1Z4JA

Structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with uridine 2'-monophosphate
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
194
structure length
194
Chain Sequence
RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate specificity of the human mitochondrial deoxyribonucleotidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords 5'(3')-deoxyribonucleotidase
total genus 63
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1z4jA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4jA01
1F5SA 3ESRA 4Y2QA 3L0BA 4HGOA 1XPJA 4KX5A 3MMZA 2WM8A 1RKUA 4YGYA 5ALLA 3PGVA 4GIBA 3N28A 4AP9A 1NRWA 3L1UA 2JAUA 4XOUA 5AI6A 2JGAA 3AR6A 5AI0A 3KD3A 3ET4A 5IS2A 2WF9A 3U19A 4YH1A 5ALEA 3OCUA 1CR6A 1RLOA 5T41A 5ALGA 5AVRA 4EEKA 4UW9A 4I9FA 1KYTA 5AI5A 3QYPA 3QXGA 2EATA 3WKEA 2HI0A 1ZJJA 3NANA 3QX7A 5AK3A 1Z4KA 5AKLA 4Y3UA 3NRJA 3A3YA 2HCFA 3GYGA 4L6CA 2R8ZA 1WZCA 1TE2A 5AW5A 3IRUA 3WK8A 2FUEA 2FPXA 3DV9A 3U7FB 5AKJA 1QQ6A 4Y2RA 3W5CA 5AKHA 5AVWA 4BNDA 3L8HA 4I9GA 2BDUA 3OPXA 5ALOA 2W4MA 2FPSA 3U26A 5AK5A 3QNMA 1EK2A 5AM3A 4ZEWA 2YJ5A 2YMPA 5ALHA 1RPZA 3QUTA 1Z4OA 1O03A 4IFTA 2YFYA 4MUMA 5AM1A 4UM7A 5AVVA 3DDHA 3QU4A 5ALDA 5ALWA 2JAWA 3U7GA 4H1WA 5AW0A 2ZBDA 2YMQA 2GO7A 1K1EA 4C4SA 3IJ5A 4OCZA 1U02A 1JUDA 3ZWKA 3MPOA 4YCNA 1T9ZA 2QLTA 5AK6A 3K1ZA 3UMBA 3I1YA 4BX0A 3U7HB 1L8OA 4UMVA 2HF7A 2JARA 2YY6A 2BDEA 3ZW7A 1L6RA 5AVTA 4MWOA 4L6AA 3UMGA 3OCWA 1TA0A 2B8JA 5AI9A 4C4RA 2PR7A 3FGOA 5A3QA 3U7EB 4XQ0A 1VJRA 2HF2A 2YJ6A 3QLEA 1RQNA 5ALZA 5ALMA 2C8KA 3KBBA 4UASA 3A1CA 2ZBGA 4HGRA 3WK6A 1QQ5A 3ZTWA 4XPZA 2G06A 2HO4A 3N5KA 5AW7A 4CF5A 2NO4A 2R8EA 5AKZA 5ALSA 2AMYA 1ZD4A 4HGPA 5AW6A 2IOFA 3QU9A 1RMYA 2RAVA 3ZVLA 2RBKA 5AHXA 3WK9A 2NYVA 5AI8A 4BYGA 5A3RA 2R8XA 3D6JA 1ZOLA 3U13A 1WVIA 4NABA 4YIKA 4EZEA 1RLMA 2PQ0A 2HOQA 4KN8A 3ZI4A 5AW1A 5AW9A 4HYTA 4KYTA 1Z88A 1RMTA 2FPUA 5AKKA 3KOOA 3A1EA 3E58A 3N8GA 2NO5A 2W11A 3AR4A 4BEWA 2RB5A 3KDPA 3OCXA 5AKIA 4KX3A 2P27A 3OCVA 4Y2YA 4Y2XA 1WR8A 2O2XA 4HAIA 3KZXA 3B9RA 3PGLA 3L5KA 4O8CA 5AM0A 1Q92A 3WGUA 3L7YA 1J97A 1Z4MA 4RESA 5AKYA 3FPBA 1RLTA 3EF0A 2ZBFA 1T5TA 3FZQA 2G08A 2Q4RA 2YN4A 2WF6A 4AS3A 3SKXA 4HGQA 3TLMA 4UMEA 1QQ7A 1N8NA 2EARA 3QUBA 3L1VA 4IG4A 2O9JA 1ZS9A 5AESA 3KC2A 3L8GA 2PKEA 5AIBA 4DWOA 1IWOA 4C4TA 3WKAA 2D2VA 4BNDB 4NWIA 3WKCA 3WK5A 1NF2A 4EX7A 2ZOSA 3WK4A 5AM5A 2I33A 5ALUA 1ZD3A 1T5SA 4UATA 3ZVNA 3NAMA 4QQFA 4PNHA 2DQSA 3NALA 4BX2A 4EENA 2G0AA 4ZEXA 1S2OA 3EF1A 2GHTA 2AUTA 2YJ3A 1Z5GA 3R09A 4DCCA 2WF5A 4CF3A 1XVIA 1SWWA 4J03A 3UMCA 3M9LA 1RQLA 2FI1A 3ET5A 4B6JA 2IOFK 3BA6A 2WF7A 3SMVA 4KNWA 2B1RA 3RF6A 5ALVA 5AVUA 4BEVA 2FPRA 1SU4A 1S8OA 3W5AA 3UM9A 1Z4QA 1TJ5A 2EAUA 5AVYA 3F9RA 1ZRNA 3VAYA 3PCTA 4Y2TA 2OYCA 4UMFA 2G09A 5ALPA 3EPRA 1YNSA 4UU1A 1XP5A 3ZVMA 3N07A 1X42A 3IB6A 4YCMA 3AR5A 5ALTA 1L7NA 4YIHA 1CQZA 2IOHA 4OD0A 5E0OA 2I34A 4NV0A 2C9MA 1YDFA 4FE3A 3ZUPA 5ALXA 5IT4A 5AW3A 2CFSA 4F72A 1RC8A 1FEZA 2C88A 2G07A 1L7PA 3S6JA 5AICA 2BY4A 2I55A 2WFAA 5AM2A 2HX1A 3ZX4A 4G9BA 2R8YA 1TJ4A 3ESQA 3A1DA 2CFRA 3CNHA 1U7OA 2HHLA 3AR2A 3I28A 5IT0A 1Z4NA 3NIWA 3SF0A 4DFDA 3MN1A 2FDRA 4J2TA 1Z4PX 3NASA 1RDFA 2GMWA 2Q4TA 1N9KA 4Y2VA 2I7DA 5AM4A 1J8DA 1TJ3A 2HEGA 4BKMA 4Y2PA 4Y2SA 3ED5A 3HYCA 5JJBA 3WKBA 1LVHA 5AIAA 4AS2A 4UU0A 2ZXEA 1WPGA 4EX6A 3AR8A 4KNVA 2FEAA 3WKDA 3ZU6A 4YCLA 4G63A 5AVSA 2Q5EA 3AR9A 3L8EA 3SLRA 3ZWDA 2YMMA 2ODAA 1PW5A 2C8LA 1RRCA 2AH5A 1Z4JA 3OCYA 5ALRA 4UAVA 2G1AA 2B8EA 2MSNA 3FM9A 2OM6A 2WF8A 5AKEA 4HGNA 5ALYA 2OA0A 1YJ5A 5AW2A 4RETA 3N1UA 2GFHA 3RFUA 2IA5A 1EK1A 2ZG6A 5AW8A 1YMQA 1L8LA 2VKQA 5ALIA 1YV9A 5ALQA 5ALFA 3I76A 2HDOA 2HSZA 4E88A 2JAOA 2P9JA 3QUCA 3W5DA 3W5BA 3L0YA 2C4NA 1Q91A 1QYIA 2P11A 3QU7A 4NFLA 3NUQA 4QJBA 1MH9A 1L7OA 2OBBA 1U2TA 4UM5A 3AR3A 1Z5UA 2B82A 4UMDA 3R4CA 4OHFA 4NAVA 3ZX5A 1LTQA 2RARA 4FYPA 2WHEA 2B1QA 3QGMA 1U7PA 4OFZA 1Z4IA 3PDWA 5AKGA 3M1YA 3FPSA 3B9BA 5ALJA 1YS9A 5AVXA 2CFTA 2B30A 2QYHA 5AKXA 3I6BA 3P96A 2B0CA 1RMQA 4JB3A 5AVZA 4EELA 4L57A 3AR7A 4CE6A 1O08A 2FPWA 2FUCA 3FVVA 3J7TA 3EWIA 1QH9A 3R9KA 1U2SA 4UAUA 1Y8AA 4DW8A 4CNQA 3DAOA 3OTQA 4Y2JA 1ZD5A 3SD7A 4FFDA 3SHQA 2MU1A 1AQ6A 5ALNA 2I6XA 4BX3A 4Y2UA 3SKYA 2YJ4A 2G80A 1SWVA 3L0CA 5AVQA 3L8FA 5A3SA 1VFPA 4JDPA 2GHQA 3BWVA 1VJ5A 4ZEVA 2IYEA 3MC1A 1L7MA 4UARA 2YMLA 2X4DA 3ONNA 4CF4A 1Z4LA 3E81A 3ZTYA 3B8EA 5AK4A 2ZBEA 2CN1A 5FP0A 5AW4A 2AGVA 4F71A 2I54A 5AI4A 3WGVA 1ZRMA 3QU5A 1ZD2P 3QU2A 1RKVA 5ALKA 2W43A 3E8MA 2P69A 3DNPA 4BBJA 3HLTA 1NNLA 1RKQA 3OCZA 2YBDA 4GXTA 3E84A 4XE5A 3WK7A 3QUQA 3CZ4A
chains in the Genus database with same CATH superfamily
