3QE9Y 4NARA 2O1EA 4DIFA 2C31A 1L4HA 3U4IA 1Y6ZA 4OV6B 2WKQA 1Z56C 3MJTA 4N39A 4TSFA 3COZA 3KOWA 2FZLA 4DBLC 2N75A 4UVDA 3K4PA 4V38A 1U0BB 4R7ZA 1QGYA 1DC4A 3FKQA 3ICPA 3L8EA 3V2HA 721PA 4KMMA 1T1IA 3AL3A 2QTNA 1Y3AA 1SCNE 3P96A 1I2AA 4JEHA 5COQA 3RJ5A 3I8XA 3V2UA 2HGSA 1VKZA 3LJKA 4MKGA 3SHVA 4BFZA 1QB7A 2BC9A 3TIXB 3ZEAA 4PYJA 3GI1A 3L8CA 3GNTA 4E5YA 1HFKA 1WKVA 1A8IA 4TMZA 3BT7A 2BTQB 5KVCA 1T5BA 4KPUA 4UXHA 3V7UA 1DQNA 2YV3A 1TADA 4YMWA 4BCCA 3PFGA 4UAJA 1E89A 2OPHA 1QF7A 4TMXA 5K6RA 1FFXB 1QIIA 2EERA 4BV8A 4WFKA 1HFEL 1QHXA 3FNEA 4FLFA 5K4AA 2PGDA 3ZXIA 4BFYA 2CHGA 2WJPA 4KO4S 2A1UA 4CF7A 1BH6A 1CR0A 1YK1A 5J4HA 4F6CA 4B3JA 1XCOA 3BJEA 1LX6A 4JU8A 2QL6A 4IX9A 3VYRB 2O1SA 4LMBA 4TMYA 4O4HA 1N8NA 2WBLC 3RTGA 1HDGO 5IKXA 2KJQA 4R01A 3IODA 1X7XB 5JZSA 2V8BA 1TGYA 3ZK7A 1H6CA 3UA4A 4CBVA 3AKDA 1YI8A 3L92A 2WWGA 3B8HA 4DLSA 4PAQA 4UHDA 4CUKA 4F3KA 1JWLA 1ILWA 4TT3D 1L9XA 5HJEA 3DUFB 1YQEA 5A6VA 3ZV5A 2OK8A 4LX0A 1R64A 3USZA 3RE1A 4JLJA 1UZMA 1O8CA 2X7JA 4BATA 1M8GA 3RHSA 1N6PA 1AJEA 1N92A 1W0JD 2EFGA 4OLHA 3A14A 3DFKA 3W06A 3ELBA 3TQFA 4ALMA 1XFDA 4ZEMA 1A8PA 3ZD7A 2PRIA 1R6BX 3DLPX 1ACJA 3G0BA 4LOAA 1WZNA 1MAAA 1HURA 2EQ5A 2JFNA 1IUPA 1YHZA 4QPPA 5F5XA 2QT1A 1K6MA 4MLDA 2HCRA 2QTVA 5F1PA 3V8PA 2WYIA 5EEGA 3CB2A 4QGSA 1NG1A 5CJ2A 1C9YA 3GRCA 4N3AA 2ZR0A 3OFKA 4OKNA 2JHPA 3OZEA 4NPHA 1QUEA 4ZZ3A 2YL2A 5EWMB 3FVTA 3ZUGA 4ONEA 5A1TA 5FP0A 13PKA 1IEQA 3DOHA 5F35A 2A67A 3R23A 2I6FA 3A3PA 1CS0A 1IUKA 2HPAA 1N9GA 1J06A 1T4DA 2WIAA 3BCHA 1HFJA 1WXHA 1DXHA 3AY0A 2EF0A 3QGMA 1I3CA 5H9VA 3KE8A 1XHFA 4U9HS 4MIKA 3W8FA 3S81A 3ZV3A 3K94A 3SC4A 4UEOA 1YCDA 2O8VA 4FZRA 4JYMA 1L1QA 2BTEA 4OI2A 4HQNA 2R1TB 2DXIA 1AS0A 1EZZA 3IT3A 3W90A 4NFSA 1EYZA 3C1UA 3DAFA 4BZPA 3NRBA 3ND6A 