1Z4JA

Structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with uridine 2'-monophosphate
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
194
structure length
194
Chain Sequence
RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate specificity of the human mitochondrial deoxyribonucleotidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords 5'(3')-deoxyribonucleotidase
total genus 63
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1z4jA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4jA01
3L8HA 4Y2XA 3ET5A 3L1VA 3P96A 2OA0A 3ET4A 5AI8A 2P27A 3I6BA 5AW3A 1F5SA 1O03A 4KNVA 2AGVA 4PNHA 2HHLA 1RMTA 4CNQA 2BDEA 3IJ5A 2WF5A 3N8GA 1WR8A 2B8JA 3KOOA 4I9GA 5AI4A 4RETA 3WKCA 4I9FA 1QYIA 2C8LA 2ZXEA 5AK3A 5ALZA 2MSNA 2R8EA 3ED5A 4Y2RA 1CR6A 3R9KA 5ALDA 2WFAA 2FPXA 5AM5A 1Q92A 2OYCA 3QU4A 4FFDA 5AW5A 3A1EA 3QU2A 4YGYA 3L0YA 1Z4NA 2FPSA 1ZD3A 2ZG6A 4EX7A 3SLRA 2OBBA 4C4SA 3NASA 2HF2A 1Z5GA 2DQSA 4L6CA 1NF2A 3U13A 1ZD4A 2CFTA 1IWOA 3N07A 3QGMA 4Y2UA 5ALHA 4BX2A 1N8NA 3U19A 2W43A 5AW9A 3WK4A 2QYHA 2YMQA 1XPJA 2C88A 2YJ5A 5AVRA 2YJ4A 3R09A 3PCTA 3IRUA 4UARA 3FPBA 1ZOLA 4UAVA 3L8EA 3D6JA 3M9LA 1QQ6A 1RRCA 5AKJA 3R4CA 4UMDA 5AKHA 3GYGA 1Z4MA 2GFHA 3WK5A 5AI9A 1ZS9A 5IT4A 3UMGA 1Z5UA 4HAIA 3UM9A 1RDFA 3ZUPA 5AW4A 3W5BA 2I55A 4ZEWA 1Z4IA 2WF7A 3HLTA 3OCXA 1Z88A 2I54A 4MWOA 2D2VA 4E88A 5AVUA 3ZWKA 1RQNA 1WVIA 1YV9A 5ALYA 4CF4A 4NV0A 4Y2YA 4DCCA 5ALVA 2HX1A 5IS2A 3ZI4A 2HSZA 2YY6A 3QYPA 3W5DA 3NIWA 4AP9A 2R8ZA 1Z4LA 3U7GA 2FPRA 2R8XA 3IB6A 4Y2PA 5AM0A 1LVHA 1TJ5A 1RKUA 4UATA 2G07A 5AI5A 3QXGA 4L57A 4QJBA 4DFDA 3KBBA 2B82A 1Z4OA 3A1CA 3OCYA 3L1UA 4B6JA 3U7EB 3NALA 3J7TA 2G06A 5AVTA 2PR7A 2JAOA 4CE6A 3DNPA 1TJ3A 1U02A 1TE2A 3BWVA 2CFRA 4UMFA 5AKLA 3SF0A 4UW9A 4BEWA 2W11A 2FPUA 3WK6A 2C8KA 2ZBFA 3B8EA 5AW1A 3OPXA 2IOHA 3OCWA 3L7YA 5AVXA 3S6JA 3AR4A 3DAOA 1RMYA 4EZEA 1Z4JA 4Y2QA 4IG4A 1RKVA 1EK2A 4UM7A 3I76A 2GO7A 1U2SA 3BA6A 5AM1A 3NUQA 4BKMA 2ZBDA 2JAUA 4BYGA 4UMEA 4MUMA 4YCLA 3WKDA 5AVVA 2G09A 2G80A 3N28A 2FDRA 4DWOA 1N9KA 3UMCA 4BX3A 2IOFK 3ZVLA 4Y2VA 2IYEA 5AW6A 2Q4RA 3ESQA 5AW7A 2YN4A 3ZVNA 1Z4KA 3AR7A 1SWVA 3MMZA 3WKBA 5AESA 4F72A 1X42A 5E0OA 3PGVA 2NO5A 2YJ6A 2YMMA 3KC2A 3FVVA 2WHEA 4BBJA 4HGPA 2AH5A 3EF1A 1L7MA 2EATA 1AQ6A 4IFTA 5ALEA 4C4TA 4NWIA 2WM8A 1RMQA 1YMQA 3AR9A 4DW8A 3WKAA 3EF0A 4YIHA 1L6RA 4AS3A 5ALSA 2EAUA 3ZTYA 3FGOA 3OCZA 1L8OA 2HCFA 5FP0A 3W5AA 3L5KA 2I34A 1K1EA 2CFSA 3WKEA 1WPGA 2X4DA 2EARA 3B9RA 5AM4A 3QU5A 3QX7A 2AUTA 3EPRA 1FEZA 5AI0A 3NAMA 5T41A 5ALGA 1Z4PX 3SHQA 3KZXA 2BY4A 4JDPA 4HGNA 4CF5A 2B1QA 5AHXA 5A3RA 4HYTA 3SMVA 1MH9A 2OM6A 1LTQA 4OD0A 3OCUA 3VAYA 3WK7A 4Y3UA 4Y2JA 1PW5A 5ALLA 4FE3A 1ZJJA 2G1AA 1RLTA 2B1RA 4FYPA 3ZTWA 2NO4A 3L8FA 1KYTA 1ZRNA 2Q5EA 4XE5A 4ZEVA 2IOFA 5ALPA 1U7PA 3U7FB 2QLTA 3ZW7A 5AK5A 3AR3A 2HDOA 1L7OA 3MN1A 1RPZA 2FEAA 5AKGA 2WF9A 5ALQA 5AVYA 3WK8A 3WK9A 4Y2TA 2Q4TA 5ALTA 3KD3A 3U26A 3AR8A 4BNDA 5AIBA 3QLEA 3SD7A 3QUTA 3F9RA 4HGRA 3RFUA 2I6XA 1QH9A 3QUQA 2P69A 3AR5A 3ONNA 2B30A 5AVQA 4OFZA 4L6AA 3WGVA 3PDWA 2WF6A 4RESA 4UASA 3AR2A 4YCMA 3U7HB 4UU1A 4NAVA 4Y2SA 2G08A 4KNWA 4NABA 4UAUA 4EENA 3E58A 4O8CA 1Z4QA 4UU0A 3L0BA 2HO4A 2ZBGA 5ALRA 2R8YA 1QQ7A 2C9MA 2ZOSA 2ZBEA 3N5KA 3PGLA 3E81A 5AK6A 2IA5A 2FPWA 2I33A 2P9JA 5ALKA 3ZVMA 2YJ3A 5AW8A 3M1YA 4J2TA 1TJ4A 1YDFA 4BX0A 3RF6A 5AK4A 1EK1A 5AKZA 1RQLA 2YMPA 3TLMA 1RLOA 4G9BA 1NNLA 1XP5A 1ZD2P 2JGAA 3DDHA 4HGQA 3E8MA 3N1UA 3EWIA 3DV9A 1XVIA 5JJBA 1YNSA 4XPZA 4KX3A 2VKQA 3A3YA 3A1DA 3OCVA 5AI6A 4AS2A 3E84A 1T5SA 1VFPA 2YBDA 5AM3A 4OHFA 2AMYA 3ESRA 2BDUA 1JUDA 5AKYA 1Y8AA 2B0CA 5AIAA 4HGOA 4YCNA 1S2OA 4KN8A 3SKYA 1L8LA 3QU7A 4JB3A 5ALUA 3B9BA 5ALOA 2GHQA 4C4RA 5AW0A 2O9JA 5AKIA 2PKEA 2ODAA 3UMBA 3ZX5A 4KYTA 4OCZA 4UMVA 5ALXA 5AICA 3QNMA 1TA0A 3CNHA 1O08A 1U7OA 3ZU6A 5ALFA 4UM5A 4J03A 5AVSA 1SU4A 3MPOA 4CF3A 2RB5A 2B8EA 2HF7A 1QQ5A 1ZD5A 4KX5A 5AW2A 3QU9A 4XQ0A 5AKKA 3W5CA 2HOQA 1YJ5A 5AVZA 5ALIA 2WF8A 4YIKA 3I1YA 2FUCA 1L7PA 2RBKA 3KDPA 2MU1A 2NYVA 3WGUA 4NFLA 3ZX4A 2HEGA 4BEVA 4EEKA 1S8OA 2FI1A 3QUBA 1T9ZA 2W4MA 2I7DA 2GHTA 2GMWA 2G0AA 1NRWA 1RLMA 1U2TA 3NANA 4YH1A 3K1ZA 5AVWA 3NRJA 3OTQA 2HI0A 1SWWA 5AKEA 5AKXA 3AR6A 4GIBA 2RAVA 5A3QA 1VJRA 2PQ0A 5ALJA 3ZWDA 2O2XA 4G63A 1J97A 3QUCA 3I28A 1VJ5A 1L7NA 3SKXA 1YS9A 2YFYA 1Q91A 5ALNA 5ALMA 2CN1A 1RC8A 4BNDB 4H1WA 3FPSA 5ALWA 2FUEA 2JAWA 3L0CA 4ZEXA 4F71A 3FZQA 1RKQA 4QQFA 2C4NA 4EX6A 4GXTA 3MC1A 5A3SA 4XOUA 2YMLA 1CQZA 1T5TA 2JARA 1WZCA 3CZ4A 3L8GA 5AM2A 5IT0A 3FM9A 2RARA 2P11A 1J8DA 4EELA 1ZRMA 3HYCA
chains in the Genus database with same CATH superfamily