1Y81A 1V9LA 2YIJA 4LYGA 3N53A 1DFHA 1K7CA 4W7IA 4Y2QA 3L0BA 3MJSA 1T0BA 5FAXA 5MGNA 5K1ZA 3TFQA 4O5OA 2Q9UA 4TYPA 4MGZR 1GSIA 3WLSA 2YRXA 3KQHA 4R7ZA 1W76A 3H9EO 1E94E 1DIRA 1P44A 3FNRA 3FTNA 5E2BA 3A31A 1KRHA 3R5FA 1CBUA 1LK7A 1NUTA 3OUZA 1Q22A 2JZNA 5I7VA 3GN1A 7ABPA 4OXQA 2OYRA 2QF7A 2BGMA 5H3LA 4JY7A 5KZMB 3DEHA 3UGQA 4EY4A 3K1TA 4KKVA 1I3OA 3VC2A 5IKEA 3UBMA 4RELA 1EI9A 4DLVA 5HBRA 5JOQA 1DS6A 1NUAA 1SXJE 2IZ6A 3PVSA 5BMVF 3I4CA 1KWKA 1BVYF 1FCJA 1TK3A 4XEUA 3C98A 3OPYI 4D8TA 2VF5X 3LU1A 4KEAA 2VZEA 3WGMA 4IIBA 3TR0A 2ZANA 5BMVA 2QD3A 4LUCA 2BZSA 4KQEA 2C20A 2CLEB 1A8QA 2IUSA 2JFGA 3OPNA 1TB4A 1ZH0A 4R2XA 4ZOLF 1T6XA 5DCLA 5FTWA 2QT0A 3CEHA 1BKSB 3MT8A 2FW7A 5IVHA 1V47A 1KPIA 4HDRB 3T99A 3WXMA 1TJPB 3AWDA 2ZU0C 1PFQA 4LE2A 4U2DA 2NNWB 2ACWA 3GYGA 4L78A 2X4GA 5M34A 1QIGA 4ACBA 5ADWA 2HB6A 3OEYA 3LPMA 3IUJA 4C6HA 4HWPA 2ZRDA 1ZY2A 3L4SO 2PUTA 1O9HA 1OAAA 1SHUX 2ASEA 2I65A 4II7A 1NQUA 4JLUA 1KJIA 2NLOA 4KAXA 3SSAA 3UGTA 1A8IA 3EUAA 1Y5NA 1IY8A 3I5YA 1WW8A 2BEKA 5IBCA 4C0AC 3JQDA 3N70A 1OPXA 3FXAA 3DE5X 2DR3A 4CCYB 3ABZA 1CVIA 1RE0A 5K0EA 2GF0A 4BJ5A 3GUCA 1GN8A 3ZNQA 1SN7A 3MHPA 1X13A 4Q1VA 1JIXA 2YJ5A 4YRIA 1KYQA 1RPZA 2GD1O 2XOKD 3RO7A 4OHOA 1M6NA 5TRTA 2YCLA 2YWDA 3NO9A 5EKSA 4A8TA 3OZDA 3ROKA 3QIAA 4UHCA 2NUAB 3VSEA 1AV7A 4UVIA 4AKHA 1I2MA 4LOJA 1C3VA 1JIUA 4NJOA 5E4JA 5CFPA 3KJQA 4QOHA 1VTKA 4KGVA 3DE6X 4F5DA 2UYHA 2CK3A 2XGGA 3R5SA 2WNHA 2ZKLA 4J0CA 5E4YA 4QJ5A 4CLOA 3K6JA 4AZVA 1U3TA 3ASVA 3K1ZA 1R74A 3N86A 4HRAA 1AHHA 4F2PA 2O5EA 3W5HA 2WWRA 2YY6A 1M7BA 4KXUA 2H2FA 3PSHA 1L6RA 3L7CA 4X44A 4CLDA 4F96A 1TVKB 1YKGA 2MR6A 2W4QA 2I2DA 4M0LA 5LB2A 3VR5D 2QYOA 4F4CA 4ZP1A 2B8JA 3V1YA 3QHPA 1GPH1 4A6DA 4WJLA 1X7ZA 1WXWA 2OSBA 3LK7A 5A03A 1G4UR 3BHJA 1CB0A 4GRIA 3U61B 3R7AA 1G5TA 3AJRA 5LP6A 2PL1A 4HGRA 3CLUC 4L3OA 4R1NA 5DYYA 1BFKA 3ONDA 1R8XA 4FK8A 3QVJA 4JYCA 5AW7A 1DUVG 1RQXA 4M22A 1UT8A 4NQRA 5FBZA 5P21A 1R5JA 3T4UA 2ZRPA 3TM5A 4E15A 4EOGA 1A4IA 4BAUA 1Y6JA 4GNKA 4XFJA 3ABOB 1AO0A 2PX2A 2N1BA 3OPYA 4RD4A 5JSYA 4BZZA 4JYAB 5BNZA 3M49A 1NZJA 5BSVA 3MTQA 1BS1A 1U6KA 1XVUA 2HQRA 3H5RA 1A7UA 2WTXA 4I9NA 4RO0A 2JANA 1TT5B 3QTLA 3ZVLA 5I48A 4GW3A 1AUPA 5AHXA 4CIYA 3QPVA 1P3Y1 2QAGA 2VI5A 1QV7A 2LIPA 3FNBA 3I05A 4MDHA 5IH7A 3EOAI 3T3DA 4DM7A 2DJIA 4FC6A 3MSXA 1FUOA 4P33A 3T1OA 4GOND 1D0VA 4IO0A 4X1IA 2HEIA 1D0IA 1XI2A 1NVVQ 1OU0A 5AO9A 3VYVA 1PHRA 2PQ0A 2WJPA 3VTAA 1BYUA 1W36D 2AIRA 2OGZA 3WO0A 4EKGA 2H63A 5EIEA 4HL6A 4D41A 2FH5B 2WJVA 4BKQA 4HWGA 3GIWA 3I1FA 1GNVA 4QARA 4GKAA 3CLTD 3DT9A 2NUBA 2FN3A 4XH9B 4JYZA 2JGKA 3VXKA 1BHJA 2A5LA 2V6GA 3T3OA 1X3LA 2NIPA 1EH5A 1OWPA 2FZ5A 3MT9A 4QFMA 5EJAA 4AG3A 4BJHB 5JLJA 4DTIA 1GZ6A 4LRXA 3L8CA 1HTBA 2Y1CA 4C06A 3OCVA 4DV7B 1YF3A 3FVRA 3GH3A 3VPFA 1S02A 2GBFA 4FQ7A 4WKCA 1FZTA 2QJTA 1C14A 3E53A 3ABSB 1AUXA 4UNRA 1HK7A 3WGUA 5TQ2B 1VRWA 4CTOA 1SKBA 2VYVD 2F3QA 2JC3A 5FI0B 2VBFA 2LTAA 4RK6A 3MAAC 4R84A 3ULKA 1T5TA 3FZQA 5EJ4A 2A0UA 4NJMB 1YVEI 1HBJA 1LF5A 2XDQB 3LSYA 3VBCA 4JB0A 2B7BA 3KE8A 4JLAA 2H2GA 5I9IA 3BJIC 4P9NA 1C3JA 5JFGA 5F5NA 2A1TS 2X77A 3VKVA 5I45A 5JSFA 1EBBA 2KYRA 3KC2A 3OE1A 1XZEA 1DAHA 1NNSA 1Q11A 3CB2A 4JSRA 3RYIA 3LOPA 4M0DA 3IA2A 2CHEA 1Y8CA 4P7KA 3DS8A 3OHMA 4BRSA 4D5EA 4DNXA 2Q1UA 2AMLA 4OBBA 1DX4A 1JFTA 2BIFA 3WGKA 4F9GA 1N1DA 5JD5A 4AMBA 4N01A 4OJTA 5ANRB 1XMVA 3TPZA 4EY8A 2QW8A 3HJHA 4UBOA 2LR0A 3HB9A 4K9NA 4KQJA 3TI7A 2GRAA 3CT6A 4K7JA 3VX3A 4DR4B 4JB2A 3FDFA 3GO4A 2GHTA 1CKEA 5TIIA 3H5WA 1UPCA 2VNIA 3QKIA 3FDZA 1DO2A 4DUYB 2BCGY 2Q5FA 1SURA 2F1RA 2OG2A 3C7AA 2P1ZA 1RXIA 1X74A 2ES4A 1TNDA 4L73A 2WHPB 4LHWA 2CY0A 2VPYA 5LWHA 1BU5A 1YDMA 4BMNA 2E48A 3EG5A 5KQLA 1QPGA 1KQFA 2YV5A 5K8JB 3TKLA 2CDCA 1P45A 4UUAA 1YBMA 2C2KA 5C4MA 3DC7A 4ER6A 2UVPB 4GLBA 1PFKA 2D1FA 3VISA 3AB7A 3LF1A 1XA3A 4ENTA 1SU6A 1MW8X 4WK6A 3U6KA 5DPMA 1T0UA 1CRZA 4YREA 1C80A 2RHMA 2CLLB 1H4VB 3BVPA 3R2JA 5D7BA 1E9RA 1PJQA 4H0NA 4MVXA 4ISCA 1AHNA 3H5TA 3SKVA 3VZCA 1HR0B 5KOHA 3DW1X 3OOJA 1BX0A 2C2YA 2RHLA 3H8JA 1XTBA 2XWPA 4UMFA 5DLQC 5CG2A 1RI5A 1YOVB 2B94A 5DGHA 4L3VA 5H59A 2GPJA 3VHXA 3KYCA 3HR4A 3K1AA 3QVMA 4S0XA 3IB6A 3MQFA 3HN7A 1TU4A 1YULA 2DTXA 5GJCA 2QR2A 2QX9A 1KI8A 2IPOA 2Q27A 2YJNA 2ZBVA 1NXXA 3LD9A 2IOHA 3PXDA 4QGFA 5E9JA 1P73A 3FUWA 1WTAA 4ALJA 4AECA 4DG5A 4L5BA 1U0EA 4DSUA 5JMTA 3KQPA 1JWAB 1F48A 3AV3A 3MT7A 4HAVA 5L40A 1J25A 4NBSA 3ZXUB 2IZ1A 1HNNA 2DHRA 2C8VA 5IT4A 4HFRA 1KDYA 1FEZA 1T3TA 1ISHA 2Q62A 4X0EA 1U0SY 1ZHFA 1ZOOA 2YZNA 3A6DA 1ND5A 4WZBA 5IC5A 3UKJA 5ESWA 3GVXA 1P2VA 3B1VA 1GSOA 1H8HA 2I55A 5DBGA 2JAPA 5IVKA 4ZICA 1T4CA 2IDMA 4ZI7B 3VPCA 5G2OA 2WG2A 4KFSA 4ADLA 1OH6A 3U1VA 1DTWB 4KPFC 5KAPA 3RQIA 5FTLA 5FWXA 2YV2A 4JYBA 3ZDCA 1RHRA 1U3WA 2Z43A 3A4IA 1H2ZA 3QZUA 1U4OA 4J9UE 4AMZA 2NYAA 3NIWA 1UUFA 4MKGA 1KAGA 4K46A 2GKOA 5IUJC 2H9YA 4OHYA 1A96A 1ZU5A 2IWRA 2E2WA 2ZJ5A 3C3WA 3QLUC 4HVAA 4I14A 1GJRA 1FX0A 1AIPA 1T34A 2Q4TA 4LGYA 5HKKA 1B74A 1C3LA 4FFNA 2JD0A 4G5YA 2I2WA 2ZAMA 1JEAA 16PKA 1ZNWA 2G70A 3AL2A 3HEAA 5AHRA 3AUTA 3PHBE 5E7QA 3SJBA 3D6VA 2PG3A 1T5IA 4HB0A 1J70A 4Y2SA 1EXVA 4E6EA 5GV7A 1JHOA 1EXMA 3LXRA 1Z12A 1G8KA 3O0DA 1R4NB 1XZGA 3GEMA 4XGKA 3KG2A 3AJ8A 5I4BA 2I2BA 5JS6A 1U2ZA 1X7WB 2AUNA 2Y1GA 3MLBA 3KSBC 1UM9A 1SY7A 1DMSA 3CG0A 3UHOA 4YN3A 1C8VB 4JAVC 4Y6OA 3HWRA 4N3NA 4LJYA 3URKA 2ODAA 1R0SA 2XUOA 1P9OA 2XUFA 2Y2VA 3DW3X 4LJSA 1XZBA 3K0CA 2UZ1B 4PQEA 3KEQA 4PXSA 3KHKA 2O59A 4AWBA 4PHTA 4TT3D 4X1OA 1YHNA 2H11A 3B89A 2OV2A 3ADCA 1R5BA 4JQSA 1OXUA 5CFZA 1UCFA 2J9GA 3PI6A 5IZCA 2NUPB 