1Z4JA

Structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with uridine 2'-monophosphate
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
194
structure length
194
Chain Sequence
b'RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase
molecule tags Hydrolase
source organism Homo sapiens
publication title Structural basis for substrate specificity of the human mitochondrial deoxyribonucleotidase
pubmed doi rcsb
total genus 63
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1z4jA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4jA01
1RMQA 3IRUA 3ESRA 1SWWA 2DQSA 3RF6A 1TJ5A 5AM3A 4NFLA 5ALHA 1T5TA 2GMWA 3L0YA 5ALQA 1ZS9A 3L8FA 4UMDA 3DDHA 5AVTA 1U2SA 3QUCA 5AK3A 1L7OA 4Y2QA 2D2VA 2HCFA 1RDFA 2PR7A 3WK6A 3MPOA 3EPRA 3I6BA 2GO7A 2JAOA 3K1ZA 2OYCA 1Z4KA 3AR4A 3B8EA 2AUTA 4UASA 1L8OA 5ALDA 2ZOSA 2I6XA 3QU2A 4XE5A 1Y8AA 1NRWA 2X4DA 3ET5A 2C8KA 4DFDA 1YV9A 4YH1A 2I33A 2IA5A 2YY6A 3L0BA 4Y2JA 3L1UA 4OFZA 3CZ4A 5AIBA 3EWIA 4C4RA 3OPXA 3IJ5A 4HGPA 3HYCA 2RB5A 2O2XA 3ZUPA 2HF2A 1QQ6A 3DV9A 3E58A 3P96A 5ALLA 2WF8A 3E81A 3N28A 4BEWA 3KZXA 3QYPA 3TLMA 3U7FB 4B6JA 5AKLA 3FVVA 2FUCA 3AR2A 4BNDA 4F72A 4Y2PA 5AM2A 4UW9A 3ZVNA 1YS9A 1U02A 3IB6A 1MH9A 3NAMA 4UMVA 1XPJA 3VAYA 2GFHA 2EARA 4C4TA 3W5CA 5AKYA 4EZEA 3QU5A 1QYIA 2GHTA 4AS3A 4DW8A 4CNQA 1O03A 4QQFA 1S2OA 2I54A 2I55A 2G09A 2OA0A 4EELA 2HI0A 4F71A 2HO4A 1Z4OA 3WKEA 2NO4A 1L7NA 2ZBEA 3M1YA 1O08A 4CF5A 3N5KA 4NAVA 2FPRA 5AIAA 4UAVA 2C8LA 5AKKA 5ALXA 3WK7A 2G1AA 3UMGA 2YJ6A 2G07A 4L6AA 2PKEA 2IOFA 4KX3A 1CR6A 2HHLA 2YJ4A 4BX3A 4ZEVA 3OCXA 3UMBA 3WKDA 3AR6A 5ALSA 1L7MA 1RLMA 4YIHA 2JARA 2B0CA 2R8YA 1QQ7A 4BBJA 4E88A 3QUTA 2G08A 2WF7A 3AR9A 5AKJA 5ALYA 3OTQA 3KC2A 3FPBA 3WGVA 1NNLA 4XOUA 1Z4PX 4HYTA 1VJ5A 2I34A 2VKQA 4G9BA 2JGAA 2YFYA 4ZEXA 3UMCA 5IT4A 3ED5A 1XP5A 2I7DA 5T41A 2HX1A 2ZBFA 1N8NA 4Y2SA 5AVRA 3FGOA 4Y2YA 4YCLA 3L1VA 1Z4LA 2ZG6A 1L6RA 3A3YA 3KDPA 3KD3A 3W5BA 1VFPA 2P69A 4O8CA 1ZRNA 4BEVA 1YMQA 3U7GA 3A1DA 3ZWKA 3U7EB 3U7HB 3ESQA 4L6CA 2IYEA 2B1RA 2B8EA 2NYVA 2CFTA 2YJ3A 1EK1A 4G63A 1JUDA 2BDUA 3SKXA 1QQ5A 3U26A 3QNMA 4FE3A 2FDRA 3NASA 4HAIA 4XQ0A 3ZI4A 4UU0A 3SMVA 3NIWA 3QUQA 4ZEWA 3W5AA 4HGQA 4Y2RA 3I28A 2WF5A 2ZBGA 3B9BA 2C88A 3QXGA 2PQ0A 5AVQA 1WZCA 4KN8A 3WK5A 1Z88A 1J97A 2R8ZA 1TA0A 1Z5GA 3ONNA 5AW1A 3FM9A 4PNHA 1U7OA 1NF2A 3RFUA 3ZTWA 3NANA 1K1EA 3L8HA 2B30A 3N1UA 5AI6A 2P9JA 3BWVA 2WF6A 1YJ5A 2B8JA 2OM6A 2O9JA 2WM8A 3M9LA 1U2TA 3EF1A 4MWOA 1U7PA 4J03A 1Q91A 5AVZA 5AVSA 4IFTA 4KNWA 1Z4QA 4JDPA 1QH9A 3GYGA 3ZU6A 5AVUA 1RQLA 2IOFK 4Y2XA 5ALFA 1IWOA 3PDWA 3L5KA 2ODAA 3N07A 2YN4A 5A3RA 3QGMA 2ZBDA 1XVIA 3E8MA 4GIBA 5AI8A 3ZTYA 3ZVLA 2RAVA 1N9KA 2EATA 3NUQA 4Y3UA 2YMLA 2EAUA 3SD7A 1L7PA 2YJ5A 1RLTA 1ZD3A 1X42A 4CE6A 4FFDA 5AKXA 2P27A 1RMYA 2RARA 5AW0A 5AI0A 1YNSA 5AKZA 4BYGA 2C4NA 5AVVA 3FPSA 2B82A 2AGVA 5AW4A 2JAWA 4UU1A 2JAUA 1KYTA 1SU4A 4BNDB 1TJ4A 1ZJJA 2QYHA 4DCCA 5AKGA 3MMZA 4BKMA 3KBBA 4I9FA 1Z5UA 2HEGA 3KOOA 2P11A 3WKBA 1SWVA 3L7YA 3L8EA 5AM0A 3L8GA 5AK6A 4Y2VA 4HGOA 4GXTA 1ZRMA 2G80A 2FPUA 3ZWDA 3UM9A 1TE2A 3WK8A 2R8EA 3OCZA 4JB3A 2HSZA 1TJ3A 1YDFA 3CNHA 1WVIA 5AM4A 3ZX5A 3ZVMA 2FPSA 4RESA 2BY4A 5ALUA 3E84A 2AH5A 2W4MA 2QLTA 3PGVA 4YIKA 2RBKA 3AR3A 1ZD2P 5ALZA 1L8LA 5E0OA 5ALNA 4NWIA 5AKHA 4Y2TA 5ALWA 3R9KA 4UM5A 3QX7A 5ALRA 5ALPA 2Q4TA 4MUMA 5AI4A 1Q92A 1EK2A 5AVWA 3WK9A 3PGLA 5IT0A 3N8GA 3SLRA 5AW7A 4YCMA 2BDEA 4YGYA 4H1WA 3WKCA 1ZOLA 4EENA 5AW3A 2MSNA 3SKYA 5JJBA 3AR7A 2R8XA 5AW2A 2CFSA 5ALGA 2C9MA 4C4SA 1WPGA 4QJBA 4EEKA 3R4CA 4NABA 1T9ZA 2Q4RA 2FI1A 2WF9A 2G0AA 2FPWA 3ET4A 3OCVA 3W5DA 2CFRA 3I1YA 2HOQA 2YMMA 4OD0A 1Z4IA 1RKQA 1PW5A 3F9RA 2CN1A 2WFAA 5ALOA 1J8DA 3AR5A 1Z4JA 1LTQA 3A1EA 3QU9A 1RC8A 3OCWA 2NO5A 4DWOA 4L57A 5AI5A 3QLEA 3SF0A 5AVXA 5ALKA 4HGNA 5AM1A 1LVHA 4AS2A 5AW6A 3AR8A 4RETA 4EX7A 1RQNA 1AQ6A 5ALTA 4FYPA 4IG4A 2YBDA 1RMTA 4BX0A 1RKVA 2G06A 2YMQA 4AP9A 2W11A 5AW9A 3NRJA 1RKUA 2AMYA 2W43A 2WHEA 3QU7A 3WGUA 2ZXEA 4UARA 1VJRA 3DNPA 3OCUA 4UMEA 3B9RA 1RLOA 4KX5A 5AICA 4KYTA 3D6JA 5A3QA 1WR8A 3QUBA 3U13A 3PCTA 4NV0A 4HGRA 3WK4A 2B1QA 5AKIA 2MU1A 3EF0A 4OCZA 4UM7A 5ALMA 4KNVA 1ZD5A 2HF7A 4UATA 5AW8A 4EX6A 5AW5A 5ALEA 3SHQA 2HDOA 5A3SA 2OBBA 4YCNA 2FPXA 1RPZA 5AVYA 1RRCA 3MN1A 1T5SA 3A1CA 5ALIA 4I9GA 3MC1A 3J7TA 5AI9A 4UAUA 3ZX4A 3OCYA 5IS2A 1S8OA 2Q5EA 3HLTA 5AESA 1CQZA 4CF4A 1ZD4A 1Z4MA 3DAOA 2GHQA 4XPZA 3ZW7A 5AKEA 5ALVA 5AHXA 3S6JA 3QU4A 2IOHA 3NALA 5ALJA 1FEZA 3R09A 4UMFA 5AK4A 5AM5A 3BA6A 2FUEA 5AK5A 3I76A 3FZQA 3L0CA 1Z4NA 3U19A 4CF3A 3WKAA 2FEAA 4BX2A 2YMPA 4OHFA 1F5SA 4Y2UA 4J2TA 5FP0A
chains in the Genus database with same CATH superfamily