1XRPA 1A69A 2GZ3A 4Y2XA 1QRDA 4LHXA 4BDSA 4EFNA 4DCOA 2REQB 2WAYA 1N8KA 3IBTA 5AI8A 2J0UA 3KHKA 3L8CA 2VJCA 1R4ZA 3ZV4A 4C88A 4ER0A 1RXYA 3E9MA 1GYPA 1AS2A 1M74A 1O03A 2Y3IA 3I0NA 3WBJA 4B7XA 4D6XA 5HZHA 5LU8A 1OLSA 5G41A 3U0VA 1IZ8A 2J09A 5EMLA 4BU1A 4ZI7A 1XX6A 2C94A 4BVFA 1EUDB 1R8JA 1SUDA 2C83A 1RAIA 4MI9A 1DUIA 1LSUA 3N8GA 1F4LA 2OCPA 3EGOA 1QM5A 4K9DA 3Q3GE 4X54A 3UAWA 1JKIA 3WKCA 2F8MA 1YF3A 3CF2A 3L79A 2FPIB 3I37X 5K0GA 3NKFA 4MVJM 1YDGA 3OTOB 4QQRA 1OT5A 2WYIA 1EA7A 2OILA 3DXXA 3ETEA 4EF5A 4LQCA 5DHPA 1E94E 1SXJC 1W46A 4MS3B 1RW4A 2EBHX 2BFFA 5D01A 3VAZA 4F4JA 3H13A 4ZVVA 2OV3A 5IDQA 1T1IA 1IAVA 3ECSA 4BQPA 1RU3A 2XBUA 3DWIA 2PMEA 3KB6A 1WP4A 2ZJFA 2QN3A 4P82A 1Q1AA 2X5XA 3K6SA 3OMLA 4XGRA 2A3NA 2OXIA 3UY4A 4OGLA 5JS8A 1GCIA 2GZDA 4EB0A 2Y1CA 4ZEOA 3EXHA 2VYND 3ZDDA 3CNNA 3WFZA 2ZUUA 2QP4A 4G1MB 5B5SA 5T64A 4FEYA 4P08A 1U2PA 3KSUA 4HEHA 1F0YA 1F2UB 1ZD4A 2ZB2A 3C5WP 3I42A 3QBVA 4HY3A 2FWAA 4L08A 1Y8CA 5JE8A 1DDGA 3IBCA 4Y2UA 4NCAA 1WO8A 5A7HA 2CLMB 4QOGA 1R8QA 4IWXA 3HLKA 3RB8A 3SBOA 821PA 1V9CA 3EEYA 4QXQA 4JYMA 3CW8X 2PGLA 2EKPA 3R09A 1DV1A 4BO1A 5L4SA 4LXQA 3BT7A 3VR3D 3VJKA 4KQHA 1NFQA 2RH9B 4K6FA 4X00A 1MIOA 1JFVA 1CKEA 1G5TA 2GWHA 1DKLA 2BZ1A 4DR1B 4B2IA 4GC5A 4PHFA 3FETA 4B46A 2P6RA 2CE2X 1BOOA 2LDXA 3E9DA 4G1UC 2M1ZA 4UBJA 5TE9A 5T6BA 3DKVA 4W5WA 1DXHA 1I4DD 4KO3S 1P1HA 4CI0B 2N1BA 2GFHA 4HQRA 4ENSA 5BT8A 4O4LA 4ZYWA 3MUNA 4GXNA 3O2QB 3TW0A 5IT4A 5JZ9A 2FFQA 3HRIA 2XKKA 4EHAA 1E1RD 1LW7A 2PL1A 2E4UA 2HRDA 4TSRA 1SXHA 3EXG2 4FE7A 5DLPA 4RVUA 5FL7D 1ULSA 3BG5A 3NWBA 3R3HA 1JDBC 1XZJA 3LF1A 4FKBA 3CC8A 4APBA 2AR7A 1M8GA 5FA8A 1AM4D 2Y1LA 5K3CA 2GWRA 4W8GA 5D87A 1ML3A 5E6RA 4D79A 1WVIA 4CF4A 1VJ0A 4TQGA 5JMOA 4I4LA 1RWNA 3AIIA 1T36B 3T94A 1O8BA 2I6TA 4B3RB 4RZQA 3W8DA 3M33A 3OHSX 4TM8A 4HV4A 4PRLA 5KPJA 4WCDA 2B98A 3OAAD 1TVKB 2PWBA 3LS2A 3QE4A 1ZSYA 5GJCA 1AS3A 4GOND 3OJOA 4YMVA 5C4IA 1DC7A 3I32A 5CEJA 3CEPB 1W85B 1THGA 4P4SA 5JCPA 4M2LA 3QIVA 1YNOA 3UMRA 3RD5A 2CZQA 4D4JA 3R6DA 1LDYA 4QJ5A 2XXAA 1O6GA 2GXUA 3FDZB 3ITEA 1NJ8A 1VIVA 4O4IB 3UUWA 2I4TA 4IICA 2R2AA 4HFJA 4FR0A 3LCJA 3A6EA 4QJBA 4V2UA 2VQFB 4CFSA 4D4IA 5L3QB 5KQLA 3L0IB 4IGIA 2BRUC 2PL9A 4MDYA 2OHHA 3CTMA 3UHFA 4JL6A 3ZJ4A 1LJ8A 3OCYA 2CDCA 4EY7A 4ES6A 5L7YA 2WAXA 5FUQA 3AUSA 1ABEA 1UMBB 1VIYA 2Q5FA 4HZGA 4L16A 2O5EA 3T34A 1ENOA 1OFUA 3AUJB 4WKPA 4ER5A 1QGAA 4HQLA 2GRUA 2FNAA 2IHYA 3Q8LA 1SD1A 3FXAA 1D5WA 1HH4A 3K3PA 3QEMA 5BYBA 4BLQA 1IBSA 2R6FA 1Q17A 3GFPA 1V7ZA 1GYQA 1ZY2A 2YNMC 3UGJA 2F00A 3L7YA 4IFBA 3A1UA 4Z1MA 5JIBA 1P1CA 3CG0A 2ZTSA 3OJWA 1J8MF 1HV8A 1V41E 2QMZA 3DAOA 2CXSA 3KS9A 5TNXA 1HT3A 3CZ5A 2FR8C 1RKVA 4ITVA 3NW9A 1HL7A 4NBUA 5LLTA 1LBSA 4TMKA 5AUQA 2G1JA 2XITA 2WVJA 5LBUA 3VISA 4GPZA 1PWHA 1E8NA 3BEDA 3G7UA 621PA 3TR6A 1K89A 7AT1A 3F5DA 4BYGA 3PE3A 2CFOA 3DFIA 1ZITA 4C1BA 1GQQA 2VNKA 1XG5A 5DHRA 1VE9A 2YJNA 1K88A 1NW5A 3HBNA 4GR9A 1P4SA 4BWYA 1V95A 1G7TA 2J67A 3AUKA 4IZOA 4AN0A 3EDOA 1NI5A 2ZTLA 3DBVO 4XLLA 5K01A 4OSOA 4Z4IA 3RTEA 3PLAE 1R64A 3SQMA 5FUBA 3WYGA 5CG1A 3HXQA 2F64A 2ZUDA 2QNIA 4BFVA 4PQEA 2FMIA 3D5QA 1X7XB 3OQPA 2O0LA 1QVVA 4AY5A 2YMMA 3FNFA 1RKXA 4X1KA 1YR8A 4IJQA 5IJ0A 1T4DA 4EZIA 4H0CA 3V4PB 1WG8A 4FOPA 2X1MA 4ZV9A 1R8SA 2QD2A 5T3YA 1HX7A 3JD1A 5EXDA 1X6VA 4CMEA 2D1QA 3IPCA 4YV0A 1ZJ4A 1C3EA 1QF9A 4JVNA 3IHTA 3TDMA 3LQ2A 1XHLA 2XODA 3EOAI 3BIJA 5KU7A 3L93A 2JK0A 1KP2A 3L4BC 3M6IA 1T9DA 2LPMA 3JR7A 1EUCB 1OBVA 3LUAA 5JBIA 3LKBA 1YQ9A 1E3QA 1TGVA 1GA4A 1UZAA 4KLCA 1RJ9B 1U3VA 3FCOA 4IXWA 2HF9A 1T36A 1RYEA 1D2CA 1YZNA 2D2FA 4JELA 3ZHXA 1K1EA 2A67A 3QMVA 4TRNA 3QF4B 5KHAA 4EHFA 1H1TA 2XF8A 4EW1A 4OB7A 4RXTA 3AEXA 3WLQA 3SY8A 1WPGA 2QRVA 4NTZA 1RIIA 2NV0A 1B8NA 2WV9A 3PNYA 4UTOA 1SBYA 1Y1RA 3HYRA 1TUIA 3UWMA 4DJ5X 4DR3B 1PZNA 3TJRA 4RD4A 4P38A 4P4SB 4U6SA 5KNDH 4DR5B 1WOMA 1EFPB 2CEAA 3SDZA 1CSEE 2D28C 3WLNA 3ZDZB 1A04A 3F6BX 4R3WA 2I0FA 3QLUA 5LNK1 1XN4A 2QZPA 3MOIA 4GMGA 3F4BA 1KXZA 2YYYA 3FX2A 3PX7A 2BFNA 1H9AA 2BL4A 2H5EA 3SDBA 1A95A 3TM5A 3BSWA 4MW4A 5THKA 2B8TA 3DP7A 4L85A 2GCNA 3OCUA 5DCLA 1XCPA 3DFMA 2MR6A 2D1SA 2NTYC 4E46A 1HWYA 2CLSA 3JQCA 1BHJA 1O4VA 2M6KA 1QE5A 4KH1A 3HUUA 4BAUA 1VKHA 4AUMA 3C6MA 2WHRA 1K8YB 3L8FA 3IAM1 4IV0A 4NBTA 4BN4A 5HKAA 2QN7A 4PRZA 4YVFA 2UYOA 1R00A 4CKYA 1E1RA 4R16A 3LK7A 3K1TA 5DGIA 1ZD8A 2W58A 1AGPA 1NONA 5D00A 4B4KA 2P1DA 5YASA 3E22A 2P9FA 2AFHE 3FTQA 3TEFA 4DQLA 1AMUA 1G38A 1IG3A 3QEOA 3K2BA 3F3YA 5AKGA 3LQKA 3HS3A 2ZBQA 2FPMA 5MN4A 1YA6A 4O2LA 5CDUA 2Q4TA 2QXTA 4G01B 1ZP6A 3U26A 1CEEA 4RABA 2NSYA 1REQA 3FIUA 5KTSA 1NVKA 1W9MA 2MSCB 4RHEA 1KKLA 4BQOA 3BQ9A 4HGRA 3O8QA 3PFFA 5CLQA 5HIMA 5T8KC 1T5OA 2NSJA 1U8EA 3C3MA 1RZRD 2PT5A 4L6AA 2IYVA 3OVMA 1KYYA 2WF6A 1TX4B 1U3GA 3I53A 2BEVB 2HO5A 3H3FA 5IXYA 4GGMX 3M70A 2QVBA 3I72A 3D02A 3QXXA 4F56A 2Q45A 3HJAA 4WN9B 3ESXA 4NH0A 5HKKA 2ZUSA 1JXOA 1JXQA 1A4RA 3MTDA 3OLXA 2VYVD 4BNVA 1PG5A 4FFNA 4DMKA 4F3KA 1N7HA 4EK9A 4C06A 2PKYX 3RF7A 3EWNA 4TT3A 4R01A 1N2ZA 4GX5A 4JMPA 3P52A 3BSFA 2NUAB 3H8SA 1Z6QA 3EULA 1LPAB 3C3AA 1PL6A 2CLDX 3VPFA 3PS9A 1XWWA 1DTSA 4AG5A 4GYKA 3U80A 1GUZA 3EXHB 1G6HA 5I9LA 3EQ9A 4FNGA 4YRLA 1RHRA 1CVIA 1SOMA 2F8LA 1QZXA 3F9IA 1CD5A 1LDGA 3AJAA 1XMOB 1S9HA 2I7XA 2LKDA 1AS0A 2PU5A 4WDQA 1V3TA 5B6JA 5ITSA 1Q0LA 1TEHA 4KFTA 5BQFA 5MGNA 1NBME 1DL5A 2G4LA 3M4JA 1P2TA 3OUUA 3VAAA 5KVQA 4U0JA 1C3XA 2QQGA 1G19A 4L8FA 3ZQJA 4BXOA 3CB4A 4I50A 5BURA 3EODA 1N6RA 3ZGYA 1HZJA 2GK4A 3GOHA 3H5NA 4KKVA 1PV4A 5T4BA 1C3JA 3IV9A 1MAUA 1NW9B 3GFSA 5CGZA 1FLAA 4YYEA 