1Z4JA

Structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with uridine 2'-monophosphate
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
194
structure length
194
Chain Sequence
b'RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase
publication title Structural basis for substrate specificity of the human mitochondrial deoxyribonucleotidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 63
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1z4jA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4jA01
2WF8A 4EENA 3CZ4A 5AKJA 3OCZA 3E58A 1Z4QA 3N28A 3FM9A 4H1WA 4O8CA 5ALZA 4EX7A 2QLTA 3NANA 3PGVA 4C4RA 2FEAA 3AR3A 2YJ3A 3OCYA 3OTQA 4Y2YA 1U7OA 3ZWKA 2B1RA 3SLRA 1NRWA 2FI1A 2MU1A 2D2VA 3EF1A 3OCVA 2C9MA 1U02A 2W11A 4BEVA 5AI0A 1ZOLA 3DAOA 1Z4JA 2WF7A 1U2TA 3FVVA 1IWOA 2AMYA 5AW5A 1ZRMA 3HLTA 5AM0A 3SD7A 1RRCA 2FUCA 4I9FA 3SKYA 4HGQA 1RMTA 3WK9A 5FP0A 1XP5A 2CFSA 3OPXA 5ALRA 1Z4PX 1ZD4A 4GXTA 1TA0A 2RB5A 2YMLA 3U7FB 3CNHA 2R8YA 4YIKA 1RMYA 4IG4A 3ZVLA 5AI9A 1ZRNA 3PGLA 5AW0A 3ZVMA 2Q5EA 4YH1A 5AKHA 1TE2A 1RLMA 5AVTA 4DW8A 1VFPA 3I1YA 4DFDA 5AESA 2O2XA 4UMVA 2I54A 3KC2A 4HGPA 5IT4A 3D6JA 2HO4A 2OYCA 5AI8A 4UM7A 2VKQA 1YMQA 3QU7A 2HOQA 4CF5A 3MC1A 2WF9A 1XPJA 2YMPA 3DNPA 2IOHA 1RKQA 5ALIA 5AVVA 2B1QA 3QU4A 5AKGA 2G0AA 5AVQA 4Y2XA 3RF6A 4AS2A 4RESA 2HCFA 1Z4MA 3OCUA 2FPWA 2G09A 3ESQA 3MPOA 3OCWA 4OHFA 3ESRA 3FGOA 5ALWA 3UMGA 3ZVNA 2CFTA 4UW9A 4C4TA 2YY6A 5AK3A 4NFLA 3QU5A 3WKEA 4FYPA 1J8DA 2HF2A 3ET4A 4OFZA 3AR5A 1RC8A 3ONNA 1YDFA 4FE3A 1TJ5A 5AK6A 2WF6A 5AM3A 3A1EA 1EK2A 1Q92A 1Z5GA 4HAIA 5E0OA 2JAWA 2B8JA 4BKMA 3W5CA 1L8OA 5ALMA 2AH5A 3WKAA 5AM5A 2OM6A 1QQ7A 2P11A 5IT0A 4J03A 1RQNA 1TJ4A 4L6AA 2NO5A 5AW4A 5AKKA 5ALQA 4HGOA 3GYGA 3P96A 3B8EA 5ALLA 1T5TA 4DWOA 4HGNA 4CE6A 3FPBA 3ZI4A 3EPRA 1S2OA 2QYHA 1YJ5A 3WK6A 5AVUA 3QU9A 3IRUA 5AHXA 3DDHA 4YIHA 2Q4RA 3NIWA 5A3RA 5AKEA 1O03A 5AM4A 3AR4A 4UMEA 1QQ6A 4G9BA 3E8MA 2YMQA 5JJBA 1ZJJA 3QU2A 2YFYA 2YJ6A 3QUQA 2YJ5A 2RARA 3N07A 2FPSA 4NAVA 4UAVA 5AKXA 4B6JA 1L8LA 3B9RA 4UASA 3U7HB 2ZXEA 2GMWA 3S6JA 2C8LA 5AKLA 2PR7A 2JAUA 3IJ5A 3L8GA 3OCXA 2JAOA 1L7MA 2I34A 2EARA 4UU1A 5IS2A 2Q4TA 3ZWDA 5AVYA 5ALTA 3PCTA 3N5KA 4UATA 1SU4A 2YN4A 3AR2A 2JARA 3L1VA 1O08A 2G06A 4I9GA 5ALYA 2X4DA 2P69A 1CR6A 3FZQA 3U7EB 1KYTA 3I76A 4HGRA 1CQZA 3J7TA 5ALGA 5AK4A 1LTQA 4EEKA 4ZEVA 2FDRA 5ALOA 2YBDA 4BNDB 2B82A 2HDOA 2FPXA 5AIBA 4ZEXA 3WK4A 5ALHA 2G07A 3E81A 2G08A 1RQLA 1YV9A 1T9ZA 3ZTWA 1RKUA 2AUTA 1ZD5A 1RLOA 2PQ0A 5A3QA 1VJRA 3PDWA 1EK1A 2HSZA 4Y2VA 2B8EA 3A1DA 3SHQA 4F71A 4CF3A 4QJBA 5AVWA 4G63A 4KX5A 3AR8A 2W4MA 3QUCA 1ZD3A 3WKBA 4BX0A 4YGYA 4Y2SA 3B9BA 3EF0A 3KDPA 2ZBDA 2GO7A 3DV9A 3A3YA 4UAUA 3R9KA 2C88A 3ZU6A 2YMMA 2BDUA 1NNLA 4Y2RA 2I7DA 1ZS9A 1Z5UA 2WHEA 3QLEA 3HYCA 3K1ZA 1SWWA 1Z4KA 2R8ZA 4GIBA 3WKDA 4XQ0A 3ZW7A 3M9LA 4CNQA 3UMBA 1LVHA 4BYGA 2FPUA 3F9RA 2G1AA 3M1YA 2O9JA 4KNWA 3SKXA 1F5SA 2HX1A 4AP9A 5AKZA 5AK5A 3W5DA 5ALNA 2AGVA 3VAYA 1N9KA 4RETA 3FPSA 4Y2UA 2IOFA 2R8XA 4EX6A 5AW1A 3NRJA 3AR6A 5AICA 2ZBFA 4XOUA 1MH9A 1YNSA 4BNDA 2I55A 1Z4LA 2DQSA 5AW3A 1Z4NA 3NAMA 2OA0A 3ZTYA 3KOOA 1VJ5A 1WR8A 4EELA 1RKVA 3U26A 5AKIA 2GFHA 4F72A 4J2TA 4Y2JA 5AVZA 1FEZA 1K1EA 3QGMA 2FPRA 3ED5A 4HYTA 5AI5A 2CFRA 1WPGA 2IOFK 4EZEA 4L57A 2GHQA 2ZOSA 3ZUPA 3U7GA 1X42A 1Z88A 4NWIA 5AM2A 4YCNA 1U2SA 5ALFA 3EWIA 5AIAA 3L0CA 3L0BA 4MUMA 4XE5A 3W5BA 5ALKA 3IB6A 2P9JA 4UU0A 4UMFA 3L7YA 3L8HA 4UARA 3L8EA 3QXGA 3N1UA 2MSNA 3L1UA 3L8FA 5AI4A 3QUTA 3W5AA 1Y8AA 3L0YA 5ALEA 3U13A 1QQ5A 3UM9A 3QUBA 1TJ3A 3MN1A 3AR9A 4E88A 2ZBGA 3NALA 4FFDA 1ZD2P 2CN1A 2PKEA 4NABA 5AW6A 2NO4A 2RAVA 4UM5A 4AS3A 5ALVA 1U7PA 2W43A 5T41A 3BWVA 2FUEA 3QYPA 4Y2TA 4YCLA 4CF4A 4L6CA 2ZBEA 5AW9A 3WK8A 4NV0A 5AW2A 3R4CA 3N8GA 4BX3A 4Y2QA 2BDEA 3SF0A 2JGAA 4KX3A 2YJ4A 2ZG6A 3WK7A 4OCZA 2EATA 4BX2A 4UMDA 3KZXA 4IFTA 3TLMA 4BEWA 4XPZA 3KD3A 3QNMA 1Q91A 3R09A 3RFUA 2B30A 3L5KA 4ZEWA 1L6RA 3AR7A 4Y3UA 4JDPA 3NASA 1RDFA 1WZCA 2WFAA 1Z4IA 5ALDA 5AVXA 5ALSA 1SWVA 5AM1A 3BA6A 3ZX5A 4Y2PA 3ET5A 4KYTA 2R8EA 2WF5A 3QX7A 1Z4OA 1NF2A 3WK5A 4PNHA 1AQ6A 5ALPA 3UMCA 2OBBA 1WVIA 5ALJA 3KBBA 2WM8A 3WKCA 5AVSA 3SMVA 2I6XA 4KN8A 1J97A 1N8NA 2IA5A 5A3SA 5AVRA 1JUDA 4JB3A 2C4NA 3I6BA 3NUQA 4MWOA 2G80A 5AI6A 3A1CA 1QYIA 2ODAA 2C8KA 1S8OA 2GHTA 2HF7A 1L7OA 1PW5A 3E84A 2P27A 4C4SA 4QQFA 1L7NA 1YS9A 2I33A 2HI0A 1QH9A 3ZX4A 1L7PA 4YCMA 5AW8A 5ALXA 4OD0A 2HHLA 2EAUA 2RBKA 4KNVA 4BBJA 3MMZA 1T5SA 2IYEA 2B0CA 3WGUA 5ALUA 3WGVA 2NYVA 4DCCA 1XVIA 2BY4A 1RLTA 5AW7A 1RMQA 3U19A 1RPZA 2HEGA 3I28A 5AKYA
chains in the Genus database with same CATH superfamily