2VHJA 3N1UA 3UXEA 4NFHA 4RPJA 1XTPA 4HH0A 2UZAA 1N6KA 1T8UA 2EG5A 3WR5A 3G2HA 3N8IA 4IEIA 1LRLA 1ZMTA 4OP1A 2BONA 3LKVA 3NUGA 3RGGA 2ZE8A 2AZXA 2VKQA 3H4VA 4DR6B 2Z56A 2PSDA 3ZBPA 2DBVO 2CDBA 1MEOA 1XIVA 2HDOA 3I76A 4NBNA 6CHYA 1SXJB 4G1MB 4CEIA 4E88A 1ZK1A 1EJ0A 1KERA 2G76A 1M76A 3SX4A 3H11B 5SZIA 2QTMA 2Q3JA 5D3QA 1Q91A 3LUJA 3C4QA 1NMEA 2Q28A 3PTZA 3RNOA 4BKUA 1OGJA 4KDFA 4TSRA 1Z45A 1Y3FE 5FOSA 4MP8A 1KETA 5C7IO 4UHDA 1YIOA 4YO8A 2GLTA 3P0EA 3UWSA 1CE8B 1FP4A 4MPJA 4UMDA 3TLZA 2Y3IA 3CJRA 2OCIA 3CV3A 2J0SA 2RI0A 1KJWA 4K81B 3VQTA 2BT4A 2FX2A 4X7PA 1GA1A 4ARBA 1UDWA 3DZFA 1K89A 1N8KA 2Z3ZA 3A4NA 2C99A 2AG1A 4KXXA 4PZ9A 4F1JA 4HGVA 1C30A 2BVNA 1NJ1A 2DTDA 3BC1A 3K15A 1H6BA 2ZIWB 3ZLTA 4C07A 4BUJA 2Y1WA 1UZAA 1JBEA 1D6NA 1HI9A 5CGQB 3G2IA 3AF4A 4XFKA 3T3GA 5GZ1A 1JDUA 2I3ZA 4LY0A 4MRSA 5IBPA 1R0LA 1YS9A 1GY8A 4OJQA 2YTZA 3MQ2A 4BV8A 3PJEA 5JZ9A 4DAOA 5FLEX 4A4DA 1SBCA 4R9RA 4P5PA 3GUUA 1EUYA 1Z6AA 3Q8LA 1HE4A 5FADA 1JR3D 3ILYA 4UBLA 4QWMA 1E7WA 3CUYA 3LO8A 3GFGA 1SCUB 3LPCA 1RJGA 4ARCA 1FDWA 1N0UA 1QTQA 4R98A 1SBIA 3DE0X 4QBFA 3UNXA 4PFSA 4KRXA 4G0ZA 5DNUA 2DFDA 4Y2HA 2Q1TA 2ZQZA 1L1QA 2B7CA 1DHRA 2HJ9A 3L8ZA 4QTTB 1ONPA 2W8BB 5LXTB 1MRSA 3H18A 1WAMA 3NV9A 3BMCA 5JLAA 4A82A 4C22A 2W6ZA 3S40A 3V1LA 5ITSA 2QNRA 3IQDB 3UTCA 1EVIA 1PR6A 1VJDA 4AX8A 1O89A 1W85B 2YIDA 3H1PA 4XI9A 2RH5A 4EECA 4MO9A 3WA6A 4J7CA 5LZ8A 1LDGA 3AB8A 1L5SA 2ZR9A 1A8PA 4ZEVA 2QLNA 1F8YA 1QXSA 5BT9A 4NCBA 3I12A 3U2QA 5TLSA 3S2IA 3TNFA 1O8BA 3U5ZB 5DBFA 2A84A 1ZISA 2ZTHA 5EESA 1GGMA 4GPZA 1XAIA 4MUKA 4WOKA 3ZCVA 2F1OA 4G5GA 5AW4A 1FFEA 4CQMD 4K86A 2KI5A 1L5KA 3TEFA 2I54A 4E33A 1P7CA 1XZQA 1UPUA 4PO8A 5AI4A 4OREX 4AK9A 4B74A 1PTJC 4IDGA 3ZIUA 1ZA1A 3AH8A 1WG8A 1CR2A 1KI2A 2W48A 4ZI3A 1ZC4A 4OLBA 3IP3A 2FJUA 1JLLB 1LRKA 1S0UA 2X5OA 2VOEA 3FKJA 3LL7A 1KK3A 3I30X 4R1LA 4X84A 2W2PA 4QFDA 1W49A 2ZATA 4MUAA 4OQQA 1A2QA 4B6FA 3HSSA 2OHXA 4HLCA 2FPIA 1RFGE 2QN2A 4XB2A 1EUZA 4AROA 2P8JA 2XSZA 2BFDB 1LV8A 5ECWA 4AP9A 4HUJA 1P6XA 1YU6A 3UJNA 3AWIA 1EPUA 4LJ9A 5A9RA 5E3JA 1NVUQ 5MDHA 3RODA 4FHCA 1QYVA 3W3ZB 2EKBA 1NBWB 2VH5R 4I36A 4R54A 4WKOA 3EEFA 3VPSA 2CT8A 3DZKA 2OVFA 4BNIA 2ZI4A 4GI7A 4M99A 4IYJA 2DMRA 3TUZC 2GYVA 4O1HA 5AI0A 5T3UA 1KDVA 5JRJA 3Q8WA 2RCYA 1AUVA 2UZ1A 4RJKA 5IS2A 4ZAYA 4ND1A 4F5WA 2HT1A 1RADA 4IXNA 5KBYA 1ECFA 3V8EA 3SHOA 5I7FA 3B20A 2PFMA 5JR3A 1X94A 2DR0A 1FYDA 3AYXB 4IF4A 5ALGA 5GJBA 4QUAA 1Q5PA 3K9FC 2G5GX 1D6JA 1E6KA 1RI2A 2HADA 3D8BA 4YQYA 3NI2A 1N33B 1KS9A 1MTOA 3IUBA 1T3ZA 5AI5A 3JQ8A 4RHTA 5K4AA 4FDAA 5F52A 4C29A 3KOZA 2J9ZB 3BICA 1VL6A 4KXVA 1EA5A 2HI0A 4XUCA 5FOUA 4ALNA 5BSEA 4NENA 1Z4KA 3PVZA 1CRPA 2PCLA 4KOEC 3IVCA 4O1IA 3OA0A 1HEUA 2Z3WA 2Z08A 4HNGA 1QIFA 1OA1A 3H0KA 3KKMA 1VB5A 5ETJA 3WGHA 4XARA 1V5FA 3HSKA 3LC0A 4UXHA 2AEMA 1QQ6A 3GAFA 1VIMA 1JSZA 2JK1A 5AVWA 5J4YA 3I9KA 4WCFC 1H1LA 1JPVA 5IVDA 4YAGA 2PGNA 4I9GA 4JQCA 1ZK4A 4GWLA 2G63A 5BN3A 1KJYA 2EP5A 2W58A 1HTTA 3L04A 1IBMB 2J85A 2DFVA 4OJMX 4QATA 5D8DA 1RSZA 1QF7A 5B3AA 1TMKA 1TDJA 5FPTA 5AOVA 4B8WA 3O26A 5CXUA 3SS9X 1ISRA 4RZIA 5EMNA 1XQXA 3ZWVA 2A4KA 3K0AB 2EP7A 1ZLXA 5DX8A 4D9HA 5FQOA 1SIWA 2ZYUX 1UDCA 1SO8A 4CCSA 3STHA 4CMJA 1U0RA 2XI4A 3LW7A 3GJ4A 3OZCA 5CBPB 1ZHOA 1IHDA 1VJ1A 2WYVA 4UUNA 5KYVA 4EFNA 2OFPA 3WK8A 2H06A 1T9KA 1UEIA 2BZ0A 2I6UA 3C3DA 2CJXA 2PRSA 4JBYA 5JYBA 2J7PD 3BZBA 4RCVA 5A9SB 3PGXA 3JD1A 1GQFA 1P0PA 4G5FA 4DYVA 4HDMB 4MWGA 3B3JA 3H9QA 4TMWA 1T35A 4EW3A 2NT3A 1ZP6A 4QU9A 3FF4A 4B32A 3DFUA 1MVLA 4AJ1A 1E2MA 1Z6TA 1HUQA 421PA 3OZ7A 5CA0A 4RA6A 2OCLA 5K0CA 3SXUA 3UMGA 4HDAA 1B6RA 2PYZA 5E6UB 3AQ4A 5L7YA 3HEMA 4Y9SA 1KA9H 2G9UA 2GN6A 1N2JA 2Y71A 4TKZA 2V5VA 1K8YB 2G67A 1RKXA 3P20A 4G5XA 4XQ0A 4YAJA 5EJ2A 4IOJA 5IAAA 2YJ6A 3GFTA 3VZRA 1YRBA 1U8ZA 2VHXA 3HB1A 4P5EA 5C1IA 1GU0A 3RHZA 3WLHA 1C5KA 1E9AA 4UASA 4JUIA 3TX2A 4HDNA 4S0ZA 4D8WA 4RHFA 3C5VA 5GGYA 4V0MA 4MCJA 3HDQA 5K3DA 1I13A 4REQA 4CR8A 5JVDA 3RHFA 4DMUB 2L0XA 2WZBA 4E46A 3PEWA 1TO6A 5ALSA 2NQ2C 4OHKA 4UE6A 1K6EA 3HFJA 3IHKA 4KRGA 4ADMA 4Z54A 1JPUA 1U65A 3ZZTA 5AW6A 2HM7A 2IOFA 2VPTA 2Q0QA 3MPUA 3C7TA 4Q4HB 1H9BA 5C81A 2CUNA 4QPZA 2DYKA 4HNUA 3PQ3A 4PIVA 2WSLA 2L69A 3OZGA 4RZUA 5T64A 3UN1A 2FUKA 4EG5A 2C2BA 5KO2A 2NXWA 1D2EA 5INTA 4EZEA 1Z0AA 1QHIA 1Q84A 2BMAA 2ZSFA 4YAKA 1E96A 4WHMA 4ESHA 5LQSA 3T15A 1WCXA 2H3EA 3IHLA 4XZ3A 3KYJB 1G16A 4G8BA 2PSJA 3OU7A 4WNAA 3PXUA 3QMVA 1V6AA 4N6NA 4BXOB 1H1LB 2I3DA 1EJ6A 4LDJA 2JEYA 3UMSA 2BD0A 1FRZA 2NN3C 4IFEA 1JU3A 1M1UA 2XLBA 4UXIA 1PDOA 4N4AA 3E48A 2FPPA 5I5GA 4JODA 1I24A 3S2SA 2AWNA 4FQ8A 1DCNA 3HWX1 3TV2A 3ZWMA 1SEVA 4A0FA 1P75A 3W2TA 3LCVB 3IIJA 4PLGA 2AJLI 3FWNA 2NYRA 3ORYA 5DTJA 4DADA 1A9RA 5H82A 3ZWQA 2XWBF 5EIWA 3USCS 4CKCA 4CGZA 1Z8HA 2PBRA 4L27A 1LSUA 3LO5A 2WABA 2J3HA 2LRHA 2QAJA 3JQEA 4C2BA 4CGYA 4K9MA 2XWJI 4J49A 5B57C 5KTMA 1PL6A 3L0OA 4TOIA 5JIBA 5JV5A 1NBOA 2JVIA 3EF0A 4IQFA 4XTCS 4GVXA 3BJMA 2G77B 2ZWIA 3W7AA 1HFWA 4B87A 3DEIA 2BJHA 3SY8A 1U8CB 1OH5A 2KBFA 4YYZA 1X1TA 4E51A 4OHMA 3P2MA 4P4NA 4BCCA 1L5FA 4QBIA 3DO8A 4JUFA 4JX9A 1I4DD 4TKVA 5ESXA 