1DX9A 2J7PA 3ELBA 2H16A 2V0CA 3ADPA 3MW8A 1CUZA 5AJWA 3WIDA 5H9VA 1QGUB 1WULS 1XNGA 3DT6A 1ZXBA 5G0TA 4AMGA 2P5UA 2WBLC 3GZTB 3WQQA 3SIRA 4AJEA 4BKPA 3QLUC 5G3ZA 3K0AB 1PW7A 1RI5A 3KAPA 3M7IA 4BKQA 1Z6AA 4UBLA 3B7WA 4XX0A 1GPYA 4FHZA 3G0CA 2H7VA 4PYKA 2GJSA 5ED0A 1QLWA 2DPGA 1HK7A 1MP0A 3UJCA 1B6GA 1RWXA 5BOVA 4XWWA 1DEAA 1RI1A 5BV1A 3UWDA 2R0QC 1JI3A 1GT91 1TTHA 2Z58A 1M6VA 4M89A 5BP7A 1IATA 4BGDA 4OHFA 2AMYA 5BWOA 5J5AA 3KWFA 4TVSA 3MT7A 3H1AA 3K35A 1ZNQO 4LGVA 5FHRA 1XTKA 2O3UA 3ULKA 1OUMA 2CLIB 1L0BA 1U11A 2FSVA 4JDUA 1Z6PA 3GUYA 4KN8A 4RPJA 3JARB 1L4YA 1X38A 1GPBA 4GMKA 2VL7A 1FCJA 1NYTA 1U0EA 2EP5A 5ALUA 1QV9A 1B1CA 2IZ1A 3BS4A 3QK7A 1NXTA 4J76A 2JLVA 3ABSB 3EZ6A 5I3ZA 2ZJBA 3VH2A 2YHUA 4JOSA 2BM8A 2AX3A 3DT8A 4L8LA 2HSGA 2H9YA 5I4IA 1E9SA 2O9JA 2RG1A 2DBRA 2ZKLA 4JJFA 1GZDA 1E32A 3H5TA 5TQ2A 2YV4A 1RAGA 1V2GA 4AX4A 1RXCA 3M81A 5K0TA 4P32A 2H0QA 4HSGA 5A03A 4CLOA 3QXHA 3D3WA 2YICA 3QVKA 3LJKA 1P3JA 4KN6A 4GPIB 2BWJA 4AG3A 3THWB 2XXAB 1PFQA 2YHIA 1A7UA 4UBMA 2J41A 5JAMA 1QCZA 2M6SA 4CF3A 4Z5XA 2ZETA 2VPYA 1GTSA 3DT9A 2Y1OA 3F96A 3HR7A 1I6LA 1WXGA 3GDFA 4HNHA 1T9CA 4KPFC 4DEVA 5F2NA 2H8GA 4PPQA 4BNXA 4PX5A 1ETUA 3PLRA 3H86A 4FDUA 3VDNB 4RPLA 4BOYA 5I7HA 1JBEA 4P3KA 1WD5A 1Z5NA 4C3UA 4W5OA 2XMRA 2P78A 3O4VA 2VEOA 1FYWA 1M2EA 3OQIB 2CL7X 2PMDA 5D3KA 3MJHA 3CZPA 4MV8A 4I0WB 4OB6A 4QYWA 2NU8B 3A1TA 3OX3A 1H0HA 3DV0B 2Q8NA 5CFQA 3ZXUB 2P35A 4ZTUB 3HFSA 1FU4A 3OT5A 4HO1X 1GEGA 3FNRA 2W4MA 3Q40A 3FTNA 2GMWA 1ODTC 3BA1A 2QJTA 3ZCQA 3SZUA 4BB5A 3R9XB 2OHJA 3D1VA 2AJLI 1JILA 3VO9A 2JIBA 3DZKA 3JWHA 3NYQA 5KJ6A 4NK5A 4XB2A 1KHTA 5IU6A 2O0KA 5JYDA 4JU8A 3QKTA 2Y71A 1LDMA 4UE2A 4C3VA 3SYLA 3DO6A 3AJRA 1LSSA 1WUTA 2A9FA 1Z83A 4XYEA 4FFPA 3RBAA 4ZOLB 1C2TA 1VJ5A 1XMJA 3ZCXA 2EKLA 5B55A 5LM3A 4ADSG 1EWTA 2JFNA 5ALMA 5J4YA 2PKWA 3K4QA 1A1VA 2IUSA 2R6HA 1J39A 3AEQA 3CFYA 3LXXA 4NENB 2FUEA 4BLRA 1CE8B 1H4VB 3CG4A 3PSAA 3K72B 3HP1A 1G3QA 2D2XA 3FZQA 3VNSA 2ADMA 4RVCA 2E1RA 4O4HF 1P62B 1EFLA 4TL8A 4P3XA 4LDNA 4URHA 4XOUA 4ER3A 3MTBA 4XGIA 2VP6A 3MWGA 2GTHA 3OEWA 3ND7A 3R7FA 3LM8A 3HRHA 1N2BA 2VHYA 3TUJC 1B76A 3K30A 1GL9B 3ZBPA 3VC3A 3CPJB 1V6AA 1OREA 1UXJA 3D31A 3MINB 4HWOA 4C05A 3K0BA 3KPWA 4OFWA 3FYUA 3NATA 2V4UA 4HWGA 1H9CA 4OYHA 3UN1A 2W2LA 3AERB 1SJ9A 2D74A 2DE0X 2W90A 4PR3A 5ARCA 3L1VA 3TLCA 3ACDA 3O03A 4LVNA 5KQSA 1TTTA 1RYDA 4IDQA 1SQ5A 4KDRA 5BN5A 3KSDO 4KIJA 4OYLA 3OTHA 1XZGA 3BDAA 4HNSA 3LXUX 1GO2A 2B0JA 1UANA 1OFGA 1XK6A 3KZVA 1Y1SA 4IP0A 3SHOA 3QKSB 5CYFA 3EIQA 2IQ5A 1QFMA 1E5XA 1FP4A 3KCNA 4AUKA 3L01A 4PNHA 2HA5A 4GLFA 4MR7B 3RS8A 1BWPA 2P68A 3IBGA 3VH3A 3RJTA 5C32A 3IT0A 5SZIA 2GQ0A 4W7IA 3HWRA 1Q0RA 4DREA 5EJGA 2JVKA 2VNSA 3ORQA 3RS2A 5CBPA 5HA5A 1JEYB 2AKEA 4B48A 2OMKA 2BKAA 1KJWA 5A5DA 5HBGA 1N6KA 2C4MA 3U1TA 3JWGA 2JLXA 3QJ5A 4Y2RA 1CR6A 5DX8A 4FYKA 5FJIA 5FTMA 5F7JA 1B73A 1DJLA 2HVGA 2ZJ8A 4XVCA 3IPRA 1RJEA 1LJUA 2RC5A 1OIWA 3SJCA 3ZY4A 1UXIA 1CB7A 2A14A 4HDMA 4XD7A 4HLNA 4O29A 3I4FA 2HC9A 1TU0A 1BXZA 4N9QA 3I9V6 4K6OA 2WJYA 1J22A 1GGVA 2GN0A 5A1JA 1WP9A 4HNUA 5BYKA 2ZJYA 2ZWVA 3O1HB 3OOYA 4MS4A 2VSXA 1Z2OX 3A4IA 4J0JA 4ZTBA 4AF6A 5JASA 4PLGA 1ECGA 4NDAA 2ZIZA 1IFXA 2OBMA 2YC2C 4LF6B 1G41A 1XHFA 1OBFO 1LPNA 3KUCA 4U7DA 4C4SA 4GSYA 1M6NA 4K3UA 1GSOA 3HWWA 4PTZA 1NSFA 4Z7QB 2FOXA 1NF2A 3KV1A 2CFTA 1C9KA 2ZAIA 1PK7A 1SUAA 2I5PO 1RLUA 1VL8A 4DYDA 1U0OC 1VSTA 4CL0A 3C2QA 3U19A 4X66B 2QF7A 1SU6A 4J1QA 1J4AA 3TR5A 1P81A 4ZYTA 1WUJS 3JQQA 1T2UA 5LU9A 4MYSA 1OAOC 4C87A 2HWYA 1T2DA 1UDCA 2ZVPX 5EE1A 3KO8A 3YASA 2E1PA 3VPGA 2GZMA 3WNVA 4L9WA 2EZ9A 3LT0A 2YWCA 3DZHA 3U1VA 3ROEA 1IEXA 2ZVDA 1KA9H 1A8PA 1R0ZA 1USUA 3H2BA 3P9YA 3R4CA 1CUUA 1CIVA 5AQEA 1PVDA 2PG3A 2AMJA 1GAWA 3KKMA 3KP1A 1ND5A 4UMDA 4F86A 2VQ3A 1N32B 1KEPA 4FZRA 3ICEA 4MO2A 4AJNA 3GLIE 4UPDA 4ERNA 1L7QA 3BFVA 4MYTA 1D6MA 2JVIA 4LZPA 3IBSA 2AOUA 2HDNB 4ARZB 4HNGA 3KB1A 3O74A 2I55A 4K6GA 3VOTA 3W5BA 2PH1A 5KAMA 4C76A 3DEYX 4CF6A 1LV8A 2F55A 4RC9A 1KPIA 4HQ0A 6ADHA 5IAEA 4YMHA 1UBRS 4RTQA 4FC7A 4KMRA 4CTMA 5K0EA 2HYIC 2ZSFA 2R5FA 2NTNA 1L5ZA 3MINA 2A5LA 4BO4A 1N34B 1ZHOA 5JOQA 3KNZA 4OGGA 1E9BA 4GKAA 4AZWA 1DJMA 3KOUA 2YZKA 2VNHA 4QPZA 3UUFA 1E98A 2PH7A 4B17A 1AZSC 2XXBA 5DM1A 3GA0A 3NIWA 3TTVA 2D7JA 2XNSA 4R4JA 2Q6OA 1N25A 4H9GA 4RF4A 4V0QA 5DGDA 3RRYA 4GW3A 4NP6A 2VP9A 2R8XA 3SN6A 3VZSA 3WOVA 3K0CA 4DCSA 4PYQA 4DSNA 1UADA 1MV5A 4QRDA 4J7CA 1LVHA 2Y0BA 3ZHQA 2N42A 2V7BA 1NR5A 3AF4A 1RD4A 4NJMB 4EB3A 4NYMQ 4V0SA 4CQJA 5AXAA 4JBHA 1H2AS 5KYYB 4A8JB 4PLPA 3QSYA 4W5QA 4DV2B 1UMDB 4US1R 2FN3A 2J30A 4KAAA 3WZMA 3EBPA 1KAHA 1AGXA 1FXSA 2EWVA 4E03A 3SGLA 2IS4A 3UWPA 3A1CA 2BJWA 4EPVA 4TTTS 5MF6A 4MQFB 2Z5LA 1Z3IX 3E0QA 2DMRA 4GO1A 1XDWA 5JMPA 5FWYB 3U81A 4NS4A 5AVTA 4RNDB 1NPYA 5F78A 1VGQA 4BRWA 5CB8A 5F98A 1L2TA 1UPXA 4HVTA 2G5PA 2IXAA 2OKCA 4HDMB 1LPPA 3L1HA 4U8HA 4GOXA 5REQB 3VZRA 1DX4A 1F7UA 1WW2A 2XR1A 3LOUA 1B14A 5AVXA 5EHIA 2VUTA 4QTZA 1V39A 1K2VN 2YRXA 3SJUA 4G5QA 1RMYA 1NJ2A 5EP3A 5CVJA 2XF2A 1PUJA 3ETGA 4M38A 4B44A 2UXBB 1BWSA 1YHYA 4QULA 2WNHA 3NUQA 3BICA 4PR0A 1G8HA 