2NP7A 1HE4A 3PUVA 3K9FC 1VYHA 1WAMA 1FS6A 3O75A 4O33A 3TGPA 3OCZA 4KDEA 2RGGA 4GL2A 1WU8A 2C2KA 4PC1A 4CEIA 4BQFA 1Q6ZA 5A06A 3GFRA 1OXKB 5HS4A 4HEQA 3B13B 3H5OA 4JNCA 4XZ3A 5JAUA 4HRYA 3B70A 4ND3A 2ZRLA 1NBIA 3ZJVA 5LZ2A 1NL3A 4JI4B 4O8CA 5D6OA 3KSAC 3T3IA 5GY7A 2JVJA 4LZOA 2HSEA 821PA 1MW9X 5SY6A 2COUA 3JR7A 4ZRNA 3MLAA 4DQDA 1G4HA 3LSTA 3T4XA 1L8AA 4Q9AA 4ZRMA 1DKNA 4B1FA 2OKCA 1LF5A 2Z04A 2Z2ZA 1AGXA 1FDOA 3ETEA 4QHSA 4UULA 3TQTA 3TTYA 3VZBA 4OX9B 3ABQB 3EXFB 3OMXA 4D02A 5EPOA 2B7CA 1A9XB 1Q0HA 1SXJA 3BWEA 3FKQA 2O2EA 1U5BB 3DDCA 4R9RA 4IIFA 2GBLA 1DOFA 1KDRA 1ZU5A 4JL6A 3UK7A 5K3SA 1J8FA 4OHVA 3UQYS 4BEVA 4EK9A 1AKVA 4AULA 2F8SA 1N5KA 1IOLA 1ZKDA 1IWOA 5DFAA 4E1VA 4AI6A 1OFTA 1TYAE 1N8TA 2V7TA 4P5PA 2ATEA 1U0RA 1NNSA 4TUYA 5JE8A 2ONCA 1GWNA 4FILA 1KJNA 5IM4A 5TGTA 2AQKA 2ZIXA 5KTTA 4UJ5A 1CRWG 1W6RA 4HDMA 5J59A 4ZYZA 5L7YA 2WB4A 4Q4LA 4NHEA 3V2IA 1Q6YA 2IYAA 1R4NA 2RB5A 3B1VA 2ZAOA 1J3UA 1GVNB 1KYZA 3EBOA 3K15A 1ODIA 4GS5A 4HVAA 5C51B 3PDJA 3Q9SA 5D3QA 1ZGJA 3KR1A 4G8CA 5AWFC 2IEYA 2PWAA 3DZCA 2WJHA 4KN9S 5FXMA 5DT9A 1YE5A 1MX9A 1STOA 1UKZA 5BV2P 1NQWA 1QH8A 3QZUA 1QYWA 4ZCIA 1X38A 1QCDA 1FA9A 4BZZA 4L7VA 3K4QA 1R5NA 2KLHA 3K4PA 4ACAA 4E2XA 2J3DA 1UWVA 1OI7A 2XBMA 2IK8A 4DW8A 3DBVO 3ROXA 2AIRA 3SWWA 1E7WA 3UPDA 4LGMA 1DNPA 3L5OA 4KQ2A 4U6SA 2X13A 3NYQA 4TM8A 2KQUA 2ZRIA 1FCJA 3D3JA 1YJXA 3AUXA 1FS4A 5JU6A 1KZYC 2FW7A 2G28A 2QUBA 1CE8A 5EHZA 2WJIA 3DVRX 4ZT5A 3WYDA 4CNBA 2JI4A 4B3JA 2G5CA 1XPJA 2HJ9A 1E7SA 2OYSA 3DNPA 1AA9A 4TRMA 3TF5A 1SR8A 3WBKA 1WBDA 1MTZA 5D51S 1TM3E 3SQXA 5FL7A 2A33A 3GA0A 1XVTA 3PIDA 3Q3CA 1DXHA 1VMAA 1H23A 4TLAA 5I3ZA 4NC9A 4DG8A 4DXAA 3QMMA 1DRJA 1FYWA 2MTBA 1VE7A 2XDYA 3HU1A 5JY6A 4CMGA 3C3YA 2CC2A 4KVZA 4LWQA 4WCFC 1WP4A 2HH9A 2GM9A 3CVUA 2VH5R 4OHFA 4PZZA 2YHUA 2A5FA 3ENZA 3BDAA 3A7DA 4F2DA 1T5BA 4CETA 5GM2A 1FP6A 2PEZA 2AVDA 3R0IA 4O4LF 5GWXA 4UW9A 4B0PA 4C7VA 4V1CB 2X40A 5KREA 4G86A 4MPTA 2ZIEA 2OCGA 1F0PA 4ZQBA 3RTCA 4Z7JA 3EVTA 4DRZA 4JS0A 2CCGA 3FKSD 1RPJA 1P2SA 1J8DA 1TJYA 1U9ZA 1CBUA 2A88A 3OFVA 5KHAA 3ZV5A 2FZCA 1U0HC 2FGKA 1B15A 3RK0A 3VTAA 4B9AA 1SULA 4EA8A 5HDQA 2I7CA 3WGJA 1X77A 2H18A 4HNVA 3E3MA 4CV1A 4W9MC 5E4JA 2FV8A 2X2OA 3SJUA 4CCYA 4EW3A 1ABFA 3N5CA 2PWYA 5KHOC 4BXOA 4AWAA 3BHNA 3EZ7A 4X94A 3ZE0B 1EDOA 1L3BA 1NONA 2Y1FA 1BJTA 5GOTA 3HUDA 2BUCA 2P30A 3UJAA 1P31A 4NBRA 1XTIA 2ANBA 2QRMA 4IH4A 4JBYA 4M0UA 4X3PA 5EUCA 3TZ6A 4L6AA 4YRLA 2H54A 3AH8A 5KTOA 4ZDWA 4N76A 4NBUA 1F8FA 3IO3A 4HGOA 3FKJA 5JLAA 1EHIA 2JBHA 3GLGA 1Q11A 3PX3A 3LH5A 3PX2A 4M8SA 4DM7A 1Z5ZA 4DWOA 1NJGA 3W1EA 2QQ0A 2VZ9A 2HRCA 2H5EA 1E2UA 2I2XB 5BSTA 3T95A 2OCXA 2GK7A 4O2BB 3CW8X 3I1FA 4Q12A 2P75A 1C4KA 1G8MA 3IOCA 4DOMA 2IH2A 3VOTA 3O0TA 4FFMA 2JFPA 3ZHQA 1QCZA 1ZSYA 2I78A 2ZYWX 4TV9F 4B2LA 4C01A 4CL0A 2OZLA 2WWHA 1Q95A 1R0ZA 1SBYA 4GQBA 3P9YA 1L5VA 2RAUA 4YACA 5ENVA 4D57A 4EY7A 5AXDA 1SN7A 2FQWA 5BMOA 1SM4A 1HSOA 4P6VF 1NBMA 5TF0A 2HU8A 2EFHB 2IV3A 4WXHA 3EJWA 4HQFA 1A8HA 3QKSA 1AHNA 3RYHA 5HZKA 1N6HA 4LCJA 2VSFA 3GNSA 4PQRA 4A16A 1IH8A 2CBXA 3LECA 5MHTA 3D0RA 1BU8A 3NT4A 2BELA 3DBOB 1JMKC 3OKCA 1U4SA 4UJ3A 5LYJF 4QIHA 2C4KA 4CZ2A 1U4NA 5K4GA 2HYIC 5ICCA 5EIEA 2FF7A 1XEWY 2BSXA 4PPGA 1E6WA 2A2ZA 4UDNA 1LLDA 1RZVA 1C9MA 2P1RA 4MQFA 3AHCA 4O3FA 1U1CA 1VIAA 3NYWA 2NYRA 1FNBA 2AN4A 4M0FA 2BLLA 4HYYA 1RE0A 1W2HA 3IE0A 4RUKA 4AZWA 4GOKA 5J40A 3ECSA 4MP6A 1G20B 3FWKA 5FUXA 5MN6A 1ZW6A 3RLFA 2IDKA 3PCTA 421PA 2ZRHA 3G2QA 3DFUA 1SKYE 3UBMA 2H1RA 2OXRA 2PMWB 2BM9A 1TQDA 3L1KA 3UUWA 2PTQA 1QO9A 1QC5A 2ZAYA 5TRTA 1UFRA 5E6RB 2Q50A 3D4NA 1L5OA 1VPLA 3X1KA 5IS2A 1PVOA 3SLKA 3D81A 2YZGA 2D7CA 1P4JA 3ZGXA 3I76A 3TW8B 3W5JA 4RD1A 2X58A 3PT5A 3TLCA 3GTDA 1YZVA 2ODWA 4FYWA 2GN9A 1EUZA 5CPBA 1YFMA 3C16C 3RRBA 2PBFA 1DIRA 3EGDA 5ALHA 1G7SA 3AI7A 5F7JA 4M88A 4BVKA 3N7UA 5HWSA 1XWFA 2IGTA 4HDQB 1NBEA 3KHKA 2NN3C 1ZD5A 5AHOA 3ILHA 4ENUA 6LDHA 4HXGA 3NIDB 3IXLA 1NI5A 3SOZA 3E22B 4RTQA 1XZNA 3DL0A 1AQUA 3SHQA 1J20A 3JQ6A 1WX1A 4EUNA 3ZJTA 4GX0A 3IBSA 3FN4A 1T4DA 3IIKA 4LOHA 3TO5A 2B34A 4AUNA 4BX0A 1XD8A 3GPCA 3F98A 5DNEA 3DMYA 4C7KA 3U5TA 3IUBA 3ZV3A 2GARA 2Q07A 4IDAA 1A04A 3NTQA 4OFBA 3QITA 5CURA 5KKCA 4TQUS 3O5AA 4CMIA 2IHKA 3EH1A 5MF6A 4I5EA 2IW1A 3F49S 1Z2DA 1TLTA 3B1KA 2XVMA 3VAAA 4XUGB 4BB9A 2ADOA 1MVOA 2I7DA 1KERA 1KYVA 2XUJA 3EC1A 3SF8A 5KCZA 5DM4A 1P17A 3BK7A 2CV2A 1AQLA 3FETA 5I3CA 4M36A 1DEOA 5DW3A 4PGMA 1E7YA 4DWWA 1OX6A 4QTZA 1R9MA 2O3TA 3ABOB 4M6WB 3R6TA 3KQQA 3DXYA 4BNZA 2R4TA 4LSMA 2PU7A 1NULA 1BRTA 3G17A 2R8ZA 5HRUA 1S2LA 1W5EA 4J7CA 4P22A 1YC5A 1YAHA 3I23A 2E89A 2Y76A 4XQ0A 2Y1OA 1XTPA 5IZ4A 4NJEB 1NF9A 1CJBA 1BOFA 3I3SR 5DH9A 1E9DA 4C76A 4EO4A 3G7UA 4JJ7A 3VMMA 1KSHA 3CLUD 3MUNA 3F67A 2WUDA 3Q85A 3ZW8A 3QPCA 2OQ2A 2Q6OA 3E03A 3KT8A 4F1KA 1R18A 1Y1KE 1C3CA 2VAMA 4R0NA 5A5FA 3OX2A 4D80A 4G0WA 1PX2A 2ZZNA 3AOEC 1OA0A 5G0SA 4IMIB 3V9AA 1VE3A 2P2NA 4NBLA 5TJHA 3ZDDA 5JAQA 3S55A 4Q4DA 3A1FA 4H6WA 4FCCA 3RVKA 5JLJA 2IVZA 2X14A 2CYBA 3DMPA 3PRHA 1WUKS 4YDRA 1WG8A 1JSWA 5KVVA 3LPDA 4IXDA 1E2HA 1IWBB 5F7OA 1XEAA 2RKBA 3BMQB 3N0VA 3VYTB 4DUPA 1H6CA 1W8IA 4TX1A 5CB4B 4X95A 1E1NA 1EG7A 2BGMA 2C9BA 1S3SA 2ODEA 2ON6A 4X7RA 1YNSA 3CW9A 3ORRA 7REQA 4G5YA 3BXXA 4NDZA 4NEGA 3ZU2A 3RRMA 4BE7B 1CUGA 3ND6A 4DQXA 2AS0A 4DADA 3DSRA 3SICE 1CS0A 4GGPA 3W6ZA 5DIZA 4EH1A 1BD4A 2V6GA 3NEYA 5GZ6A 1MX3A 5B55A 1NYRA 4JXJA 1YS2X 3JVVA 4N03A 5IJXA 5K3BA 4DANA 3PRKE 3FOEC 2XJ4A 1RZRA 3W2FA 4TYYA 4LNHA 4DUZB 1U0LA 4BU1A 4YLYA 2A5GA 3O31A 2LPMA 4EHLA 4OHMA 2UUCB 3TKYA 