3RU7A 4TV8F 4NFSA 5L3SA 5C34B 3AL0C 2JB9A 3IXLA 1Z62A 3Q15C 4BB6A 1U11A 4Z1MD 4NR0A 3L6CA 4G0NA 4G5RA 1IEVA 4MVJP 2QTWB 4UATA 4Z2YA 1T13A 4G97A 1CF9A 1M1XB 4FYJA 1K8XB 4ETMA 1WBJB 1UF9A 3WB0A 3GPBA 4MV8A 1Z5WA 2W2VA 4Q21A 1QGYA 1DC4A 3MTGA 4I3HA 3NQ41 3JQ9C 5K6RA 4U9IS 2QQFA 4YR7A 5I3CA 1T4GA 1LK5A 3ANTA 1CY2A 1E4YA 3V8VA 1U98A 2YL2A 2JAQA 3IULA 3M9LA 4F12A 3F47A 1JIJA 5DHUA 4NG4A 2XCTB 1G60A 3O95A 4QNRA 5SYMA 1MOQA 3T1HB 3T3EA 4ZMBA 4Q4HA 4MXDA 2PEYA 1OAOA 3BL5A 3EG9A 1E59A 3ID6C 3BRQA 4HB4A 4XQCA 3X0DA 2I1QA 4EMSA 5BVGA 1ZWKA 3OJ0A 4JEUA 2A7XA 1ORRA 4JLNA 1O6GA 4MIKA 2B83A 4IINA 2Z6UA 1NQXA 2IYOA 5IYZB 4HP8A 2OP0A 2X13A 2V4UA 4HS9A 3DBHB 2F17A 3DFFA 4WJKB 2ZB7A 3L01A 1VYHA 1JSXA 4R40A 3PC8C 3WL4A 3VPXA 2OQVA 3KPWA 2J09A 2XQJA 2YC2C 3ZBTA 2C9CA 3WAJA 2O2CA 2PUJA 3A28A 1VYVA 3UTDA 1ORVA 4YAWA 5K4HA 1QDUA 1YQEA 2WICA 5EIOA 1W46A 5TMDA 3R0IA 1GAEO 4F2DA 3QKRB 4GGMX 4N1AA 2G4LA 4X54A 1W581 3X44A 3DMYA 5KHOC 1VXOA 1VPDA 4RKYA 2RKBA 5H68A 3TWOA 3RUHA 4PE5B 4IH9A 5ALXA 4OKIA 1UP6A 1ZOIA 2CFSA 4N9QA 2CJYA 4PYRA 1JG6A 2C88A 3D2AA 4OGLA 4XKJA 4XUDA 4Y30A 4YAIA 2CZGA 3T7DA 1P7YA 3QXJA 3IUYA 1UC5B 3NFYA 3S6JA 4DDVA 3HU1A 4O4IF 4A0QA 3B2QA 1JKXA 1ZM7A 2FGKA 2GAFA 4HWKA 3WOVA 2JI6A 2FEPA 2OZVA 2B4YA 2AR9A 3PJFA 4TKUB 4GMFA 5AHOA 3A1DA 1F51E 4O2BF 4UVEA 2POCA 4D3ZA 4ZIRA 1W6RA 1FP6A 2GEVA 3IVXA 4ER3A 3EFHA 2Q9CA 5D86A 1YR6A 5DCWA 1KIAA 3HLYA 3ODPA 5IX8A 3RSGA 4JK3A 5JPCA 3OEEA 5K0BA 1TVKA 1CC1S 1SK9A 3BMNB 3DH0A 4GMHA 1DOZA 5DTIA 3U4MA 4Z8XA 2I7DA 1MX5A 1Z0SA 2OCYC 3K2IA 4Q05A 1X7ZB 4HUTA 1J8FA 2BP7B 2WUFA 4H7JA 1PFVA 1D2NA 4I55A 3ZDFA 3EGWA 1X9HA 1FP1D 3ZWBA 4YT8A 3ETHA 3PRKE 4AIIA 3DCYA 4ML3A 5BY2A 2F1JA 3X2FA 1DU4A 5T6MA 3WMWA 4F93B 4IEFB 3VA7A 1L7XA 3A32A 4M36A 3UW3A 3NT4A 4EQ6B 3EARA 1E5TA 2EW1A 2XMPA 3AUSA 3C6ZA 1SD5A 2W6PA 3K9CA 3WMEA 3R6QA 1NMZA 4PNZA 5K20A 2E4AA 2JH9A 2NZYA 3I72A 1PQUA 2FOXA 1J3UA 3RYHB 1Z0ZA 3Q11A 8ADHA 1PR3A 4LA4A 2UUOA 3P9PA 4UAVA 1XMPA 1DBPA 4LAFA 1KU6A 5KIAA 1NQAO 1GPMA 2G83A 2ILTA 2ZJYA 3HMQA 4EGJA 1MC4A 2HSGA 2ZW9A 1KH1A 1V1MA 3CX8A 1X7HA 3FM9A 3WRVA 1PR5A 2RIPA 1C4OA 2IEGA 1Q1NA 3NVAA 1VMDA 2H7XA 1I3MA 1PZMA 1Z16A 1NATA 2V7QA 2Z4SA 2HWXA 3CZRA 3HI4A 1XRLA 3CRZA 5DYIA 4LN1A 2CB9A 3EIFA 2DQKA 1VXRA 2AG8A 2A30A 5FI5A 2AFIB 3AHCA 5D5PA 1TQDA 3U40A 4HFMA 1KI3A 2A78A 5BNWA 1FYEA 1X7YB 4WGFA 3LXMA 4JFRA 5EZYB 2P11A 1MO2A 1WVMA 2YS7A 2O3RA 2JGNA 2AYZA 4YFYA 1YMUA 4R81A 1K66A 2RFLA 3L05A 3AVUA 1XZDA 1R2QA 3H7AA 3VSBA 3AW8A 4Q34A 1I0IA 2V55B 3RPEA 4NIMA 5AOAA 5BNIA 3ZX5A 4PQGA 3TL6A 4WXRA 4K9DA 2CLHB 1LEHA 1SBZA 1CRLA 1P5RA 1RZ3A 3P9QA 4UDYX 2H2WA 5EKUA 4DCJA 2SBTA 4FYXA 1LW6E 1SM4A 4OSPA 5F12A 1RIFA 1IDN1 1KHTA 1H1TA 1YQQA 5F21A 2C77A 2BEWA 4TRNA 5C8DA 1VBKA 2P3QA 1JBKA 1TEHA 5A5FA 5KNDH 5KNDA 2UYGA 4BX9A 1P0FA 3W9UA 1SCBA 3DBVO 4JIMA 3EPLA 2ZE5A 4HNAA 1N2OA 4CKEB 4UDOA 4EHDA 3P52A 4DB4A 3P1JA 2X23A 3HKCA 3L07A 4FONA 4PRLA 3RC1A 4A15A 3QEBZ 3OQPA 1II8A 3HR7A 2JDID 3I9V6 2QM7A 3SR4A 2J4CA 3V7FA 4C2TA 3AC0A 5LP1A 4LJAA 1RU3A 4R1QA 4FYYA 4OB6A 3KPJA 1JECA 3BMNA 4V0OA 4WFIA 3ROMA 4UFOA 1YZ3A 2PD4A 3QOFA 4UNIA 3W90A 5JNSA 3BUSA 5BWCA 4I8IA 4WOJA 2VQEB 2ZIZA 3X1YA 3CJTA 2AE2A 1H8ED 5K6AC 1OE0A 1JNXX 4H16A 5AJHA 4GD3Q 4JI7B 2W6QA 2V74B 3KKQA 1M6VA 2OCBA 5D87A 4GUAA 2XE7A 3QLVC 2PLFA 2QRLA 2XQKA 1X1DA 4BFZA 3JQRA 5E1OA 3MCVA 1Z18A 1OKKD 1IOZA 4QYSA 1M10A 3O8OA 4Y2JA 3HKEA 3RVNA 5JBIA 5JYDA 4ZOEA 2MU1A 4JQOA 5TEWA 1ZI9A 3LQ4A 1DKNA 2O3QA 4NC9A 1JXQA 4FILA 3A70A 3TJZA 4RPHA 3TQTA 2R6DA 1VJTA 2GBCA 5JPDA 4MJ3A 4C0WA 1SB9A 3MTEA 4E2WA 3ILVA 3TLYA 3L0CA 5I51A 1ZVVA 1A97A 5CLIA 3QTTA 1MAAA 1ZH2A 3HV0A 2WI8A 2WU8A 1J2YA 3F9CA 1YIAA 2PSHA 3JR7A 3OQ1A 3NWEA 3RYCB 1O3YA 4UARA 4BP1A 1C9KA 2KE5A 4OQ4A 3RFVA 3ZTYA 2O0KA 2ZIFA 3WAGA 2WIDA 2AKAB 3DVRX 3L06A 3SC6A 4ESVA 2JHGA 2PD3A 1P2GA 2DSNA 4R7GA 3QJYA 3EXIA 5TR9A 4NH0A 3O31A 2JJ2D 5CYGA 1U8AA 4X20A 5KSPA 1VCOA 3NH6A 1W2WB 4ZZ0A 2OCKA 2R62A 3O75A 2PKYX 3BD8A 3K09A 4ZANA 2O19A 1RKQA 1V1RB 5EC8A 1JFLA 4PR3A 3T0GA 3TRJA 3EAFA 5THKA 3LWBA 1BC5A 1FSSA 1G2PA 1RAEA 2H6EA 1YQXA 1BVRA 3O1JC 1B43A 1HSZA 3IOMA 3BIOA 3MMZA 2O8DB 4L2IA 1EAMA 4EG6A 1Q0SA 5DRYA 2JEZA 2W6OA 3ODGA 1YBHA 5DN9A 4F4UA 4CEJA 3L1UA 4ZJZA 2EX1A 4W8HA 1UBGA 2B4KA 5AI6A 1YB5A 3F6EX 1W1WA 1YQUA 3RYHA 5EYPB 3PRHA 3MWEA 3O91A 3OQBA 1SOMA 1DIGA 2B4AA 4KN5A 1USKA 3AHEA 5GOZA 1KGSA 3BH6A 1BTOA 4YRMA 5CDUA 1JEYA 1EE1A 4XR9A 4LZJA 3LT4A 1NW3A 3DDNA 3O8QA 1CXZA 1IBCA 2GEFA 3P19A 2QN3A 1H5NA 3B48A 4FZJA 4KBYA 4P0TA 4RULA 5BRAA 3O3CA 2I8CA 3ZWXA 1RRKA 3FH0A 1NBAA 1DRUA 2HJSA 3VZDA 1CTQA 1IVSA 1SC4A 3ROEA 5LXTA 1UPAA 5I3ZA 3PDUA 5DTRA 3H6HA 4M89A 4BX8A 2MCFA 1L8XA 2XB9A 3VPGA 5U4XA 3CZ9A 4C4AA 3C1UA 2BFCB 1K5GA 5AHKA 2OHJA 2P1DA 1P33A 3EZ9A 1WZUA 3T7AA 5MN6A 4DBLE 4F5ZA 3NANA 3EXHC 4AF7A 1U0OC 3C3PA 1C7EA 1Y6GA 3NNSA 3A3YA 4JL5A 4KFRA 3SZOA 3ILXA 4NYJR 5L45A 4QU5A 2R8ZA 5F98A 521PA 4XYLA 1T4DA 4C5CA 4MVJH 4MVJA 4F1WA 1U94A 3DQQA 1W85A 2NVBA 1TKBA 4I6GA 3HYNA 4Q9NA 3ZGZA 4PQRA 2HAEA 2WZQA 2ZUCA 2Q99A 5U4QA 1T91A 4MS3B 3TRKA 1F12A 2YUTA 