3VR2D 2QTCA 2PX3A 4ZIRA 5DK4A 3T7KA 2FWPA 1AKTA 2KB0A 2WJHA 1WMEA 2ORYA 2ZXFA 3WKDA 3UA4A 4C6TB 2ZT6A 3N2NA 1FMCA 2OLEA 3N28A 4CL2A 4X45A 1Z0KA 3WNBA 4ARAA 1H8HA 1Y1QA 2D0OB 3FNGA 1U6JA 3V7UA 3MUFA 2HADA 1J7JA 3QY0A 4EGQA 1P18A 1VCIA 1Q3TA 2ID7A 3C7KA 3EIUA 1ESDA 4BQEA 3H0EA 2IOYA 4QDUA 5K8IA 2RHDA 3R5SA 3NVKI 1HEUA 4JLDA 1TZBA 3AR7A 2X6QA 4MVJD 3G8CA 4TV8A 1PEDA 3MMZA 5HXAA 2DLNA 2DERA 1PS8A 3BXEA 3AKZA 2YINC 3JAWB 3FVVA 1FP1D 3H04A 1LX6A 3HVUA 2WHEA 1I33A 1WPRA 3TQQA 1KE1A 5BRJA 5DNUA 3CZRA 5JSZA 2EL9A 4QWWA 1O77A 7REQA 2RGNA 4MP8A 1T91A 3NPMA 2XB2A 2ODPA 2FLVA 1UZMA 1WHSB 1JT2A 3DAPA 1U9IA 4Y1FA 3DCIA 4J1SA 3C5HA 1LFAA 4LY3A 4ZDWA 2Z3VA 2ZSEA 3I8XA 2FH5B 4Q1DA 2FEXA 2AOXA 5B57C 2WJIA 4BEJA 3GPLA 1HFJA 5JALA 3WWEA 2QP3A 4KIUA 2CVFA 3REGA 3H9EO 3S8YA 4JROA 1EWQA 3OI7A 1B0ZA 1KSGA 3RSLA 3GYBA 4BVLA 1Y37A 4C7BA 1AK1A 1CUSA 4X20B 1BEZA 3NC0C 3O82A 3OC0A 2JGJA 4S24A 1PT8A 3VNBA 3ZS8A 4FDVA 2YFKA 1GQ2A 2Q2OA 3LL7A 4KR7A 2EZUA 3EJWA 4S1VA 3DGEC 4PINA 4ARUA 5JAIA 3VJRA 3BD9A 3F73A 1PS0A 3AESA 1TJ7A 1Y7HA 4OAPA 4C2BA 1DEXA 4Z9YA 3H18A 4EG5A 3KZXA 3W7VA 3I5XA 2VTBA 4MGZR 4CF5A 1KXJA 1T9AA 2INGX 5D86A 4IVNA 4MKIA 4A8JA 9LDTA 5JDCA 1ID8A 4MRAA 4LJ6A 3ORRA 5FOSA 2P7HA 3H11B 4KXNA 5LLSA 3SBEA 1PTJA 3CWCA 1A9SA 1G20A 1X1AA 2J3IA 2ARKA 4YALA 3S68A 4BZQA 2DSNA 5CW1A 1GKLA 2HH9A 3A9RA 3H65A 3LD9A 5H5JA 3HL4A 5A0FA 4JWTA 5MHTA 1N9ZA 2XVAA 3VR3A 4ZO6A 4GI7A 1KDYA 4MGEA 5LN1A 4MDEA 4PG4A 5JAQA 4A15A 3E03A 4LCJA 4I14A 3ME5A 1XTQA 3FBTA 4IIJA 3GJ7A 3OM1A 2FPLA 5C7YA 1LA2A 2X0KA 3WZ2A 2QIOA 2ZRIA 5DNWA 3F74A 1JT9A 9LDBA 3LVBA 2YV3A 3DCNA 3GLHA 4O4HB 3MTQA 4C14A 2NPOA 2Q5JA 4JBIA 1X13A 1HM5A 2P9QA 4QIHA 3L7DA 3OURA 5TC4A 5CA1B 3TG8A 4Q4AA 1Z45A 2WOOA 3RRXA 3PZBA 4BC0A 1W5FA 1XXHB 2VK8A 3F0TA 1NNEA 2ZRPA 3C3CA 3N05A 1CULC 1TRKA 4N7MA 2XWPA 3TX6A 4U3JA 5GQSA 3S2EA 1JR3D 2B9VA 4IIFA 1TZCA 2B30A 5ICGA 4M21A 2Q4DA 3ZXIA 1YR3A 2NZ2A 3D4IA 4L1KA 3QVLA 4QOJA 4DLBA 2PS9A 4JI7B 3T9FA 2ODEA 2RBEA 4G23A 5LWQA 4BL5A 2Q1UA 3B3FA 3TKYA 4TOIA 3UHAA 3FKJA 4QUEA 3RJZA 1AQJA 1P1RA 3LUBA 4H0FA 2ZWAA 4Q01A 1DQPA 2XOKA 1XWOA 1RNLA 4MH0R 4Q03A 1KEKA 3D4PA 3B5EA 2IV7A 5EA2A 4QOEA 4DYHA 3ADCA 2QTNA 3S2GA 1CYDA 1ZIPA 3TLEA 5HW0A 1CUJA 4M0UA 4M98A 1UBLS 2H1HA 2ONCA 1X7WB 4MMXB 3W2EA 1JQ5A 2JAHA 5HHTA 1QGDA 2DGDA 4B4WA 7YASA 4EA6A 2PK3A 3BGIA 5JSZB 4Q66C 1A9ZA 2B5OA 3EH1A 3NHBA 4C0AC 1USKA 1IY2A 4ND8A 1X1EA 3HWX1 3EVDA 3MUEA 3MA0A 2P4UA 3E2IA 3T0FA 1DX6A 1FTGA 4JD5A 4G1BA 3WLFA 2H4YA 1RQLA 1K75A 2CUZA 4Z6KA 3QI7A 1D2MA 2H5JA 1JYFA 3GCZA 4CDNA 2ZI7A 1WXIA 1YGPA 4YCSA 1SUEA 2GXSA 3D5TA 4Z9BA 1P29A 3HQ4O 5KSPA 3MMXA 4RMNA 3RIMA 1LX7A 3OT4A 1YZTA 5HFJA 4ZCSA 5A4DA 5JJBA 4WW0A 4D0GA 1TXGA 4HMOA 3F4TA 4YX9A 4EFKA 3E48A 2Q2WA 1Y3DE 4LZOA 1DAGA 3UBMA 4G24A 4AS2A 3FHLA 1U7TA 5DYTA 3X1DA 2E6UX 1F48A 1FNNA 1P8JA 4G0MA 3SR3A 2IEDA 3VKVA 4D4LA 1L7BA 4QXAA 3R0QA 2XCIA 1D2HA 2DHEA 3AY0A 1T0JB 1TYBE 1V7CA 2EW2A 1AUPA 2LP4Y 1Z0ZA 3NAGA 3WGMA 3WRYA 2BUBA 5AJZA 5IM4F 1NJ5A 4LYAA 1WXWA 2UUOA 1X9GA 2HIMA 1T8PA 2FPIA 4WKBA 1TDJA 2HA4A 3RC7A 2ZYWX 4BJ3A 1T8TA 2DQYA 4KPYA 1VKNA 2P9CA 2YIJA 3PUXA 3LO8A 4MLPA 4GBJA 4DLTA 1WNFA 4PZUA 2XB8A 4TRMA 3R8CA 4JI8B 5C1PA 4C6RA 1ESCA 1W0JD 2A8YA 2DUNA 3H9UA 2AG8A 3R5KA 3AH8A 4Y9TA 3CKKA 1KKMA 4W1PA 1YR1A 5BQXA 3HYTA 2F3RA 3LH5A 4LRWA 4MV0A 1C7RA 1Z26A 3CKLA 3Q87B 3ZW8A 4D8YA 3H8VA 2IIBA 3INYA 4D7AA 1XMIA 3VTAA 4HAVA 3K6SB 2KMLA 3B36A 5IABA 4MV4A 2HF7A 1CB0A 5AW2A 4MIOA 1A71A 2FZ4A 1F1JA 1UMKA 2IZ7A 4YREA 1GKKA 1M0EA 3DMGA 2WF8A 1I32A 3E82A 3F5FA 5CTAA 4U9HS 2QTGA 4M7WA 1KRHA 3CSSA 1ZOIA 2QORA 3KDPA 3MBOA 2NW6A 4HC4A 2Q1XA 2MU1A 2QRGA 2PKCA 2W6JD 2AK3A 3GCXA 5BQ3A 4C7VA 4JQZA 4M0LA 1FFHA 3TFWA 1SIUA 2OGWA 3UIEA 4DJDC 5A4JA 2LZ0A 2X0NA 4M8SA 5JISA 3BE6A 4CKEB 1QKIA 4YLEA 1NQUA 4L50A 5HM8A 2ZCVA 2WMOB 4GBED 4FHFA 1XZLA 2P77A 4LN1A 4LHEA 4FMDB 5AKEA 2SNIE 3RVJA 2V1XA 3TCNA 1E6CA 4GS5A 2OQVA 3UC5A 1DKOA 2Z2IA 1YOVA 2AQHA 3GGDA 4L4UA 1RQ2A 1MAWA 2CXXA 2ZUCA 3H9CA 4JFRA 4FGUA 1IPHA 4JK3A 3V2HA 4J0HA 2OHXA 1YIDA 4C7OA 2C1XA 5JXJA 3D3NA 5CXQA 2C1ZA 3M5WA 3QOFA 3MRVA 1MHPA 1ZUWA 2O1SA 3HB5X 1XTRA 4IWYA 4YRRA 3IOEA 3G3EA 2EW1A 4UZSA 2JAWA 4G0PA 3KFXA 4DBLE 2RB4A 4EB6B 4M83A 3RVPA 4F2PA 4H6PA 4QQFA 3MTJA 3LT4A 4GXTA 4PBSA 1QF7A 3Q7IA 5HKKD 1XZDA 3KUXA 2GYVA 2AKAB 3LWBA 4AMZA 4G4GA 4A8TA 2XOKD 3CZ4A 1VLZA 3D8SA 3Q7TA 1YFLA 3JQDA 4ESOA 1NBAA 4H4EA 1NNUA 5F91A 4E5YA 4EELA 1VGRA 4XGQA 1YVEI 4J1TA 3DQZA 1GHTA 1U1GA 3UJAA 4N5NA 4YUWA 2Q1SA 1Y9DA 3CEJA 4UUBA 3L7KA 4Z49A 4WOCA 2RCNA 5EZ5A 3W1VA 1PFWA 2CHGA 3FOWA 2AXEA 1R4AA 2MYPA 2NAFA 3I6BA 1JDUA 2IGBA 5L53A 1PE0A 1R5NA 2J9XB 2PUDA 5DNVA 2O3TA 2FX5A 1EBUA 1PZMA 3U4AA 2ZSIA 6YASA 3U5TA 1CF4A 1W581 1XOIA 2Y4OA 3L6CA 4JKOA 1NF9A 1EVEA 4GF5A 4I9GA 3HCCA 3EUFA 4RQBA 5CLLA 4Z4QA 2OQ2A 5LZ2A 2AMVA 3ETHA 3ZNNA 2DB3A 2IGTA 4DY4A 1R0KA 3PZRA 4MV9A 1JNYA 2HSDA 2VYQA 2ID9A 4HK4A 2CHEA 3G85A 3WAKA 5CFRA 1HLFA 2O06A 4HBZA 3QWFA 4XCVA 4XVHA 4Y2HA 3U4QB 2VCHA 2EKBA 2XEDA 3L4KA 4LNUB 1ACLA 3AESB 4FFBA 1GRQA 5FUYA 3WQHA 3PUIA 2HCBA 5JS7A 5K4HA 