3FTCA 3G9ZA 4QYMA 1NWCA 2WU8A 4BO0A 2JK1A 3E2IA 3GEEA 4Q4CA 4Z4IA 3PPWA 1JEJA 1PD1A 2CSUA 5JCOC 2ZTMA 4P4UA 1RADA 1IBSA 2AFHE 2X40A 3VZBA 1SD1A 2GPYA 4M88A 1G63A 1UXKA 1N5RA 2QY6A 4Z6KA 2NU6A 3RS4A 3FX2A 3UGQA 5FYDA 1J6UA 2GBFA 3S44A 4N0EA 4DHEA 3AJEA 3G5LA 5EIAA 2IIQA 1CEYA 2JI7A 1G41A 4IOKA 1QP7A 2JZOA 4YCJA 1P7ZA 5DLDA 1PEDA 3PJFA 2XB2A 3T1HB 2OVBA 3BGSA 3DOIA 4ND4A 1FURA 1AKUA 5LC1A 1QH1B 2Q9CA 4MI3A 3B8EA 1AS2A 1NXXA 1WJGA 1LLFA 2AN5A 2JB9A 3OPVA 4LRWA 1JWAB 1VM6A 2B0JA 3IEIA 4HYEA 3VR0A 1LVUA 1KFCB 1NVVQ 2GCOB 2ZRGA 3PJEA 4HB0A 1OWMA 1TLTA 2II6A 1IM2A 4X61A 3DTVD 4DC1A 4GL2A 3K2EA 4FGSA 4NBWA 1F9AA 1GNQA 2XKJE 1KH1A 3GLHA 3OZ7A 2XNDA 4Q02A 3D6NB 5IFLA 2OV8A 4DTIA 3DKKA 4LOLA 2GN0A 4D46A 3TDKA 4GUDA 1GUAA 3QYAA 4MICA 1HE3A 1J2UA 3B6ZA 3OPXA 1BRMA 1R6TA 1GG2A 1GPDG 5A4DA 2B61A 1EHIA 2H92A 3ILSA 2WW8A 2ZJ5A 5MN4A 3HBLA 3AUYA 4B43A 8OHMA 2VOJA 1ORWA 1UANA 3KWFA 4DV4B 2XHZA 4EF5A 4BE7B 1KTIA 1OHHD 1Q19A 4C3VA 1RW4A 2HF2A 4BQOA 4KDRA 3AJDA 3KLNA 1ZC4A 2EP5A 2GRJA 2H65A 3ACCA 1TO1E 3DOCA 3Q41A 4HH0A 5ALLA 2CXUA 2V03A 4DMFA 3SSOA 4BEWA 3IMFA 1DKRA 1THGA 3O90A 1TZKA 1AY0A 2P2LA 1M7BA 1I2MA 4WBNF 3CNQS 4LE1A 1U3GA 1C8KA 1I0ZA 4KQXA 5TJ9A 1I9GA 1T8YA 3AJ9A 3OPNA 3PD0A 5ADHA 3NGLA 1KQPA 3F6BX 4U5QA 1XDSA 5H80A 1NHGA 3RV3A 1E94E 5I7RA 2CXQA 3WGYA 5IPFA 1GY8A 3SF8A 2CWWA 2OOKA 2VDPB 3CWQA 4IGIA 4KDEA 4YRQA 4YXWD 4M0KA 2E7ZA 1YI1A 2QV0A 1ZKMA 3U4AA 2JGLA 1FLVA 1USKA 3A1UA 4Q3OA 2Y6VA 2YIJA 4KQEA 5CLJA 3SQOA 1YR1A 4LFBB 3IDFA 2LCQA 2JIQA 2PJDA 3QFCA 2XUKA 5KNCD 3F90A 1LCIA 4MYCA 5AUQA 5IDWA 2A33A 4FINA 1XJQA 1FLAA 1Z4OA 4RFSB 3WKEA 1L7NA 3DWEX 1MXFA 3O1HB 3I62A 1QS0B 3AC0A 4PY2A 1OZAA 1Y3DE 4CF5A 1DWOA 1FK8A 3F6PA 3IHKA 3N3BC 3HJCA 3QMPA 1WSDA 1KK1A 5IG2A 1CUCA 2ZYRA 1EMDA 3T3IA 3HKEA 3FWKA 5TJHA 1T1EA 4L27A 3RRPA 5EP3A 3V46A 4E1BA 1L5GB 2VL7A 2CVPA 4L6AA 5BSUA 1FDUA 1FXWF 3ROXA 3RS3A 1A9PA 5HKKD 2ZRIA 1FP2A 1K68A 1RABA 2LD4A 2YYZA 3H3FA 5TSDA 4EHFA 1U2EA 4IO0A 4MJXA 1TT7A 4NPAA 3V4FA 1EA5A 1UBTS 2I6GA 1V2HE 2WKSA 3Q10A 4FN5A 1ZUNB 3E82A 4EJSA 1CJBA 1N2BA 3OTWA 4E08A 1LQUA 4MEJA 2GXQA 1XBTA 4HLQB 2EIXA 4RMJA 2XXBA 4BFXA 3W7AA 4YV7A 2BCJQ 2ZE6A 2ONZA 3C14C 1C1XB 2ZKIA 1A7UA 2F1HA 1LPBB 1UBCA 2Q1TA 1KZ1A 3CU5A 3D4NA 3M4XA 3PNLA 4I55B 1DO0A 3I2HA 3IAAA 3P4XA 4HO1X 4B5KA 1PKXA 4J6FA 1UWKA 1XEWY 4YRRA 1C9MA 4XAQA 1RXEA 4TQGA 3RSZA 3FNBA 3DFIA 4OY3A 3LX5A 3INTA 4KQ9A 1E89A 3D0OA 2LV8A 3A9VA 4C6TB 4D3XA 1YZGA 4RULA 5B4VA 1AS0A 3DULA 2F3UA 3FPJA 1IVSA 4IS2A 4YJGB 2P68A 4G65A 4X8MA 4RF3A 4I1PA 3K8ZA 4FYKA 3FUVA 3ZY3A 4AROA 1L6RA 1X74A 1Y37A 2CLLB 2R6FA 4HWPA 5FWAA 3L79A 1H42A 1HDIA 4G5QA 4LEIA 1NMEA 3VKWA 4PAMA 1DOHA 5JRDS 3DDWA 3KQSA 1SEVA 4AG5A 5LLDA 3PHIA 3FETA 2G9RA 3T7SA 4O4LF 3GPCA 4QGFA 1NQAO 3SR0A 3C5VA 2EW2A 2IYEA 1WMEA 3MB5A 2CVFA 4WOBA 1MEOA 5A4AA 3FY4A 1DHTA 4W7SA 3WO0A 4D02A 4A6DA 3M9WA 2NYRA 5CLQA 3WY9A 1JUDA 1QMGA 4AKSA 1JR4A 1LTHR 1GPLA 5KWEA 4AO6A 1X2EA 3B6IA 4PGGA 2FDRA 5FTMA 1QF7A 4C3UA 4R2HA 1A4XA 1YJCA 1AXEA 3L1HA 3EDOA 4FZRA 4G9GA 3NO4A 1PUXA 4ZTBA 2E9FA 1WXWA 3ROTA 1M6WA 4CW7A 2XZOA 3GDFA 2ZYUX 1NAHA 1CRWG 1TQ6A 3I28A 4EA8A 2AEEA 3VV2A 3W5UA 2IQ5A 1FMLA 4Y6QA 1BQ3A 2YY5A 1GV1A 3NHWA 1IZYA 3PHJA 4I8IA 4L50A 2YRWA 2C0PA 1U2DC 2Y4OA 3CB4A 1EX1A 5DCWA 5AVQA 5JI2E 1XEWX 4KN8A 5A5EA 3VZRA 3AH8A 4F2WA 4LDZA 4TQ9A 5HP4A 1PGQA 4BAUA 1JA9A 1Y1LA 4TV9A 3S0JA 3STHA 2I5PO 4IQJM 3MJTA 4C2TA 4PNHA 2D2EA 1NF2A 4YTEA 4CQLB 1XP8A 2X77A 3JXEA 4K9OA 5KTPA 4DLAA 2FSSA 4R83A 1XPUA 1JG2A 3BKWA 4Y6PA 2BZ0A 3RAFC 2O54A 2PBFA 3EVDA 1SG0A 3L18A 2ZJAA 3BWVA 5FOXA 2OORA 3CUTA 2FMIA 2VRNA 3PICA 2M1ZA 3R2JA 4P7FA 1GCAA 4YWJA 3ROPA 3EULA 2P4UA 4ZO6A 1JKIA 3FFWA 3IC5A 5TLSA 3U61B 3Q1KA 4GZLA 1CZUA 1LFDB 3L84A 4IFTA 3EVZA 2BH2A 3L4BA 2NUAB 1CE8A 2GO1A 2NU8B 1I0IA 4O59O 4WDRA 3MMXA 1UBHS 2C95A 2LCIA 4HTAA 4BPRA 1X80A 3IRVA 3RK0A 3B52X 4NCAA 3K9BA 2FPPA 4XKJA 2A0FA 2IY7A 1H3NA 1DAFA 3G8AA 4A26A 2ZBDA 5JS8A 1ZSNA 2M1XA 2OV4A 1AHIA 3UGTA 4D82A 1B4DA 1KO4A 1YJBA 3ZTYA 6CHYA 4BGDA 4MRAA 4RBNA 1BRTA 1II9A 4GU5A 4RQBA 4XDZA 1V16A 5IBRA 3SYRA 1GQSA 2A92A 5JO9A 5LQDA 1FF9A 2A6PA 1YFEA 3QEOA 2EAUA 4FJ2A 4TMXA 3HA2A 2C2MA 2WG1A 3T3HA 2WAMA 3EG5A 4BMZA 3G23A 1QZUA 1RRFA 3DT8A 1RYMA 3K0BA 3K9NA 2OC9A 3LSYA 1A2OA 3U4HA 4BLVA 4RJTA 1ADBA 3GAFA 4E32A 1DAKA 1GTL1 3K1AA 3WTCA 4UXJA 1PJTA 1LBTA 2W7TA 1QWSA 3ZKWA 4A36A 1Z7YA 2HMVA 2DPLA 4EPTA 5T5QA 4DV3B 4KQMA 2QN1A 2ON6A 3L8ZA 4OQXA 4J94A 4L7QA 1MVOA 5A9RA 1CUYA 2Y1KA 4AYTA 1ZJJA 2CBZA 3DBRB 5SZJA 2NGRA 2A9QA 3HN2A 1NP3A 2N1MA 3VC2A 2WJ3A 2O7RA 5ULLA 4BKMA 5K0ZA 2PKXA 1ZWKA 3DW1X 3KSDO 3PCXA 1XTQA 4JUBA 5CEFA 5ER6A 1KNXA 5FJIA 2J0SA 3TIFA 3D5TA 1LPOA 4KRGA 1KF0A 1XI2A 3ESBA 4P3XA 4BLQA 3YASA 1Z0FA 4B44A 1ELOA 4LWOA 2M2IA 1RBQA 1Z8HA 5HG0A 1VE6A 4Q47A 3WL8A 1E92A 2YWCA 1GL7A 3G8CA 4P7GA 5H83A 3ZVRA 3DCNA 2CNDA 2QUIA 2DT5A 2XGMA 3SIWA 1RXWA 2G80A 3IESA 2Q29A 1RJGA 3UM9A 1YO6A 2PZEA 1QGZA 3OESA 1XPRA 3DMYA 2GF0A 1CY2A 2W5UA 5CXXA 2OBYA 1M67A 2P9EA 3IOCA 3KB6A 4TSFD 4YJGA 4ZMSA 1VLMA 2DULA 2HSDA 2WTNA 1TUBA 3IV9A 5B1EA 2YZ7A 2WUEA 4K9MA 2YIVX 4OHXA 4R2JA 4QELA 3V4VB 1JDNA 4Q7QA 2DBZA 4ZKDA 1J2RA 3IAHA 5GGXA 2SICE 4O2AA 5HILA 3UV7A 1MT0A 2QDXA 2RJNA 4G4JA 2ZWIA 4U2BA 1WZ2A 1ODCA 3EDCA 3FPHA 4X9XA 3EQ2A 4MQ5A 2BM1A 3WICA 1Y8ZA 4DWVA 4BAGA 2WUVA 5D2CA 4LSZA 1MD9A 1ZAYA 2LVBA 1OXTA 5CDTA 4B32A 3QBDA 4YJHA 2YW9A 1QUFA 1W4RA 3Q8WA 4N8EA 1QR2A 3MTDA 3HNOA 4INOA 1ND6A 3IIMA 4XASA 1QBGA 1ZH0A 1GU0A 2OZEA 4N65A 3UJDA 2AS0A 1NFRA 