1KI9A 2Z2XA 4X66B 3VVLA 3DL0A 2P65A 3O8QB 4JKYA 4KSYA 1JFSA 4XSGA 3GRVA 4BO3A 3C7CB 2G9RA 2OV6A 1FFWA 4PLPA 1T24A 2J5RA 4BO5A 1PZGA 2E7ZA 3JWHA 3N59A 3T5TA 4IUBS 3FLEA 4DQDA 3K5HA 5ER6A 2WVAA 4HDCA 4E2FA 4WCDA 2XWSA 4IFTA 4QE3A 4WNAB 2NNLD 3WMRA 5DRTA 1PKXA 2B4TO 1ZMOA 3VR2A 1A7AA 3GAAA 3ZS9A 2R60A 3D6TB 3HG7A 2M2IA 4WLEA 4M21A 4ASUD 1SUWA 2Z5GA 1OYYA 3K9LA 3NJ4A 3E23A 2KB0A 5J9FA 5HJ2A 3F3KA 5IFLA 4Q6WA 1NE7A 3OQJA 3NRCA 4FHEA 3HWWA 4Y1GA 4TUYB 2BSAA 4Y6GB 5J1SB 3HUUA 4PZEA 3FOEC 4EHLA 4G1VA 4LHYA 1RJEA 4MK4A 3K16A 1N57A 4Y9RA 4BMCA 2WV9A 2WLTA 2HA0A 4FWIB 2OO3A 3I1YA 4WX2B 2Q5HA 2J5KA 3DUFA 1GGJA 3GVCA 1W0CA 1M6YA 3O8OB 4IDBA 4RLQA 2VSYA 4WCFA 4PZLA 1QMPA 3EH1A 1NXVA 3HPRA 1MQ9A 1YOVA 1YCDA 4C0XA 4MWOA 4I4TA 4EF6A 1WD7A 3SC2B 3Q8MA 3Q5GA 1XXLA 2CHGA 2NU9A 2YYZA 3KWMA 3R77A 3RKRA 5AR1A 5BORA 5I9LA 2I67A 5IUNC 4HX5A 1SHZA 4C1BA 3A6KA 2SKCA 2QRKA 1VJRA 2B2CA 3PNYA 2F55A 1CF2O 2EBFX 4KH0A 5IW8A 1VLHA 4K8OA 1VLJA 3P26A 1ZONA 4G0XA 1VE5A 1QG6A 1G20B 2DUUA 2IYZA 3PNQA 1Z5NA 4Q7LA 5DNEA 4Z2AA 2C4UA 1PV2A 2GCGA 2V0CA 5F7XA 4QC2A 1F7VA 2G17A 4RDCA 3PJGA 3T9DA 1W36B 3TZ6A 4I0WB 1YAJA 2REXB 2J8ZA 4U2KA 1GNSA 5TGZA 1HNXB 5MHTA 1RT9A 1OQAA 1PT6A 4RVHA 1HQDA 1KJNA 2GA8A 1JS1X 4XQEA 3E1KA 1GAJA 1L6IA 3DMPA 1U2RA 2X7HA 3D7LA 4KO8A 2ROQA 3KXKA 1XZLA 2EJTA 4LBWA 3EZ6A 2EZTA 1IOWA 4QUJA 5A3RA 1SBHA 3TX6A 1ZOLA 2H1HA 4H1VA 3DCIA 1T4MA 3LUGA 4EHNA 1Q7TA 3U3KA 5NULA 5IKXA 3RVQA 4DQ0A 5C1DA 4HJXA 1ESMA 2UYOA 3PPWA 3ZV3A 4D57A 5HZHA 2HLHA 4ANFA 1WW2A 2HN9A 1C7QA 1YFZA 2QRGA 2FPLA 2R8PA 1XD2A 3GRAA 3NR2A 3O03A 4R1TA 5AW1A 1E2JA 4XWOA 1WA5A 3PUVA 3CMMA 4U8HA 1M0EA 4KIJA 4RU1A 2FPUA 3RHSA 2I76A 3C3BA 3JQPA 4TWAA 3CURA 1P7PA 3PXXA 3M82A 2BEUB 2XYRA 4IIUA 1W59A 1BX3A 2I29A 3BEOA 1GG8A 2GF2A 4D9MA 3LNCA 3OCXA 4XRRA 1VGRA 3KUDA 2H0AA 1ZGGA 4QPPA 4OXYA 5AJXA 3RS8A 2Q8PA 1JG4A 1QIHA 2ATEA 4XIIA 2H18A 1U8FO 3GXOA 2WIKA 2X4LA 4LYFA 2OFWA 3I2GA 3KQMA 4LZZA 4P80A 4LHVA 4RESA 1K08A 4B7UA 1NXOA 5BOVA 1JR4A 3D7NA 1AQLA 4KI0A 1NBIA 3PE4A 2PTQA 3H2ZA 3HS3A 1JW9B 1KZGB 1E69A 3ZEAA 3ZJYA 3SXUB 1CDEA 4IHKA 4GQIA 2BSXA 3A04A 2QZ4A 2ZT6A 3AHHA 1N0VC 2YOFA 3GBSA 5BYAA 4LQLA 1OT3A 1V6CA 5EGNA 5KC8A 2WC1A 2Y68A 3QITA 1WZNA 1T0JB 1VPLA 3EMVA 1N1GA 4RABA 4N82A 2D2VA 1QHHA 2Q0SA 1ADCA 3MWKA 4RZSA 5T7BA 1KE1A 3LE8A 4E3WA 1BWSA 1G5PA 1E3LA 3DGEC 1I33A 2WUWE 3N7TA 3OIFA 5ALUA 4BB0A 2KPOA 3KKKA 4DLUA 4WN9A 4NHOA 4GVLA 4LRSB 1OROA 3ZWCA 5JD6A 4HMOA 4EJFA 3A9SA 3OFNA 5EJ9A 1EFPA 4A7PA 5K05A 2XUIA 5JXHA 4OB7A 3AQIA 4ND5A 2IV7A 5H5JA 1T36B 1E7QA 3KJXA 2G0AA 1W73A 2QL5A 4C7BA 1TTHA 4NDZA 3X1KA 4DJDC 3A6ZA 3QBDA 2W2XA 2FCRA 3N2KB 3FYHA 3WIUA 3CEMA 2R1VA 3AK4A 4GM0A 1DELA 1UJ4A 1V37A 2QD5A 1PBNA 3CKLA 4I55F 1I5RA 3U48A 3BXZA 2FKNA 4ZYLA 2IOFK 3PF9A 1UKZA 4OV6B 5K8TA 2ZRKA 4HZUB 4EI9A 4KNWA 1RWVA 2AG5A 1TKRA 2FZ4A 1AQYA 4FYHA 5CPBA 1E1YA 2BE7A 6NULA 4LYHA 3RSOA 2R86A 4I4TB 5HNKA 1E2QA 2CNOA 4YRZA 1ZA2A 4PN3A 4I9UA 1IUKA 4YJGB 3H3FA 4PX2A 1R50A 2V5AA 1M1YB 2HLDA 3X1DA 4CTMA 1KFEB 2R84A 3PGMA 3T3NA 3JR3A 4QPDA 1XZNA 4H18A 4XIYA 2ODTX 2ZQYA 4Y2TA 2NZUG 3FSJX 4MB2A 1IQRA 1XT6A 5B7QA 1NAIA 1UK7A 2ZJFA 5FOWA 1LJ8A 2PQ6A 3WJ1A 1NI3A 2NU9B 1UBJS 3TK1A 2IEDA 3ESAA 4YUXA 1E9FA 1VP3A 3GVIA 3ZGNA 5KTSA 1L7NA 4X97A 5BV7A 1XJCA 3GFSA 3WRYA 2C07A 4OD0A 4M1MA 5EE0A 4EJSC 1ZN9A 3H2YA 4E1VA 1O87A 1O5OA 3QE3A 2HR1A 1HFJA 4F9EA 2R8RA 1F9EA 4C20A 4EQZA 2FQ1A 2HNKA 4U6QA 2Y1LA 5A7GA 3ZUPA 2FHPA 3U9LA 2Z6QA 1KMMA 4L5JA 4XIJA 4ZQFA 3LC2O 1OH8A 3H97A 4GYYA 3TAXA 3C15C 2EC5A 4KO4S 5EVCA 1O95A 2JZOA 3ZXXA 4XVCA 1A9SA 2HPVA 5AICA 4WZAB 1NI5A 3PICA 4DY6A 2ANBA 3UYLA 2FLWA 1WXGA 5KTPA 1W0KD 4EKIA 4UZEA 4QQNA 4B6EA 4PYLA 4G4GA 3C8ZA 4XGNA 4YP0A 4KUGA 3HXQA 1HYHA 3DHEA 5AQEA 4F5EA 4TLCA 2DKOA 4L16A 5LU8A 3T1TA 3HXLA 1Y8RB 2HRQA 1J21A 2YXEA 3N8HA 1P9NA 2V65A 3H2BA 4G0YA 5TGTA 4DVGA 3VPHA 2HQSA 1J2TA 3U4CA 2HRBA 2BM8A 4OQZA 2VIIA 1LPMA 2MSEB 4DLXA 5LIRA 1XHEA 4ITRC 2CCJA 4OHBA 2MSLA 1ODIA 1TLLA 1U9JA 2Q1WA 2PNJA 3RC9A 4FKBA 3SJZA 3MIZA 4UM9B 1VKRA 4BLWA 3BMQA 5B1IA 4ER0A 3QIVA 4WA8A 1T0PA 3ITKA 4YK7A 3RABA 1DP4A 1NR7A 4IXDA 4BLQA 1AQJA 2B5WA 3M6VA 4LV6A 5KYXA 3QE9Y 1ONNA 1EA7A 2R2GA 4QVGA 1LVHA 3LBFA 4E2YA 1A1VA 1PZHA 1KIMA 3LDUA 2Z2ZA 2GWRA 2RHHA 4I19A 4LDNA 2GPBA 3X1XA 2WWVD 3S5UA 1WPGA 2WR8A 1JHRA 3K0FB 1IXKA 1GZSA 1QYCA 3W1WA 2HU2A 2HREA 4L3WA 4M88A 3RHTA 4CLRB 4CIDA 5B7PA 4JEMA 1J0BA 5K0SA 3H5IA 3G8BA 3IUPA 4IILA 2EV9A 5CTAA 1BWPA 3TM4A 3L92A 2ID7A 3IP6A 3L8EA 3MS7A 4NATA 2WQ7A 3V4RA 2JG3A 2NMVA 3W3AD 4F2HA 1W5TA 3CISA 2NQTA 1L5LA 3ZGOA 1IQ0A 3V1NA 1KOGA 2YC4C 3MHTA 3DT6A 4LRUA 4MQ6A 3JTMA 2PK3A 3R6TA 3W5JA 3IA7A 4B5LA 4HTFA 2BFDA 1D0SA 5EN4A 1DJPA 1MO3A 1KI6B 3BAZA 2O05A 1YCGA 4XWAA 2OA0A 3RJZA 2PTHA 3ABRB 3NX4A 3KB8A 3OM1A 3DYIA 1RBMA 3OY7A 4JJ8A 1DHTA 2C0CA 2QN7A 4F9TA 3IP5A 1F0YA 3GG2A 1YV9A 3FYUC 1OBVA 3UAYA 3Q4GA 3Q0TA 5GAJA 4O4IB 2HK9A 4M1ZA 3BX1A 3GJRA 4MCAA 2G0NA 5DOZA 3GA7A 2AJDA 4QDOA 5CIYA 3T38A 1W96A 4EYEA 1POXA 3FCOA 4PINA 4MS4A 5HW0A 1MQAA 4NFLA 3SFVA 4UBKA 4AKTA 3T34A 2FFBA 3L4JA 4N3BA 4KIWA 1YB7A 