1A2OA 2H0RA 4OQLA 1EMDA 4DSTA 5JNVA 3EZYA 1TQHA 4HCJA 4IDDA 1EIZA 3I9OA 2GRUA 3CT4A 3EWIA 3CURA 4H7JA 5LQAA 4PYQA 1NQTA 4QVGA 1OGYA 2C78A 2E18A 2ZTLA 4OI1A 3KVOA 3WLFA 4F6LA 5KWJA 3UOGA 2V1XA 4BVAA 3CLTD 4V38A 1EHCA 3B6JA 4EWLA 1JHUA 1YKFA 4WBNB 1D1SA 2A4MA 1G21E 2DHQA 3TL3A 3MJSA 3RWOA 4EKIA 4J6EA 1C7FA 2NXEA 3PQ4A 1YZKA 3QVMA 4MUNA 5EJGA 3ZIDA 1Y8RA 1OH8A 3N1UA 3QWIA 2GB4A 5EUBA 5NULA 1MB4A 4TYWA 2CMHA 2NVBA 4Q1EA 1KOJA 1U80A 1Z37A 3G0CA 2GD6A 4RNCA 5TEVA 2WQ7A 3FUXA 3SDBA 3JZAA 1EESA 2GBIA 2ZEJA 3K31A 3Q7SA 1JG4A 1WHSA 3JXEA 1F2UB 1FFCA 3P5BA 2A9QA 3E61A 5JROA 3WLIA 5HW0A 2A9FA 1AZTA 1PAUA 2ZJ2A 1V26A 1P1RA 1G63A 4G9GA 4DWVA 3ECAA 1ZCJA 3K0FB 3P94A 2WWYA 3CPJB 2YNMD 3ME5A 4IHKA 4Q7EA 1QFSA 3D8NA 1SD2A 2GO1A 3U49A 5JISA 1AJEA 2QDKA 1U9YA 4EPWA 1GO2A 4HD8A 1O94C 3OP4A 5LBTA 5IDVA 3C98A 3HA3A 3MWGA 1U1DA 4A10A 2R6HA 4Y2QA 3W6UA 2BFEB 3QPAA 5CMLA 3VO9A 3THXA 4JEUA 2VK8A 3V7FA 1B73A 3TW6A 5CNJA 3UJ3X 1OXSC 3LBAA 3DZKA 2V7PA 3DV2A 1VL6A 3AEUB 3O4RA 4GOMD 5JJ5A 3QNMA 4ITVA 1Q91A 2NZXA 1QVAA 3VPFA 2XAAA 4MRPA 2IHBA 1VOTA 2I4IA 3BTUA 4KO8A 4DNOA 1KKLA 3ZW9A 2A35A 2XBLA 2I2DA 3M4JA 3NO9A 3T94A 1IBSA 1E79D 1NBWB 3RRNA 1ZCBA 3IKMB 2VRCD 1YI1A 1V3UA 1R5BA 2ZWOA 3C15C 1QCCA 1P45A 1I6WA 4JJEA 4LISA 5EMHA 2VUUA 3WLSA 2OHGA 3AL2A 1SRQA 1JDBC 4JR0A 4DIDA 3VR1A 3TOSA 4BN4A 4MLDA 1P1FA 2RE8A 3GUYA 1DAOA 2FRVA 2OGUA 4GM4A 4EA6A 2PGNA 3TD2A 1AGNA 1AM4D 2WAOA 2PIAA 3QIVA 5JFTA 4AZ3B 4GYJA 4ZEMA 4A27A 4D0SA 1CZRA 4EPYA 4MV7A 1GCIA 4EFKA 3VH3A 1QF9A 2OCKA 1PFUA 3HO8A 1CZLA 1CJKC 3ZHTA 1W4RA 2XKAA 4RY2A 1YB4A 3NCHA 3CBGA 3UANA 3O90A 3AI2A 2P5YA 4NBKA 4JI0B 3PIIA 4RJKA 1YQTA 2WIGA 3ND9A 1TGVA 4R05A 5LZ8A 3RVDA 5C5EA 3AETB 2X2FA 3FCSB 4F06A 1X3SA 3A1CA 3FSEA 1JVNA 4G5SA 3RS3A 1A5ZA 4JI6B 2Y8EA 1L5SA 2H00A 3T34A 4TVOA 5CT5A 2GVDC 4R51A 2KW5A 1GILA 4U63A 3P5SA 3K8ZA 2P8SA 3PKJA 1OZHA 2C2WA 2I33A 3IFSA 3MPUA 4HL6A 5DTEA 1L5HB 2HI0A 1QAOA 1ZR2A 2CL6X 2Q27A 2VDOB 3N6RA 4GXRA 4WAUA 4E0BA 5FWYA 1O89A 4FWIB 2GPBA 1FJ2A 1UJMA 4HJRA 1KI4A 3FPHA 2B8WA 2OG1A 1GUZA 3BTSA 4YMLA 1M2OA 2ZE7A 1BDMA 1KEUA 2IBSA 3NTOA 1QH1B 1N3BA 3C87A 2X8BA 3DLPX 1I2DA 1GZ3A 1OW3B 2R60A 1VZ3A 2NLOA 1Q0SA 1MOPA 2VUSA 3DOIA 4QRDA 1KJ9A 3SFZA 4OGKA 3IIEA 2UVDA 1MBZA 4DCCA 1Z26A 3OECA 4F0JA 3FFWA 2B99A 2D5BA 1M2HA 3AU9A 3WYAA 5JCOC 4D7AA 5AW7A 1PBTA 3I5AA 1AK9A 2FXIA 2HWYA 4W99A 1P3JA 5LMNB 4WCFA 2PS3A 5FULA 1RLUA 4CTKA 3AB7A 3EOBI 3KSDO 1H6BA 3VC2A 2GCIA 4ARVA 3FHOA 4FGWA 2FQXA 1KO1A 3GFOA 3CZQA 4IDNA 4Q39A 5FWDA 4MV8A 3EEBA 1A69A 2J0VA 3JAKA 4E2ZA 2NQ8A 4DNQA 3IQFA 1HETA 1TCCA 4UKDA 3X1XA 4N18A 3SJ7A 1IQ0A 3VC7A 2FEAA 1NE2A 1U7HA 3H5WA 2YJ3A 5FBZA 4A82A 4EMBA 4EAAA 2XMCA 2Z58A 3TRDA 4ZGWA 4E51A 1SOUA 4KQGA 5MGBA 3U37A 3UMFA 1J99A 1K6IA 4TSRA 4ZT7A 3CMCO 3K6JA 4WY2A 3EE6A 3WNQA 1DP4A 1ZJZA 1TGYA 2DZDA 3AW9A 3GXOA 4D42A 3ZQKA 4QFCA 2OCPA 2YUIA 4F1JA 2XH8A 2ZKIA 5BWBA 1CHDA 2X7HA 4QYIB 1NQUA 2XR1A 1EVYA 4JT4A 1CDOA 1GG9A 2OILA 1JMVA 5EQJB 1GTG1 4PIPA 2QRUA 2VT6A 2WWRA 3VZQA 3LT4A 3WNDA 2CLEB 1RSZA 3HADA 4HTFB 4YMWA 1DOAA 5CIWA 1WCV1 3PNPA 2IXGA 3RU9A 5K0SA 3BWYA 5D5QA 2CHEA 1XRJA 5GV8A 2Q99A 3DYIA 4OI4A 2ECQA 3SIPA 3TGLA 2ZIAA 2Y2VA 1DKLA 4IUYA 5AW0A 1VGRA 3FDJA 4YH1A 3NBZC 2DWPA 2JJ2D 4KK4A 1QHIA 3WOHA 3C1AA 2RGCA 2SKDA 3CNLA 5LP6B 1C29B 1Y4UA 5KIAA 4FS3A 1FMJA 2ZSIA 1L5QA 3O8QB 2FPGB 5FCDA 2RGRA 3GO4A 1NW6A 1KQ3A 3OHPA 3WL7A 5ICEA 2ZSEA 2OVFA 3CVXA 2O8BB 3OF2A 2DUMA 2C03A 4JSYA 1G6Q1 3BB3A 3EMKA 1BWPA 3UAVA 4Q4CA 1G60A 5BQOA 4F56A 4E4RA 4GWGA 4TT8A 1R6AA 2ZETA 3C6MA 3LY9A 2RI0A 1OLXB 4D43A 1M2NA 2J1LA 2R6JA 2PJDA 3ENWA 3QU4A 1NSTA 4ID3A 1SU6A 4D99A 4DREA 2XCSB 3THWB 4OHXA 3E70C 1SQ0A 5CW1A 8MHTA 1Y3CE 3SC4A 4IQ8A 2XQFA 1GARA 4OOEA 2N3ZA 2XMQA 3OZRA 3RC7A 2WHYA 2Y4NA 4JGIA 4WNYA 3Q2KA 1KEKA 3B78A 3OM9A 3QQ5A 4Y18A 1EHYA 4AKHA 4X9XA 4ZPJA 4K6OA 4DQVA 2ZSFA 3HCRA 4I46A 4G5OA 4A9AA 3ESRA 2K4MA 4PZ0A 4Z99A 4B3MB 1UR5A 4Z4QA 1IHOA 4F92B 5KNDH 2XD4A 3NG1A 1AT1A 5E9JA 4RIHA 4AJ4A 1Z6TA 1ZVMA 2HZ7A 4YV1A 4CIDA 2YOGA 3OFSA 3NTVA 1K75A 4E46A 1OJ7A 3R75A 3RAPR 2R62A 3OCEA 4AMGA 1A2KC 3GRCA 2GHIA 2ZPAA 5LQMA 3U16A 3DW3X 4JUBA 1SUEA 4JI8B 2GYWA 3I42A 3OAAD 5AM3A 3DEZA 1P7WA 1M33A 1KYWA 4NATA 1MGPA 2IX9A 2XWSA 4H77A 4KW7A 1MO6A 4MS3A 2VT7A 3DEHA 4KXVA 1W44A 3HCEA 2JAXA 4R5MA 3U31A 1R66A 3HCBA 4I1YA 5CH8A 5HIMA 3W5CA 1XJQA 2ZP1A 4WJZA 4K1LA 4MUJA 1DSSG 3DF9A 1WD5A 3CS3A 5I9LA 3FOFC 1QO0D 4QQ8A 4WESB 2Y0EA 3W9SA 2EKDA 1MD9A 3L6CA 3TDNA 4F4UA 4J6FA 1MJNA 2X4IA 5K20A 2WPDD 4GNKA 4L9RA 5JTUA 2JRCA 1EWQA 1RBYA 1PYDA 4RTSA 4A36A 1ZZGA 4JP2A 2Q5JA 4IIXA 2X3YA 1LLUA 1F5NA 3O21A 3PQ8A 5FA8A 3KOYA 3I4CA 3IRUA 1P91A 5BR8B 5A3JA 5K0FA 2Q9BA 5FO1A 1CT9A 4W8OA 2WJ3A 3G9QA 4IQ4A 4B3XA 3T41A 4KWIA 4CIVA 4B40A 1MJHA 3V2HA 3DLBA 2XHEA 3REFA 4BYMA 4MROA 3C4JA 3JATA 2ZW9A 1FZTA 1HY3A 5E3IA 2YJ6A 3H3JA 4FUTA 4NG5A 1YGPA 5I9TA 3AOEA 3L79A 3TW4A 3CLVA 3UCXA 2XTMA 3TDKA 3CH4B 1M1UA 3D7SA 4JQCA 4XAQA 2WE8A 4YBZA 4S1OA 5DCLA 4DMUB 3CCBA 5CA1A 5KYNA 3LRTA 4M9UA 1BXGA 1JA0A 5K0NA 2PLAA 2C2MA 5CFRA 2ZXUA 4J0JA 2Q7DA 1QHHB 3BMXA 