5C5IA 1ODCA 3BTVA 4HPXB 4BJ5A 5KTPA 1K5GA 2JRLA 4XPIB 4YRTA 1OU4A 4YGYA 2F7SA 1I2DA 1HI9A 5EWJB 1FQKA 1DCMA 1JKJB 2CLCX 4ARVA 2CVQA 2I2DA 1C8KA 3TDNA 2P9TA 4OXXA 3K4PA 3RU9A 3AEZA 2J08A 2KBEA 3NNSA 4JMLA 4BBPA 4D82A 3PR2B 1C81A 4B7AA 3ESZA 2FA9A 5CFNA 1PX0A 1OZFA 1VDMA 1Z5GA 1OILA 4LY0A 5DF1A 3ZNQA 4MW1A 5CA1F 5B58T 1F9AA 2MSWA 2RGCA 1IWOA 4UAGA 3OM9A 5BQOA 4B35A 4A0RA 5A2QA 5H3HA 4G0VA 1KI6A 1MO3A 3N8HA 4A0GA 1KEVA 4Y0AA 5ANRB 5P8WA 4JNCA 1NUPA 4XFJA 1K6EA 3NAZA 3R41A 2QYHA 1TK3A 5EUBA 1FRNA 2JI7A 2DKFA 2B1GA 4FYXA 1TQ8A 1TLFA 4MWCA 2AJ8A 2W2TA 4C0BA 1N2EA 1SHZA 2BH9A 3HJCA 4J4HA 4ZTZB 4Y1EA 3V9PA 2SBTA 1TYCA 2BR4A 4DLVA 2PSEA 4EPWA 1WXXA 5E4TA 3BGSA 3PI6A 3RK1A 4ENRA 3PLNA 2OFXA 5AOBA 3T7RA 1HNNA 3MQFA 4N01A 4BYMA 3DNFA 1KMQA 1ODKA 5AKHA 3AW9A 4B4UA 3MLBA 3PFIA 3P27A 5IAGA 2YJTD 1K8ZB 5BV0A 4I3GA 4ZXFA 1GZVA 3A1WA 5KYWB 2Z6AA 4CUJA 1FSSA 1V1MA 2JFUA 4WJKB 5BR8B 3NT5A 4EA9A 4E70A 5B3LA 1UBEA 1RBMA 3GPIA 4RADA 5LYJF 3OFND 3OU2A 5TMEA 4CEIB 1CU1A 4JX9A 4MPPA 3K0EA 4ZK2A 5ADHA 2Q62A 2A9JA 1MOSA 4XEHA 1GPAA 1RQNA 2YKGA 1I5EA 4DMUB 1DQYA 4PYRA 1OFHA 5CFZA 3KELA 3MJ4A 3WTCA 3NOXA 5EP4A 4DKJA 3GIDA 3FLEA 3RARA 1PJTA 4DIEA 4H27A 5FFFA 1WB9A 3JPWA 3PGXA 1VKZA 4YV1A 1O94C 3BAZA 1NMSA 1FFGA 4DA6A 2BH2A 4QEKA 2H4HA 5FPSA 1T4GA 2I91A 3BD8A 3FPFA 3KSMA 4LRYA 4U39A 4YFVA 2D06A 1XWFA 1YR9A 4ADMA 4CUZA 3EOBI 3EGXA 1W7AA 2BR3A 4YJ3F 3S7ZA 3IKJA 3AHHA 2OXTA 1JQLB 3BH6A 4QYIA 2QZJA 4URVR 4HTFB 1Y4SA 3G2PA 4N5HX 3IAHA 4XVRA 2ZTUA 2FLKA 4X6LA 3G79A 3UV6A 3C7TA 3HKDB 1EDEA 1G3IA 4ZI7B 3KBBA 4OXIA 4P5EA 3IHLA 4DSZA 1O87A 2BGGA 4QWMA 3EDMA 4F9GA 3ICCA 1HR0B 3AHFA 3KHSA 5KNDD 4Q9AA 5IYZA 3TLXA 5JAPA 1YCHA 2EX1A 4Z53A 4G65A 4KE8A 4TTIA 3BSSA 4FX2A 4BMPB 1I2MA 2VSFA 3G0BA 4F91B 5D3ZA 1H2HA 1GN9A 1U9ZA 1VPLA 2W2KA 3ISVA 4BEWA 2VZ9A 2ID8A 5T3UA 3X1ZA 5HTOA 2BFFB 3DE6X 3LTEA 1L5RA 5JQGF 5KOHB 3S44A 2Y1WA 4LMPA 1Q1BA 1PDOA 3JALA 5C37A 1JEOA 1X8JA 3EZ9A 1P2SA 1U65A 3KB8A 3GRAA 2Q5OA 3NKVA 1DQRA 1UT6A 5EJAA 2O7SA 1SBIA 3IOCA 1SPXA 3FYSA 4PGFA 4QU5A 4YRPA 3NKLA 3PQ7A 3UO8B 2PUHA 3WSTA 1JFLA 5KYNA 4N48A 1FSGA 1FDWA 2CJFA 2AN4A 2XX3A 3G9ZA 5T4EA 5JH7A 3GRFA 1TO6A 4EW2A 1IVNA 4D81A 4EUNA 2F62A 3QWHA 4NI5A 1T0PA 1XP8A 5CX1B 2O3QA 2IXTA 4O2AA 1RZRA 2VWQA 3EUWA 2FDRA 4FDLA 3WGQA 4DV3B 2CXNA 5HG0A 4RK4A 2GN6A 1HDXA 1WY7A 1XAIA 1XDUA 4C5BA 4EF4A 3C97A 1BH6A 2YN4A 3A0UA 3A9TA 3ZWQA 3OEYA 4NZZA 1NLZA 1SCUA 1M6EX 5DTRA 4Z51A 4I99A 4RZ3A 2MYNA 1A1SA 1SU7A 3V4RA 2GGSA 4BE9A 2CL6X 1X42A 1E8MA 1MIOB 4Z0PA 2PGOA 1ZMBA 2FXIA 2JD1A 1DAMA 2GYUA 3EDYA 3FD8A 3JQAB 3ZE9A 3OP4A 4Q3NA 1S7CA 4M7OA 3FI9A 3FPKA 4N0DA 1HMPA 4TMFA 2ILVA 3Q7RA 1RHQA 1KMCA 5IBRA 1XRSB 1Y4AE 4PWZA 1OZ0A 3UJPA 4RCYA 3WRXC 3ES9A 4J9UE 1JJFA 2R6GA 2NO6A 1NBMD 3VQTA 1UMCA 4D4KA 2JFBA 2ZWPA 3LF2A 5ELXA 4HDKB 2P30A 3GZNA 5EHQA 2J0QA 3N58A 3TEJA 1A82A 1QDLB 3VXKA 3T9EA 2CYBA 3TZCA 2NYAA 3VO2A 2OVBA 4W8OA 4YONB 1Z6XA 5TQ0B 1M0TA 3ZY2A 3B7PA 3EVGA 4WD3A 4OLAA 2J4CA 4R1PA 2CFSA 3B78A 4WA7A 1OU0A 4E4RA 3SVZA 2PZKA 4OHVA 2TMYA 1HDYA 4GFDA 4G07A 3I83A 4R1QA 1NVXQ 3RSOA 3SS9X 4ZFNA 2RHHA 4LJAA 2A0FA 3QYAA 3GY0A 5EQTA 3VR2A 5DU2A 5BSGA 2IEAA 3RS5A 1FP6A 1G0NA 3TOXA 3V2UA 4QG7A 3V32A 4Q9KA 1RQPA 3BILA 1ZHFA 1JFRA 2PA3A 3HO6A 3KWLA 3OLZA 4HH0A 4IGFA 5SZHB 2VBGA 1JXMA 1R18A 1WMAA 1O94D 3BTSA 3PHCA 3Q3HA 1P0IA 4GDFA 4BKOA 2HHCA 4MWBA 3SIXA 1VLVA 1W88B 3OT1A 2C2WA 1C80A 3IDFA 1RJ9A 3KHUA 2FW7A 1IOLA 4MHSA 4YUXA 1FUOA 1YZGA 4ZAWA 1P73A 1IBMB 5H68A 1NIJA 2N9UA 3OECA 2YOFA 4IZ6A 2FRVA 2AD1A 1Y7LA 2VO1A 16PKA 2HQRA 3AQ4A 3QM1A 2VA8A 3KXLA 4KAFA 4ZAGA 4YT8A 5IRCD 5GPBA 1JR2A 1OXBB 1U31A 1QVZA 2BMJA 4JUCA 2P41A 4QUDA 3MVEA 3OICA 5TQ2B 4BNGA 5F23A 1SC6A 3C48A 2WU8A 2OFPA 5EYPA 4OLFA 4MW5A 2QTVB 1JWLA 3L6RA 3IQXA 4FMCF 3VYWA 1KSFX 3GXOA 3IOMA 3LPDA 5BSWA 3KQWA 4AZVA 4IXDA 5ER9A 5CCEA 4C08A 1L1QA 1WCIB 1XZHA 1NQTA 5IUNC 2PGXA 1J09A 5CMLA 3WK9A 2JAPA 1QG2A 1E9FA 4QGGA 4JC4A 3DEZA 1ACJA 1FTQA 1U2QA 2FSHA 4DG9A 4DB2A 3I0MA 1L4KA 3QG1A 1U6IA 4JLJA 4UDXX 1TPYA 5C1BA 3A6FA 4XM0A 5DT2A 3HN7A 1PHRA 2C9DA 4EUFA 1K8QA 3SBXA 2WOJA 3M4NA 3IUSA 5K3BA 3FPLA 4OI1A 4C2TA 3QZUA 2VPZA 2X8JA 5GZ6A 5B12A 3EXEB 4CU5A 4DZZA 3QKRA 4RFSB 1WB6A 2BIFA 4J4TA 4QPCA 5BYAA 4Z86A 1G42A 3JSXA 2FEKA 4PG8A 1NBOA 1IN6A 2Y77A 2Z09A 3AUXA 2QTMA 3COZA 3LHKA 4RYDA 4E12A 3HXLA 1J8VA 3UH0A 1TK2A 2BM0A 2OBFA 4DR4B 4L75A 3WIUA 2P6NA 1J9GA 3E58A 4XGNA 5B3JC 4GZ5A 1HOTA 1XAJA 1J9EA 3TZKA 3FMGA 3Q9SA 5EWMB 4XZ3A 2IYYA 2XMZA 4YAFA 3E9RA 1JH8A 2TRSB 1FW6A 3DL2A 3N5KA 4MWSA 2IEBA 2P9JA 4L5JA 4N5IX 4JC0A 4RSRA 1UAGA 1YZKA 2PX5A 4FCTA 3EBLA 1GQRA 4PSAA 3GRPA 5DWQA 4RX1A 4YP7A 1S2MA 2K2WA 3VYVA 1NN0A 4HDKA 2WJ3A 3NOOA 1FY2A 1QXSA 4EHNA 1BDBA 5BSHA 4WN9A 1QQAA 3AKCA 3UATA 4NULA 3R4VA 3PI7A 2QHXA 2BW0A 3JQEA 2G36A 3R3SA 4JLNA 1ZCBA 3DZDA 3QTBA 3ZDCA 5TQ0A 4DJJA 2V65A 5A3JA 2Y1FA 1AMNA 2V0GA 2ETXA 5BV7A 3K32A 5F1OA 3KSBC 5JNVA 2R6DA 1E9VA 4A0QA 1C8VB 1GGEA 4M9ZA 4BJHB 3KUDA 1RVDA 1WPQA 4P80A 4HB4A 1EXWA 3KJIA 1NVGA 3K1AA 3KL2A 3KE9A 2GB4A 5CK4A 3E70C 4LJ8A 3PA8A 2PU7A 4KVZA 4L2IA 3GEMA 