4TM7A 5KYNA 5LOVF 3MXOA 1Z08A 3IQZA 5FUWA 1MVNA 2XTZA 5IAEA 4UUPA 5HA5A 4EFDA 2BTQA 1P31A 3CT4A 4DLAA 1AK2A 3QX9A 2YWJA 5KOIA 3FOWA 3TCNA 5F3RA 1R6TA 3PNMA 2Q1SA 4MLCA 1K7YA 1U80A 4P31A 1DX6A 3WWEA 3WGGA 3EG9B 3LH5A 2VUIB 2DLNA 2D2XA 3M1YA 4YRRA 4Y8VA 3FTPA 2JLWA 1KMCA 1QCCA 4Y0VA 4NLEA 5LXTF 1NE2A 4YXWD 3ZV6A 2W2OA 2WYWA 1CUCA 1VJ0A 2FPMA 3PFGA 1N2BA 1OI3A 4I5GA 3PFHA 3MM4A 4BUZA 5ER9A 5AVXA 4IOKA 4RL4A 2ZPUA 3QLTA 4X6UA 4IHJB 2QYHA 4BWVA 3E22A 3T7SA 4IDNA 3I6BA 1YL6A 1XTRA 2WKWA 2BGGA 4JQZA 1SCQA 2WKPA 2PGXA 2FW8A 4MVJG 4MKHA 4X94A 5DZSA 5JW6A 2P2DA 1HYBA 1TEXA 3EEBA 2JJMA 4G81A 4NZZA 5A1TA 2CLIB 1Z0FA 2RIRA 3F8SA 3QKWA 4NV3A 6REQB 1I7QB 3HGQA 2QRNA 2C2MA 4RMGA 5LLSA 3W7BA 4UOEA 3G6WA 1BHO1 5CFQA 1LB1B 4GLLA 5EIBC 4KVZA 5C1OA 2BUAA 1SXQA 3D8UA 4R1OA 6ADHA 1XKQA 1Q0HA 2HC9A 1LDEA 4DABA 3KLPX 5CB6A 5L9AA 4RY9A 2NXEA 4RVUA 3JS5A 1RBYA 3AT1A 5DT2A 3QY0A 3HNRA 2Z1NA 4FKMA 2I7TA 2VKTA 4N76A 1MABA 3M4NA 4LYEA 2X3FA 2BHTA 1IY1A 1YHZA 4BTLA 4LYJA 1FUPA 2NPIA 3Q87B 3DAPA 3VTKA 2NQ8A 5LZ2A 1MB9A 1U63A 1UQUA 4AJKA 2YMLA 1HFEL 3IPXA 2QZPA 1VA4A 1P77A 2REBA 1E2EA 3TRFA 4C2UA 3HO1A 3G2OA 1RAIA 3GTDA 1GGEA 4J3JA 3IODA 2D59A 4RFSA 1T2AA 3RSSA 2H4HA 2XB2A 3M33A 3O83A 1EHIA 4CKWB 4EATA 4ENUA 4LDRA 5CURA 2GAAA 5FTMA 3WX0A 2AN4A 1T2EA 2P9BA 5FYQA 3ZCXA 4QGSA 621PA 3MJDA 4QUKA 5ALKA 4YY3B 4ZT3A 5B5SA 1IZYA 2C3YA 5CTJA 2VUSA 1E58A 4KGXA 3PGKA 4XJVA 3WIVA 1Y9ZA 2IKSA 1YFJA 3VYUB 2O8EA 2PT6A 2VUUA 4IIDA 5E8JA 2YXDA 2C4TA 4Y1FA 2GVZC 1HSOA 5FKJA 1GU7A 1XLUA 1T6ZA 1TVMA 3WNDA 5KMGB 5ALLA 4GIBA 5HE9A 1WMBA 5D3KA 4DEVA 4OFWA 3TINA 1H3EA 8MHTA 5BSMA 3FSRA 4QDXA 4MUYA 1SIBE 1PJ4A 4MV0A 2J3EA 5JJCA 5EZ5A 2JGAA 2BL4A 1EUCA 2R4TA 1T3GA 3LPDA 2QTLA 1K6XA 3G8DA 1VFNA 4OKNA 4OVKA 3BMOB 2XA2A 2Q49A 4MW2A 4CRWB 4EAQA 4DXHA 3GEHA 3EFOA 3ZG6A 1EESA 1QUEA 3OCUA 1JQKA 3A11A 1XLTA 3EZ7A 3UFBA 1GCGA 3T5MA 2ACKA 1JEQA 1A5SB 1Z0IA 2NAPA 3QI2A 2ZBQA 5AP9A 4D45A 1K4YA 5FIUA 3SZGA 5LQJA 2HQ1A 2UZ0A 3O8NA 3SM3A 4XJXA 1MB3A 2VDOB 4HBGA 2J9XB 4MUNA 3T7RA 2GZ3A 4FKZA 1DKUA 4BGUA 2E5FA 4CMBA 1IZ7A 2YVKA 2ONYA 3BIXA 2AI2A 3PQ8A 5HOQA 1YVDA 3DMDA 2OCXA 2EQBA 1FUIA 3PXEA 5HX7A 2FLKA 4EQ6A 2G1KA 2F8LA 1RNLA 3C3XA 2FSHA 3B2EA 4HN4B 4G6ZA 1S8FA 1ML3A 5DF1A 1HTWA 4LYAA 2ZFUA 1QU3A 4IIXA 3RYCA 1TZMA 4HDMA 1CUSA 3HZZA 4LOIA 5CT5A 1EUDB 1Y82A 2B9EA 2P91A 3TJRA 2D3WA 1VHLA 1HF3A 3A10A 4C6RA 4PAGA 2CZQA 3PXBA 3C16C 4US1R 4A1FA 3RFCA 4WZBE 5EPEA 1YS4A 10MHA 3K6RA 2BGRA 4KVAA 3UFXB 4AZ3B 1KMQA 1XWOA 1QIJA 2NTJA 1UIMA 2VK2A 3V2IA 4Q9IA 1N5RA 1Q3KA 5KUTA 1MGPA 2RGRA 1E3MA 3D8NA 3QNMA 4MVCA 3P9XA 3ZJVA 2GN0A 1W29A 1GL6A 3G9XA 4C7XA 3N0RA 1M1ZA 4B9AA 2XRFA 2XYHA 2NU7A 3GJYA 3QMMA 4DDKA 3MMSA 2IU6A 4RH1A 3CPEA 3RVOA 3TAHA 2CHFA 3VR2D 4UM7A 5LQCA 1WF6A 1MNAA 4LPKA 1Z6YA 4OXIA 3SYTA 4UTOA 5ALWA 3HL4A 2JAWA 5KOJB 4LZAA 1TJUA 4YWHA 4C4SA 3WLRA 2YQ4A 3LFHA 4R8LA 1L1RA 3PHLA 2M6RA 5DM4A 3GJ5A 4B3GA 1KU0A 2PX0A 5TQ2A 5ENDA 3L8YA 1J42A 3Q2KA 3RV3A 3CVWA 1K9VF 3RE1A 1NM5C 1EWVA 1MC1A 2EIXA 1ZR2A 4MS1A 1UXHA 1O6ZA 2E21A 1LDMA 2Q8NA 3QKUA 3JPWA 4GE0A 1XU7A 1CRQA 3U7RA 1FFBA 3I42A 3MWEB 2I4IA 1AJEA 4RD1A 3NBMA 4W5WA 5CFLA 4FWTA 3HMKA 4PWYA 2IQIA 3EC7A 3LUKA 4OGWA 4G24A 5HIMA 4C7OB 1EXNA 1UBNA 1YR3A 3DBHA 2NU6A 5M7EA 4E4YA 3VNVA 2F8MA 5IFKA 5EHQA 1PEKE 3IUSA 3C41J 3CUSA 1F1JA 1RQRA 4G1FA 1ZM2A 2ORIA 3ESYA 1G66A 1N2GA 2GZAA 3O7WA 1JIIA 4I1UA 5A71A 5LB4A 2WY2D 3R9IA 4D25A 1AA9A 1UJNA 4CF5A 2OEPA 1E1CB 3GCXA 3UAXA 4BEBA 4KHPB 5FT9A 3T7KA 1WXQA 5HXAA 5K99A 2QHXA 4FHGA 4LG1A 3IAS1 5BN4A 4IXWA 4ZEMA 4JN6B 4DDTA 2E6UX 2VHEA 1SPBS 2GERA 1FW8A 1L9KA 1M8FA 1HY3A 2IW1A 5CJPA 2R48A 3NHMA 4MB6A 3LVFO 5C4GB 3NAGA 4M86A 4ILKA 3WSVA 3KJIA 3M6IA 2QD2A 4KYVA 1PJTA 1NMXA 2JLYA 4AL4A 4BZXA 1WVIA 3G0DA 2OFOA 3KV3O 1E5XA 1ZX1A 3WZ2A 5HM6A 2ZK7A 4DA0A 1IATA 4LVUA 1I1QB 1VPVA 3R1IA 4MZDA 4JVOA 2P5SA 4URWR 3GA5A 5IJXA 1I5EA 4QOEA 5BXYA 5JZSA 4FSXA 3KKLA 4OK3A 2QGFA 5LMNB 2B8WA 1DEOA 4HD8A 1H3NA 1GZ7A 2B4RO 3REQA 4YR9A 1CUXA 4W5QA 1QZ3A 2JFXA 1O57A 1KQNA 1NW4A 2UZ3A 3CLVA 3AI7A 3KKZA 4MGKR 4ZRMA 1ZXBA 5JTTA 1UKAA 1LS6A 1WSWA 2BC9A 5BN5A 4WWHA 4HQNA 1G17A 2BKVA 4WBNB 1BOOA 1XQ9A 5G3ZA 2EQ5A 3OG9A 3F5QA 1BWQA 4B0PA 3MK31 3ZU4A 1A69A 1J23A 1KY5A 5FUVA 1Q21A 1WR8A 2WLSA 3K94A 1V11A 5C35A 3INGA 2GBPA 2AWOA 1ZI8A 3UJ7A 4DSAA 4NBVA 1EFCA 3WRXC 4DRZA 4DA6A 5AKYA 2P4SA 4DUZB 4EG1A 1NOJA 1T1GA 3L7IA 4JXKA 4GUDA 3UK7A 4W1RA 4D8XA 3G0OA 3OPMA 1SQGA 2P90A 1FYFA 3MINA 4LJ8A 5IT5A 1QZUA 3ZCTA 5B3KA 3TCXB 1EK5A 1T10A 2B6HA 2BGUA 1FSZA 3TE7A 4CMEC 3GHYA 3EBOA 3HCDA 1PT7A 5BO5A 1EGHA 3I5UA 5T4EA 1BN6A 3D0QA 3IBSA 1QV9A 3QPCA 5CA0B 2O23A 4W8GA 1A4RA 1NVAA 2Q4OA 4JEIA 3WIBA 3JD4A 4QRHA 2LNDA 5CW1A 1YR7A 3TTWA 3RIGA 4PG4A 4QDUA 5ILOA 1AMNA 1AUQA 3RKUA 5FWXB 4QYWA 5EYPA 1N6LA 3QVSA 3RAEC 4EA9A 4FUQA 1B0ZA 4RS3A 1ZCZA 2R2AA 3EXAA 3O82A 1E2PA 1JR2A 3DDZX 3VTZA 3HXPA 2AW3A 4TLDA 3ZE0B 1SUAA 5HKBA 1C1YA 1X7DA 2AUTA 2REOA 3R09A 2CL0X 2EKDA 4DAEA 1XE3A 2FEXA 4M83A 4EJSB 3ETNA 1DUSA 1JDNA 4QPNA 2JD2A 5TE9A 5IARA 2GXAA 3F90A 3QKRA 2UXDB 4I1RA 3U60B 4D56A 2X2PA 