2D27A

Structure of the n-terminal domain of xpse (crystal form i4122)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
148
structure length
148
Chain Sequence
MEQRSAETRIVEALLERRRLKDTDLLRARQLQAESGMGLLALLGRLGLVSERDHAETCAEVLGLPLVDARQLGDTPPEMLPEVQGLSLRFLKQFHLCPVGERDGRLDLWIADPYDDYAIDAVRLATGLPLLLHVGLRSEIDDLIERWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of the XpsE N-Terminal Domain, an Essential Component of the Xanthomonas campestris Type II Secretion System
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Protein transport
molecule keywords type II secretion ATPase XpsE
total genus 43
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2005-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.70 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Ribonucleotide Reductase Protein R1; domain 1 2d27A01
3.30.300.160 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2d27A02
2D27A 2BH1X 4PHTA 2D28C
chains in the Genus database with same CATH superfamily
5E7QA 1PU1A 4XX2A 3CJEA 4AQYC 1AUWA 3T1HC 4G36A 3C8TA 2Z51A 1O9TA 3GTDA 4BC7A 1IB8A 3EERA 5BR8C 4LF6C 4LF4C 1O93A 3LAXA 3AY0A 3CW8X 5BUSA 3J80D 4OXIA 3KXWA 4JI3C 3UEBA 1XWOA 1Q92A 4APBA 4DR5C 3ETCA 3GR1A 4RM2A 1XMQC 1IW7D 1XHJA 4LF5C 4IZ6A 5IT9D 3RD8A 1IBKC 2PROA 2PFMA 5AE2A 2UUBC 3BWVA 3B7WA 2YCBA 2PN2A 1V60A 1JSWA 1M6XC 3N2QA 4JI2C 4HGVA 2BH1X 4DCUA 2HHHC 1NY8A 3TQIA 1FJGC 4ODJA 4RM3A 4NDNA 4WS9A 3DLPX 4JI4C 2P2FA 4K0BA 1HR0C 1UKKA 4NXNC 5DV9A 2YWCA 3GPCA 3J81D 1XRBA 1K7WA 1ZB8A 4BCAA 3AF6A 5T8SA 1LQLA 4X64C 2D1TA 4RLQA 4DR1C 3SO4A 3TV2A 3F4RA 4IR7A 4KTTA 1TJVA 4NSLA 4L7IA 1TH5A 2KZ0A 3GR0A 2WP0C 2UXCC 1USPA 4DG8A 4JYAC 3H2TA 4U5YD 2V7BA 1KQ7A 3OCEA 1MD9A 3R44A 4K0KC 2CY1A 3IEVA 2MMAB 2XR1A 1U0LA 5GTDA 1HNWC 1HY0A 3LNVA 3VNSA 2P02A 3CI0K 4NOZA 3OCFA 2JARA 1Z4QA 2OBVA 4NLEA 2YX1A 4R1LA 4KHPC 1FLOA 1WCJA 4L6AA 2D1QA 5K8FA 4OYCA 3S82A 2D1RA 1V26A 2QW0X 1LCIA 4GS5A 4PHTA 5A1IA 5BSWA 1FUPA 4GXRA 4I9FA 2PT7G 1C3CA 1DOFA 1P4EC 4NXMC 4GKKC 3ETOA 4DV6C 1C3UA 1TJWA 1Z4LA 2Y4NA 3A26A 4IQJM 2ZM6C 4B3MC 2KZFA 1IBLC 4JV5C 2QVZX 4BSZA 4G1IA 2P2JA 2DYJA 3CW9A 2PTQA 4ISBA 2DHMA 3LNOA 3UX2A 1PG4A 5LCIA 4APAA 4RMNA 4RLFA 4E88A 5KEIA 3O2EA 2PTRA 3NYQA 3RG2A 4L6CA 1YJ7A 2DPLA 5BSUA 2YV5A 4DCTA 4NFLA 4R1MA 4R0MA 3TUFA 2UXBC 1HNXC 4OX9C 2F4VC 4DR7C 4DV3C 3UOWA 4GXQA 2CU6A 2MM9A 1ULTA 4JI5C 4X62C 5AE3A 2OPLA 4LFBC 4ZJZA 