1XCPA 5D5QA 3U3ZA 4JL8A 1K0FA 1JU4A 4BNFA 1DXOA 5JJBA 3AETA 4B7CA 2ILTA 821PA 4FNAA 1MV8A 5KB3A 1F6WA 3LC7O 4NABA 5KNBD 1PQ4A 3LTEA 1IBKB 5F1PA 4LECA 3ZGLA 3BPSA 5JAMA 4NULA 4KLCA 5E95A 3WV5A 4RHCA 3K7EA 3ET4A 3LHSA 1DU4A 3T12A 1W9HA 1QVRA 2EP8A 2UUPA 1SVLA 3F49S 5HF9A 4DCOA 3A58B 4U2DA 5EE1A 2OYSA 3U17A 3HP1A 1TECE 5BYJA 4QC2A 3WSTA 2QB5A 4GL4A 2X1HA 1OFIA 3FLBA 2SCUB 2J6CA 2RGCA 2VSFA 1GYPA 5HPYB 4GMGA 5G0SA 1HDYA 4OP2A 4RH1A 2RG7A 1KO5A 4R5MA 3IUMA 3G2NA 5IC5A 1EX9A 5IUKC 2GZRA 1ISIA 1Z2AA 3B13B 4MKFA 4LAFA 2ZULA 1C0IA 1WMDA 2C2XA 4FUTA 2UUOA 2HPHA 1G8GA 2P78A 2ETXA 4B31A 3HGMA 3VNSA 2TMDA 5FNVB 1NYTA 5E4YA 3PQ5A 5A3JA 4M3NA 3HB0A 4J9UE 2ZREA 3WLFA 4IEFB 2WWTA 1W94A 3NH9A 3TUZC 1P39A 1N75A 2QIPA 4YRJA 4NCIA 4IG4A 1DEKA 1K89A 2F4VB 2AXEA 4QDKA 5FO1A 2LKCA 1OX6A 3KOXA 5K8VA 4AJ2A 1U5CA 3CKYA 3DE3X 1YRWA 1XWOA 4RENA 5G4KB 3ZGNA 1VLJA 1E3MA 1ULSA 2YY7A 3C16C 3VR1A 4WEOA 2FPLA 1VRVA 1JPUA 1PUIA 4F7DA 2H4HA 4B3MB 1JEDA 2PNFA 4IVRA 4DLBA 1V8DA 2A7XA 2FZCA 4R2KA 3T3EA 4DV7B 3QTTA 3AI7A 3H8WA 3U3KA 4NOJA 2VIIA 3IBSA 2PBLA 2O2CA 5JHGB 4FFMA 3ZJYA 4JVMA 1EE9A 3LWZA 4RA6B 2P30A 1PFWA 1OU4A 1J0DA 3DE7X 3UJ3X 1K63A 2J87A 2OQRA 1WHSB 2XMQA 5G2OA 2VPTA 2XQFA 1FY2A 2ZTHA 1FQWA 3RQSA 1U8FO 2AFIB 4PX2A 3T5TA 2R4TA 3HKCB 2F9FA 1YONA 4Z2AA 3GK3A 1IHOA 4EX6A 1R3DA 2WVAA 2PO7A 3GEHA 4PG5A 5H70A 4HPXB 4IIYA 4I1RA 2C83A 3E7WA 3M5WA 3SEAA 2YZMA 2CD9A 1Q1EA 4UCFA 3SI7A 5LPNA 1CG6A 3CI0K 1XKXA 2ODQA 3F6CA 5IS2A 5FFFA 3DC7A 3BWMA 2BI8A 3KB2A 3OM0A 2Q7DA 3TTWA 4DNQA 4DLPA 4Q1VA 3EC2A 3M81A 2BI7A 2QS9A 4OXYA 3HLTA 1JKJA 3TWOA 5D3QA 2ZUFA 4L78A 4QTXA 2ATXA 4A4DA 4CDRA 5LKAA 3E9QA 4LRTB 2R62A 1XRQA 3LQ2A 3HCNA 3PBKA 5ALVA 4AZTA 2PTGA 1KTVA 4P93A 1H5QA 2ZRNA 5LA6F 2VUHB 4EGQA 1FEZA 3KT0A 1UF9A 4D9CA 2UU9B 1NOJA 4BBZA 4R40A 2NX2A 4OH1A 2J33A 4BNTA 4FFRA 4M0FA 3G59A 4IDOA 4GX5A 4JS0A 4B3FX 3VU8A 5BVGA 5GZ6A 4IRXA 1MJHA 4Q93A 2GWHA 2Z5GA 5CVUA 3G9XA 4RIGA 3WKAA 3RVBA 5KJEA 4HT3B 2YMPA 4OHFA 2H1FA 2UVPA 4HAOA 4EYSA 4TKVB 4MUHA 5IZ4A 5E8JA 1Y7IA 2D1SA 4CMGA 1N2ZA 1BTOA 3QYJA 4JGBA 4WBSA 1KMQA 1XXHA 1NZJA 4LRSB 4GYYA 1EXWA 1AGPA 1JSRA 2VHJA 5IDXA 2KHZA 5JFGA 4UFPA 5KDLA 4QASA 3WQHA 1JHDA 2X8BA 4FZ3A 4H31A 3DFMA 4KDCA 3CONA 4JI5B 3VNAA 4LBZA 4Y6GB 2C7PA 2ZSHA 5CDFA 2APJA 3VTFA 1YA4A 4B40A 1CS0B 3L1JA 2QY9A 3VMMA 4Z0HO 2QNRA 1EFVB 1DWQA 3U81A 1K97A 1AT1A 2HWUA 2PPVA 5BRJA 1EK0A 3FVTA 2GO7A 3KV3O 4MO2A 3E9RA 5J59A 4ECAA 3LCRA 3L7DA 4V02A 4LVUA 4ANFA 5DTEA 5FT9A 3JARB 5HR5A 2I6XA 2PYDA 3NRBA 4L8FA 5ESXA 1JT9A 2DUMA 2PU7A 1PP4A 1ADGA 3KPJA 3TGLA 1WO8A 4P0PB 1FRNA 1H05A 2QG6A 3BTSA 4X5OA 4E11A 2WC1A 1WPRA 5A0TA 1AX9A 2C4WA 2VP3A 3LT0A 3U1BA 5DP1A 2J7KA 4R3NA 2I33A 5FWYA 1EFPB 2F6RA 1YKFA 4BZQA 2ZZMA 1E61A 4DS3A 4ALKA 4Q4HB 1WCXA 3I2IA 5CW1A 521PA 4ZK2A 1RWBA 3JQFC 3L40A 4YP6A 1GGNA 5LWHA 5EQDA 1CSEE 4LHEA 4DKXA 4CODB 3ESYA 4ND6A 3C45A 3DLAA 1GFZA 3MTGA 1U0GA 1O94D 3I9JA 3MT8A 4LVOA 4P92A 4GMKA 1X3SA 2VPQA 4L22A 2C7VA 1D2CA 3ROEA 3GT0A 4LYAA 4TTVA 3ZUPA 3C8UA 3FUUA 1G19A 1UBGA 4FZJA 5FB3A 4X6LA 1HZZC 1OREA 2AN9A 2AL7A 2VYCA 3WP1B 4MDFA 1GR0A 4RTPA 1Z18A 1AUQA 1ZPDA 2HXYA 2WF8A 3DO8A 3MBOA 4Z7OB 1AZTA 4PSCA 2PEZA 3K20A 3KKMA 4RTKA 3GGJA 3K0AA 5JC1A 4A9AA 1QVWA 2BKEA 4TTIA 5E9AA 5TB5A 3TLYA 4UW9A 2SBTA 5J4YA 3VKVA 4C0LA 1E1MA 1XU7A 3LVFO 2BN4A 4AZWA 4CEJA 3O8QA 4H0FA 4UMVA 3PNMA 3CH7A 4REOA 5GIOE 1SD2A 1GGFA 5FBVB 2I2CA 3DDOA 5DN6A 1U6KA 4MS1A 4PBTA 3KX2A 5CCDA 1QYIA 3R3JA 2DWQA 1PDOA 2J09A 3GGDA 1QV7A 4X1YB 4XJVA 4D26A 2EQAA 3ONEA 1YCDA 4EJMA 1ZL2A 3EXFA 3OP1A 1IE3A 2H6EA 5GONF 3SM9A 1PLLA 1F1JA 1Z7EA 4WLUA 4G9EA 3Q3GE 1SBTA 2CB9A 4Q4DA 5L3SB 1AGXA 4F71A 1H2AS 1KI3A 2IIVA 3JQGB 1RWWA 1TZJA 3KDAA 1ADJA 4OAOA 1SOVA 2Y6UA 4XTRA 5FAXA 4XJTA 2OLKA 2PFGA 4F3CA 2VXCA 4UAVA 1SOUA 3R4VA 4AUEA 5J4KA 2QRVB 3ZTTA 3N05A 4INPA 1J4AA 5LUBA 3R9WA 2H9IA 2JIMA 2XNSA 1S3GA 3LCVB 4R9VA 5DOVA 1M83A 5ELMA 3OQMA 4NMLA 3RE1A 1CR6A 4GI5A 4ZEVA 4XQEA 3Q2OA 4RLQA 4URHA 2WJAA 4PYOA 1XGKA 3ENZA 4PBSA 5GM1A 4MW2A 5BT8A 5KSZA 3RYCB 5PNTA 1STOA 1IRXA 3NTVA 1JQJC 3C5CA 3AGPA 1UKZA 3L4JA 4E88A 2PZBA 3UMSA 3I42A 4HXFB 3K6RA 2HK9A 3OTQA 4OI0A 1BXGA 3ROQA 4NG5A 1QR6A 3QV1A 3CA8A 4QATA 4X8HA 5C8XA 1O95C 2F3PA 5HIJA 4PQYA 2KI5A 1IXRC 1OAOA 1Q2XA 2YWBA 5HK8A 1WBBA 3FYTA 1IQ0A 3T5CA 1DX6A 2PMWB 2UZ1A 3OPYA 2I7DA 5DWQA 4GWGA 4C7OA 2G04A 3W2FA 4RFLA 4XVCA 2OD7A 3GU3A 5FX2A 3ONWA 4NENA 3N70A 1GUZA 2A0XA 2WAOA 3SSNA 3AEKB 1ILEA 1SKYB 2OAEA 3M70A 1Z4LA 3NDPA 4D9HA 3LNTA 5AD1A 2YWJA 1RI1A 2L42A 4FKZA 3A3YA 4QNNA 2ZYTX 4UKDA 3TIIA 3N8DA 4GMHA 3LY9A 4O02B 4HVCA 1JLLA 1RJDA 1CJSA 2IIBA 4S1NA 4Q7KA 5DBGA 2JFFA 4RE6A 2X0KA 5F4BA 4C7MA 1EM6A 5JJ5A 5JTTA 3LQ1A 1C8VB 1QTNA 3REOA 5ES4B 1NSYA 1JEQA 3FFAA 2XYVA 4MYDA 4C4ZA 1K7WA 3B2EA 4EG7A 1AXGA 1WMAA 4FOOA 1LWOA 3AF2A 4ENSA 1FYDA 2IHTA 4RDHA 3SIRA 4PEVA 3RVMA 2R9VA 2P65A 4IV0A 5TPWA 1E66A 1RWXA 1Q0QA 3FH0A 3OKCA 3SKXA 3VV3A 3QNMA 3VZQA 5CDFE 2Q6VA 3HKDA 1SVIA 2HUPA 2NSLA 3P9KA 4R1MA 5D3KA 3T9BA 4C0WA 1J9ZA 1Z2OX 3L6RA 2CE2X 1WS6A 1T2VA 2PDAA 3AM3A 3G1TA 3VZPA 2IS2A 2YXLA 1XCJA 