2HNAA 5IBCA 1SKMA 2D7DA 2XKBA 3X1WA 1T5SA 1YXMA 2PNJA 3MRTA 4KV9A 2CT8A 4I50B 4UUNA 5AM3A 2GD6A 3HB9A 5FL3A 1C4OA 1K4KA 1BDHA 2P3OA 1ZUNA 4MVJH 3LLCA 2WM9B 2SCUB 1OH5A 2OYSA 2WLSA 1XCLA 3TRIA 1CJSA 1HKUA 4LV5B 1J2JA 2R62A 4H15A 4AUEA 1S4MA 2WILA 3CURA 3UAXA 8ATCA 2LGJA 5KYXB 1T15A 3WHIA 3M4ZA 4GYYA 5LNK6 4JH0A 5BN3A 1PJZA 2QD5A 3LKZA 2YV2A 1NQ5A 1TO2E 4TVOA 5ALOA 2XHEA 3WYCA 4Q16A 4CETA 5EQDA 2DBQA 1A5TA 4U4AA 1Y3CE 4WKOA 9GPBA 2QTVA 2ORVA 3KZ1E 4E4YA 4C1NA 5AKIA 1F8GA 2VDWB 1QX4A 3KVOA 3JPYA 1FMLA 2C5GA 2HLDD 3QNMA 3MOGA 3HXKA 1P1KA 4B75A 4QATA 5E8RA 3UOAB 2G6BA 3IERA 2ZFUA 4TPKA 1GR0A 1S2LA 2BZGA 5IH3A 3WSVA 1EIZA 5JR3A 5TX7A 2A3RA 3FG9A 2GM4A 4EMTA 4M9SA 2AIRA 3LT2A 3T5DA 2C2BA 3NUZA 1X7YB 2FMXA 1Q15A 1I1QB 1B43A 1EJ0A 2R7LA 4A0HA 4ZHQF 1MNAA 4B87A 2AS0A 1DHTA 4YR7A 3FFBA 3GP5A 5EJ5A 2BMDA 5EKTA 3QH4A 1JZSA 5JLAA 3RABA 4N40A 1PL8A 2YVKA 5CVTA 1NI3A 5CXXA 2NXCA 2P3LA 5BQPA 4R1OA 4D9MA 2FI1A 4NCBA 1YB1A 4DG8A 1MAAA 3DFZA 1ZJZA 3P9PA 4AP5A 3AI3A 1YWGO 1H1DA 2BFOA 4J3NA 2HW8A 4J16C 2C0QA 4G9EA 2BEJA 3GLFA 1ADFA 1ARZA 1ZM9A 3C85A 3UICA 2YYZA 1FTNA 4DYVA 3EB9A 4CODB 4IEEA 1FURA 1CRLA 1SWWA 3QI2A 4C04A 1W36B 3AR6A 4DL9A 3ZE1B 1U1EA 3MJEA 3L0DA 1AZLA 5KJFA 1OD6A 4EH1A 1DC4A 4LQLA 4MHOA 1O8CA 1BXRB 2NUAA 4D0RA 2EYQA 2YFQA 3CH5A 4G63A 3BK7A 2GK6A 1TIPA 4CEHB 1ZSNA 4O2BA 4S0XA 5EE5B 2EP8A 1M67A 2LCQA 3C3WA 1FX0B 4DMMA 3I52A 2G7MC 4OUDB 1RC8A 3RVOA 1VYHA 3HBAA 1U9CA 3T3MB 1B23P 3EZNA 1QOZA 5G0SA 4RL6A 3GW8A 4WEOA 2JFVA 3TLBA 4DIMA 1IXYA 4GI1A 3O38A 5AOVA 3RVDA 2VP3A 3GFOA 2R8PA 5TMBA 5JQGB 2QTRA 4GD3Q 5FOTA 3G7NA 1RJWA 2H4WA 4IIVA 3RVQA 4BFSA 2EC5A 1CIJA 2O23A 3GZJA 4NBLA 2FJUA 5AM2A 4G67A 1J49A 3UB2A 3GP8A 3IGFA 1PI3A 2CNWA 3SX2A 2QTTA 4TZ6A 3IAAA 1GNVA 1NN5A 4UDNA 1ZRMA 3O4GA 2PLAA 4ZHQA 1J42A 1VCHA 5L51A 4C22A 3ET5A 1P44A 1LY1A 3LA8A 5A4KA 2NIPA 3DR5A 2FFJA 2AI1A 4O1IA 4LC9A 5DPMA 2OA0A 3HP4A 3V4SA 2HY7A 1EUYA 2O05A 3PYLA 3N2GB 2MSKA 3ZWMA 4Z1OA 4ZPXA 3GRUA 3FLBA 2JLQA 3OFJA 3WBBA 4XUEA 3T5MA 2M6RA 1ZO8A 5IP5A 1RMTA 1USIA 3TAXA 4J1NA 5CFOA 4JJIA 3QYJA 3V1KA 4ZPJA 3WMEA 3BXPA 5EIBD 5EHGA 3RQIA 4CFYA 4HHEA 4CKXA 3LAWA 4N7RA 1V2HE 3IEVA 3OTGA 4IIJF 3RE1A 4QFCA 3ZHOA 2PA0A 2GXAA 1NI4B 2AX4A 3F5QA 4Q7MB 4WOBA 1OXSC 2WIBA 3RIHA 2JF0A 3C3BA 3ZIDA 3IALA 4KITB 2F1JA 3SX0A 1ZJWA 5DM0A 4HKTA 3VPXA 2BP7B 3G2MA 1Z0SA 4CM3A 3ZZNA 3Q1LA 4LJ5A 4RHTA 4GI3A 4AN1A 5FO1A 2Y27A 3PWTA 5I9NA 1Q3KA 1YZQA 5GMOA 3N5CA 3L07A 4EFCA 1J0XO 1XVTA 4J7UA 3U31A 4C4OA 3T3NA 1PWZA 1XFAA 4UEWA 5E4JA 4UQPA 2Q3MA 1VFNA 1JEJA 2IHJA 3KK0A 3L0YA 1MOPA 4M60A 2XKAA 1NNSA 4LZNA 4CQNA 3V8RA 1CS0B 1DQZA 4HNVA 3K5WA 2QXYA 4BRUA 2E89A 1JHRA 2YV1A 5IT9A 2VQEB 4OH7A 2DULA 3ZBQA 1XB2A 1EE2A 3NASA 1G7CA 2V3VA 4UM8B 2NZVG 1WX1A 3COVA 4IOLA 1RLIA 1VL6A 1VXOA 3HJHA 3HBLA 2QTFA 3SR0A 5FT9A 1GNTA 1QBKC 2QAIA 5CEFA 1Y6ZA 1X14A 5CRIA 3WK4A 3BMOA 3B12A 4AY4A 1XPJA 2O8VA 2QM8A 2WMDA 2OMEA 4YJGB 3ZZUA 1ORRA 4HQNA 3HA2A 2FPGA 4AC9A 3LYUA 2X2PA 3M4YA 2VUUA 3VR6H 3FYHA 3GRCA 4Q1BA 3OQMA 1KI9A 2HRCA 3CLSC 3QJYA 2C54A 4NZOA 5LA6B 1IRIA 1U2RA 2GVZC 3MS4A 2PTQA 1JU9A 1O96B 3KYBA 3QXCA 4Q4JB 4R2LA 1GZ4A 2QQ5A 3HZHA 3M9LA 1U3WA 4UZFA 3GUUA 4TT8A 3BBLA 3IV6A 2OHVA 1P7CA 3RLFA 5K0CA 2J5KA 3EZYA 4M87A 2XZOA 2RFLA 4G8DA 1T8SA 2VDNB 3HU1A 1ZS9A 4PCVA 2IK8A 4RA6A 1OLSB 3NOQA 4IZIA 3S2FA 3RCBA 1RDFA 1D7OA 3G8YA 3OJLA 4YRQA 1NX6A 1E1NA 5FPTA 4ERXA 3WC4A 3CWQA 2X75A 1N5LA 1NUTA 4M8LA 4JFAA 4Q1FA 3FRJA 2VVTA 4F4UA 2GBGA 3WL3A 1L9KA 2PV0A 3MF4A 4I50F 1GV1A 3PWSA 3ER6A 4N54A 3CZQA 4JXJA 3ZWKA 3BQMB 3CONA 5LP6A 2CFIA 4OH1A 4D9NA 4XEUA 1QZ3A 3DEFA 5K3FB 2C5HA 2DY0A 2ZE5A 5JTUA 1Y3FE 4L5AA 3NWEA 1FQWA 4IYRA 2GCOA 2H1CA 2Q0HA 4UHEA 4R5HA 1RYNA 3OLVA 4YAWA 3RIXA 4AP9A 3Q3VA 4BNUA 3RBXA 1CIPA 2MMCA 3IB6A 3Q72A 3OWOA 4A03A 3O0TA 2VPTA 1LZKA 3C14C 3QEJA 3O9MA 4GWLA 4PZ9A 6CHYA 1N9GB 1O58A 2AE2A 1ISHA 1GAJA 4P2GA 4ZKEA 4Q0MA 4E5SA 1H6BA 1Z8HA 2N75A 3EAFA 5ITWA 2EJWA 3QKSA 3WRWA 1TU3A 1ORWA 5DEIA 1W29A 1U0HC 1DTWB 5F52A 4GOOD 1L4FA 4MCHA 3UZUA 5KOIA 2QAGA 4JP3A 4IJVA 4PO1A 1X80A 5ICFA 2RGWA 3DD5A 1DDOA 2WTXA 4M1TA 1YOBA 5FADA 2R11A 3D1LA 2G28A 2J33A 2JK1A 2PGNA 3PFGA 2BI7A 4Q9NA 4I66A 4G4SO 3MIZA 4L15A 3PKZA 2BKLA 3IT3A 1N8SA 3SJZA 1W0KA 5M29A 3TO5A 1Q7GA 3KPJA 1XKXA 3WVNA 1XCOA 1PS9A 2ONYA 3BC1A 3G5TA 3LRXA 4LJ4A 4AJ1A 5HUQA 1UODA 4AJHA 4AY6A 4Y6GB 1D2RA 3GPCA 1K3FA 1DINA 3WDSA 4L0CA 4N6GA 1D0SA 3HVJA 1GUYA 1TU4A 2R4QA 2WK1A 3EC1A 2ZYUX 1JJBA 3O2SB 4FGJA 4LHWA 4EZEA 3FJYA 3OA0A 4X97A 4O4LB 1CJKC 2IP2A 1K7EB 1QC5B 2DR0A 1U2SA 1E58A 2G4CA 3WB9A 4E21A 2BGJA 4UQOA 3T3PB 1UBKS 3UK0A 2R8OA 3TWOA 1BE1A 4KQMA 1YTLA 2V03A 4HPJB 1KVUA 3BWYA 4V24A 3ZEAA 1Q0UA 2RGNC 1GNRA 3I2YX 3LK6A 2LTAA 3MBIA 5CA0A 3KOYA 1H3FA 4YJKA 1JLKA 3W4JA 1W0KD 3U3MA 3WJ2A 3WYFA 1P9OA 1X7HA 2GETA 2AFIA 4LX0A 4BECA 4DDWA 4DV0B 2NGRA 3ZVNA 1QHHB 3BXXA 1YBVA 3X1XA 1E2JA 4NH4A 2GNOA 5AXBA 3R7SA 1Z4KA 2P6PA 1XMSA 1CQPA 1Y7PA 4IMPA 1I9CA 3Q6MA 1OE0A 1OFVA 1AB6A 1GLGA 2Q0SA 4XQ9A 5E0OA 2HWKA 2QTWB 3OE7D 3VU9A 2W42A 4WL0A 3KC2A 3DYIA 2WTUA 4JI4B 3D4LA 3T7TA 4N47A 