2PTSA 1P4EA 2ZZMA 1ZB9A 3RV2A 2E8CA 3F4TA 4LF9C 2KDNA 4MTNA 1QM4A 3PBKA 5BSMA 3IMLA 1Z4JA 2HVGA 3I08A 2E8EA 2I7DA 2AYAA 4GKJC 3F4SA 1T9HA 2VZEA 3UZ0A 1J5EC 3PROC 2FUSA 4ADLA 3U19A 1T5DX 4LE5A 3A4IA 1FUQA 5D6BA 4EATA 3UX3A 1WF3A 1IBMC 4I9GA 1FURA 2P2MA 4ZLPA 5IWAC 3TR3A 1Q91A 3IPLA 3DHVA 4PUHA 1RG9A 3E04A 5K85A 2P20A 1AMUA 5KYVA 1HY1A 3K6RA 1Z4KA 1BA3A 1I94C 3AF5A 2OO4A 2E8FA 2P2BA 3U13A 4B3TC 1VDKA 4DR2C 5BUQA 3G7SA 2E0GA 2VQFC 1XMOC 2D7VA 1Z4MA 1U15A 1K0RA 1PA4A 3CQ1A 4DCVA 4DUYC 1GPMA 5T8TA 3E7WA 3L8CA 2D28C 4JI0C 1N36C 4D57A 1N32C 4MX2A 1ML8A 3EQ6A 2WD9A 1HH2P 1J3UA 1MH9A 1JOSA 4DR4C 4PZPA 4DCSA 1YFEA 1T5HX 3NO9A 1MDFA 1XRAA 4D56A 2OPLB 2X75A 2D1SA 1MDBA 5JRHA 4DV7C 4D4IA 2JAWA 2JAUA 4FUQA 2P2QA 4FTFA 5HW2A 3A9UA 1XNRC 1Z4IA 3CQ2A 1WH9A 4PROC 3JAMD 5BSVA 3VNQA 5A19A 5A2QD 4DV5C 4FUTA 1V25A 2Y27A 4TPSB 1UWDA 1I0AA 5CZXA 1VEHA 2YWBA 3VNRA 2UU9C 3R9XA 1KKGA 1Q5NA 1MKYA 4MWOA 2QVYX 5IFIA 3NI2A 4DR3C 1HNZC 2CXCA 3NYRA 5KYTA 4LF7C 3PESA 3R6VA 3GKUA 1MXAA 1N34C 1XNQC 3LGXA 4JM1A 5BURA 2BJOA 1XRCA 3FCCA 1U16A 1O92A 4PUGA 2MCQA 4L2ZA 5BSTA 3R9WA 3T1YC 3RRPA 1VLAA 1TJUA 2ONFA 1L2FA 1N33C 5FLXD 3DAYA 4BBYA 4DV1C 3BHGA 3C5EA 4PUIA 5F91A 2EGTA 4EFCA 4EEIA 3E7XA 4DR6C 3R6QA 2QGAB 4YIKA 4JI8C 3CQ3A 4X65C 2ZZNA 2UXDC 2Y4OA 2QVXX 5AE1A 4HPVA 4B3SC 4LFAC 1O90A 1RY2A 3NPDA 3LUSA 1K62A 1FUGA 3TDEA 4X66C 4L57A 2ASBA 4B3RC 2E7GA 2M5HA 4JI7C 4L4QA 1Z4PX 2M5OA 2NCLA 4KTVA 1N2FA 4D4GA 3A25A 2JAOA 4YIHA 1XS3A 1NYEA 4MH4A 4G37A 1MXCA 4YHHC 2VQEC 4DUZC 1USPB 2VSQA 4JI1C 4BC9A 1FUOA 4WV3A 4YY3C 5CZVA 2UUAC 3IEUA 2UUCC 4DV0C 5LMNC 3N54B 3FCEA 4DV4C 5A1GA 3L95X 1QWIA 2D27A 1RE5A 4LF8C 3QBPA 2JMPA 3A9VA 2HJGA 2E9FA 1YFMA 5F92A 5BSRA 1P7LA 2ATWA 4MUMA 2QL8A 5LMUC 3I07A 3OTOC 5ADZA 4LFCC 4ADMA 1PG3A 2JNVA 4DG9A 4DV2C 1MXBA 1DCNA 4RVNA 4JI6C 3GZHA 2E5LC 1M6XA 1TJ7A 5H9UA 2RCNA 1EGAA 4RVOA
chains in the Genus database with same CATH topology
5E7QA 4XX2A 3CJEA 4AQYC 3T1HC 4G36A 1O9TA 4BC7A 3EERA 5BR8C 4LF6C 4LF4C 1O93A 3LAXA 3CW8X 5BUSA 3J80D 4OXIA 3KXWA 4JI3C 4DR5C 3ETCA 3GR1A 4RM2A 1XMQC 1IW7D 4LF5C 4IZ6A 5IT9D 1IBKC 2PROA 5AE2A 2UUBC 3B7WA 2YCBA 2PN2A 3N2QA 4JI2C 2BH1X 4DCUA 2HHHC 3TQIA 1FJGC 4ODJA 4RM3A 4NDNA 4WS9A 3DLPX 4JI4C 2P2FA 4K0BA 1HR0C 1UKKA 4NXNC 5DV9A 2YWCA 3GPCA 3J81D 1XRBA 1ZB8A 3AF6A 4BCAA 5T8SA 1LQLA 4X64C 2D1TA 4RLQA 4DR1C 3SO4A 3F4RA 4IR7A 4KTTA 4L7IA 3GR0A 2WP0C 2UXCC 