4LZZA 3U3OA 2BM0A 3H9UA 3UC9A 1NUHA 3IVGA 4B83A 4BLOA 1T0JB 5IC4A 1P9OA 3GLKA 5JD5A 5F4ZA 2A58A 5CVJA 4D6XA 3KSBC 2GAAA 5M5BA 2JD0A 2ZAOA 3DVAA 4BRSA 4BKPA 2O59A 1EU1A 5IANA 1X1DA 3GLVA 1XDWA 4I6GA 1QQAA 4BQFA 4K9DA 3W0LB 1N2HA 2XQGA 1ES9A 2X86A 1EX6A 3Q7SA 2B69A 1Y0BA 3AIMA 4BNKA 1IXYA 5F76A 3STYA 3N1UA 3C6XA 2X2PA 3CRQA 3QUSA 4FCWA 2QIOA 2X0IA 1D6MA 2JHCA 2QN9A 2RHJA 1ESDA 3AHCA 3CX3A 3A6DA 1YRHA 2RSLA 3DF9A 3IBFA 5ERGB 4IDBA 5FOTA 3ANSA 2PWPA 2IYXA 2Z9CA 2F8SA 2OG1A 1R8JA 1NVXQ 1GOTA 4FOTA 2JCBA 3VH3A 4X7BA 1CD5A 1GU1A 4HZUA 2OHGA 3KKOA 1MKYA 1DC4A 1PIWA 4GW3A 4QDUA 1K7SN 3TVDA 3WB9A 3ZE2B 4B1FA 4EW1A 5ARBA 1Z8DA 1VI5A 3PLRA 1GXSB 4R1LA 2QBYB 4CV1A 1M6VB 1VHJA 1K6IA 3EZFA 2WU1A 2ICAA 5JFTA 2BCGY 2EWWA 3I05A 1FDSA 4K6KA 4TVOA 3J7AC 4EK9A 4EH1A 3PLAE 4G1MB 3I4LA 3BZUA 1D9XA 3PTAA 2IYUA 4Y3UA 5LU9A 3NTRA 3P4YA 3W2IA 3THYB 1XJ5A 1AGRA 4GGPA 4RS4A 4DPMA 4WK4B 2EWVA 1ZY2A 1MGPA 2DWPA 2VPZA 1W25A 1X7WA 4UTOA 1FJXA 2BTQA 3VDRA 1OWLA 1ID8A 3IPXA 1UQRA 1M10A 1PSZA 3G89A 3JWHA 1LRKA 4CZ2A 3U40A 3HXTA 4FQ8A 4MJ3A 4BYGA 5CA1A 2YXPX 3FTQA 1DC3A 1K5HA 2C4NA 3ELDA 4O2RA 4X3PA 5DXAA 5A4KA 2RCYA 3P20A 2PJUA 4UU1A 5B1DA 1TJPB 2XT6A 1AZLA 1NGSA 2XMDA 4YASA 1AHNA 3I2GA 4B2IA 3HEAA 4B46A 3R1IA 2HEIA 2PV7A 3JVVA 3V9PA 1HQYE 2A5LA 3UJHA 2PZ8A 3A7DA 5JAIA 2I76A 1V3TA 3DV0A 4TV8A 1MO6A 2H63A 2DKFA 3W3ZB 4MR7B 2V4ZA 3CKLA 1V96A 3P32A 4O4LB 4ALMA 1NVWQ 1T15A 1Z35A 4A0RA 4R81A 1YS1X 4A8JC 4RK7A 3L8GA 4BIIA 4HQ6A 4X91A 3IT1A 1GU7A 3IE1A 1EWYA 2VRWA 3T6KA 2PSSA 3A4NA 3QXHA 4FNOA 5DM1A 4RIFA 1PQYA 4PFKA 1YDEA 4ZVSA 3H9GA 5JCXA 3F5DA 4B81A 1OU0A 2HSZA 2R66A 1JAHA 5J40A 4ZYLA 5FHRA 1GCOA 3MEQA 4ZQEA 1Q1NA 1JB9A 1G8PA 2J3IA 2VYQA 3DAPA 4XYBA 4ZDWA 4R6XA 1KI6A 1ZSYA 4CFZA 4NJMA 1QP0A 4A6PA 1M73E 2B6NA 1YJ8A 3JAKA 1DP4A 2D1RA 4LDPA 3ME5A 3PGVA 1VGVA 4M89A 3VR4H 3EYAA 1KOJA 2FZKA 5T4FA 4C0JA 4LF4B 5HRCA 3E7DA 2IYOA 4FYWA 4EABA 4I08A 5ALRA 2H3EA 2X0DA 2X0FA 1UJ4A 4DR2B 1TMYA 1Z07A 3O4RA 3MQ4A 3B85A 4EY8A 3PGLA 2WHPA 4ER6A 5TV2A 2QXUA 3HCOA 4YVFA 3GG9A 4BS9A 1E2FA 1EA7A 4QHYA 2XQKA 5KNBA 5DWVA 1YRBA 5M3BA 1WZUA 3H7AA 4S05A 1Z5VA 1SR8A 2G9UA 3OF3A 1TK2A 4WCFC 5FJJA 4Q6BA 1AV7A 1HQKA 1JQ5A 3KKQA 1QH8B 1MIOA 1H65A 3B5IA 2R8XA 3NTUA 4KHZA 1FDIA 4WWHA 5AW2A 2YVAA 1NUUA 1YHYA 4C4SA 1O0CA 2QR2A 3VAZA 2FGKA 1UZLA 4ZYYA 3ANXA 3PGMA 4QPPA 2MSDB 4HPWA 4QSMA 5COBA 1LV8A 2XRMA 1AF7A 2BJVA 3P5BA 3ZG6A 1W19A 2EF0A 2GDZA 2UYHA 4HI0E 4J7UA 5BR1A 2XTMA 4P31A 1YAHA 3VOSA 1OYVA 5KMGB 4UBIA 3O8LA 5JJKA 2XRZA 2Q9BA 4POAA 3R5HA 1O0SA 2RHMA 3TKYA 2BC9A 5FKJA 3ZHZA 4S04A 3ORFA 3AEQB 4FPXA 4TYPA 1GA4A 5ALOA 1TTHA 5D8DA 5EQFA 1DTWA 4IM7A 3H1EA 3HZHA 4WOCA 2DECA 1E7WA 1A7JA 2P67A 1Y1RA 4DWOA 2PKWA 2A67A 1ZU4A 5HDBB 4NH4A 3R0JA 4OBBA 1ZK0A 3PUVA 1SK8A 5BNFA 5A1JA 4AMBA 3JQAA 4DSUA 3HE3A 4KE9A 2AFVA 3L6UA 1D1PA 4Z99A 1G5FA 3PDJA 3Q9UA 4NSNA 3BFPA 4DDKA 5JSHA 3VPDA 1DCTA 1W1WA 1HFJA 2V74B 4RJ2A 2CK3A 3T41A 1T9GR 2OG2A 2F90A 2O06A 3OAAD 2O1WA 3JASA 3OOEA 3M4JA 4GX0A 1HQDA 4CUKA 5CXUA 1CS4C 1ESNA 3K0FB 4QQKA 1BHJA 1L8QA 2GNAA 1B8VA 2VK4A 1LJUA 3H1BA 4E1VA 4KXQA 4RY9A 1EFVA 2ZXUA 5DNDA 1RE5A 3NRJA 1QZXA 4LNUA 4UDOA 3KAPA 5D51S 2Q07A 3JATA 2AMYA 4B80A 4YAIA 3QU7A 1GYQA 4GP7A 4LBYA 3U9LA 1IY1A 3PFBA 4O29A 5IJXA 5TPZD 3VYSB 4MVJM 3BICA 4PZLA 1UKVY 3P0HA 2FPIB 3TBHA 1YMUA 1R4NB 4F9TA 1KY5A 3CMCO 4KE7A 4ZVRA 1P0IA 1VSBA 3EDYA 4MA0A 3VGJA 1ECJA 3MOIA 5FNZA 2QYSA 1XKTA 3LUAA 3C15C 2VN8A 4Q34A 3JQBA 2Q6OA 4I14A 4QBKA 1Q0UA 1L4HA 2FWMX 4LRXA 3UWDA 1ZLYA 1Z2PX 5BURA 3KYCB 3HGTA 1CY4A 4XGKA 3PGJA 5C8ZA 4B4VA 1ZBDA 1FYEA 1E2PA 2HDOA 4F5YA 1A7AA 3KOUA 5FUQA 2X0RA 3UMRA 3KETA 3EODA 2FPXA 3MWLA 3K9FC 3L8DA 4KVZA 1RPZA 4MDEA 4S3MA 4GNRA 2X7HA 4KXYA 1O5OA 3NU1A 4OGKA 5JJIA 4MVJG 3A1CA 3AUKA 1W59A 1V45E 5B55A 4JT4A 4HAUA 2O8DB 1KJZA 5AT1A 4H3KB 2Z56A 3JWGA 2VQSA 2JD2A 4ZT2A 3FPCA 4RJIA 3ZJVA 5LFAA 3ZCQA 4KAXA 4BN5A 1V9LA 5IHXA 3FIJA 4XPZA 2WHPB 2A9PA 1JFFA 3FYHA 2YV4A 4M1YA 3PIDA 5C3UA 1L1FA 1JFLA 1QQBA 3AYXB 3OC6A 1N2CB 3R0XA 4CLOA 1RXCA 4JUCA 4I5EA 1CHDA 3HBJA 1RXVA 1XVLA 1SHJA 1EVYA 4QVIA 3GZJA 1XMQB 3BB3A 4E4YA 3OHPA 2QTHA 4C4XA 4D43A 1DMRA 3C39A 3GEBA 2BDTA 4IIJF 1HLFA 2O57A 3PGXA 3UCEA 3WC4A 2JLRA 3D8UA 1G5HA 1K66A 4NZYA 1YS4A 4Q7JB 3UWPA 1OLXB 1A9XB 3CLSC 1YB7A 1YKGA 3I5AA 3OT4A 1K7YA 4Q1CA 2V8BA 3WLHA 5MFPA 3I04M 4HFRA 4CM9A 1DFGA 3TJMA 1WBDA 1QIHA 2HQ1A 2ILVA 2CLMB 2UZ0A 2VDJA 1RMQA 2IHJA 2OB1A 4WEQA 3ON5A 4MI1A 3VR4A 4OBWA 3TN7A 2OGUA 2L18A 1X2BA 3H04A 1W36B 3LW7A 1QIIA 5BQ5A 3KALA 2CHVA 3PQ8A 1XFDA 2EX0A 1KAQA 1V1MA 4O4LA 4KAJA 4XA8A 4V1CI 1HL3A 3ZV6A 3X1WA 5J58A 1HXHA 5JAPA 3CUVA 1MB2A 2QEQA 3BJMA 1S1CA 2OMEA 5KWSA 2OZVA 1AKQA 2WI8A 5KYYA 4L0CA 2Z3ZA 1XZHA 3P0EA 2EV9A 1ORVA 3A6HA 3PUIA 4JU9A 4XQ9A 5E3HA 5KNBH 1QE3A 4ARUA 1LKZA 1RYFA 3CVYA 4NNJA 3K1ZA 5HNKA 2CL6X 3B5JA 1U2QA 1XMOB 3PQ3A 2Q8NA 3G68A 3GGOA 2JLZA 3FMPB 2A9VA 3VH4A 4ZJPA 1PR0A 5KX5F 1G8SA 1JVSA 3G17A 4WX2B 3PT5A 1UXGA 2H3HA 2GJ4A 2QM7A 4UEQA 5FI3A 1W88B 4N48A 4ZAGA 3SDZA 1YV9A 4DL9A 4X62B 1I13A 1ARZA 2F1KA 2GUGA 1PAUA 3VR2D 1DEXA 3KJFA 3WDMA 