3IPYA 1GPUA 3A0RB 1LLCA 1UFQA 1X39A 4HGPA 3D3EA 1ZIXA 3OESA 5GGYA 4RFVA 5FPKA 2BGMA 3ZHTA 2O2CA 2VDPB 1Y81A 3RU7A 1E2MA 1TM2A 3SHVA 3DMNA 1BDMA 2XTAA 2BONA 4GEGA 1UCFA 4G2NA 5U4XA 1YMQA 1U7HA 2G17A 2F3UA 4N39A 2PX0A 2Z04A 1YL5A 3H87A 3LUFA 4W99A 2OFFA 4TLAA 4HT3B 4YIHA 4TRJA 1NJGA 2L82A 4PHTA 5ES4B 1NSTA 4R2MA 3ORHA 2ILTA 2D13A 4ZOBA 4UEOA 1DCTA 3AVUA 4AKIA 4DXHA 2I3DA 2HCFA 2ZXUA 4M6WA 4IXTA 4WCFB 4UOEA 3HCDA 2QUJA 3I3SR 5DN6A 3S5UA 1VI2A 4P34A 2C1EA 1V35A 4HB0A 5F1PA 4BLVA 4B6OA 5KX5B 2EARA 1Y9AA 1C1XA 4RW0A 3DTYA 1FYEA 4D99A 4FNMA 1K6JA 1WCWA 2V3WA 3BB1A 3KTFA 5CR9A 4TWIA 4NBVA 1CYEA 3BFXA 3DG9A 1XZ8A 2Z3ZA 3FFXA 4U7HA 3NBFA 4C3ZA 3OE1A 3NT4A 4JCOA 5EPOA 3TCXB 1C0EA 1MG5A 1V37A 1EFAA 3JYNA 1F8YA 1THTA 4HGNA 4JL5A 4I2NA 1VE7A 1IIRA 1DKRA 3G8AA 1D4OA 2BFMA 2B4AA 2BFCB 1BMFA 2P5TB 4UBOA 4DJAA 3OD1A 4XM1A 1QAMA 1J8YF 3HB4X 4F3CA 2H31A 2X7XA 3VAYA 3VX4A 4E2YA 1NW4A 1TO1E 1AE1A 4XR4A 2YVQA 1HTBA 4TWRA 3GCDA 2HRRA 3JVUA 3K0SA 1A5BB 3REQB 4BUJA 2VCYA 1OAKA 1Z5OA 3A4TA 4GI2A 1ZJJA 4PAMA 5LMZA 1PUIA 1H2WA 3JVIA 4MW0A 1WOYA 3N2KB 3ZTWA 3UTCA 2NO4A 3SHFA 4EUHA 4S2EA 5JW6A 2GAIA 3GJQA 3A9CA 1UBUS 2KQUA 2J3KA 4GXRA 2ZSAA 4TS9A 3JV7A 2D2IA 4OEHA 2Y1KA 4RF2A 1EXDA 1SC3A 1U94A 2ZQ5A 3PQ3A 5G2OA 2JHAA 4A7PA 1NULA 2EKQA 4TTSA 3SSOA 2WHYA 1YRAA 2TS1A 4ENTA 1Z2EA 2G77B 4QPPA 4U2FA 1M1NA 3EHDA 3MTIA 3TGPA 1RPZA 5E1BA 5KOJB 3C1AA 1HDZA 3H11A 3ZK7A 1WUIS 4YV2A 4NQZA 3KD3A 1YKSA 3RJMA 3CRNA 1BGXT 1C7IA 1T6XA 1XDGA 3UJ9A 1TCAA 1AUQA 1T8YA 4HAWA 1VDKA 2P62A 1HY1A 3UQZA 2A0WA 2BM1A 3QUTA 3SD7A 5C51B 2O8CA 2HSJA 5EMMA 5BNTA 2P2ZA 1QH9A 1FUIA 1TM7E 1TCVA 2IX3A 5IPFA 5CB4B 2PRKA 5BMOA 5TB5A 4RGVA 4E0BA 1Z34A 2OY0A 3GZ4A 4GKBA 1OX4A 1EG7A 3LZDA 4QUKA 4UASA 3V8NA 3W5IA 5JZVA 2AOWA 3GEBA 1EGQA 3TLJA 2OWDA 3KJNA 1QYRA 1Z39A 3UTDA 2XNDD 1QP8A 2PZJA 2B1IA 3MGCA 3PQDA 3U7HB 2VRBA 4D80A 3HSYA 4UVEA 5DV9A 1GKUB 1YL7A 2GSDA 1NF8A 1KOLA 4WXPA 4XIIA 5KNBH 2D6FA 1EKXA 1O6ZA 2VSOA 1TMGE 3NI2A 3ZXYA 2WIJA 4OHXA 2PFKA 4OKIA 4ATNA 3CF6R 2H2WA 4JHLA 4RKQA 5FAKA 1E9EA 1Q83A 2B4QA 3FR8A 2F8SA 2V7TA 2EZTA 2ZEJA 2ZOSA 3BCSA 1GNPA 3LNCA 2FMFA 1JU4A 2MYUA 4MW9A 2ZUEA 5AK6A 1LEHA 4P3OA 2PSJA 4EGAA 1SHKA 1EP9A 2VWPA 7MDHA 3S2IA 1D0IA 4G36A 1YAHA 1LBIA 1WLSA 3DUFA 1O6FA 4Q24A 4R0MA 2E49A 2IPLA 3RFXA 4Z7NB 4C7XA 1GKYA 1WDMA 1W30A 1VMKA 3KFLA 3IURA 1P72A 4G9BA 5E6SB 3CO5A 4M9QA 2CMHA 3A3OA 1JKMA 1M0SA 1B42A 3EGEA 3EW7A 1TK9A 4KDFA 4UHFA 3O8LA 4GPD1 5B7NA 2O50A 3DTTA 3DNMA 3IILA 3ODPA 4NIMA 3VM6A 1XVIA 3KOWA 4IIUA 1M2GA 2CVHA 2JIZD 4DIBA 2OO7A 4ZAXA 4C6HA 1H3EA 1NKSA 1Z17A 5TGDA 2HRBA 3ABZA 2FETA 1UBNA 1N0WA 4QASA 4QELA 5AI6A 1RHUA 4CM8A 3AZQA 4L4RA 4YB8A 3URMA 4OHYA 2CJWA 4QBGB 2AG6A 1MA0A 3BE4A 3O90A 1JG2A 4FHEA 4U2BA 4KE7A 3PFBA 5E7QA 3CNEA 5BRNA 3MD9A 4GWGA 1EVKA 3D7SA 3UWKA 1JHVA 4LHSA 3CO0S 4EL0A 1G3RA 5AIAA 5KSYA 4ROSA 4URXR 2ATVA 1FUYB 2CBXA 2XSZD 3D6NB 1N2CB 3L04A 3D3JA 2VTDA 3QVTA 4TMVA 1PZHA 1K5PA 2BHRA 2JFZA 4ZVTA 4GDMA 1GTRA 2I3AA 4PYJA 5HQJA 5A7GA 4ND5A 3SEZA 1YZVA 2R65A 4AX8A 4XR9A 5FTJA 4ALJA 1AKNA 2PXXA 1UK6A 3KYDB 1YBFA 3MXOA 3P5BA 4BV9A 2F4VB 1E2KA 1ZNXA 4ZDIA 4M1WA 1EUZA 1U5CA 1LQUA 2JGDA 3FDJA 4HZUA 1RJDA 5KMGB 2NT4A 1O08A 3W6PA 2ZIWB 3PB3A 1WY5A 4MTLA 3WS7A 5B3KA 3ZU4A 3RRBA 2NVUB 1JAYA 1P0PA 4PANA 1CX9B 2UDPA 3HU3A 4KACA 4HD8A 2DFNA 5H82A 1DKNA 1TECE 2EQAA 3C6BA 3ZGNA 3S2UA 3W5CA 1ISJA 1R10A 1Y3IA 3DMHA 3ED1A 5KUTA 2V4ZA 2EFCB 5BNZA 5CB4A 2J59A 3NEJA 3A28A 1P9NA 1ZN7A 3I1YA 4I19A 4U3JB 4D8VA 1R88A 4RPIA 4YMUA 3ZJVA 3R20A 4ZJZA 5ERYA 5FNVA 3CLRC 2AF3C 4B3CA 1C0PA 1F2UA 2EQBA 2R79A 2JLRA 2AL7A 1OAAA 3PGMA 4EL5A 3NTQA 1T8UA 3R7DA 1EDDA 1SBCA 2YXNA 2EG5A 3T5PA 5HF9A 2XMBA 4AB1A 1JB9A 5DISB 3L46A 1E61A 2ZIEA 1Z68A 3E1SA 4XX0B 5AH0A 5DHUA 2OBYA 4ER6A 4O3MA 1L7DA 4COKA 1NC3A 2FZLA 2P2DA 2G1KA 1JPVA 3ORYA 4KBGA 4GIBA 5D3MB 3L05A 1XQXA 1EWVA 2OYRA 3ETJA 3WL8A 1F17A 4DT1A 1XNJA 3JQ9A 3QENA 3QMMA 5J2TB 4F3NA 1YDWA 2C92A 1G2IA 1K8XB 2AZTA 4KQKA 4YPFA 5ALNA 5E7MA 3AI2A 1U1IA 5AOCA 5KWJA 5CVDA 4IPTA 2D8MA 2I22A 4MZDA 5FL7A 1H66A 2IJGX 4ZRDA 4EUKA 4C43A 1ZONA 4I9HA 4D1YA 2D1RA 4LXGA 4YI3A 4UAJA 1ILEA 5CIWA 4FGZA 4I3HA 4YAUA 2R96A 2AC4A 2DBZA 2HIGA 3K31A 1B93A 3TN7A 3BF7A 2JARA 4N6NA 1LVUA 4LG1A 4BO8A 1C1HA 1XZEA 1BQEA 4BLPA 1A7AA 3PTZA 3IAFA 4PTLA 4QEZA 3HDYA 3NFRA 1SXJD 1BIFA 3AM3A 3ETCA 4R9NA 2I4IA 4TSFA 4EY8A 2OZKA 4DQDA 4IKPA 3TBKA 2GJKA 4DPLA 4HWTA 1PWEA 2A9VA 2C57A 2RD2A 1X15A 1U8XX 4O02B 4R7ZA 1OTHA 2IZ0A 2W2OA 4B2YA 3EWSA 1X0VA 2QRHA 3GJ5A 3QVMA 4L0DA 4NBRA 4HAYA 2J5BA 3OG9A 3OJFA 2G5TA 4B3GA 2UVQA 3LX6A 2Z83A 2BLLA 4IL5A 1CZRA 2NXWA 4M37A 4DR7B 1WU8A 1N7GA 1ZCJA 4ZZIA 1YVRA 3QIAA 1DWOA 3V48A 4DCNA 2VHVA 4GQIA 3GAFA 1JYSA 1A9OA 2JL1A 3JRWA 4ZU6X 5KX5F 1XUOA 1XVUA 4QPNA 4AN4A 3D7LA 1C9MA 1KYVA 3DVLA 4MVJA 5IYZB 1W2WB 1QYIA 3O1IC 3OIYA 1IBKB 2Q46A 3MMNA 4I9NA 2Q3HA 5A2GA 1US8A 3IR6A 4OI0A 2NOAA 1RBQA 4KFSA 5LUBA 3SOZA 1MJGA 4DBVO 3AQIA 4PN7A 2XYGA 3WRYC 1ZMRA 1XXHE 2Z43A 3DMTC 4G41A 1XCBA 4MJ3A 5EFOA 3EPPA 4TTJA 4ECAA 2J7KA 4P1ZA 4MPJA 1PBNA 2OORC 4LA4A 3EMDA 3TZQA 4X41A 