1NMQA 1Q1NA 2HRDA 2I1WA 1V4NA 1C7EA 4H60A 4UNQA 5IBRA 5FFNA 4NCIA 3H3XA 3N5KA 4MV3A 4HAVA 1E3IA 4C14A 2DTXA 3CNQS 4UATA 1XCOA 3BD6A 4LYDA 4QPZA 3EX7C 2FKNA 1UMCB 3HYNA 3A04A 3ILYA 1NAHA 5CLQA 3SFTA 2AXQA 2C3YA 1AIPA 1C0LA 1H5NA 3FG9A 4MO9A 1MX5A 1B16A 1U0FA 2O3SA 1T36A 2BFFA 5THQA 1W76A 4D0GA 1EWTA 3AEXA 4B3RB 5E6SB 3LF2A 1N32B 1NDQA 3GHYA 3LGXA 4ZAFA 1XEXB 4HGRA 4WLEA 5I9IA 4BNHA 1N1GA 1DAGA 1JIXA 5JVDF 5KNCA 2QRJA 4M8IA 5EYPB 4MKGA 1R27A 1NT2A 4WLFA 3M6VA 3T35A 1QGUA 1OBHA 3CRNA 1E1QA 3GAZA 2VP0A 1NN0A 3E81A 3WIEA 4PZCA 3U3DA 5E7IA 1NFQA 2A1TS 2O5VA 1MB2A 3MRVA 3NEJA 4MGKR 5KYWA 1SFRA 5EERA 3NDPA 3QE9Y 1YB6A 2RCNA 1KDVA 2H85A 4LYFA 3RU7A 1RYZA 4Z7QB 4YT8A 1FMFA 2OD2A 1EBBA 3KXPA 1PEYA 3D7LA 4GH5A 3IB3A 2B8TA 2IEAA 1SO8A 3G2HA 3P20A 1V1RB 2Q6TA 3DZFA 3QUCA 3QW2A 4KMMA 5FJIA 1E32A 2VH1A 5FR2A 3OM1A 2JEYA 4N5MA 4ZQCB 4B79A 4F86A 1XGKA 2JJ1D 1R5OA 4GP9A 3IUNA 4PLHA 4G1EB 4JI5B 5H82A 2BGTA 1WZ2A 1XJCA 3ELDA 1IPFA 4AF6A 2IYSA 4QEKA 2YMMA 2YY5A 5D7NA 1NNLA 5A4FS 1HDYA 4GPTA 1T8WA 3BH7A 4TZ6A 1TCVA 5DOZA 3WFIA 2D7DA 4ONEA 3KWMA 4B4UA 4HMQA 4BGVA 2IE0A 3HXKA 3EPLA 2GBPA 1SVIA 3WRYC 4CM9A 3NPAA 2Y99A 2AKAB 2NO6A 5CFPA 1JB1A 3MGGA 2I6TA 2DUJA 3F5QA 1UMDA 1DBWA 3MFQA 3AP3A 4JOQA 1X1RA 2QUHA 2REXB 3LRXA 3K9HA 4LWPA 5D3MB 1B2LA 3IQDB 3PL1A 3CR3C 5COBA 4GOOD 2DCMA 1O94A 3N70A 3M5WA 2JASA 1FLVA 1GKUB 3JWHA 4BYGA 4JV5B 3MJ4A 1VA5A 2YJZA 2YW9A 4QULA 4HKTA 2QRHA 1BDJA 1ZWLA 3E1GA 2HC9A 3IAS6 4Y6QA 2BGLA 1P4HA 2D8AA 3EUEA 1T8SA 4M46A 4NARA 1U8XX 4YMVA 4UM8B 3PLAE 2P6UA 5KAMA 4BQSA 4R2LA 2P0EA 4RX1A 2EX1A 5SICE 2O2SA 3T52A 1T3HA 1LQ2A 2H1FA 5IJZA 2NTYC 4QE3A 3VU0A 1Y7LA 3P9KA 2RGWA 4WACA 4QKQA 1XPUA 1NC1A 5CW2A 1MEJA 2VJMA 1HLFA 3L6OO 5H1YA 4ZOLF 5ICFA 3JASA 4AG6A 2OQIA 1CDDA 2IS1A 5K0TA 4B6EA 3W5HA 1RM0A 2XXAB 4QTYA 3AC0A 1ZM4A 4I1SA 4F8EA 3A6LA 2INGX 4C4ZA 4NXNB 4UFNA 2Q41A 1LTHR 2QL6A 5EE1A 1S1MA 4DGSA 2VHTA 2XWPA 1E1DA 3UK2A 5F21A 4I3GA 3LZ6A 1DC4A 2RHOA 1W4ZA 1QYXA 3FB4A 4U2GA 3HTXA 1BGVA 2WUVA 5FNZA 2IYZA 1GG5A 1BGWA 3IERA 5IDXA 3KCNA 1N57A 2YXDA 3U26A 4EJMA 2VC2B 4HFNA 4M9RA 1ZL0A 4D9JA 4QUHA 5LR6A 3H6HA 3EOAI 1L7EA 1OIWA 4WECA 2X1VA 1JH8A 1E2FA 3R7WA 4CLDA 1QQBA 1H1LB 2YV2A 4PBSA 3OHSX 3VKWA 4ZOAA 3TTUA 1KDPA 3IHTA 5D3KA 3DKIA 1T0BA 2PMKA 5DBHX 2V6IA 2C7VA 3IMKA 5DPMA 3RCBA 1NX9A 3BSWA 4NWIA 3IULA 1QIDA 4I5FA 1TIBA 4NF2A 4PCAA 3TSYA 4A8JC 3T0IA 2YYZA 3HM2A 5B58C 4QL3A 4WXMA 4QOSA 2QT1A 3L0BA 2PGAA 4P7BA 5CCDA 1T9DA 2PL3A 5IN5A 4EF5A 2KPOA 1X9IA 5JWRA 4ZHSA 2YUTA 1O95C 1Z2CA 3CF0A 3FMFA 3BE5A 3G13A 3H11B 4UNRA 3WIDA 4DLYA 4GLLA 1T0PA 1IXSB 3VAZA 1POXA 1Q3HA 2W2KA 3AUKA 4LY0A 3IPAA 2GEFA 3O03A 4YN3A 1C14A 4JT8A 4KQHA 2W0MA 1PK7A 3NBUA 1IY2A 4GI5A 1GTRA 1HTTA 1HYBA 4HK4A 4JWKA 4MA5A 4BNKA 4V2IA 2F8MA 1J0XO 4DR4B 1G98A 3DMDA 2EJUA 3MN1A 4Q9DA 4EA7A 5K8LA 1ZKMA 2L2QA 5AVJA 1TF7A 2DY0A 4E31A 5I7VA 3NM6B 5EP2A 1LW7A 4ZXPA 3ETDA 1O7JA 2ZJ8A 1YQWA 4IYJA 3LQ2A 4Q4JB 3WE7A 4GHWA 5JCOA 2JCGA 3V32A 2FN4A 3L6BA 3NVDA 1Z2NX 2WYIA 5AT1A 4OO3A 4PC2A 5KOYA 3ZV4A 1WMDA 4ME6A 2E4VA 4R54A 2W43A 3GPLA 1J5PA 4MJXA 2I7XA 3KYBA 4BO8A 1I5RA 4E6PA 1DHRA 1XZPA 3OE1A 1R4ZA 3HI6A 3KALA 4OQQA 1VBNA 3TOXA 3U1VA 4RDHA 2QU8A 4XGIA 5ARCA 3HVKA 5AW2A 5BNZA 4W9RA 4F5EA 3Q2IA 1YA4A 1E4EB 2J9ZB 2K6GA 2PGIA 3QSYA 4P3KA 1KAEA 2JGAA 3V4LA 2ZJZA 2XCTB 1SKYB 4UBJA 1YJQA 3BULA 4QRHA 5CIQA 2OL4A 2AHRA 4OHZA 3E7FA 1BTOA 1ULTA 1S8FA 1WDLA 2XGMA 3MWEA 4OKNA 4UEJA 1DUIA 1EIWA 1HDRA 1E5TA 5EIBC 5C5CA 5GIPE 1JHRA 1VECA 3IA7A 4P7GA 4FZ3A 4Y3UA 1FE8A 1O58A 3C0KA 2IY9A 5EWMB 4JLUA 1FBTA 1NQAO 4D9KA 3EQ8A 5AQEA 1GPMA 3ZWVA 4OPMA 2VHVA 4YJKA 4UXIA 3OT1A 3DDUA 1JECA 3D6FA 2HK7A 3MG9A 2L18A 1OYOA 1KFKB 2MJLA 3JQQA 3P2EA 3LCCA 4WBSA 1KDOA 1LRLA 2QRNA 1U8FO 1NUQA 1AY0A 2W0SA 4MW9A 4U6QA 4Z7OB 4H0CA 5CXXA 1IZ9A 3L77A 2QD2A 1ELOA 3FY4A 4INJA 5LB4A 1FUYB 3KKLA 4X8LA 2PNJA 3RS7A 5KKNB 3DTVB 3LCUA 1R4MB 3FROA 4HI0E 5BUCA 2DVMA 4GX5A 1L4LA 4TUYF 4PLTA 1ZK0A 1T6XA 1BW9B 2HMTA 4MWSA 1MABB 4RF2A 4A2CA 4GKKB 4CCAA 2E4AA 1GAXA 2GN1A 3NC0C 4MCHA 1S7CA 2YTZA 5IM4F 1RRVA 3PEYA 1XQ6A 3CLKA 4WOKA 2PZAA 2FSFA 4I50B 3C4VA 1BVRA 2M6SA 4R8MA 4OQ4A 1W94A 3ZNNA 2J33A 4A91A 4BV8A 1Z8HA 5I7FA 5JXGA 1XJWA 2QB5A 4CTNA 3NNNA 1M2GA 2HN9A 4NRDA 1E8MA 4GZ3A 1A77A 3PC6A 5IDYA 1QG6A 2HGSA 3CKMA 3BHJA 3CPEA 1ADBA 3FPLA 1XHEA 4MH0R 5A9SB 5AW8A 4RSMA 1OBFO 3TTTA 4L5YA 5IAEA 4FYKA 4CLRB 4K6FA 2H5JA 1P2FA 4ZP1A 1D6SA 2QT0A 3A1TA 4ZO9A 2FW9A 2MR6A 4AMBA 4ZAVA 1CRZA 1M2WA 1BVYF 3KLMX 1SRRA 4MOWA 4UBIA 5AJXA 2NYVA 4K8OA 2W70A 1T3TA 3CNOA 2F8LA 3AY7A 3HE3A 2FPPA 5IVHA 1BHQ1 3JALA 4NZNA 4BFVA 5JTTA 1R0XA 2AOVA 2VQSA 4NLLA 1U11A 4DB4A 3EZ9A 4C6SA 4ZICA 4UBKA 3A4MA 1HQYE 1WSBA 4TL7A 5M04A 3HRHA 3A9CA 3HDTA 5M34A 2PTHA 2PH3A 2NYUA 2PTGA 2V6JA 4G3XA 3EFOA 3VHRA 5BOSB 3FBGA 5E1MA 3ZS8A 2Q6KA 2VP5A 4MICA 4U7FA 2PK3A 3HB4X 3BIWA 3QBDA 4B09A 5J2UB 3H2KA 4KFRA 2ICAA 4U7GA 2OOKA 3NT5A 4N0DA 3PHLA 1N6IA 3PR1A 3RHSA 3I6ZA 5BR1A 1UT6A 5KQLA 2RJNA 1ZESA 1PR2A 3ETCA 2FX5A 5KTMA 4YCSA 5IRCD 4YRGA 2QTMA 4J7AA 1IZYA 4FR0A 1YRYE 2DF8A 3UQZA 1M66A 1HFWA 1C81A 