1I14A 1XTTA 2HA7A 4XM1A 1RNLA 2OZLA 4JC0A 4KL8S 3NKLA 4YUVA 4A8HA 2QT9A 4JCCA 4BTLA 1QRAA 1D1SA 4C4RA 4ID3A 1HGXA 5K1ZA 4IDFA 3VSAA 1CRQA 3A37A 4LHVA 3I58A 4MWGA 3CLVA 3TMYA 3R5FA 3FFTA 4RKRA 4Y8VA 3PPIA 9LDBA 1COZA 3PHCA 1MG5A 3HYCA 2O8FA 1O6BA 2KWIA 2P9FA 3MUFA 3R6TA 3PKJA 5K99A 1LVGA 2O2XA 1HTWA 2QZSA 1JN0A 4XDYA 4ESVA 3P0JA 2HTEA 4URUR 1N1GA 2GM9A 1RZVA 4R9RA 5A7FA 3OQIB 4LHSA 1ORDA 4XX1A 1YFJA 3DG9A 3WE7A 3GJ8A 1EUQA 1QIDA 1H66A 3BCHA 3EBOA 4B6JA 1ZHOA 4HEHA 2EW8A 2R65A 4RZ3A 2P4EA 4CM6A 1FSSA 1KVUA 4PXYA 2QQEA 4ZVUA 421PA 2J31A 1JG3A 1U9IA 3O95A 4KKVA 5T3UA 1PJ8A 3IB6A 5CA0A 1DIAA 3L7OA 3MILA 3PL5A 4RE5A 1RYBA 1PWHA 1XDUA 3F3SA 3FPEA 3H11B 2O3RA 3P2YA 4H7JA 5IJZA 1R0SA 1N7JA 4DLYA 2IC5A 1XLVA 4M9RA 4EZEA 4RY0A 1T9HA 2Q46A 5KPJA 2E0IA 3HYNA 3DW3X 3AM5A 3PEYA 1H94A 2J0UA 3QPDA 4JJ8A 2VK2A 3RSSA 4BV3A 5KOJA 3DBHB 4DKJA 3G85A 3BDIA 4UHBA 1O8BA 5EG5A 3LO8A 3TLKA 2P9CA 2VDNB 1R0ZA 3NCHA 1RZRA 2YWDA 3CLSD 3WGMA 2H48A 5KTMA 3VJRA 2GKSA 1J8QA 2A5DA 3EIHA 3A2NA 4S1WA 4DVJA 2GNPA 3PEUA 3R7NA 3QE0A 2FPRA 2QXTA 4ENTA 3LOQA 3GVIA 4GVPA 1E8MA 2G5CA 5ALXA 5EMLA 3ZBTA 4B71A 3FLAA 3Q7EA 1DEAA 4WY8A 5K8LA 3FD8A 4P54A 1D8TA 3GLHE 4R9NA 3UMGA 4NXMB 5E9JA 3H2SA 2PXCA 4FB4A 3KQLA 3H65A 4Q01A 1X0XA 1J24A 2I8LA 2VH1A 2W37A 1AC5A 3LBIA 3AR6A 4JOQA 3JATB 1P7YA 3U4IA 1L4KA 1EQ2A 1V3VA 3ODGA 2EEPA 5HFJA 1QQ7A 6LDHA 4AY3A 3DLHA 1JLRA 2OGWA 3SAJA 1VA4A 1GSIA 3ZD7A 1PLJA 1Q17A 4BFWA 3P9SA 3PEWA 1B8OA 4JXJA 2WJ4A 3ENVA 1RD4A 1C3VA 3C8HA 2F1JA 3K2QA 3SF8B 3AEYA 3WWDA 3D1LA 3L06A 5DNEA 3UMJA 3WBJA 4DG8A 2HSEA 2VKQA 4BMSA 2CYCA 4JUDX 3S2IA 5I47A 2IH4A 1CQIA 721PA 1JIIA 3OPMA 2EFJA 3QELB 4WOPA 4XI9A 3HABA 4AKGA 1GFWA 1JJFA 2QD5A 4QJ4A 5TT0A 4D0SA 1S9HA 1V6SA 1JDSA 2CJXA 1IPHA 1OXMA 5JECA 1WETA 4IICA 1WVGA 5H1YA 1WLSA 3BAFA 3K15A 2BFEA 2OCBA 1QPBA 3RTGA 1KJYA 1K75A 4RKFA 1UQTA 5DJ5A 2FG7C 1TEHA 2WYOA 3PC4A 1Y8CA 2V7QA 4BTVA 3QVKA 5BWNA 4RKYA 3IUQA 1W93A 4MWSA 1N5IA 1W5FA 4X00A 5JSYA 4B6GA 1WUYA 2ZP1A 5DW0A 1LA2A 3OI7A 1Z12A 5DYGA 2A35A 3LC0A 4HLNA 1R8YA 5EA2A 4NI5A 1FFGA 3SX0A 3TMKA 3GRZA 2LZ0A 1AKTA 1KFKB 1O4VA 3AJAA 5CNKA 4YAFA 2WJVA 4Z9XA 1RVV1 2GN8A 5BSEA 1GN8A 2OR3A 5M34A 1ZGBA 2AJLI 4H77A 5MN5A 1QQ5A 4GOXA 1Q5PA 1Z75A 4ATNA 2LPMA 1ECPA 1GG8A 1RR6A 2R86A 4KXWA 3QOFA 1FFXB 1VHTA 1T9BA 4UC0A 2VCHA 2NTVA 1II0A 1VJCA 4HRVA 3CF0A 4V0NA 3ZDCA 1F3LA 2ZZKA 3U56A 1KK3A 4N40A 4PGHA 1DLIA 1U7ZA 4QBIA 1PR2A 4RF2A 5K3FB 2WVGA 4BNWA 3B1ZA 3MJSA 5JJCA 5IF3A 1I0LA 3UYKA 3LA8A 3EWSA 1YR9A 3AF3A 1FP4A 4LGMA 1RAHA 2FZ5A 3A9SA 3IPAA 5FUXA 1DAHA 4LRYA 3H2BA 2R8ZA 1AQIA 1PW7A 2KM1A 3HZOA 5IAKA 4PNEA 2B8TA 1ZXBA 2BGWA 4UHCA 4PG8A 3SDBA 4KR6A 3BAZA 4W9MC 1BX0A 2C3UA 2FP3A 3GN2A 5JCJA 1KEEA 3AVYA 4RDXA 1B1AA 3RD5A 4DBLC 2RAUA 5BN4A 1H2YA 3DZHA 1OILA 1N6IA 2ACKA 3BIFA 3VPSA 3G13A 4M0DA 3F8WA 3BXEA 4MPPA 2Z83A 4YN3A 1LD3A 2AMFA 1HK7A 1H85A 3ESAA 4POOA 1RTKA 3WLQA 5INTA 1L4UA 4QEDA 1L5YA 1JZSA 3FRJA 4PSVA 3AKYA 2NU9B 3ND9A 3WQQA 3GT3A 5KYWB 2XVAA 3JQGA 1ULHA 4YLEA 5K4AA 3DOHA 1XKQA 1NVBA 4XJSA 2EEZA 3D7NA 4CHGA 1MG0A 2FCRA 4RKWA 1I4WA 3DKPA 3T3DA 4PC1A 3B48A 3D8HA 1F6DA 4ZPXA 4Z4CA 1I2BA 3SZ3A 1KA9H 5HSGA 2C9DA 2GPSA 2XWPA 5DV9A 1V9CA 5K9ZA 1SB8A 3PXBA 2PUWA 4WXMA 3W2HA 3DDCA 4AECA 2Y1CA 5H3CA 2VJLA 2WSMA 4ML3A 1IN6A 4WNAB 4E09A 5EJMA 5HF5A 2ZRPA 1OMOA 4RSHA 5C2JB 1G6HA 2VDWB 1WTCA 1M1YA 1NFQA 1R6UA 2PX2A 4UBLA 1NJ5A 5KAPA 3TGWA 3CUEF 2FR8A 1KR5A 5G0VA 3PZRA 3VSEA 3TZEA 4TLAA 2Y92A 3QPAA 3QBPA 2YV3A 4OF4A 4RORA 3FCCA 2AGVA 4QHSA 4TQUS 1DDGA 2COUA 2PXAA 3A6FA 5AK0A 1MW8X 2YDYA 1CQIB 4OX9B 3RF7A 1TM1E 4KIUA 1C14A 4PVCA 2AQ8A 3ITNA 3JY6A 2ZTSA 3PNOA 2D1QA 2NO9A 3V4SA 3AKZA 4RSGA 2BW0A 1A9RA 1IOLA 2NAFA 1BFDA 2FH5B 5KQPA 4N0QA 1JS1X 2P75A 3T1YB 2AI2A 3HI4A 1QGOA 5EZQA 3BKXA 1E2EA 1QP8A 2HRDA 3M6WA 4WRRA 3KJHA 1K5DA 5AK6A 3X3HA 5LM3A 5FI0B 5JD4A 4DR3B 4NYJQ 3O8CA 4U0JA 1QK5A 1ZN9A 4B4DA 3EQ8A 2FLWA 5JRZA 2JNWA 3CUWA 3Q7QA 4R68A 3JTEA 3H97A 4MVYA 4UTNA 2D7CA 3GRFA 1KETA 3STWA 3VKUA 2FPSA 3PXXA 4RXUA 4GI7A 1U3CA 1UBLS 1V11A 2JIRA 1ZCZA 1QGAA 3T5MA 1SKYE 4RTJA 2GCNA 3PUJA 3IULA 4GZ5A 5E1OA 2C4HA 3MJHA 4MYUA 3M7IA 4X41A 4OUDA 5KDOA 4P6VF 5FFNA 4CQMB 4OU5A 5LMUB 1I2ZA 1DFHA 4OQNA 2HXGA 2YYYA 4RWZA 3TTVA 2H1SA 2W9XA 2XGOA 1ISRA 1GQRA 4J29A 4D57A 1XK6A 1B6RA 4WCDA 1YTLA 3ADPA 1XRNA 2QXYA 1HFKA 3DVAB 4LY6A 3DEFA 1L5LA 3I52A 1DBQA 4YRTA 2AE1A 1TLFA 3R6GA 4W5RA 4I9UA 1B8NA 3JW8A 1RACA 3C7TA 3O74A 2XUOA 3OT5A 3ZZUA 3C3WA 1NVUQ 1XU9A 2QTAA 4KPYA 4QTTB 3QVLA 5ALGA 1I36A 1GZ4A 1IEWA 1US8B 2TMKA 2Q28A 5YASA 2QVLA 3T5DA 1Y42X 2RE8A 1FZQA 1ULBA 3H0CA 4EEKA 1YDWA 4EFMA 2I7XA 3AEUA 2WF9A 3TOZA 1GVHA 3GBSA 1GLNA 1ORIA 5C35A 5JWOA 3NDBB 4M1SA 4YMWA 3A4MA 3V97A 2ODTX 3DYIA 4CKWA 2PBRA 3GZHA 3CCFA 4UXHA 4HAWA 2DBQA 3LDGA 4G85A 3VR2A 4ZALA 4DAEA 1K7EB 2CVQA 2FFRA 2A86A 5DP2A 2GBLA 1SNYA 4NJEA 1G4AE 4AG3A 2VP6A 4UTRA 3AY3A 3MLEA 2OV3A 3OCWA 4OQPA 2E48A 4MLPA 1OBOA 2Q2QA 2C4UA 1Y98A 1NLYA 1QGUB 1SU6A 3NKVA 2VZEA 1F4LA 4ZI2A 3RYTC 3UWSA 1OBHA 2WHXA 2EQ5A 1HFEL 3TZHA 4ZHQB 2HCBA 1K6JA 2AOTB 4HGNA 1TJUA 5HE9A 4D3YA 