4NBSA 4EJ0A 1RKBA 2EFYA 4J49A 5EN4A 3T52A 3FMVA 3QVSA 2HFKA 2W6ZA 2ZVQX 3PU6A 2B5WA 4RU1A 2O8EA 1I3NA 3WGLA 5TJHA 3DBOB 2F4NA 1A2OA 3VU1A 3DBRA 3EVZA 3LPCA 3EXFA 3IQWA 1C29B 2HPHA 2O3SA 1TT5A 3AF6A 3ERCA 2AOTA 4MW7A 1O0SA 2HF2A 4LGYA 4OHOA 3H19A 3COSA 3MQ4A 4H7FA 5KVCA 5EIHA 3A6PC 1R6DA 3BGWA 4FEEA 1HLDA 1NC1A 2AQKA 4MVJG 4C0SA 4AAYA 2VNJA 4F3RA 1Y5NA 2VJMA 3PKJA 4IEFB 4I6EA 4M36A 1PCXA 2WWGA 5IJ0B 1AHHA 3QLVC 1XVLA 3QVOA 4EI8A 4KQFA 3WQRA 3PEVA 1II8B 2ZZMA 1VMIA 4JQCA 3COPA 5H3CA 3VR5H 2MWMA 3ZWWA 3LYAA 2QMUA 2ROQA 3AERA 5AP9A 2WWVD 4B43A 5E3IA 2Z9BA 1HY0A 1GGFA 1WPXA 2W6NA 3RFFA 3HY4A 3TZLA 2IBMA 4LRUA 1SG9A 2GVNA 3FUWA 2VHWA 1P3DA 4X60A 2R4UA 2I3GA 5IBPA 3GYGA 3ZLBA 2K2QB 1G16A 3QA3E 5LYJA 5B2FA 1A72A 1ZD1A 2EL7A 2WU1A 2LKCA 2QXUA 5DYWA 1L4EA 2AMLA 1DZIA 3A9SA 4D0LB 3GEDA 2L19A 4KRXA 1DWQA 4LMRA 2C59A 3WO0A 2HMAA 5TVGA 1KPGA 3P0RA 5EXXA 1LI4A 4M86A 3B7GA 2D2VA 5LP1A 1PFYA 2D5BA 2QL6A 1XKTA 4PLFA 3ZEIA 4BNJA 2YNMA 4NLLA 5IUJC 2IUEA 2AFHA 1EX9A 3OC6A 1P77A 3RUIA 1VYTA 4WX2B 1QO9A 1B2LA 2E5FA 3AVQA 2FPRA 1URPA 3I45A 3MWYW 2XTZA 3VSEA 4D9EA 5DYNA 1JIJA 1KOJA 4KE6A 2L42A 4K6HA 4QJIA 1C14A 5E3JA 5CAEA 1OFIA 3ZG6A 1RKUA 4OLHA 3G8BA 3PJEA 4PZZA 1LW6E 4AKTA 1W0JA 2FJPA 2Y99A 4JEIA 1OOEA 5TS2A 4DLWA 1QG0A 1V3UA 2X5NA 3GI1A 5DBOA 4FX5A 5LLDA 4WOJA 3BH0A 1TIBA 4F0JA 4XVUA 5C5DA 5K4GA 3GNTA 4Q82A 3SR4A 4IM7A 2GTPA 5CCXA 2ZVJA 4QODA 3Q3CA 2JLZA 2B82A 2FQXA 2HL6A 2O2SA 3GMDA 4HXFB 3VJLA 3GRYA 3GEEA 2VOJA 4BE7B 5KJ1A 4AKHA 5F4ZA 3CUVA 2FMTA 3TQIA 1H8HD 1V7QA 4ZICA 3BMQB 4Q3KA 4QECA 4LDPA 1NZFA 4WNIA 3CEAA 1Y8RA 2GA9A 5ICCA 2MSLA 1L5KA 1TW3A 5JFTA 5H0IA 4TQAA 4L9RA 3E22B 3H9BA 1LQ2A 4H3KB 1SC9A 3AEYA 3L77A 3N2ZB 2PUJA 3LU1A 2QRQA 1KZ6A 1EK2A 3AM5A 1B8PA 4PW0A 3BCUA 3T5CA 1DEHA 4EJSC 1OLUA 1G8YA 5AM1A 1E7SA 1ZQ1A 1JQKA 2DVMA 4QICA 2QW1A 2OBLA 4DLPA 4TXNA 4B9AA 4MUMA 3ZZTA 2QG4A 4XD7D 4E51A 1K5HA 1OPRA 4EG7A 4YUZA 1PZGA 3K0HA 1NN3A 5L45A 2O2YA 3GJ0A 4JP1A 1Z2CA 3N2LA 1CY4A 4YEDA 3T1VA 1UC9A 1L4LA 2Q4RA 4XRGA 4ZI3A 3ENKA 5FIUA 4Y30A 4KMOA 1T0UA 4OJYA 4G4IA 4U9IS 4P3PA 1YO6A 4BS9A 3O8DA 1R1DA 1B8UA 1J2RA 3GA7A 3HVIA 4YRFA 5HIIA 1QPZA 3HGMA 1A9RA 2VP0A 3PGVA 3QFCA 3VVBA 4F6RA 2NO5A 4NOKA 2AZDA 1VMAA 1KIAA 2FZCA 5LZ4A 4ZI2A 1T4CA 2CMDA 3EVTA 3OZCA 4LWZA 2QVZX 3S29A 1N3IA 3IAM6 4O08A 1O7JA 1OYOA 2HIHA 4B2LA 4YT2A 3IDSA 2OB2A 2DQKA 1Y82A 3LG2A 3IXQA 3K0KA 4IFTA 3VA7A 3VKFA 4CRWB 3ZH2A 1VRVA 4DLKA 3I2HA 4DW8A 1L4HA 2PMFA 4HLUA 3R76A 3NJRA 3RC9A 5E9JA 1Q0SA 2BRUA 3B60A 3EZGA 1CFZA 1YE3A 3COJA 4RK0A 1JG3A 1EJ2A 1FL9A 3N87A 3GLUA 4B47A 1SQFA 1YBHA 2GN2A 2QLFA 4MWDA 3TZHA 4DLSA 1FZTA 2ZRMA 4NG4A 5CVUA 2DWQA 1X2EA 2R87A 2WTAA 4RO0A 2WUDA 2QN1A 3LQQA 4HQOA 2P67A 3RQSA 4K3VA 1J33A 2Z5VA 2NTJA 2Z1MA 5FYQA 4EDHA 4JXXA 3G6KA 1Z2PX 2XA1A 5DHSA 4AZTA 1V6CA 4KQGA 3GLRA 1J56A 4ENVA 2C3OA 2ODWA 2WSLA 4FFLA 3NQ41 2YCLA 1BGWA 2XT0A 1XLVA 2REBA 4MMZB 4PSCA 1O57A 4LRTB 4HJRA 1M6VB 2HBQA 3OZRA 4NXMB 4CLRB 3DBLB 1MRZA 1PR9A 3MWDB 2AG0A 3P26A 3G1WA 1D6NA 2ZRDA 4RZHA 4F84A 2A9OA 1J0DA 4K6MA 4ZOQI 1HNWB 3KEQA 4RORA 1FXUA 4Y3UA 4PGAA 2ZZNA 1Q16A 2JGMA 3IQDB 4FE3A 2E3JA 3L5OA 8ABPA 2X0EA 1SRRA 3ZHCA 2MOKA 3CRMA 5BSRA 4EG3A 3LC7O 3RLIA 4FGSA 3E6AA 3T8YA 1P7WA 4GRDA 1A5ZA 3AHIA 3N6VA 1V5EA 2DPMA 4M0KA 5JC1A 4AQYB 4NYJQ 3E5NA 3WNDA 4R1UA 1LI7A 2EZ8A 1GGHA 4L3OA 3JZIA 3Q5DA 4ZRMA 4CWAA 2AJTA 2EP7A 2VXCA 4XGKA 5ALPA 1YRWA 2ZYVX 3H1BA 5DHQA 4YT4A 2DETA 1DG9A 5AK5A 1Q12A 3F1KA 3WTBA 3R9XA 3F4SA 2ZATA 1GUDA 2X8WA 1GZHB 1JTFA 4JP2A 2QYSA 3DL7A 3AXTA 2XE8A 5GOTA 1VBNA 1W48A 2QTHA 4NE7A 4K9OA 3R0IA 2X3YA 4FGKA 4ZVPA 3TQHA 1FBNA 5JROA 4BB9A 2QU8A 2EGHA 1H5NA 3DHEA 2GARA 1TM4E 2JCSA 2BKEA 2HFJA 4M9RA 1C9JA 3AF5A 4BNDA 3F8SA 5AVOA 1G18A 4ZO4A 1AIPA 1GZ6A 4JT8A 4G97A 1RWVA 4OJKA 4WXRA 3Q2KA 5C8ZA 1GPNA 5K6AC 3QMWA 4OO3A 5EIFA 3WB1A 3CLUD 4NDNE 5JH7B 2CDNA 1NW3A 5I4BA 4GC9A 4CR6A 3UPTA 1ZA2A 4QXOA 1K2WA 4XDGA 3ROQA 1N4DA 3P2KA 5D6NA 5K3SA 3ZQ4A 2NAPA 3AM4A 3CZMA 4MKRA 1QPBA 2IXDA 3BIOA 3EVAA 3H5IA 3OQ1A 3Q4GA 4DTIA 1DOZA 2IYNA 3A2NA 1QFSA 3BWEA 4LYDA 3ROMA 4RMJA 1V1JA 4WXEA 3VOBA 1QIIA 2HLPA 4BQRA 2J9FB 4IY1A 5AT1A 4BIIA 1NPDA 2Z8YM 2CK3A 3FSEA 4O4LF 3OZSA 4PS1A 1R6XA 4JA2A 3QYFA 4BLOA 4BVEA 3NHJA 1TYEB 3RRZA 3JATB 3B6MA 4CQMB 5TIIA 1Z7YA 2DRIA 2FMHA 1GQFA 1DTEA 2H4ZA 4PWYA 4Q19A 1NXXA 5F73A 3VBEA 4L78A 2IS2A 3C8UA 1SKYE 1YZ3A 3KQVA 2A0KA 1UBGA 2K6GA 3ABOB 3CGGA 4KN9S 2VJMB 3R40A 1F20A 3KXKA 4TTQA 2OK7A 1JSLA 3DE2X 1K92A 4GUAA 1K7WA 5KNLA 4A10A 2BE9A 1IZYA 3MAAC 1IQ0A 1JLMA 1ZOPA 1G6Q1 1N2GA 2FN4A 3QHAA 1CQJB 5HGJA 5HR5A 4G8JA 4S05A 3UPUA 1D6JA 2PMWB 3UT5A 1BE6A 1CZHA 1H8ED 1LPSA 1Q7TA 2G76A 2ZYGA 4IKOA 2HQ1A 3OZXA 1EK0A 5FWAA 2ZBUA 1SBTA 3AGPA 5TT0A 5B6IA 4KAXA 4QRIA 1Z16A 3A3YA 3GLHB 1J5PA 1J8FA 3U7QA 4A16A 3RTCA 1O0BA 4V1CA 4H16A 5LYJB 3OQNA 5CA1A 3A6KA 4ZZ1A 3RUAA 3EISA 3BXHA 1D9ZA 1M7GA 3UEOA 3UYLA 4Z3KA 5KVVA 1XTTA 3EUAA 3NC1C 4RZ2A 6NULA 4G37A 1N1DA 1XQ1A 5F1KA 5HK8A 2ZSHA 4JB0A 4YDRA 1PGPA 2PY6A 1X3SA 3DTVB 2EDAA 2IZZA 4QO8A 1K7FB 2HREA 3WYDA 2YJZA 4KQIA 4H7HA 3FSGD 1UC5B 5E4FA