4PTYA 5T5QA 3I45A 4CQJA 2BCJQ 2V7QD 3K32A 5M2QA 5MFZA 3AONB 4Y9DA 4IHJF 3VGJA 2VDWA 1B3RA 1DFGA 1V8BA 2AW5A 3CIFA 3LW8A 5ALVA 4A0RA 3WLIA 4Q37A 3E3OA 1R00A 1ODKA 3I9OA 4ARVA 3FCEA 4EVQA 4IMPA 3FHLA 1C8LA 3BPSA 2FPRA 3FROA 1XLVA 2ISQA 3TBFA 1HT2E 3BF7A 5KNDD 1VLQA 3EIOA 4GPIB 4N8EA 2PBLA 5G02A 4F3TA 1HT3A 2H00A 2P30A 3LBYA 5DSZA 2QTTA 1DEAA 2FUG1 3UXHA 3FNHA 3VMMA 2GYYA 2DERA 2JFZA 2LCIA 3CY6A 3ONVA 3G0GA 4MWEA 4RIFA 2OORA 3TLCA 4DQLA 4M87A 3VTFA 1NBMA 2XZTA 3TW4A 4A10A 3LTNC 4IDAA 5LYJB 5HW2A 2B4QA 2PRYA 1G8AA 3E5RA 3GUYA 3PFBA 1VLVA 3DBLA 3DKVA 4MUIA 4QGGA 4Y6PA 5E6UA 3WISA 1WX1A 3ZHYA 5B4VA 4RTPA 4Q3EA 1XZCA 3Q7PA 3WYEA 3COVA 1CQIB 2XB6A 2XMDA 1S2LA 2JIZA 4KFTA 1WB5A 3HCRA 3A4YA 2GKGA 5EXTA 1SU8A 1FLDA 3I39X 2PUAA 3PLAE 3VH4A 3DV0B 2X9QA 1Q1QA 2ERCA 3MG9A 2ICAA 4KJXA 5FCDA 3UAZA 2XXAA 2A4MA 1FC0A 5KC9A 3EODA 1NXQA 3ZCSA 5C5IA 3FFBA 1B6GA 3AV0B 3R5KA 1PRYA 2ODQA 1Y9AA 3WDSA 4CR7A 2QV0A 2XBLA 5HR5A 3B1ZA 4C6SA 3R7WB 1OXXK 2HGZA 1UBFA 2ETVA 2HFJA 4DBVO 2R1TB 4DF3A 2C7RA 1XDWA 1GTVA 1EEXB 2HWWA 5KWJA 1PHPA 1UXKA 3I1JA 4ABTA 1UK6A 5JCOA 2JLAA 1YDEA 2VPQA 4MQFA 1SBQA 4D4GA 3R23A 2A9JA 3FETA 5JCXA 1VG0B 5EXXA 5EUMA 4KR7A 2VTBB 2X9VA 1D07A 5LD2C 3WK7A 4E1AA 4C4XA 3A1WA 1GL3A 1ABEA 1MV8A 1EWYA 2ZYHA 1U0HC 2QXTA 2OXRA 3KZMA 2Y1XA 3P4XA 3ZW8A 1CQPA 2OORC 1N5KA 4EB6A 1GUYA 1KORA 2XV1A 4Y2PA 1RE5A 2CZCA 1UPFA 3W6PA 3F46A 2DX7A 4GBMA 1PAUA 4KLCA 2OVBA 5F1YA 2GXUA 2OBFA 1M2JA 2IOYA 3S1LA 1NQWA 3AEUA 3K96A 2RHOA 2OHGA 5CNKA 2OD2A 3P0IA 1E1RD 1SVWA 2VJDA 2H5LA 3ONWA 4C7KA 1MNQA 4YB8A 3PX2A 1NJGA 2N0SA 2OOSA 2V1UA 3JARA 1WW3A 2F3TA 3G13A 2HPAA 1FSFA 3SN6A 1DE0A 4BATA 2KX7A 4UOZA 4DUPA 5K9ZA 3EMDA 2E4UA 2XUPA 4ND4A 2R5WA 3RUAA 4BQFA 1XO1A 2YDXA 1TLFA 3ZE2B 3DTVA 3HVRA 2AC2A 4ND6A 3DKKA 1ZBDA 4Z5XA 3JAMA 3KTAA 2RAUA 2O0LA 4IJ6A 1D2GA 1DBWA 2IP2A 3OWOA 2LZ0A 3ABIA 4Y67A 1X1EA 2BKAA 4QASA 2EYQA 2A0XA 3LUBA 4IRUB 4UUOA 1V4VA 2OM6A 2CWDA 1ZGZA 1SUDA 1WNTA 3CCBA 5EEGA 4E12A 2IZOA 4WBXC 1IB6A 1NW7A 4RETA 4E30A 3OQNA 5ITVA 3LY5A 4EJ2A 4OI1A 1E3WA 1JQ3A 1GPBA 2P40A 3RRFA 1CJTC 1HDGO 1WPXA 4LJ7A 2BFEB 4ZT5A 4QAQA 1YE5A 1E3IA 4YT4A 3OLQA 5CITA 1DRVA 1Y6RA 1A9OA 2JVKA 2ZYVX 1VSVA 3HP7A 4HSEA 4D8YA 4R7TA 5BUZA 3UATA 3L0YA 2MYUA 3QK7A 2GK7A 5CYPA 1FTGA 2P6OA 1GA6A 3FZYA 4R83A 4TKMA 4IKPA 4FS3A 1YUBA 1ECBA 2IXEA 3S68A 3VOBA 4EEXA 4F7WA 5F9FA 1PK8A 4P4GA 1DAGA 1XFAA 4NHEA 4PS1A 1U2TA 1DXYA 4KQKA 4X93A 1CUIA 2GRUA 4W5JA 2ABWA 4DNQA 1P60A 2R65A 1FTWA 3LQYA 4NK4A 3J7AC 3WQRA 4MYCA 2JEOA 4L2IB 4CL2A 1XDUA 2AFIE 2IJGX 4MUJA 2JCXA 4D3FA 3PNPA 4M9QA 3RJMA 5HOEA 5KSYA 2HIHA 3WICA 5BVGB 3SI7A 4GLFA 1IAVA 3H99A 3EK2A 5DBEX 1IONA 1X92A 5CA1A 4P3PA 3DEJA 4RADA 4NSNA 4MS3A 3VR0A 1ZD8A 2EJUA 4GOXA 4HRYA 2JCVA 3B60A 1UKEA 3DOOA 4X6XA 4ZDWA 2XMRA 4RHCA 1ZITA 4EP1A 4DV3B 5AKXA 2Q1XA 4LTDA 3NT5A 1BKYA 4GZ3A 3Q7TA 5A4JA 2L42A 1U0LA 3L4BC 4LSZA 1AKQA 2FN8A 2VZ0A 1UXOA 1BMDA 3L7OA 4P58A 3SNHA 4CTKA 1QANA 3G7SA 1JJ7A 1PGQA 3W8RA 4DZZA 1B6SA 3SBOA 2X40A 4JOCA 2WJIA 2CL5A 3KQYA 2PSSA 2FK8A 5HJ5A 3LJKA 3QMPA 3MEQA 3J7TA 3JYOA 1YFLA 4CQNA 3LP6A 4KAFA 5LMCA 3STXA 3M9XA 4MR7B 1I3NA 2BKXA 4Q9HA 4FI3C 1AQIA 2BEVA 3DBOB 1I2ZA 4ZXFA 3H2IA 3SHQA 2H7CA 2R00C 1AQ6A 4Q3AA 4A8PA 3DOHA 3WYDA 1M5UA 4QYXA 2W2TA 2BJWA 3QYJA 4Q47A 2A6PA 2ZJ1A 1KEEB 3B12A 4LZWA 4JJFA 3ZV5A 1SWVA 2O6HA 4JZKA 1HNZB 1D2MA 2AEJA 1RABA 2PLAA 1T3SA 2EF0A 3SF8B 3EPKA 1HXHA 2ZP1A 2I99A 1FFGA 2C58A 1G3UA 3C8HA 3LRXA 4BNLA 4Z8YA 2PN1A 1RC0A 2ZYIA 1NNUA 3HVHA 3A1TA 4W1PA 1YVRA 3L79A 1NYTA 2NXCA 3D7RA 1IHPA 4E31A 2IDKA 2IXDA 2R6AA 2Y76A 1L5NA 1HO3A 1IHUA 2YY5A 4QL3A 4KU4A 4N5MA 3I0ZA 1JLRA 4HOYA 4KODA 3RBVA 1VI5A 3TGPA 3QVUA 2OR3A 3WWZA 1YJXA 2CN1A 2J6IA 2AGVA 2WJWA 3NB0A 4HNRA 2AXEA 5CT6A 5JQWA 4Z51A 1AC5A 4PO3X 1T2FA 2JIBA 4R9UC 4FTWA 1U15A 3HCFA 1RZRA 1CEYA 3LBHA 4ZVKA 2LPMA 4G0VA 4L5YA 5KNBH 5KNBA 1N5OX 1Q19A 3FPEA 4L5IA 1EYZA 4N6OA 1SU7A 3FOFC 3CLRC 2XX3A 5DI9A 2DH6A 3W2IA 4URVR 1TAGA 3LT5A 1EP9A 1D2CA 1OHHD 2CCGA 3QHAA 3INNA 1VYUA 4EAAA 2CXQA 2ORYA 4UREA 3EGCA 1MX1A 2IIBA 1DBQA 2CYCA 2B0JA 4IZ6A 3MT0A 5ULLA 3KE9A 4ESEA 3N87A 3PGVA 2FW6A 4WBNF 5L51A 3UJ9A 5EE1A 3WJ7A 5A9SA 3CHYA 3EZLA 1QVVA 4C4PA 1GLVA 5HILA 4IX1A 4C3OB 3VOAA 4UVHA 2G88A 3B9QA 4O2AA 4W99A 1U16A 4WCVA 1NFRA 2UUBB 4Q93A 4Z0HO 3NYWA 5JXJA 4KE7A 1Z6QA 3AUUA 2FWJA 1PJCA 1WXHA 4X6LA 1X80A 3HK2A 2NTEA 3KJFA 4G41A 4GM1A 2RMKA 9LDTA 4R9NA 2B5VA 1RXUA 2KSQA 2YWCA 2AC4A 5JAMA 2ZR0A 5AVRA 1I36A 4DPLA 3CE9A 4YJDA 3OQ6A 2R85A 3PI7A 3IR7A 1QG2A 3HKDA 1E5DA 2O8BA 4K9SA 4NBWA 3WIOA 3OLVA 5A2QA 1KYTA 1Q83A 2OD9A 2SCUA 1ZSYA 1GXSA 2OESA 1EDBA 5ICCA 2MT9A 2C5AA 1G21A 5J47A 2JHCA 3USES 1KEUA 1PG2A 4P3YA 4JA0A 4LV5B 3VUEA 1A3CA 2P78A 2BTOA 3QX7A 4Z4QA 1UDXA 1W5AA 2VTVA 4WNIA 1JGTA 1FQWA 2P9FA 2HCFA 4R3UC 5D6NA 1HE5A 2OCDA 2FR8C 4DOMA 4X7MA 3T7TA 5DCYA 1Z36A 3QXSA 3U7IA 2OZLA 2RAFA 1U28C 3FUTA 3JQAA 3H1EA 3H1AA 1U2QA 1U1FA 2O48X 4HPXB 2FUEA 4D3XA 2GM3A 4R6WA 2FPXA 2X6QA 3HJTA 2QQ5A 4M1OA 5E2AA 2ZBPA 1MC8A 1W48A 3UCFA 1HZJA 5JZMA 1CLUA 3ZD7A 3I04M 3ND7A 4J4HA 3R3HA 3ZJUA 1VHDA 1XYVA 