2AEJA 1DBRA 5LUAA 3OLYA 2W8BA 4M0LA 4F96A 3THXB 3DAGA 4K9NA 2AN3A 2B9VA 2WB4A 4IFIA 3EHEA 1CB7A 1P2VA 5KNDA 4QQ8A 1XDBA 2G4LA 3UZUA 4ND3A 5KVQA 1U81A 2PVSA 4URVR 5BWMA 5HZGA 1H2BA 2JAPA 4OMDA 1QXSA 4Z4QA 2IWRA 5EJ6A 1HEYA 1KJQA 2ZRJA 3OFVA 1NY6A 2B4RO 3H6HA 5G53C 4AP9A 2PGXA 2EKDA 3V8BA 4BDTA 5KYNA 3THXA 3RRFA 2CV1A 2O5VA 2F1RA 4Z9FA 3SC2A 3GCDA 2CL5A 4N39A 4V0LA 1CZHA 1H1LB 3BE8A 4W1QA 1KGSA 4QUEA 5JQGA 3C8DA 3WGUA 2X41A 4XJXA 5LXTF 1VJRA 3AI3A 4JLAA 2OHFA 3OZBA 4RIIA 1DC5A 4KPFC 3JWIA 5E38A 1C81A 1UPCA 2ONYA 1RWPA 2PKQO 2PWBA 1XXHE 5ITVA 1T9KA 3DOEA 1M75A 2FX5A 2ZJ7A 4IBOA 4IXTA 5B3JA 2B2NA 3WIEA 4E2FA 4YXFA 1NE2A 3EK2A 4CKBB 4BQEA 1YDMA 2FFQA 3Q7IA 4TLDA 3RAPR 2H1CA 1E1NA 3GLUA 5D3MB 3V2HA 1EB8A 4I46A 4X7RA 3H5AA 5T6MA 1SMKA 5C51B 3ZK7A 3KO8A 1H2EA 4YJFB 3D5QA 2V4UA 5LD2C 3OIWA 4PX5A 3WMXA 2HV8A 2Q3LA 4UATA 2KQUA 4H15A 1VPEA 2JF0A 2ZRQA 3NPMA 4FFNA 4IQGA 5A9SA 1G2PA 4QDOA 5ALEA 3G0HA 5K3BA 4PC3A 1TCBA 2ZI5A 2F8MA 3NLLA 1X7YA 4GXNA 4ZCQA 4EKIA 1UZNA 2I7VA 2L2QA 3ZHQA 2XCTB 1NDQA 4DJEC 2R1VA 2Z57A 3FOBA 3H2YA 2C5LA 2F4NA 2JGIA 3I2KA 4HAVA 4PFQA 3E3AA 3UJNA 3PGA1 1RRCA 1T5SA 3R5TA 5GOTA 1NW8A 2D3WA 2JL1A 1W87A 2X5OA 4KIJA 1S8OA 4OEHA 5KZMB 1FBNA 1DXQA 1Y80A 1FVHA 4PU0A 3T7TA 1Z2EA 1DX4A 4G4SP 4I4LA 4V1CB 1PJLA 4FR0A 1UOOA 2M32A 5A03A 3OZRA 2UKDA 4RK1A 2BFDB 2RK6A 3GRAA 2FF5A 2PKYX 3QX8A 3WGTA 1K92A 1L4EA 2OFPA 5A71A 3QELA 1Q14A 2B3DA 4B3DA 4BVHA 4ENWA 4IY1A 2R8BA 1P31A 2J4DA 4Q7EA 1Q83A 3MD0A 3N6XA 1SGWA 4HS4A 1ANKA 3W8EA 2HT6A 3H1AA 4IQ8A 1FS5A 3BWXA 1YQEA 4KR7A 3BMNA 4RL4A 3VKFA 2HWWA 4Z86A 2X15A 3OQPA 1T1RA 5HF8A 2IV2X 3GBVA 4REQA 4UZFA 1A27A 1ONPA 1ZJ6A 3V6MA 4F7WA 1K4YA 1Z2DA 5JPIA 1XLTC 1I30A 1A76A 1CZNA 1FMCA 2ECPA 4BHTA 1FX0A 3GJXC 4PIMA 2V6MA 2Z4RA 4HYYA 4D44A 4R9SA 2X2OA 4AAYA 5BR8B 1TM2A 3C3KA 1YFLA 3L0YA 4WSOA 3QF4A 2WD7A 4QXOA 5ALQA 1W29A 1U0EA 2ZI3A 3DDHA 1NSTA 1C9DB 1U2SA 4KE8A 4MP3A 5AVTA 5IN4A 5IU6A 4QJ3A 1QCDA 3VOBA 1L7OA 3HACA 3FCOA 1ZITA 4MV4A 1V48A 1KHTA 3MLBA 1OW3B 4LUCA 4YFVA 1OE0A 2IEBA 2YVKA 2ZDGA 4KVAA 5D6OA 1YFMA 1A9QA 1R74A 2C77A 3W3AD 2G9VA 1ML3A 3L43A 1UBKS 4A7PA 2CHQA 3IPLA 4WGGA 4PG7A 2I2BA 1HRDA 5EE9A 3MINA 2DR0A 3L93A 4O4IB 1OF1A 6ABPA 1VPLA 2AC2A 2D1YA 3KR1A 1RYEA 4RAQA 2PRYA 1KMNA 4QLAA 4QUGA 4Q4JB 5SYAA 1TJVA 4MV7A 1F8XA 4HTFB 4M37A 3EOBI 5EWJA 4WLNA 3PNPA 5CB0A 2PO5A 2BR3A 3SHVA 1IN4A 2BKUA 3JZFA 3IHTA 1OWNA 2JJ1A 4Q4AA 3RLIA 4GAEA 4EP1A 2GM4A 3HM2A 2WT9A 1Z5NA 4YH1A 1PFGA 3FDZA 2N3ZA 3V3KA 2HA3A 2IA5A 1WB9A 4ZQIA 1DAIA 2G4CA 1S96A 1XRSB 5DGXA 4MX2A 3Q1LA 4FOLA 4IIXA 1EUYA 3B9QA 2FW7A 5FBRB 3CVOA 4D41A 3QVSA 4OP3A 1I3NA 4KDFA 1YH3A 1BEEA 4HGPA 1X1CA 3RRXA 1LDEA 3QP9A 2ONKA 4CL2A 4OL9A 2I1LA 1J09A 1ZP6A 4KTVE 1CUFA 4NYMR 4ND8B 4RCVA 4JXXA 1F60A 4Z4HA 1S2DA 1C1HA 5JZOA 1RJEA 4CG0A 3Q12A 4FDUA 2MT9A 4YJFA 3FKQA 3LUGA 1E3SA 3BFKA 2JCVA 4MIEA 1GNLA 2AZDA 3KLBA 4AZSA 4JLWA 4D9GA 3R6WA 3OZVA 3EGWA 1IMOA 4OB6A 3GNLA 3TOVA 1I7SB 1FPQA 1ZRHA 2VFAA 1CEXA 2VBIA 2L19A 4Y2PA 3TL2A 3WYAA 4XCVA 5KNDH 1N78A 1U02A 1AUPA 3GRRA 5J5VA 3GFRA 3WL4A 3ANYB 2DPYA 2O2GA 4GC5A 3X2EA 2I7CA 2PKRA 4JJIA 3K8OE 3SS9X 4CQLA 1INLA 3ILHA 2HA2A 2V7QD 3B1YA 3JQ7A 2AWNA 3AT1A 4HQOA 4BNYA 3X1KA 2O8EA 3RU2A 5IVPA 1QJ4A 3GAZA 1XCLA 4BWVA 2DERA 1WDMA 4L5JA 1MOZA 1SCDA 4ZQFA 3G88A 1U3FA 3OG9A 5FTKA 3Q3JB 1P33A 5L95A 3GVXA 1OAAA 1HNXB 1A3CA 4F84A 2FP4B 5ICSA 3QKSB 4ABTA 1D0VA 2QR5A 3DB2A 4KO8A 1A82A 1JTEA 1FTGA 1JTFA 1AG9A 1KSGA 4F6LA 5CEEA 2ZBRA 1F8FA 2JGMA 1S7GA 2X5XA 4DA4A 1VQ1A 1RU3A 1G8HA 3QNUA 4MW0A 1QNFA 3TNLA 2PZMA 4YRNA 1ESMA 1FUKA 5LOVB 2HM7A 2PUFA 3HZRA 2D0PB 3KOWA 4KX3A 5H16A 3U60B 4MEAA 3IEVA 4DDMA 1E8NA 1RJ9B 1E2DA 1H1LA 1XVUA 2C07A 3DMNA 4MRVA 4NJEB 3QF7A 3JRXA 1MDBA 2B0CA 1EH5A 5K09A 5B7PA 3OJXA 3KXDA 2ZIVB 1Z63A 3PIRA 5LP6C 2OFFA 1UJ2A 4KI7A 4U6QA 3AR9A 4QU8A 1VHQA 5IASA 4NU0A 4FJ0A 3NGMA 2BEJA 2QW1A 4F2GA 3RIHA 1RYDA 3B1JA 5IYZB 5JEEA 1WLYA 2GS9A 4Y7CA 3CEMA 2HLDD 2IOYA 2I34A 4P86A 2O4CA 4AW9A 4D4HA 5BV2P 3UJAA 3HUUA 5JCPA 4JEIA 3AVXA 4LE2A 2V45A 4FEAA 4RWEA 3CLTC 2BGJA 3VNQA 1GEGA 4JOBA 2R1TB 3WWZA 1QX3A 2MMGA 2HD4A 1F14A 2QRZA 3DXXA 4E94A 5BN5A 4OHYA 2EKPA 1SXIA 2R7LA 4HVAA 3QLUA 5IDQA 1A8HA 2RH5A 2YZGA 1E64A 3G7SA 2AG0A 3MT7A 4TKLA 4O2BF 1XWWA 2DTEA 2NM0A 4BNZA 1SUPA 3I12A 1YACA 4D9BA 1SCBA 1M6NA 3KOYA 5EUBA 3ZE7A 2P69A 1SVMA 3W6PA 2J5XA 2O1XA 5J1TB 4UCQA 3UA4A 3JQ6A 5JYCA 3HP4A 3EC7A 4DR4B 1LH0A 2VDQB 2H7VA 1BXZA 2BP7B 2FGJA 1DIOB 1DWPA 1OTXA 3P9QA 6NULA 5K0EA 2OMKA 1Q1BA 3U7HB 5KDDA 3C3BA 4L6CA 1MTOA 3D0RA 4DBZA 1GDDA 2HVGA 1WB5A 2SECE 1SKQA 1OTHA 1GRCA 2VT7A 4FLFA 8GPBA 1UPXA 1CUSA 1MHTA 3CCCA 1LLUA 1TUIA 1AKMA 2H06A 2A94A 4PN3A 3NYQA 4PYQA 4XFJA 5C5EA 2IHZA 3HKEB 4WN9A 4YCBA 3BRCA 4M4SA 4ZOCA 4C9BA 2VHQA 5C5IA 1YU6A 1M0WA 4EKNB 1CRPA 2VP5A 5SZKB 3UJ7A 4XEUA 3ZCXA 4NLEA 1CDOA 1HORA 2JFXA 1TEXA 1N0IA 1L5KA 4E6PA 2ZBUA 1RRVA 3WFZA 4F9GA 4ZIRB 3OA0A 4GQIA 4C2UA 1B74A 4LX8A 4YMIA 3PZBA 4IVPA 4QOEA 1R00A 3AY7A 3COVA 4HDNB 1H0SA 2W2XA 1GD1O 4L4SA 3TFOA 3S8MA 4EPYA 4RIHA 2VSYA 3IS3A 4ZQCB 1MJGM 4JYPA 3D8SA 3O73A 4NS4A 