3Q5GA 1NRWA 5BRJA 3Q5DA 3E35A 4XQCA 4E4TA 5EY5B 1FF9A 3KKPA 1LUAA 3IILA 1DQPA 2O2DA 2QX6A 4ZCMA 1E2NA 4HLDA 4AIRA 2EGUA 3HSKA 4P82A 5JPIA 5TPWB 5GVSA 1EWRA 5REQB 5FA6A 1XMOB 1PJSA 1RQRA 3QHPA 4G0YA 4FTWA 3IXQA 1FPQA 3QMPA 2XHZA 2CXQA 4B31A 4CWAA 1SHTX 4HAZA 3PQ2A 1ADGA 1XP5A 2BZ0A 3UTCA 1OZAA 3ZHOA 1G21B 2PRYA 3PD0A 3P9RA 1TC1A 5TJ9A 3SXUA 3NQ41 5KSOA 4GXTA 1J24A 2G5PA 1LBTA 2FOXA 3CUTA 3GF4A 3HXLA 5C5IA 5JS1A 2VYVD 2EV9A 3AUAA 3FUTA 4JVLA 1K3UB 4L2IA 1E20A 3RFXA 5HUQA 5IVKA 5AUNB 4LMAA 2A0FA 2OP0A 2QR3A 3RROA 2PE5A 1FX0B 3EIWA 2WTNA 3LDHA 4REQB 4DQKA 1JYSA 3K05A 3L6UA 1SHKA 4YR9A 3U4QA 1QVVA 3HJTA 4RVFA 1ZRNA 1NGSA 4DRXB 3ZDXB 3FDXA 3GVCA 1MJGM 5I8WA 5IK2D 4BNLA 3OO1A 3L7IA 5EXTA 1SOWA 3TGWA 1YR1A 2LZ0A 4A5SA 4J4HA 1D4OA 4F5WA 3VO2A 3VR4H 3LO8A 4LQCA 4NNJA 1NLZA 1IVSA 2C83A 2GDJA 1SU7A 1TFUA 1GPWB 2R9VA 3D8TA 4UMVA 5FO0A 5LQUA 1JSRA 5EIWA 5I7RA 1Y9AA 2G8NA 3IPXA 4P4SB 1F2VA 5HUHA 1R0KA 1C2YA 1TT5A 1M8PA 2EFGA 4JENA 4PZEA 1ODJA 4C4XA 5DTJA 5EJEA 3MTBA 2H1CA 2B36A 4OIFA 2BBOA 1QORA 3KPJA 2B1QA 3A05A 3UFXA 2H57A 1KS9A 4D0RA 5A5GA 2QM7A 1M2VB 1C80A 2W8BA 2H1WA 1AGPA 2WHPB 1SELA 1EB9A 3CUEF 2UZAA 1P3Y1 4DCVA 1SC9A 5A05A 2JI9A 3TCNA 4ZYXA 1B0PA 2ZGVA 3U3KA 3MYYA 1P1CA 3W3AD 1VYTA 3MIZA 2QL5A 2V98A 2MSLA 4IGKA 4RMJA 3ZHXA 5KOJA 5LIPA 2WIAA 1AA6A 3JARB 3LS2A 3T12A 2BP7A 2EQAA 2J5QA 1JG1A 1C7IA 2XADA 4PPYA 4RFVA 4AG3A 4EF4A 5FAKA 4C4TA 5LLDA 1PKEA 3MINA 2RH4A 2M98A 1AD2A 3OUZA 1SOMA 2I4MA 1TQ8A 5SYNA 1ZN7A 3O84A 4G4IA 5GJBA 2WJYA 1QWOA 1N7JA 2WABA 2ZZKA 1T4MA 3CLSC 2FQQA 2G82A 2B7LA 2CJYA 4ARUA 1FTNA 3OA0A 4X54A 3A6JA 1EU1A 1Z5GA 1QR6A 4HAIA 1RWNA 2ADMA 4P35A 2R96A 4CLOA 4HDKB 3ZYZA 4MINA 2VKTA 2IHYA 1F4LA 1QQ7A 2IPOA 4JJAA 3ROPA 5B2FA 5DTQA 1WMBA 4MUGA 6PFKA 3H5RA 1AOXA 2XB8A 2O5EA 4DJTA 3BJRA 2TMDA 2X23A 3Q2OA 3GUUA 1PIWA 1DAEA 3E23A 2JFXA 4WNIA 3WRYA 3DWEX 2IHTA 1LCIA 2O23A 2OAP1 5D5HA 5BQ5A 1DTWB 1Z35A 4WZ6A 2XX3A 1GFZA 3PFWO 5F2KA 4YTEA 4EHIA 1FRQA 1UBGA 2Q7OE 5EEGA 4S0ZA 4Z49A 2Q4RA 4MA0A 5P8WA 2ACKA 1O03A 1NU6A 1ZXLA 3NATA 2V8BA 4FOLA 3RC3A 1OHHD 3ZGLA 3HN6A 8ATCA 1RWBA 3IQHX 3L0PA 3NOXA 4G9BA 2HB6A 3GJSA 1H3NA 2YVLA 2B6HA 2VF8A 4LF4B 4MP8A 5JJBA 1TVKB 1PJZA 3HCFA 4G01B 4JP8A 4IW3B 4PE5B 3AWDA 5BV8A 3MJDA 4FMDB 3KLNA 3PUWA 3B3QA 4N6NA 4TTVA 3JQFC 2FSVC 4YAIA 1R3UA 3L0DA 2WOOA 4MJLA 3RVSA 5L53A 1J0AA 3N6XA 4MUXA 4NP6A 1H0KA 3BZWA 4YAOA 3K3PA 1N2OA 3BHIA 2BR3A 3OF5A 2EZUA 4FJ1A 5JDIA 1ZM9A 1H4SA 3D7NA 4NENA 5EZQA 4XVHA 2C04A 2GSWA 2R79A 4F3KA 5C80A 2G76A 1A95A 4U2BA 1FRNA 1VMDA 2PMBA 1GZVA 2Q4TA 3KCQA 4UCXA 3WLOA 2IP1A 2HJSA 1QRAA 1XU9A 2PY6A 4KXMA 3ZCUA 5B3KA 2AG6A 1PD0A 2R68A 4P83A 4L8GA 4RE6A 2B98A 2QJRA 4HRVA 1QZZA 2OBNA 2BWJA 3SDSA 4ZZ1A 1QE0A 5KYTA 2BKXA 4G0VA 4LHYA 4N7RA 1JSLA 4BIIA 2Q1TA 1ULBA 4DZTA 4HNSA 4EHHA 1LTQA 2YDYA 3K9CA 3DF7A 4O6VA 8LDHA 2DCUA 5IEJA 4YMIA 1NBOA 3BPSA 5BSGA 2D3TA 3S2FA 5JBNA 4D8XA 4HLCA 3TR0A 4NH4A 4M22A 4OU4A 5DI9A 4BLOA 4BMDA 1VSBA 1WCYA 1O54A 5DGHA 5B1HA 4DARA 5CFQA 1SG0A 5I4CA 1KQGA 2OHVA 1RQLA 1N3LA 3P0IA 1T9ZA 3ZTWA 2Q28A 4D3YA 1KIMA 4O4IB 2FWIA 2CBGA 4A8JA 3DT6A 3A4NA 3LWDA 5ADWA 5H02A 3EQ2A 1PGJA 3WLQA 3OQJA 2DFPA 3IEUA 5DGCA 4DLSA 3ZJUA 2I7TA 3NT2A 4PW0A 5CJJA 1O95A 3AR8A 1FYVA 2CK3A 2BISA 2ZUUA 1VJ0A 3H1BA 3Q8KA 3ADDA 3LUCA 1HFEL 4DIOA 5LVAA 2M6KA 1K6MA 1XZDA 1PF7E 1W5BA 3OJOA 1Y34E 2ZYAA 4GYWA 4WBXC 5B3LA 4ZYYA 3OSUA 2X4LA 4KO4S 3DDWA 1NF3A 3M6LA 1JWBB 1I3CA 1MEEA 1JEJA 1EX1A 1JP7A 1MZVA 1RXSA 2X8JA 2VLIA 3KZKA 2LXNA 4WWHA 3SYNA 4D8TA 4D98A 1UIMA 4PXSA 3EVBA 2EU8A 2PAFA 3WHPA 3PNBA 3U9TA 2WHEA 2B6NA 4CDMA 3D3NA 3C1TA 2I5PO 4WASA 1TPYA 1FP4A 2Q3HA 3ZJYA 4D3ZA 4TMKA 3F6CA 1F8XA 3TOZA 4IICA 3RIHA 5TQJA 3RLIA 1ILWA 4MVXA 4RPJA 4IFEA 4NJMB 5FI0B 2QWXA 1GR1A 5GMOA 3F9IA 2AQHA 2VYCA 2ZCUA 2P79A 2AN1A 4UEQA 4U7DA 1B8VA 5HKOA 1RBMA 4B4OA 1D8AA 2VHWA 2ZJFA 3CZPA 3G9TA 4H27A 3KHTA 1HT2E 1KJZA 1R0RE 4RVDA 2DXIA 3DDZX 2HRBA 1YDEA 1E64A 3OQ1A 2AEFA 3Q12A 4JL5A 3RIYA 4CUZA 3M6UA 2AJCA 2IT1A 3TXAA 3S8YA 4I1PA 2J9XB 1FRZA 4EVIA 4D45A 4ENRA 3IUSA 5AKZA 1QIFA 1QS0A 4ZVPA 4FGLA 1K7WA 2JLBA 1TRHA 5K3OA 1J49A 1U1FA 4Q7QA 1J8YF 4QQKA 2QTAA 1AN0A 2I99A 3MWDA 1IEWA 4ZTUB 1VRCA 4LDZA 3SE0A 4US2R 4WI1A 3VJLA 4GZ6A 3E0QA 5F91A 1NUAA 4K0RA 1Z0ZA 4QDJA 3S1AA 1CUUA 5DNCA 1OSNA 4AZSA 3IP9A 3HDYA 2I3ZA 3QUSA 4D4MA 2WJAA 3HS3A 4MYDA 2ZBFA 1CYDA 4DUGD 7AT1A 1Y8QB 2O7RA 3DOOA 4B43A 4D4GA 1IJBA 4RHXA 2WWFA 4FINA 5DX1A 4AM8A 4GG1A 5HE8A 3PQDA 3AF1A 4M2LA 3S7ZA 4I2NA 4RQUA 1SCQA 2XYRA 2GUWA 3PHBE 1PWYE 2VP6A 1PX0A 5AKIA 3U9SA 4ENVA 3R3UA 4L72A 1RBQA 4J2TA 2JIZA 3CUUA 2J3EA 4RH3A 1PJBA 5ED0A 1QK4A 4I1OA 2YXBA 2CFRA 1J8QA 1GZ5A 2XMDA 4CEJA 1UPCA 1X42A 2GPTA 2ZYVX 3UHFA 5DYIA 5KAPA 3U61B 1OQAA 1QRDA 5FQNA 5G1PA 5DWQA 1X3LA 5L3RA 3PCRB 5FBHA 1GZ7A 1UXIA 5EQTA 1YE3A 4AYTA 3DL2A 5IJ9A 3W5BA 4CMBA 5IT9A 5AK0A 3FZYA 2WAYA 3HACA 3N39C 4UHEA 2ZR9A 3NWPA 1MDBA 4X20A 2NUTB 3K2QA 3QXXA 4CU5A 3QVSA 1ZWKA 3OIDA 4HNTA 4R84A 5HS6A 1HQCA 2ZDQA 4KRGA 1PBNA 2XPCA 4YJGB 1PV2A 2Q0HA 2C5GA 3FAKA 1IY1A 2O50A 3RFFA 2O20A 1S4QA 4ROSA 1E92A 5M2QA 