4HXFB 2FAXA 1EUCA 1YKSA 2BV3A 1LZKA 2R7KA 3KJIA 3D4PA 4J6FA 4IOJA 1G8HA 2TS1A 5DLYA 5G1NA 1SOAA 4ZZIA 4IDNA 3ZNQA 4RESA 4Q4DA 5LU8A 3W8DA 1S2MA 2O07A 1O2DA 3EFOB 4G0VA 2VJKA 2RJ3A 5FL7D 3Q10A 2BGGA 3JXEA 4WY2A 5JRZA 1PJSA 1MPTA 1XZMA 1N8SA 3VOTA 5FWDA 4AFNA 5KJCA 5LA6B 3AVXA 1MPXA 4XE5A 4FMPA 2ZSJA 3E8MA 1VA5A 3AB3A 2O2YA 1U7UA 3ITNA 4ILEA 3B6IA 1XZGA 4AULA 3PTLA 1DQYA 3WQQA 4N5IX 1XPJA 2YTZA 3SBDA 1C5KA 4EA9A 1UMCA 3F7MA 4G56A 2ZTSA 1Y1KE 2NTJA 2BHRA 4DW8A 2K2QB 3B7PA 4PHGA 2ZIXB 4NX2A 1Z36A 4AYTA 4EGQA 3HN7A 4JI1B 3RIYA 4DDWA 3OX2A 4H7IA 1GTZA 2W90A 4R71A 1P0CA 2J0SA 4HP8A 3MGBA 3A2NA 1E32A 4PGFA 3LW8A 4HVLA 1NR7A 4GKBA 3PNLA 1O5TA 4JL8A 3SS9X 5J63A 3WSVA 2ZTHA 3DOUA 4RK6A 1NR5A 3IPAA 3J7AC 1P60A 5GONF 3SG0A 1UP7A 2PSSA 3RBVA 1T2VA 1IATA 3O94A 3CLTC 3SY8A 1ENPA 4MS3A 1PT5A 1ZU4A 3VVBA 1GT6A 1SBHA 2ZTUA 1ULUA 2FQQA 2HRDA 1JHXA 2ZYUX 3L0OA 2IYTA 3R44A 3EOAI 1LK0A 4OHUA 1NLFA 1W1IA 2GF9A 2FFRA 4JK3A 4Q00A 3UNXA 3JQ7B 4TLLB 2ZYVX 2GEVA 4KWEA 4BN0A 4P54A 4CYMA 3HBMA 2HLDA 1J23A 2J5XA 3LO5A 4LMRA 5LMUB 1L3BA 3NUGA 1FTQA 2FPKA 3EQ8A 5T57A 4WBXC 1BQEA 4BLTA 3BGDA 4BNKA 2V9CA 2C59A 2X41A 3MPUA 2OXIA 2EAUA 4Q4AA 2NYVA 2CV1A 1FLNA 1QOQB 3WA6A 3X1XA 4K9DA 3V3TA 5A7HA 3VYTB 1RTKA 1OIVA 1T6ZA 2O8FB 1P73A 2VEDA 3CF0A 3BTVA 3NONA 1CIJA 1G7RA 3NALA 3K8ZA 1JU4A 2VI5A 1SBNE 3P4XA 5BW8A 3SKVA 3UAVA 1CCWA 1FNDA 2EKPA 3QVLA 4JH0A 1TVCA 3CGWA 4CMIA 2Y9MB 3QWFA 3B9PA 3LZCA 4RH0A 3LIIA 3CEJA 1RYEA 2VNHA 2TMDA 4YRNA 1PDVA 5J4YA 3GOQA 3OO0A 1JVBA 5T5QA 1M83A 1F8FA 2CLFB 3QPAA 2PKCA 2P75A 3QVVA 1DLJA 4TMWA 1IMOA 3LVBA 1SCDA 2O1XA 2QRQA 3GGDA 4K46A 1IB0A 2GFQA 3HKEB 5D6BA 4B8ZA 1O9HA 3MNFA 1TCCA 4H4DA 2IWHA 4D3XA 5CK5A 1JIQA 1JQLB 3VJKA 2ZRIA 4B74A 1J9ZA 5LKAA 4GVLA 3C3AA 3R6GA 2HHCA 5EKUA 