3U39A 3PI6A 4HRAA 3MQFA 1HURA 2DHCA 1J5EB 2DQYA 1XTPA 2JJ2A 5B2EA 1CJUC 1JDVA 1P29A 3MINB 1U63A 1U7OA 4BJHB 3RFUA 1GEEA 1HE8B 1K1EA 2UDPA 3KU4A 3OOWA 4J16C 4J0KA 1VBNA 3HCDA 1R88A 4JN6B 4X84A 5ARDA 3ZQJA 3K2BA 1NR5A 4MS3B 3O9MA 1FXWA 2C1XA 3DT9A 4Q48A 2AEMA 4DRZA 5BNTA 4ARCA 1A9TA 4B3JA 4ETNA 4AUMA 2Z2JA 4BUJA 1HNNA 4RLSA 1T0IA 3ZWQA 4BO5A 3V4OA 2X0JA 2QN2A 4L8WB 3ETGA 4UUPA 5H3HA 1DZIA 4JDPA 2PTQA 2EP7A 1WVMA 3CH6A 3OQIA 2GHRA 4HFMA 1ZGAA 4WK2B 2F2TA 4MI6A 3EW9A 2IX9A 3D2BA 3HV2A 1MNQA 4GP9A 5CR9A 5AP9A 5GONA 3UT0A 3JZDA 3HH8A 2CXPA 4YONB 3L5KA 3O31A 4JI8B 2AMVA 3DQZA 3QGMA 4Z8YA 1N5JA 1Z7WA 2GVNA 4XD7D 4GIBA 3S5UA 5EZ5A 3HKCA 1UBJS 3O93A 5GVRA 2EATA 2YYAA 3WLTA 2AA3A 4WESA 1CX9B 5DTMA 2XVYA 1A5SB 3SXPA 5K2MA 1VL5A 2O7QA 5A5FA 4BO7A 1KY3A 3UWKA 4NHOA 3SD7A 3X44A 2CB0A 3GUCA 2P41A 3DVRX 5JMTA 4X95A 5MGNA 4FM9A 3NJRA 4YQZA 4NBVA 2ZR0A 2H57A 3EXHB 5EKUA 3EGVA 3VH2A 4B73A 1G98A 1T1SA 3ETLA 4R9UC 4B3TB 8MHTA 3F5QA 3W8RA 1X92A 5AW0A 1GRQA 3TXAA 2WSIA 1XQ1A 4N7JA 3GHHA 2R2AA 3AG5A 1L5OA 1BEUB 2I4IA 2O3UA 2QZPA 3OUUA 2XWJI 3QPVA 2IW3A 2BM8A 3DL4A 4JJEA 4I81A 2FA9A 2WR8A 3F97A 4GNKA 4MCJA 3A1SA 2QL7A 2GPAA 5G41A 3TQSA 2F3TA 4JUFA 4FFLA 5JNVA 3M82A 2CVZA 5ITZB 5BR7A 1F8UA 4ETMA 1U5BA 1ZJ5A 2ZBQA 3GA5A 4P3PA 2FFJA 4YR9A 2HWXA 2G8NA 1YRLA 2GJSA 5TARA 4M53A 4OFWA 1SWVA 4HVLA 3MW8A 1VGQA 1NXPA 1YIOA 4BRWA 3A14A 2ZUUA 1E58A 2BR4A 4RD1A 5AM0A 1PSWA 4P2BA 2OWEA 3SJBA 1UXOA 1ZO8A 5FL3A 1XCMA 4EMTA 3U4QA 1M1XB 1DAMA 5T67A 2QGZA 1WPXA 3SLGA 1JIVA 3P0RA 5CGQB 1KMMA 2FLKA 3V6LA 2PUDA 1E3JA 3IEUA 3OCZA 2FWPA 2W58A 3SFZA 1IBMB 2DTXA 4KMRA 5F7XA 4MVJP 2ONCA 4LSGA 3U3RA 1K27A 2QP3A 2RGDA 2YZKA 2Q2OA 1Z0ZA 3N6RA 2YVQA 2FSFA 2KW5A 3JU3A 3WI7A 4EG3A 3RFFA 3L4EA 5IKXA 1FUUA 3SY8A 4B3IA 2ROQA 3FSEA 3DEKA 4OUKX 1C2YA 3CRVA 1L7RA 4OHMA 4QUDA 2XD4A 3WRWA 4H7KA 2H29A 1OOEA 1XN1A 2QJFA 2ZFUA 1RWVA 3DO5A 4BP8A 3G1UA 4Z7QB 4JX9A 3FLEA 4MUMA 5AHOA 5MF6A 2P2NA 2ZT7A 3S1AA 1B0UA 1TLLA 4GBED 2AJCA 3O1LA 3NNSA 4CDGA 1P1KA 3CUUA 4Z1OA 3LYUA 3A06A 4M7OA 1F8YA 1OYOA 2FEPA 2D5IA 2E55A 1OXUA 5FI5A 3U4CA 2RIPA 2AMJA 1VCHA 2QGNA 3ZD6A 1QKKA 1UQUA 1Z6GA 4DDTA 1P1JA 2BWJA 2ZIXB 3CG0A 3CEPB 1UINA 3CF4G 1HYHA 1L9XA 3LT1A 5IDYA 1PV4A 4HNHA 4DZTA 3WLSA 4J75A 5E7QA 1TADA 1CRLA 1ZH8A 4Z4EA 3VO8A 3ND8A 1IY8A 4OBXA 4PAWA 5BYKA 5CH3A 1DOFA 1T9ZA 3LBAA 3A9UA 4TUYF 5H5JA 1DJQA 3TLXA 4C07A 3WNVA 1QHHB 1B42A 4PHGA 2FWRA 3WHIA 4I1YA 3ANLA 3FDFA 3F5FA 4UEKA 1QLJA 3V3TA 2QAIA 1BX3A 4MUGA 4NBUA 2W0SA 5G0TA 5I3ZA 3UKOA 3VUFA 3SC4A 4ZZ0A 1J56A 4UD6A 3V4RA 3P4UA 3D43A 3KJXA 2QYTA 1D0IA 1ZGGA 2O7NA 1XA3A 1AQLA 2XNKA 2Y99A 4MCAA 2REOA 4OTZA 3O9ZA 3GEDA 2WFLB 1LBEA 3UUWA 3MGBA 5LXTB 2NO5A 4J0JA 4JLNA 2OV1A 1M6VA 3IR6A 5JANA 4L57A 3E2MA 1TF5A 2Q99A 3VH1A 2VPPA 2Z6QA 5HF6A 1EIZA 1ECCA 4M87A 3TKLA 4ZIRA 3LHKA 3SP1A 4EKYA 2J9XB 3FNQA 1KAMA 2QZ4A 1U0OC 2PLRA 3B6MA 2PQMA 3H86A 3DMHA 5SYMA 3BK7A 4PHTA 4JEHA 1LVHA 3AHEA 2PD6A 2J85A 4I99A 2IHUA 2QW0X 1AQ6A 1FOEB 1Q57A 3E61A 3GVCA 5BXQC 2VBCA 5C0OE 1N6RA 2Y05A 4KXNA 5FD8A 2H1IA 2IXTA 1NQUA 1K4KA 2R25B 2R1UA 3JASB 4KYUA 1M1ZA 4CLRA 2XDYA 4KITB 3V1KA 3HYTA 5K6RA 1JG1A 3R3VA 2Q5HA 2W11A 1N3LA 2RAFA 4LX0A 1PVOA 5IX8A 4G09A 2OTCA 3FYSA 2QBYA 4MKHA 1QDEA 4EEXA 1EM8A 3HDJA 3RHFA 2A84A 2WNSA 1X8XA 3PA8A 3EXIA 2HKIA 2IEGA 1SBCA 2FVYA 1ENOA 3GDWA 1M72A 1CEQA 1V4BA 2VO1A 1JLHA 3ZNOA 3WDLA 4U2EA 3C3AA 3KQMA 2IRWA 3ZZNA 2LDXA 5EIXA 1Z0KA 2MSEB 1P4RA 4HG2A 1X9HA 4L6IA 4NJOA 2AK2A 4C5AA 1SCNE 3IP1A 5DHTA 4BP9A 1GTRA 3C5HA 5FBLB 2HO5A 3QLJA 1P2BA 2PMCA 5B57C 4RK4A 4CM9D 2GCEA 3SR3A 5H81A 3OX4A 1LSJA 1ZD5A 2O3TA 4PX3A 2XV1A 2E21A 3LZ6A 3V4PB 2BEKA 5JWHA 4LXQA 1CTQA 1U1DA 4N5IX 1JILA 5HQ3A 3INYA 4EI7A 1YZHA 1VXOA 1NWHA 1RQRA 1DC7A 1XB2A 2FR8C 4NZOA 4B7XA 5HYVA 4EJ2A 3ZX4A 3H2GA 5AQ1A 2BMWA 3C2QA 4N0MA 1KARA 1ODKA 1G66A 1UC5B 3I4FA 1OFUA 1LX7A 2XCUA 4GYWA 4V0KA 4XLZA 3GLFE 4ND5A 1K6XA 1CT9A 1EWKA 4KH0A 3ADBA 2VC2B 3NWBA 1VL6A 4E5KA 4DLLA 4CQMD 3Q3IA 1T8SA 1VPTA 3NWPA 4EPWA 1Y1QA 5LYJF 1X9GA 3DCYA 3RC3A 4PRYA 3DOUA 4NFHA 4PWZA 3DPUA 1J49A 3DDUA 3HB4X 1LBQA 4Y2GA 1X3LA 2ABWA 3MYRA 2UAGA 4KVFA 1FLDA 4A8JB 1N33B 3K6SB 3DD1A 1YXMA 3LK7A 3L8MA 4JSYA 4TLMB 3TTXA 2OZLB 1HYEA 5I7EA 1KSHA 1IM8A 1XD9A 2HRQA 3QK7A 3ZQ6A 1IUKA 5EE3A 1XDGA 2DY1A 4G0NA 3WLOA 4BX2A 1B6TA 1Z22A 4FC6A 4XM0A 4A0GA 4LDQA 3N0VA 4HQRA 3OPYI 1KI7A 4HDKA 3JQBC 2P9ZA 4O2BA 5JT1A 1V8ZA 2BGUA 7MHTA 4NENB 1JH8A 2I62A 3ESRA 3CBQA 3H4TA 5LQKA 5FDFA 3UW3A 3FYUA 3NHLA 2UUAB 3NPAA 3ZIAD 1T34A 3R0ZA 3RS8A 2JGFA 3CUSA 2R6AA 3PUWA 4FMDB 4O33A 4YP7A 2F43B 3D3QA 5FNVF 1O96B 1OA1A 3II6X 5G4LA 2PRZA 2FCAA 4MW4A 1AZWA 3U16A 3FNHA 4Q39A 2BE9A 2NW6A 3A6JA 3V8VA 3KR0A 1PR9A 4J3JA 4WV3A 1GGEA 3RVKA 3TNYA 1U9ZA 4HLDA 1KO8A 1DWUA 1G7CA 1V4NA 3SC6A 4A2CA 4HX2A 3EEBA 3CC8A 5KQRA 4IRUB 1XJWA 2OBXA 2QX9A 4Q3KA 3WLEA 1EQAA 4P3KA 5ALDA 1U98A 4R05A 5IEBA 1ZVQA 3CTPA 2PKCA 3E8SA 3ET5A 4IRMA 3RRBA 3SZRA 3X1ZA 3U80A 2ZSDA 3MRSA 2SHKA 2XA2A 2Y1LA 4BNJA 5EIWA 1LBSA 1KS9A 2POQX 3OQVA 3ORYA 2DSTA 2PT9A 5K3OA 4Y2JA 4B9EA 4LXUA 1SQ6A 4PAGA 1Z0UA 4FZ5A 2NTYC 