3O26A 1ZA2A 3UM9A 4M1EA 3KL2A 5D7BA 2XVYA 3LVQE 4LRXA 5GADl 5G53C 4OBWA 4DC0A 4B4VA 2V3CC 1E9SA 2JIOA 1T1RA 2O6LA 1G3MA 3KQUA 1PNQA 4ZOQI 1FSSA 2QX9A 3I1IA 4NYJQ 4OHYA 2ZPUA 4UM5A 1SXIA 4Q93A 4IZIA 3RVMA 4GLFA 4IIJA 2PUHA 4Q4AB 5JNWA 3BWVA 1X80A 3D2AA 5BQ3A 4NKRA 4Q1BA 4XJXA 3WBFA 2VR1A 2IZZA 4UTOA 4M1SA 3HYSA 4YUXA 4MVJI 4RVOA 4B82A 4DSNA 4AO8A 3DCJA 2ZWAA 5CHEA 5IXJA 4FVTA 1KQOA 2J6CA 4BMYA 2KI5A 4JR1A 3A3PA 5KYXA 5MFPA 1IN6A 1T2VA 1W35A 2FY8A 1ECBA 3RYIB 1ETUA 1S96A 1YUBA 4OCZA 4YYZA 3MHTA 2M1ZA 1KA9H 3CO0S 4B6SA 2VSOA 4RTKA 1Y33E 2QG4A 3GT4A 1VBMA 5TV2A 4BNYA 1NN1A 3L7CA 2ID9A 5EOVA 3V4FA 3N2KB 1CVLA 1WVMA 3TNJA 3L5KA 3FNGA 1Z9BA 2OBMA 4JUFA 2HEIA 4BQRA 3CR7A 3QXCA 4ER0A 2EZ4A 3HVRA 1BCRB 1H8HD 2JAHA 1I2BA 1WZCA 2TMKA 4JDPA 3WXBA 3J81k 2EF1A 4DGQA 1IW7D 3EEFA 1JJIA 4E5MA 2W2LD 2NVOA 4MMYB 3IVGA 1FURA 3OU7A 1NIJA 2JHGA 1KFBB 3ML1A 4RXMA 1ECGA 3J81A 4NCJA 4Y2PA 3WL5A 1FJHA 2PBLA 4KMOA 4KYTA 4RABA 4WZBA 3DLTA 3WK5A 2DM6A 3MBOA 1BE8A 4N47A 2QVCA 4MHTA 4V0ME 3FWYA 1J2JA 2IELA 2WM8A 4DCMA 2YJTD 3O8OB 2EYUA 1UBOS 1FLDA 1ZQ9A 5CPFA 3VR3A 5DBOA 2O8VA 3PS9A 2QMQA 4M21A 4UCQA 2Z3WA 3OEED 2PVSA 2OK7A 3UEOA 2GN0A 1SCAA 3ULKA 1RXIA 1WMEA 3IQWA 5DISB 5BV0A 2QLNA 1MG5A 2UVPB 3QKUA 1OUMA 4MQ4A 1G41A 1GJRA 5C7OO 5K01A 5DU2A 2WSSA 4RTPA 5IG2A 4GPZA 4RF5A 3IMFA 1QYIA 3OJXA 3CF6R 3I01M 4W7HA 2PJRA 2Z4SA 1O5TA 1O8BA 2Q3JA 2WHRA 1U7DA 1JFTA 3PNVA 1F12A 4QQFA 2HA4A 3NHUA 1VCNA 3HP1A 4OSPA 1ECCA 4TLLB 3HJCA 5TVKA 1JI0A 4IILA 4QGGA 1NG9A 1ZIXA 3HDHA 1CXZA 2EZ9A 3BXEA 3K1TA 3AL0C 1O0SA 1H4VB 1ONPA 1UT5A 4DV6B 2OHFA 5ALXA 3MTEA 1TM4E 3VKFA 1JALA 3KSUA 1A2QA 3T5GA 1FTSA 1TF5A 4KNVA 1BVHA 4BY9E 2WP0A 3CLUC 4FZVA 1VSUA 3IDQA 1FNCA 2J3JA 2ZTVA 3D4IA 3RIGA 3WGVA 2YCLA 2AMVA 5CX4A 5G0WA 5A7FA 1DO0A 4TRRA 2YR0A 4UTXA 1WW3A 4DDHA 1PT8A 3D1JA 4TWZA 3GRYA 1F06A 3LV8A 3PFGA 5KTYA 5G2OA 1JPNA 4O2AB 4JX8A 2PUVA 2P6NA 5JQGB 4LQ4A 4MAMA 4U00A 5HYVA 1HO3A 4KFTA 3T3NA 3SC2A 2FFAA 1N5OX 1RMQA 3Q40A 1FU7A 4RK0A 4QHYA 4RGVA 1X1DA 4RHYA 4YNBA 4AIIA 2NWQA 2HTEA 4CQMD 2V6FA 3WMXA 1CVIA 4W5JA 2FUSA 1HRKA 2QTLA 3PNMA 4MVWA 4TTAA 5BR4A 1ZW1A 1X7WA 5BT9A 3TZKA 1DTSA 2V7WA 3GDHA 4YRCA 2G9RA 4R83A 3TH5A 1X2EA 3L04A 2ZCVA 3QKTA 2VF5X 3V2UA 2BGIA 4TMVA 1NJ1A 3NTLA 3HCPA 1ZHHA 2CJPA 4BQOA 4JUIA 2ZJ7A 4LJLA 5AHWA 5HIIA 3LSYA 5F76A 3P7MA 3V8VA 3S2ZA 3OMWA 3LZCA 3STTA 2C98A 3N0XA 4I1UA 3M3PA 3L6RA 2AXNA 1LSJA 4GAEA 5K05A 1C8BA 2OB1A 4MDEA 2VDPB 4DG9A 1ENYA 2CNWA 1I80A 2C4HA 5A71A 4EUSA 3BGWA 2LWIA 3GEBA 4ZDJA 4ITRC 2ZTUA 2HLPA 1XYGA 3EF1A 4HUQB 4JDUA 3EVNA 3GFTA 3OCVA 3U3JA 4FKMA 4DTIA 3O2SB 4F96A 1A4IA 4ZI5A 4ZI2A 1CJCA 3FYTA 4HGVA 1VIYA 2IYRA 3OIYA 3HLTA 1QRRA 3A4TA 3LLCA 3A9RA 5AM0A 1RRCA 4CJXA 4HF7A 1BFUA 1FQKA 1Q7GA 1X8KA 1WPQA 2EW2A 3FH0A 3FMGA 2BM1A 3CLTC 4L85A 3K5IA 4R2XA 5CNIA 4YO7A 3NHBA 4JB8A 1HV8A 3WK9A 2WOJA 3VR2A 2ECFA 5FP0A 1FFEA 2OFXA 2R65A 2VXYA 3HB7A 3L01A 5EQDA 4MNTA 1EGHA 2H1VA 3MSXA 2V3VA 1HDGO 3OOJA 3PYMA 1FFXA 2KBEA 2P40A 5K8VA 4S12A 1P0FA 3MHPA 3B3JA 2QUIA 3R5JA 4WHMA 3SZGA 4D9NA 4OHKA 1TYCA 3R6VA 1SVSA 2R8YA 1FDTA 2GM5A 1JKJB 5KCMA 4EUFA 3ZQ6A 1PR0A 3DJYA 1E9FA 5AUOB 3PXXA 4KNYA 3C3BA 2NU9B 1Q5NA 4IMPA 1NZJA 2EF0A 2FCAA 2VPXA 4KWHA 4RXUA 1XR3A 1AZWA 2FSVA 3JQFA 4CFSA 4X45A 3UGJA 2GD1O 2BF4A 4M9QA 3RVJA 4QJ3A 2HSDA 1BX3A 2YNMC 1MEOA 1Z25A 3OQMA 1X7YB 2WFMA 1ENZA 2W6JA 4LXUA 4QDZA 4RFSA 5B6JA 2I54A 4C6HA 3TTWA 5BR7A 1JFFA 4H7HA 4WKGA 3VU8A 1NNEA 4KR6A 1V7CA 2QJTA 1CFJA 5BVGB 2XMPA 1PWXA 5K3FB 1EWYA 2QVXX 3PXBA 2DWQA 1A50B 2QAIA 3H84A 3QU7A 4LOKA 3RSHA 4CF5A 3MXTA 2IOHA 5CA1F 3QX3A 4I8IA 1TZJA 3MT7A 1E5LA 1VIMA 1N25A 5DM1A 5B1EA 2FFBA 2D5AA 4UZFA 5I01A 4MWGA 2EERA 2HCFA 1HDXA 1RI4A 2DT8A 2QTWB 2BAGA 3MK31 2E9FA 4QVKA 5KVCA 1C9YA 2EFDB 3BN3A 1JBQA 3L8CA 1NUPA 2DG2A 3MLEA 2ZSBA 3OD1A 4G6ZA 4XTRA 1YI0A 1IXZA 5KDOA 3NDBB 4X66B 3TZCA 4G5XA 5J58A 2IPXA 1IUKA 1DGQA 1O87A 5C8YA 4RAOA 4RTOA 1D7OA 1RAHA 4BV3A 1OIXA 3EN0A 3EXFA 3IURA 1M34B 4OQDA 3NBFA 4F3TA 1OE0A 2DBQA 1ISFA 2H1IA 1A9XA 2VJCA 3DEKA 4KAJA 4LJ8A 3OZDA 3BXOA 1U5BA 2WIKA 4JVOA 3BWXA 1JEQB 1NURA 3O8NA 4DV4B 3QG1A 2PSEA 1QFJA 3OZEA 2OV6A 2AN3A 2XRZA 1GGKA 2B8JA 3OC6A 3OLYA 1GUAA 2Z5LA 2QTRA 2MINB 4G5HA 1SEPA 4UBLA 3T9EA 3AHEA 4ARZB 1GV1A 3WBJA 2JAQA 4CDNA 1RYEA 6ABPA 3GJ4A 4K46A 4KU4A 3JQ7B 3E82A 1JDUA 3DS8A 4J03A 5EJFA 4Z5XA 2FN7A 2PZFA 2IP2A 4R7TA 4EHAA 1DX6A 3QVWA 4FQ7A 3U3MA 3EW9A 1IEXA 2V55B 3QELB 4IX9A 1P2TA 1Q44A 4GBMA 5CFZA 3F6SA 2R6ZA 4KC0A 1RLIA 1XUOA 1IAVA 5LQRA 1W25A 4LYEA 2P4QA 5HILA 4C7BA 1HNNA 3KJZA 4B3BA 5AVUA 4CXMA 2WG2A 1XZAA 3KQNA 1Q1AA 2L42A 3CLRD 4ESHA 4IUCS 1LLCA 3OM8A 5JSHA 2RGAA 4PG4A 1JJ7A 5AKEA 3TLJA 4MRSA 4TYMA 1QVRA 1RQPA 3LDFA 1PR1A 5FV7A 1TB4A 1VI6A 4MUHA 3V5NA 3O1JC 1YS1X 1X1BA 5IFKA 3RVRA 2WBLC 5ETJA 5IAAA 4FLMA 4ER3A 3FDIA 1Y89A 4C88A 2ZJ0A 1HWYA 1YFZA 3F8TA 1K86A 3DDOA 3IVCA 3KBOA 4ZYWA 1CS4C 2VS1A 4XD7D 1SGWA 1BWQA 1PO7A 1YVPA 5ECYA 1KMQA 1E3TA 4IV0A 1PU2A 3LCJA 1E3JA 2YY7A 3QJ5A 3AB8A 4BNXA 1I94B 3N2EA 4ETIA 3L2OB 3ZHCA 5BRAA 5KNBA 3NLLA 2ODNA 4CV0A 4L9AA 3RSSA 5KU7A 4HWKA 