1TQ4A 3ROFA 1VE5A 3S68A 1O5IA 3L8HA 1WVMA 5K01A 5KQGA 3LBHA 3M2PA 4Z54A 1T5IA 1NW9B 3EASA 5CVJA 3EIOA 3PNMA 4G24A 5LN1A 5AVKA 1U5BB 4KAXA 2AHRA 4I3GA 1RU3A 4QM6A 4NG5A 4TGLA 1R6XA 3K2BA 2BHTA 5KCMA 4QVIA 2G09A 1VSUA 2DH5A 1MDBA 2WT4A 2RGCA 3UWOA 1NMEA 1YRBA 3FVVA 1WXGA 2ZITA 3ZDEA 1FYVA 1NATA 3EBLA 5AKYA 1KWKA 3OUUA 4L22A 4K6HA 4KB5A 3ENVA 3LY7A 5EXEA 3V1MA 3GTDA 3C6XA 4MIEA 5JS1A 3JTEA 1MO6A 1FMCA 2VBIA 3DR3A 3HKDB 2QTMA 2GXUA 4FZVA 3MGGA 3ZHTA 4FHEA 3ZDAA 1YJ5A 2G5GX 3I05A 1JKJA 2FMUA 5C52B 2X9NA 4DA7A 3KXIA 3N7AA 3LQYA 4QOFA 2EFCB 4L16A 1ZUNB 3GCDA 3IUYA 2R8YA 4HXEB 1W88B 1C7QA 3TECE 4WUVA 3RIEA 3BICA 3MN1A 2D06A 2Q5LA 2QG9A 3HYSA 1XPUA 5AW1A 3AFHA 3LUJA 5AJHA 4NF2A 4YLYA 3HGMA 3R5KA 1A5TA 5ITSA 3CWZA 3I3SR 4I4TB 1RBQA 3VC3A 3SC3A 1Y6RA 1KK0A 1K8ZB 4R1OA 4RY9A 3T9DA 3AFGA 2BR3A 2G80A 1LSUA 2GZ1A 4HUQA 5D3MA 4AJLA 5AHOA 1JLKA 5JNSA 3LVQE 2GZMA 1IE3A 4R3WA 5C8VA 1IZ9A 5FPHA 5JVDF 4S1PA 1NONA 3V8BA 5M7EA 2BLLA 2YWFA 1MP0A 2HMWA 3K7EA 2J33A 4KMRA 3KSUA 4D9FA 3SYTA 3DLCA 5ESXA 4HDKB 1MIOA 3LLCA 3RFVA 4B4KA 3IHKA 5JCXA 3A6PC 4GPZA 4AX4A 4OMUA 3DQPA 4WLOA 4L57A 4M89A 3V2GA 1VECA 5GGYA 4F2GA 4PRKA 2G77B 1ZOLA 1FLAA 4NDNE 4EG0A 3B8EA 4QJ5A 5JCJA 1XZPA 1EGQA 3RT9A 3UUFA 1FPMA 1LKZA 3KALA 3RJMA 3K4HA 4FOLA 2R9VA 1X1RA 4MA0A 4XVQA 5E4JA 5GINE 5D7BA 5B1SA 1QIEA 3X44A 2G6TA 4D9BA 2ZE7A 4NZYA 1P7VA 4MVJI 3PRYA 1SKYB 5I7RA 2WV9A 4U3JA 4QGFA 1KH1A 1FOEB 2NZ2A 5BSHA 4CM9A 5CA1F 3KTFA 4IZOA 3UC5A 1G3MA 3RBZA 1UDAA 2PZKA 3SHFA 3R3SA 1T5SA 1SXQA 4FI3C 4J8PA 4HOYA 5LBUA 5HQ3B 2OGWA 3V48A 5LR6A 4WV3A 3GEEA 2CDNA 3QTTA 5FJJA 3ROTA 2WYWA 3ZDCA 4CDRA 4TTIA 4LKOA 4J2HA 3SSOA 1SVLA 1PUJA 2ZRAA 4RMIA 3WMFA 2HD4A 2LIPA 2NV0A 2PKRA 3IH5A 1GZ4A 4WXYB 4G81A 1Z26A 1GG9A 1TL7C 5EVCA 5LOVF