1W2HA 1EEXB 4V24A 4E5VA 4F3RA 3BD7A 3D02A 4JXZA 4YCDA 2XEXA 4H1HA 2B35A 1SD5A 2XB9A 5CT6A 2ZUSA 2MR5A 1CVLA 1IHUA 4PPQA 3LC1O 2GUWA 4JVOA 4A0QA 4EB8A 5C7OO 3PDIB 1TMGE 5DNYB 4C04A 1L1RA 3E5HA 2FSUA 3B60A 3CLUD 3GJ7A 2B2CA 4X45A 1I1QB 1DC8A 1PGNA 2FVXA 3QEJA 3RG2A 5BUSA 3AZOA 3QVOA 3RT9A 1S6YA 2DUUA 1V47A 1LW6E 3KZXA 1UADA 2NYUA 3BREA 1FUPA 1NYRA 2QAGC 2ZJ4A 4HLUA 3QEMB 3ZVNA 3M6MD 1ZQ9A 3FR8A 3TM5A 1YVPA 4IJWA 5JDIA 5F23A 5CG2A 1C9NA 4E1AA 1TKBA 3F7MA 3L6DA 2X7JA 4E21A 1J8YF 1VE1A 5J1SB 2LGJA 3TQRA 2DBYA 1IOWA 1BHSA 1XTUA 3KHSA 4M9ZA 5I9MA 3E70C 5AVOA 1WCWA 2XCIA 1B3BA 2XT0A 3Q9LA 3T3GA 3IIJA 1JSZA 1UDBA 2VHXA 1NY5A 3DPIA 3KFXA 5B12A 4BMXA 4BVAA 2D00A 5FEUA 2VVTA 5KINB 1I2AA 3RWOA 3KOZA 4MSUA 3KSRA 3MIZA 4I8DA 2QTCA 3NBZC 3U0BA 1E0KA 1DB3A 3AIKA 3K8YA 3USZA 1F2VA 2C04A 4B79A 2P5YA 1PJRA 2TS1A 4HWGA 4AZ0A 4E5NA 2QZZA 2IPLA 2Q3CA 4HH3C 4KACA 3E04A 3K05A 2C84A 4MIOA 4L4RA 5KNDD 3OLVA 5C34B 3BXPA 1JU9A 1JRLA 1NFFA 1ZCAA 3A3OA 1HG0A 3FWNA 3WK7A 4MA4A 1A2QA 3H5OA 4H0CA 4IGKA 5T8KA 1YAJA 3ABOB 1TYDE 5WRFA 3TLGB 1MMFB 1R16A 2VLBA 2G07A 4AZ0B 1T3GA 2R84A 5AJZA 3UMBA 3SHTA 5CX1A 4IHAA 1DZ3A 1QWOA 1DUSA 1UC9A 2GD0A 3MTIA 2HSJA 2JLXA 1T2AA 3HU3A 2IYYA 1A8IA 1Y3AA 4XWKA 4BNUA 4YT5A 4ZAFA 1F12A 1VOTA 4DNPA 5HMMA 2R11A 4WFQA 4X6UA 1W0KD 4XIIA 3NWOA 1F0NA 3ILVA 4HYTA 3ZV7A 1E2MA 4MWZA 3HEBA 4G0ZA 2HPZA 5L3RA 4Q4LA 2Q2WA 3ED5A 4I5DA 4X1OA 3WO1A 2HX1A 3WIDA 1N8NA 1LSUA 4RQTA 3KFLA 3USES 4LXGA 2A9OA 1DARA 1D4FA 1GP2A 3K1AB 4E5PA 2PBZA 4JLPA 2IU0A 3OZWA 3B70A 3LXRA 4MHSA 2F59A 5LL6P 2Q6TA 4REQB 2VEDA 3N58A 4XDGA 2JLYA 3ISTA 3KD3A 4XB6B 1JPJA 2QI9F 3W3AH 1JGTA 5F9MA 4Y98A 1M1UA 5L3QA 2HUNA 3EBLA 4O8CA 2X3FA 4NMMA 3RI3A 3QW4B 2H2FA 1XF9A 5A0FA 3SMQA 4OXQA 4LNAA 2V55B 4BVFA 5FORA 3ZKAA 4EMSA 2WTAA 2ODEA 3H9QA 4I50A 3ZWKA 5KSPA 3AERA 2PSEA 2JFBA 4MARA 4V03A 1H0HA 3ES9A 2QJOA 4QTZA 3H0EA 3OSZA 1LK0A 2FMTA 3U49A 4RF4A 1KI6B 2A3NA 3TM4A 5EWLB 2GA9A 2GTPA 1TF2A 2EZ9A 4QODA 4M0PA 2VNJA 2NU8A 2AI3A 1MB0A 2Z8ZA 3LWNA 1D2EA 2P1RA 5CHYA 5BW8A 4OHCA 5BWOA 2TYSB 1D09A 3QWIA 3RFVA 4EHBA 2HK7A 2ZAGA 3C3DA 4K1LA 1PJZA 2ZR9A 4OHKA 4F04A 1U6JA 4M83A 4CMEA 2PTSA 4MQ4A 3PYMA 1TW3A 4TWRA 4O25A 1FYWA 3THWA 1IULA 3LGXA 4RZHA 5AUPB 1J97A 4IIFA 4Y9SA 5DASA 3R0IA 4I66A 5CB4F 3TGPA 1D8AA 2XKKA 1ZH6A 1EYZA 2G1UA 1QDLB 1JPVA 1S9DA 3FM9A 4PYIA 3H8JA 5ITZA 2B92A 2AKAB 1XQWA 2VNKA 1H8HA 3LX6A 1QHSA 1SC6A 1KAEA 1W4BA 1XAGA 3CO5A 3D7RA 4D4KA 5GQSA 3NCTA 4LMAA 3UXYA 1GZ3A 2A9KA 3DLCA 4FW9A 4K9KA 2W8BB 3ORSA 4GPTA 4RVNA 5CNMA 5D3MA 1K6MA 1PYDA 2YJZA 5MGBA 4D5GA 3DZJA 3M9LA 1V9SA 1UMDB 1B8PA 1O96A 4HWSA 3PEEA 2JAHA 4U2GA 3GT7A 2PU5A 4JBNA 2FEWB 3WA7A 1Y5RA 2D6FA 3D6TB 3JYHA 1PEAA 4FCCA 5L4NA 1ZW6A 3LQ4A 3WB0A 1ULTA 1PE0A 2C00A 2OKGA 3SXUB 3U5TA 3HBNA 2H54A 3LOPA 1XMIA 3URMA 4R8KA 4MYTA 1GG9A 1N57A 2R7AA 1QHGA 1BVRA 4TPKA 5HFAA 2CLEB 5JQGF 1OB2A 5G4KA 1M1NB 3AVVA 4P32A 4MP6A 1U0NA 4R2LA 1X6VA 3IUPA 1IBCA 2I99A 1EUDB 1G64A 1XVIA 3HCRA 3K32A 1O7JA 4KSYA 4BQSA 1U3WA 3WYCA 4D1YA 1WQ4A 2ZETA 4YCCA 2BISA 4UNRA 4DUZB 2GK3A 2GEFA 2RGEA 3KQVA 4N8SA 1LPMA 1P5HA 2Z5VA 4QHTA 3ZUGA 3LKBA 4US1R 5EUMA 1OASA 5BSKA 3ZHSA 3EJWA 2AZ4A 2ZBPA 1GRVA 1Q3HA 1RLTA 1Q3TA 1Q44A 2NG1A 1UIRA 2RHTA 2RGWA 1Z3CA 3DDSA 3P45A 1L5HB 3EGXB 3WYEA 5KQMA 4CE6A 5KU1A 2Y0BA 5EEHA 4B33A 4WOJA 3WYGA 1H2FA 1G5PA 4DIDA 4HUTA 3BMQA 3QVJA 4JLVA 4H1UA 2DG2A 2B82A 2OSBA 1Q2UA 3HM9A 1JLMA 4GLBA 2I6TA 1KYTA 1QV9A 4AJ1A 4RC9A 2HJ9A 3FMVA 5K0NA 3VKGA 1LPSA 3O2QB 4UTXA 1NVVR 3JQEA 1JVBA 4EL5A 2OCXA 1D6JA 2W4IA 4QOFA 1Z5UA 3O4VA 3BERA 1VL0A 4ROTA 4TMZA 2OLJA 3OO0A 1YOBA 5BR4A 1WM1A 4OJQA 4PC7A 2WJYA 4A23A 1DKNA 4CTNA 1QVVA 3C6YA 5DEIA 1K86A 2AJTA 4W1SA 3RVOA 1RE1A 3E35A 3UV3A 4QT4A 3FTPA 4EW2A 1T9AA 2WP0A 3GCXA 3OY2A 4U7WA 3VRHA 1MA3A 4R6WA 4F9EA 1L8XA 1TZMA 2IPXA 4G07A 4Y2VA 3UT5B 2D62A 5CX4A 5A6VA 2O19A 4G0YA 3ZWDA 1TE2A 3KJGA 3WK8A 5JAUA 4AZ3B 1FTWA 3PHGA 4FDMA 1THZA 1V11B 1S2GA 1Y5NA 2WVJA 5LBIA 1T8WA 2W70A 3RS9A 3MTQA 6ADHA 4Q9DA 3WGHA 1HYQA 4MIKA 4AP6A 1Z68A 1H1TA 2QX7A 3ESCA 4JL6A 1V6CA 3RYIA 5I3CA 1AUXA 4MW5A 2Q3JA 4LJKA 4YJHB 1Z2NX 4YO7A 3OZGA 1QS0A 3FWZA 3PRYA 4FILA 5CNJA 5JSFA 4CEIA 4B47A 3AIOA 1YZFA 3NZEA 4Q4JA 2V97A 3MZ0A 3VDQA 1PNQA 2AEFA 4UHKA 1ZD2P 5DBFA 4TKZA 1EGMB 1N3YA 2C82A 2WJ6A 5A7GA 2BONA 4BU1A 2I91A 3F6EX 4PNPA 3U4MA 1IVNA 1UCFA 1C3CA 3PQEA 4UM5A 4IYJA 3DBVO 3ORQA 1EK2A 1GPAA 2CHUA 3PUZA 4NDAA 3CH4B 1JKXA 4IGFA 1EG2A 4Q9AA 3P0FA 2PT6A 4GOKA 3X1DA 5ADVA 4PS1A 5CX1B 1QIKA 1ZIOA 1BH2A 3ROKA 4TYWA 3KUKA 1M1YE 4DA0A 2GBPA 4FOPA 3AEKA 4JR1A 2P90A 4CKYA 5CCXA 2QENA 4H4CA 3IHLA 4FLEA 3WJ2A 5A02A 2CNKA 4C1BA 1WUHS 5J5CA 2FX3A 4TXJA 3RB8A 2BHRA 2XWSA 1PN3A 2O8VA 3M9XA 1UL1X 1ZG3A 1HOXA 3NV9A 4DEYA 1PNOA 3ESZA 1RQGA 1R27A 3P9IA 5DI9A 4FEYA 4E14A 4HK4A 3GIWA 1W36D 1PK9A 2FPWA 2QL6A 4EO9A 2ENWA 4QGBA 3M6VA 5IN5A 4RHEA 3FXAA 4PGAA 1XLUA 4KPUB 3G1WA 2CCGA 1BEZA 1SUCA 1SU7A 1N7HA 2C4TA 1LW7A 1XKLA 2DCUA 2HOQA 2Q4EA 3BB4A 3I1YA 3DBRA 3IH5A 1GJRA 2NXEA 1Y3IA 2IYZA 2CN1A 2CF5A 3LUPA 5HIMA 4AG6A 4X71A 5F7OA 3OC0A 4LA4A 3LF1A 4MZXA 3BD6A