5AVYA 4N48A 4FFBB 3Q7EA 3DD5A 3IIJA 2H52A 4TWBA 2PG3A 5HGXA 1MJ5A 3RG8A 2VJBA 3C6ZA 1BMFD 5TEWA 3UJBA 4D0NA 2A5YB 5K45A 4B32A 1NE7A 1HDZA 2X4DA 1JSXA 5DN9A 4V1CA 1EBUA 2AG1A 4PCUA 4I4LA 4QLAA 5FNVF 5TR9A 1LDEA 4FYYA 5ALGA 1SBQA 4UZEA 2GBGA 4AX4A 2YXPX 4L27A 3RO7A 3E5HA 3GFGA 4B85A 4R1UA 1ZN8A 4HS9A 4AX8A 2J85A 2HDOA 1J42A 3VISA 5AP9A 1XFDA 4PAGA 4CTJA 5CG1A 3NGLA 3I39X 2IZ0A 2C0QA 3LKDA 2RD2A 3VHLB 1DIHA 1P77A 4HFMA 1JR3E 1M8FA 4ZVVA 2OV1A 3L46A 1OGIA 1FUPA 4XDZA 1FFYA 2V7XA 1CRPA 1F9EA 1N3IA 3E9EA 4QJBA 3QVVA 3TIVA 3K0EA 1PR3A 1PT5A 2DPLA 2QUZA 3K9NA 4ZQFA 4RXTA 2X7JA 3T0FA 4DBZA 3VYWA 3I72A 4M38A 4EQ6A 3TK1A 1X13A 2GNPA 1YQGA 2HQSA 5I6DA 4ZOBA 3IDOA 4H1UA 4UAUA 5EWLB 1RQGA 4IEEA 4AYWA 2HQBA 4O2BA 4FOTA 1KDZA 3RUFA 3AUFA 3LBHA 1RWOA 3KLBA 3DVQX 2GBCA 1SBHA 2J4DA 1EH5A 2IF0A 2V65A 2QP9X 2HQOA 1WLYA 2NGRA 3OIVA 1E6EA 1T8PA 3OFND 2OP1A 4H18A 4Y0NA 2PZ8A 2XNJA 3N58A 1PWZA 1DG1G 2V3WA 3K1ZA 3O4IA 4J1TC 1SWWA 1L4UA 3LUKA 5GAJA 2X6RA 4FCVA 3R5XA 3G2KA 4OM8A 2HMWA 4IPTA 4PIMA 4UHFA 4Z0HO 5FA5A 5JS8A 3A9UA 4DYHA 2A5LA 3B2QA 4FYVA 4MHSA 4PTZA 3WSTA 1DKQA 2FE1A 2QZSA 2H7YA 4G36A 1MF7A 1Y5RA 2O3RA 2PTRA 4ZAWA 2FPUA 1CFZA 5LP6C 3ZNQA 4O1IA 2W2MA 4J3FA 4BVFA 1A8UA 1BRMA 3M1YA 2IEDA 4KL8S 3ZXSA 1DV1A 4DIEA 2BMDA 3B5IA 2JLZA 3O3OB 4Q7JB 3ZY6A 3PA8A 1K8RA 4GYYA 4TT3D 3AF0A 5T4BA 1JL3A 4Q7KA 4EABA 3INNA 3L05A 2WJJA 3FRIA 2BFCB 1XU7A 1G20A 3FD8A 3O83A 3DVAB 1CD5A 3NTRA 1YS6A 1U2DC 4D6YA 3UZUA 4ZO7A 5TARA 4FHZA 2H9IA 4X41A 5CT8A 3FFTA 3DFFA 3L7AA 1L3IA 2DP4E 3SS7X 1ZNZA 4JYZA 5E6RA 1AKTA 3ZH9B 1GQQA 1PZNA 1Y1QA 4FKZA 2Q6IA 5IHPA 1SUSA 4L4RA 1P5JA 3RT9A 3TW8A 4HGZA 1FUKA 1EFRD 2XEDA 4BGEA 4COKA 2AJLI 4Z4HA 2AI2A 3KJGA 5LQKA 1BGXT 3ACBA 5E38A 3FYUB 3TFQA 4D9MA 1MNQA 1OFGA 2HJGA 4FDMA 3PB3A 3WVNA 1ULHA 4KDCA 4JGGA 5A6SB 1SKAA 5D3ZA 3LDAA 1ZN2A 4RANA 1OAAA 1NPDA 4IV5A 1HDEA 1P7ZA 3QTBA 2D1FA 3SZLA 3W90A 2EDCA 2Z2IA 1KZ4A 1G3QA 3MS7A 3WWYA 4BNFA 1JR6A 2XQGA 2ATIA 2V74B 2GVNA 2OZKA 3E22A 5HCIA 1W0JA 3T6KA 5WRFA 3TB4A 5HKBA 1JAIA 3IEIA 3IVAA 2MMGA 3E9YA 4CI9A 1W19A 4E6EA 1ONNA 1P9WA 4XWYA 2YHBA 4MQLA 1WTAA 2ZUVA 1A5AB 3K7EA 3NH6A 3OP1A 1OU0A 2XCRB 3B53X 1QPZA 1P9OA 4KN6A 4MUMA 1I6KA 1S8AA 5C4IA 1EA7A 3JQAB 2J3HA 2O57A 3X1ZA 5FADA 4DRYA 1H9CA 3SG0A 3QWFA 4GEGA 1U1GA 1Y3BE 4GSLA 2AI1A 3V8BA 2CVZA 1P2UA 1W2WB 3HUFA 5EE5B 3KTAB 1V5WA 2NZ8A 5I5EA 3ZEIA 4TLDA 3WQRA 2FYTA 2IHUA 2J87A 4M6WA 4EOGA 3L43A 4IOMA 4RLQA 3JQAD 3H5LA 4LVNA 4C04A 1GG8A 2PVCA 3N05A 4MYTA 4ECEA 3KDSE 5JYCA 4PZ9A 2GTPA 1WO8A 1QE5A 1VHLA 2C1EA 4IH9A 3OIGA 4UUPA 1B0AA 2YXLA 4NJEA 2ZRCA 2WZCA 1ACLA 1E66A 1W48A 4ZT6A 1YA6A 2QMHA 2V6BA 3KSZO 4MJ3A 3FYDA 3RS5A 1PUIA 4B7ZA 3QH4A 4BLTA 2W42A 5H83A 1XRNA 3GBSA 5T41A 2O5CA 1UJ6A 1V5FA 5DO9A 3ZHYA 4J1QA 4I9HA 5JZVA 3KU1A 1HBJA 3NHPA 2MDTA 5BN5B 5DDIP 2WIBA 5B37A 2EIXA 4ZVLA 1EFLA 3ZD8A 2WVGA 2IYQA 2XCQA 3IP6A 5F73A 4O0LA 1HG0A 3JQRA 4DMFA 2C9DA 4QNRA 2PUBA 3LUFA 1MHTA 3WK7A 2EATA 4P2GA 1W96A 5IUKC 3HLKA 1A8IA 1TYEB 4N12A 2IH4A 4NU6A 2WT8A 2HVGA 3BMQA 4G0QA 3ZK8A 2FWRA 5CB4A 4NEQA 4NMXB 4LVUA 1JEOA 1SUPA 2CF6A 2L0XA 3D5EA 5DBFA 2IZ6A 3BXGA 4ND5A 3QFFA 4BFTA 1Z36A 1QU3A 2HPZA 3X44A 1SVNA 2CE2X 2QGNA 4DIMA 3V7UA 1NR5A 5J2TF 4E09A 3JYNA 4EATA 3EWSA 2FUKA 1TZ2A 4DNXA 1PGOA 3ET5A 3FGPA 4WUVA 1C7JA 3GZNB 1A4RA 3M6FA 1GA6A 2QVZX 4RIFA 3LPNA 2ALJA 5EKUA 1WB4A 4D9EA 1ISJA 3I8OA 4K40A 2WU1A 3CB4A 5B2EA 2AE1A 4NESA 2CD9A 3I2YX 4R69A 4AL4A 5ITZB 3U4IA 1NVXQ 3W9BA 4B71A 1ESDA 4ERXA 5ABPA 4OMCA 1F48A 3TQIA 5JAHA 2I8AA 4F5DA 2BFOA 3DT8A 5C7IO 2G6TA 4TLMB 4B2IA 4NCHA 4HNAB 5KWEA 3V8NA 1PYGA 2IXEA 2PZKA 2ZSKA 3RSCA 1H2XA 1SQ5A 2QVLA 2V5VA 3RW9A 4P84A 4IIDA 2B83A 2VF7A 3COWA 3WZLA 4MWTA 4OGWA 4WBNA 1BSVA 1EVIA 4J43A 5EP3A 5AVKA 2RKOA 4TMZA 4UNPA 1ZJ6A 2JCYA 3WI7A 5M29A 4G2NA 1JFRA 2BKLA 4ZARA 4OLHA 3HZOA 4WXPA 1XTRA 4OY3A 2FEMA 3EDOA 4QOIA 4B8ZA 3UJ6A 2CXPA 3B6ZA 4FCWA 3UXHA 1U3FA 2YNMA 1UMBB 1ZNXA 2NUPB 1KI2A 1II0A 2GF9A 2VBFA 4PR3A 3U7RA 4LW8A 1QH9A 1TZCA 2GTIA 3T3GA 3F5SA 2OTCA 3AIIA 5JC8A 2O52A 1F2UA 1T4BA 3DL7A 1SVMA 3EASA 3IJEB 3EGDB 1NYQA 1F0YA 2NO7A 3EQ6A 1GSIA 2Q2OA 3NETA 2W00A 3K0FA 4JN6B 1B43A 1IY0A 4OREX 3HRIA 2GT1A 3SIRA 3T5MA 3TD6A 3E7PA 5I48A 2BFAA 3VH4A 1MC8A 4K8RB 1V2GA 3TINA 4K6GA 3UW3A 1U6IA 4JOSA 3F4SA 1KYXA 721PA 3HZRA 1IL0A 1EWVA 1AKMA 1DAMA 1FMLA 3AGPA 3LLMA 1HL7A 1JIQA 2BFEA 2IRWA 3CG4A 3GH3A 4FLFA 3EG9B 4NJOA 2Q46A 3BKXA 5C3UA 3L7KA 2JA1A 2GZAA 3A4IA 4TVBA 3FPEA 1NVVQ 1TKBA 5AKJA 1E79A 1Z4QA 4JJ8A 2VRCA 1P72A 3CZCA 1HMPA 3AEUA 3KQLA 2VPYA 2DFLA 5EKTA 4HB4A 3O74A 4H1WA 4KOEC 1C4XA 2YCBA 3GN1A 3EAQA 3SEFA 4YA6A 1PL6A 2VNKA 5IEBA 1PJCA 3HB1A 3QSGA 1Y5IA 4G4JA 2I03A 3DUFB 4HV4A 2O0HA 2C7GA 4TKUB 5EE3A 4BJHB 3QEJA 2XZPA 2BEVB 3WIOA 1TK9A 4CTOA 3RHZA 1DJQA 2DUUA 2LCQA 4RC9A 3DHWC 1FDUA 1A4UA 3NHAA 2VAWA 5JS7A 1V43A 1IXRC 1XO1A 3AX6A 1ZH2A 1UAGA 3FJYA 4G1UC 2ZUEA 4DA9A 1ZK4A 4AZ3A 2C9MA 3LW7A 2YWDA 4B6OA 4CM8B 3EBPA 2EL9A 1GGVA 4GI7A 2X3UA 1QP7A 1JQDA 1JDTA 1AH2A 4EIWA 1YVDA 2TS1A 5FTMA 2J30A 4Z9AA 3A6EA 1GKIA 5CA0F 4DV7B 4OL9A 2PWZA 2QR5A 2BRUC 2ZIWB 