4FI3F 4J4BA 4BNDA 2QMOA 4XRGA 1C9JA 4O1MA 3TR6A 5B4UA 1XWIA 5LZ4A 3THWA 3PJRA 1WE2A 2BDUA 5ECGC 4WY2A 3IS3A 3BGIA 1SXHA 2Z9CA 2C59A 2QORA 3U56A 2W2LA 4EVIA 1LY1A 3NNNA 1XZFA 4ZZ2A 4ZEWA 2B8NA 1QC5B 1ESEA 1ZIDA 4MVJM 2A5GA 4HUQB 3L6OO 3VU1A 4JT8A 4R2MA 5BR8B 1BA3A 1TU3A 3N8DA 2CV1A 1QQTA 4IVRA 7GPBA 1KY4A 1NVBA 5CLGA 3A3PA 1JFVA 4UEJA 3CLHA 2CE7A 1Y1QA 4HBZA 4NBRA 1H2YA 4NULA 5H1YA 1Z7EA 3BEDA 4ZAFA 1FMTA 4GZ5A 2OGWA 3U3OA 4EBFA 4KTVE 4JUDX 4O4LF 4P54A 3AINA 2JFFA 3IDOA 3PE6A 4TMZA 2IF2A 2XNJA 3NOQA 4H7KA 2AR7A 5FPQA 3AI3A 1K5PA 1EG7A 2JGRA 4KWEA 3GY0A 3QUAA 3UQYS 1M1YE 2GR9A 4ZFNA 3FHJA 3EFOB 3KOXA 4NMWA 3NPMA 3ES9A 2TMDA 1ZICA 4B3SB 1Y37A 1AN9A 2FPOA 3NOVA 2C98A 1XELA 5FA5A 1A9YA 1EFPB 5F1PA 3BXXA 3FGOA 4HNQA 1QYDA 4S2UA 1CZKA 2F4VB 3RW9A 3DA8A 4OFXA 3KK0A 4EPTA 3B82A 4QSMA 2HMVA 4RKRA 5FFNA 5DK6A 1NOKA 3N5KA 3OFSA 4K87A 1ULSA 4NMLA 3D3QA 2R8EA 3Q3JB 4PCVA 3SG0A 2BEUA 5CK4A 1ANKA 3AXTA 3L7NA 1N6OA 3BOSA 5DHSA 4TVSA 1X7XB 5G0TA 3RD8A 2X5XA 2XNSA 3G17A 1K9SA 1ZD4A 3N2ZB 3U9TA 3VC7A 5C5EA 4DV4B 1SCNE 1L7BA 2UVPA 3CNOA 4HR7A 3WK9A 4MRPA 1YK1A 2BUCA 3DWEX 3KQTA 1FJ2A 2R8XA 4ZPJA 1FTYA 1TM7E 4PZAA 4RHYA 4RK1A 1LTHR 3R6VA 3EXFA 2GBIA 3QLVA 1LF0A 4P4LA 4FCWA 4EB0A 4BFSA 4BV2A 3WG9A 2KWIA 3HJUA 1K4MA 2P6NA 1Z39A 3PUWA 4QOSA 3TSCA 1XVVA 3T5AA 4Z9YA 2F59A 2JFYA 3AY0A 3M3PA 1HDZA 3BKWA 1XDBA 4L6IA 1KARA 3B1WA 4KYTA 1XMSA 3HTXA 2FZLA 3MYYA 1PVVA 5E4TA 2PZLA 3O4VA 4OHXA 3VNUA 1R8SA 1P0QA 2XNDA 5AKKA 1UT6A 4ZCLA 4GC5A 3SJUA 4GGPA 4QGAA 3RVRA 6PFKA 2AQIA 3VR4H 3VR4A 3RTAA 4HEHA 4YRGA 3R5XA 1SZDA 4FN4A 1QF6A 4FZRA 4CKXA 3LRPA 2EZ8A 3FYTA 1EVQA 2W2NA 1UM8A 3NH9A 1QH8B 4CM6A 2FMKA 5A0FA 4HAIA 4JI1B 4LIPD 2QNIA 5BOSB 1J39A 1ZK3A 3PGLA 5TPZA 1QQAA 3O1LA 1WUYA 1V95A 3NYIA 1PGNA 1E9CA 1OIVA 2QLJA 2J0EA 4G85A 2VO1A 5CYFA 1ZRHA 4K2AA 4CKZA 4DZRA 5CEEA 4A1OA 2I87A 2DM6A 3QEKA 4H7HA 3DZHA 1EXWA 4PSKA 2PGOA 5DW3A 2Z6VA 1X8JA 1JG3A 3BE6A 5HFNA 2B1IA 1ZNXA 5KTTA 5KQPA 1MZVA 4X63A 1UKVY 3KQOA 3LF2A 3LL4A 3GLFB 4H6XA 4NBKA 1C0KA 5I5EA 4F4HA 2PKXA 4KXWA 4ZV9A 1B8VA 2H1LA 5ERYA 2Z98A 1JLHA 4NH4A 3PC8A 3L6RA 1R6XA 4UPDA 4C89A 4F4DA 5JSQA 4LEIA 1C3UA 4X7BA 1EK0A 2E4ZA 4YYEA 1WB9A 4XASA 3DONA 5C2JB 3AL3A 1GOTA 1JX6A 1JQEA 3GUZA 4R8RA 4C0KA 3QY9A 1OB5A 4B84A 3RG8A 5FWYB 4N7BA 5CNIA 4WDRA 1F8UA 3DXYA 2BBOA 1VCNA 4L5AA 5ES3A 1L8QA 2MINA 2QK4A 5HF8A 1EVKA 1G41A 2J87A 4MIOA 1DJNA 2P4UA 2VP5A 4OQXA 4PFQA 3ZYZA 5JNVA 1Z29A 4GKVA 2VJLA 4PPFA 1KAHA 1OZAA 3AUFA 3EF1A 5JSHA 1U7XA 5K6TA 2R96A 4M1WA 1U0BB 3K0KA 5EPOA 3UJ6A 3WMXA 3UGJA 4A36A 3EULA 1BVHA 4DLSA 1RI4A 2AK2A 1PV1A 4WFJA 1XL0A 1J09A 1WV1A 2EHJA 2VDVE 4MKIA 4XB6B 1K8RA 4JA2A 4MTCA 5T6BA 2FWBA 2IITA 3ET5A 3IV7A 2FOLA 4GX5A 3TTSA 4BO9A 3BA6A 4NYMR 4ETNA 3GP8A 2OV4A 3LC1O 2BFFA 3PQ7A 4I4IA 3HBAA 1CZUA 3HB5X 1TT5A 3SQLA 3V4FA 3HU2A 5U9CA 3ZOKA 2WTMA 2ZTMA 1Y4UA 2YW2A 2B98A 1AH2A 2HUPA 2IXFA 3LYUA 3MWDA 3NBQA 2ZUTA 3E22B 1YWGO 3ZYCA 3AXSA 2NUPA 2EZUA 4J0KA 5D51S 3SOZA 2OHOA 2AI3A 3UENA 2IXGA 4J3FA 2C4KA 4BGIA 2N1MA 4WK2B 1SC9A 2OYCA 1JJIA 2DBRA 4D0GA 4W63A 1PJSA 2QD4A 1YNSA 2R97A 1WPRA 3AB3A 5G40A 2RI1A 3RIMA 4EHJA 1NN0A 2NVOA 2PU5A 4C0HA 3OKCA 2FFAA 5FOQA 3JAKB 1J7KA 4PZUA 2AD5A 3KBOA 3Q40A 4JI4B 5GIOE 1C1HA 1E6CA 3FR8A 1NY6A 5LN1A 4DRYA 3COJA 4KO3S 4CIBA 2GVNA 1JN0A 4J0FA 1E1CA 1I7PA 4NZMA 3WGTA 1Q0PA 2Z1MA 4JVMA 4CN8A 2RGCA 2UXCB 1A72A 1GT91 4MIYA 1E7RA 1GTRA 3JYQA 2JLRA 3EHDA 2HSDA 2F00A 2VT7A 4NEGA 4DQXA 5AJUA 3TIVA 4ZCQA 1W4AA 3KR0A 1U0FA 3DDWA 3KQLA 4B81A 2WIAA 2G1PA 3ZD6A 2CXNA 2JGLA 2PJUA 3PQ6A 5LYJF 2QL9A 1C9DB 2XMGA 3DMTA 2ZS8A 1RHQA 1VL5A 2FSFA 3GLRA 1UWKA 2AN5A 1QCYA 1SB8A 2R8YA 4G9BA 5FOVA 3K1JA 4WESB 4DSTA 2CFOA 4NK5A 3NTVA 1U7OA 3GJTA 4K28A 2WZDA 2QS9A 4KR6A 3JASB 5K3SA 4MSUA 4RY2A 1SCIA 5F2KA 1IBRA 3V8RA 4TN1A 3WLJA 4YRDA 2VH1A 4NXNB 1PEAA 4RV5A 3LCCA 4ZO7A 3KJHA 4QBKA 5AM4A 4BGEA 5KX5B 3HCCA 1BQ4A 1W2GA 5I8WA 4JBWA 4PHCA 1XF1A 2GZMA 1S7CA 2DFPA 1UMBB 2QR5A 2JJQA 4XCVA 2QSZA 5LZ5A 1Y4DE 3NONA 2I7VA 3ZNOA 2VA8A 1ZAYA 4Q01A 1W8DA 4PYJA 1V71A 3A1VA 1HORA 2VXYA 4XVHA 4DN6A 1XXHA 3LUCA 2OPBA 1GCUA 3DE4X 3FWKA 3T61A 3ZWOA 2XUDA 4LCBA 1J8VA 2XOEA 4KV9A 4BDTA 4AY5A 1LV7A 1NJ8A 1M6EX 1GN9A 3TBHA 3WKDA 3CLTC 4RIHA 4NBTA 1QP4A 2R1ZA 2DPLA 1ZU4A 5SY6A 5AVSA 5HGJA 4JFAA 2Q5EA 3OOHA 4HXGA 4EVRA 3WY9A 3I9NA 4AFNA 3H9BA 1MCZA 4RH3A 5EKTA 1RRCA 2AH5A 5JNTA 4QD3A 1HWYA 3MNFA 2B61A 2ZVPX 1K75A 4HB3A 4PEVA 5TV2A 4M0FA 2BFPA 3KVRA 4PHGA 2ZT5A 1ZNYA 4DMKA 3ZXYA 4RZ2A 3UHJA 4S1VA 5A05A 1ORTA 5JS1A 1P5FA 1LSOA 3EVBA 3RFUA 4ZMRA 1KC3A 2WVHA 2ZWOA 1IN7A 4MH0R 4YALA 3I0MA 3MJFA 1XNRB 4TSFD 3S4YA 3T5CA 3SE0A 1R4MB 1B16A 1HLGA 1AQUA 1E0JA 1CW2B 1PIWA 2EBUA 2QTVB 2GD0A 3FDIA 2ZWAA 3LHSA 1DARA 1Z25A 4MEBA 2ZSBA 2DH5A 2P9JA 3I3OA 2BFAA 1PO7A 4E5MA 4EMBA 3WIEA 3EQZA 4F0JA 3W5BA 4V0NA 3KETA 2YDYA 3NUZA 2FPPB 1CF4A 1YDGA 2I1LA 3CUEF 5KREA 1JKJB 2AJ8A 1GKYA 3M7IA 3OLYA 3ANSA 3DZIA 4FYKA 4RJ2A 5DH9A 3RT7A 4YV7A 4EJSA 1MOZA 2NZJA 3SHVA 1MH9A 1M0TA 4LNUA 3KWLA 3WRYC 4HO1X 5HZKA 4CIWA 2EXXA 4ARAA 3OEED 3T1YB 5TQ0A 1ODLA 2V54A 3A58B 3N2KA