3NHRA 3AKEA 5ESXA 4TXNA 1LZKA 4YCBA 1I4EB 2GWHA 1K98A 1V39A 3WG9A 2YOFA 3N0TA 2XQIA 3OPYB 3L9WA 3AETA 1YHZA 4GPBA 4BLSA 3OZTA 4LVOA 5CVUA 5JHHB 2YV3A 4RPKA 2DHRA 2I71A 1IPEA 4I7EA 4DJJA 3JQBC 5HMLA 5L95A 4XCQA 2WHQA 4AJEA 1CUVA 3NGXA 2VCYA 2AEMA 2IYFA 1K97A 3RT1A 1P8JA 1L5HA 2ZTMA 3HEAA 1M7BA 4U3JB 1SH7A 2XWJI 2BMVA 3KTOA 1WDMA 4O25A 3P9PA 2BFPA 1K62A 2A30A 3MD0A 1EAMA 2QNBA 3V4PB 1XQYA 3LGAA 4OXKA 3KKEA 3MUOA 4TLEA 4XQGA 3AHGA 1MUUA 3F97A 1L3CA 2Q9CA 4R2IA 3SC6A 4OXNA 1UL1X 3GLHE 3LHIA 2C54A 2F8TA 5DYYA 4DFDA 3Q5EA 2TECE 4Y9DA 3SBDA 2CEAA 3KWLA 1WQ4A 2I6UA 1SA0B 3DNMA 1ZH0A 4QFBA 3GJ8A 2R86A 2XUQA 4FIZA 3U1TA 1W5SA 4AB1A 4XWTA 4U2KA 2RHDA 3GCWA 2A5JA 2GPJA 1D3AA 1UBMS 4CKYA 2ZB4A 3MC1A 3ZIAA 4YXWD 1KAGA 3ROQA 1VXRA 4TKZA 5EKDA 3C3XA 5EZYB 2J0QA 2PKCA 5FOSA 1QMPA 5I7OA 1KVTA 2JBWA 4GRDA 1JYFA 4PSKA 5EJAA 3ZS9A 1E1LA 2C4TA 4R68A 2E55A 4BBZA 4D9IA 1MX1A 3R1IA 4JLDA 1TIPA 5ANRB 4BMVA 4BRWA 5DM60 6REQB 3CT6A 3ZBQA 2C61A 1I4WA 2OD9A 2HD4A 2P68A 3MPOA 4UBMA 2C7RA 4ZALA 4DCOA 4E07A 5CEFA 3B82A 2WHXA 2C3OA 4URVR 5JSFA 6CHYA 3AOGA 3G1UA 4LSWA 5L51A 3QPUA 2ILVA 5KX5B 1A9SA 3F4RA 1OOEA 4D79A 3KL4A 1QPBA 2YY6A 3ETLA 4WTOA 5AK3A 4E5VA 5ITSA 1GTJ1 1QB8A 3MZ0A 3NKVA 1EFHA 1RC1A 1K5DA 4AXBA 2CUKA 4RLFA 4UXHA 5ECWA 1RYMA 4R6XA 3U09A 3O1LA 3PHCA 2I22A 4MQBA 2E1RA 4WXRA 4F2PA 5B7NA 4NV1A 4RTLA 1ULSA 3LQYA 5A9RA 1J1ZA 1C8LA 2OQRA 3WIUA 5LOVB 3NYIA 4IDGA 3Q8MA 1LS1A 4BRSA 1YASA 3LZDA 2IQ5A 3HJAA 3EYAA 1A27A 4GP6A 1E99A 3PE4A 3MS2A 2XV1A 3GC6A 5AM5A 4ROTA 5EJ2A 5HE9A 2M6LA 4AQDA 3BEDA 1OY1A 3IOBA 2BKVA 3QHQA 4QYIA 3TBFA 2FEWB 3GCDA 3AK4A 4DC9A 2FG6C 4BMNA 2WSMA 1NJSA 1P39A 3E4CA 1E60A 5H3HA 1YULA 4HTFA 1EZ4A 3CO5A 5EEHA 3IX7A 5L3VA 4R2WA 4Y9SA 3H9GA 4CE6A 3QQPA 1NQVA 2HQRA 1A71A 1SOVA 4J1TA 1T2UA 3CH7A 2FHSA 3Q1LA 4ALMA 1N9GB 3FNBA 3M2PA 1Q1EA 3JTEA 1A0OA 1IB6A 3NIBA 3EMVA 2M1XA 3G89A 4N0EA 3FFXA 5CVEA 4AUMA 2VH2A 1NXPA 4RO0A 2I4OA 4YEDA 3MILA 1QM5A 2OLEA 3HP4A 5GGYA 1K6JA 5HFJA 3RPEA 4UBOA 5LP6A 2V45A 1LRKA 3OA2A 1FYDA 1TZMA 3P0EA 3O8QA 2FPGA 3ZK9A 1Y4AE 5EJ9A 4R2MA 4GPEA 1ZJJA 3K72B 1Q74A 4BPRA 3NS7A 5AKXA 3I52A 5HW2A 4UAVA 3EIFA 3P9NA 5DCUA 4ED9A 1RIIA 2ATCA 3DLIA 2RI6A 4JEMA 1U2DA 4ZVOA 3IC5A 4HAXA 2PFGA 4JYAB 1FSPA 4Z51A 3CRZA 1JGTA 4MX8A 5AOVA 1OLXA 2ZU0C 4XWWA 3ZZ0A 1NZDA 1I33A 2VPQA 3NW9A 4NR0A 4BFWA 4PQFA 3THWA 1XDGA 3IRVA 5U4XA 3C48A 3ZHUA 5FBQB 1QKJA 2CNKA 4PYIA 4BRUA 2H08A 5BO5A 3HNRA 4K6HA 2EKZA 4RS3A 1SU4A 4A8TA 3KS9A 1O4WA 2I2AA 2FX2A 4IRUB 1BQ3A 5MDHA 1M2FA 1NY6A 1BDBA 4MW7A 2OG2A 4I9GA 3OAAA 4PQYA 5EJ7A 1O77A 1KK1A 4XUDA 3ETHA 3WL8A 5A6VA 5JATA 1VLVA 2P9QA 1P81A 1TMYA 2KHZA 1OKKA 5TGZA 3WRXC 3B1ZA 3SOPA 5FLXA 4INPA 4JLVA 3B48A 1IVYA 1M2OB 3GX1A 3AKZA 1FFWA 3G2JA 2OMKA 2DECA 3GHHA 1QO0A 4Y7CA 1L4KA 4L8LA 1Q1GA 2E21A 4BNDB 4ZJYA 5B3JC 2GYYA 2FWAA 4WZAB 1OLUB 2XCLA 2Y2UA 2G08A 3NUGA 4BFCA 3WHLA 4WH0A 1VYUA 4MYRA 4YY3B 3DE1X 1P0CA 2B21A 1SMKA 2WPDA 4L22A 3CTPA 2HHAA 3M8KA 2VK2A 5EWJB 1AXGA 3AXTA 1GAWA 1YDMA 1NP3A 2AOTB 2CKMA 3PDWA 1J9EA 4ZZ3A 3K0HA 2B8EA 2HSJA 3IE2A 3QF4B 4WESA 2OAQ1 2QU7A 3TRKA 3WSVA 4BTVA 2ZR7A 4F71A 3Q11A 2PMFA 4G5FA 1WXHA 4Z9BA 4X91A 2P0YA 3BIXA 5H9VA 4Q1CA 1IZ7A 3DC2A 4YGYA 4J0EA 4KDFA 5FI1B 3L41A 3UAXA 1PJLA 3I05A 4PTYA 3EF0A 1XWWA 1PG5A 3I9KA 3EUWA 3NDIA 3DV9A 4HFJA 1J0BA 1P3DA 2WVAA 3V8MA 3R9KA 1ADYA 1JEDA 2XNKA 4O0MA 5BW8A 1CEXA 2BFMA 2NSDA 1SVWA 5TQ2B 3WMGA 5A2GA 1DG9A 4H0NA 3ONWA 4S24A 1U8UA 1KSFX 1H65A 4LBZA 3IEVA 1ZMBA 4CMCA 2ZS7A 3ICWA 5EIXA 4DSAA 5IKXA 3WWDA 2OZVA 2HNKA 3G1WA 4O4LB 5ESWA 2IOQA 4GIBA 4NXMB 3ISTA 1VPEA 3BD7A 3M70A 4UHCA 4EZBA 2VNIA 5K5EA 4GQAA 2P3LA 2ORVA 1MXFA 3HVIA 3WP1B 1XNGA 3QV1A 2V7QD 1Z5WA 3EH2A 4A15A 2NU8B 1L2TA 4PFJA 2ID8A 4IIJF 4KQJA 1A96A 4U9IS 4XM1A 3VVLA 4U2EA 4AAYA 6YASA 5E9QA 2PUFA 2RHCA 1CY7A 2GCOB 3NIFB 4UC0A 4F46A 1QHHA 1Z0AA 5BYKA 4NONA 4CRWB 4C0JA 4NNOA 5F23A 2TMYA 3T7SA 2COKA 3N8IA 2XT9A 2HWUA 3W5DA 2Z95A 3E9CA 3C3EA 3ENVA 4XM0A 1QOPB 3LC7O 1UMCA 2MT9A 3JCZA 3RYTC 4YRQA 1RKXA 5LU9A 4QDOA 2YYAA 1V7QA 2QTVA 2IU3A 5KYUB 3PF9A 2CMFA 1ZGCA 2IOFA 3G6KA 4YRDA 5E6SA 5G0TA 1GR0A 1FVXA 3HLYA 5JC1A 1XEXA 4RHCA 3DPSA 3PDCA 5AICA 1QRUA 1EFDN 2Q5HA 3Q9UA 1EVLA 5FX2A 1MH9A 2XA9A 4LRWA 5EYPA 1WMAA 3LXMA 4HEHA 3DWFA 2ZULA 4HO1X 3JQEA 4JWTA 2PS9A 1AU9A 2G7ZA 2IXDA 2BUAA 2X5NA 3LC1O 1KKMA 3HJRA 4M9XA 3FPKA 3UVEA 2N46A 2WV7A 5IDWA 2DFTA 1ESZA 1DOHA 4JFAA 4N82A 3NNDA 1YRQA 3GJYA 3KU4A 5KYKA 4F72A 2QHXA 1JLMA 2JJ1A 4Y2JA 3QGMA 3PSHA 4EFMA 4B7UA 2F00A 4L1KA 4Z0NA 5PGMA 3RUAA 4B6RA 1I8TA 1WPGA 4YT5A 4CR8A 4EBFA 2B7BA 3JR3A 4OQYA 2A94A 4Z3KA 5HFAA 1Z33A 1DBPA 1HQKA 1Z88A 4OH7A 1V1RA 3ETNA 4R1LA 3UUFA 1LC3A 3UXEA 2VJAA 5L40A 4E1BA 1ZI6A 4WFQA 4X6YA 4YDHB 4GM0A 3ORFA 2Q5IA 5TMBA 4RM3A 4DIUA 4IJWA 1EFKA 4M0CA 4X0EA 2I4NA 2VOJA 4F12A 3E9NA 3BGOS 1C3OB 1Z2AA 6Q21A 1FNMA 3EVZA 5GONB 2EW1A 5ESDA 3WRVA 3T3PB 4YDQA 3CI0K 4G09A 4OKIA 2BCJQ 1Z28A 2EJWA 4EUHA 3P4UA 4LF7B 2ZJ5A 3PC2A 3OZSA 5EXEA 1AXRA 3H2HA 5H16A 4QGSA 4R2KA 3P27A 2WY2D 3KV3O 1QWSA 1DI0A 3ONDA 2BFDB 1J07A 4RL6A 1GL3A 2Z09A 1L1RA 3D5QA