1USPA 4DG8A 4JYAC 3H2TA 4U5YD 2V7BA 1MD9A 3R44A 4K0KC 2CY1A 3IEVA 2XR1A 5GTDA 1HNWC 3LNVA 3VNSA 2P02A 4NOZA 2OBVA 4R1LA 4KHPC 2D1QA 5K8FA 4OYCA 3S82A 2D1RA 1V26A 2QW0X 1LCIA 4GS5A 4PHTA 5A1IA 5BSWA 4GXRA 4I9FA 2PT7G 4NXMC 4GKKC 3ETOA 4DV6C 2Y4NA 4IQJM 2ZM6C 4B3MC 2KZFA 1IBLC 4JV5C 2QVZX 4BSZA 4G1IA 2P2JA 2DYJA 3CW9A 4ISBA 1PG4A 4RMNA 4RLFA 5KEIA 3NYQA 3RG2A 1YJ7A 2DPLA 5BSUA 4DCTA 4R1MA 4R0MA 3TUFA 2UXBC 1HNXC 4OX9C 2F4VC 4DR7C 4DV3C 3UOWA 4GXQA 1ULTA 4JI5C 4X62C 5AE3A 2OPLA 4LFBC 4ZJZA 1ZB9A 3RV2A 2E8CA 3F4TA 4LF9C 4MTNA 1QM4A 3PBKA 5BSMA 3IMLA 3I08A 2E8EA 2AYAA 4GKJC 3F4SA 3UZ0A 2VZEA 1J5EC 3PROC 1T5DX 4LE5A 3A4IA 4EATA 1WF3A 1IBMC 4I9GA 2P2MA 4ZLPA 5IWAC 3IPLA 3DHVA 1RG9A 5K85A 2P20A 1AMUA 5KYVA 1BA3A 1I94C 3AF5A 2OO4A 2E8FA 2P2BA 4B3TC 4DR2C 5BUQA 3G7SA 2E0GA 2VQFC 1XMOC 2D7VA 1PA4A 1K0RA 4DCVA 4DUYC 1GPMA 5T8TA 3E7WA 3L8CA 2D28C 4JI0C 1N36C 4D57A 1N32C 1ML8A 3EQ6A 2WD9A 1HH2P 1JOSA 4DR4C 4PZPA 4DCSA 1T5HX 1XRAA 1MDFA 4D56A 2OPLB 2D1SA 1MDBA 5JRHA 4DV7C 4D4IA 4FUQA 2P2QA 4FTFA 3A9UA 1XNRC 4PROC 1WH9A 3JAMD 5BSVA 3VNQA 5A19A 5A2QD 4DV5C 4FUTA 1V25A 2Y27A 4TPSB 5CZXA 2YWBA 3VNRA 1KKGA 2UU9C 3R9XA 1MKYA 2QVYX 5IFIA 3NI2A 4DR3C 1HNZC 2CXCA 3NYRA 5KYTA 4LF7C 3PESA 3GKUA 1MXAA 1N34C 1XNQC 3LGXA 4JM1A 5BURA 2BJOA 1XRCA 3FCCA 1O92A 4L2ZA 5BSTA 3R9WA 3T1YC 1VLAA 2ONFA 1L2FA 1N33C 5FLXD 3DAYA 4BBYA 4DV1C 3C5EA 2EGTA 3E7XA 4DR6C 4JI8C 4X65C 2UXDC 2Y4OA 2QVXX 5AE1A 4HPVA 4B3SC 4LFAC 1O90A 1RY2A 3NPDA 3LUSA 1FUGA 3TDEA 4X66C 2ASBA 4B3RC 2E7GA 4JI7C 4L4QA 4KTVA 1N2FA 4D4GA 1NYEA 4MH4A 4G37A 1MXCA 4YHHC 2VQEC 4DUZC 1USPB 2VSQA 4JI1C 4BC9A 4WV3A 4YY3C 5CZVA 2UUAC 3IEUA 2UUCC 4DV0C 5LMNC 3N54B 3FCEA 4DV4C 5A1GA 3L95X 1QWIA 2D27A 4LF8C 2JMPA 3A9VA 2HJGA 5BSRA 1P7LA 2ATWA 2QL8A 5LMUC 3I07A 3OTOC 5ADZA 4LFCC 1PG3A 4DG9A 4DV2C 1MXBA 4RVNA 4JI6C 2E5LC 5H9UA 1EGAA 4RVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D27 A;  2BH1 X;  4PHT A;  2D28 C; 
#chains in the Genus database with same CATH topology
 5E7Q A;  1PU1 A;  4XX2 A;  3CJE A;  4AQY C;  1AUW A;  3T1H C;  4G36 A;  3C8T A;  2Z51 A;  1O9T A;  3GTD A;  4BC7 A;  1IB8 A;  3EER A;  5BR8 C;  4LF6 C;  4LF4 C;  1O93 A;  3LAX A;  3AY0 A;  3CW8 X;  5BUS A;  3J80 D;  4OXI A;  3KXW A;  4JI3 C;  3UEB A;  1XWO A;  1Q92 A;  4APB A;  4DR5 C;  3ETC A;  3GR1 A;  4RM2 A;  1XMQ C;  1IW7 D;  1XHJ A;  4LF5 C;  4IZ6 A;  5IT9 D;  3RD8 A;  1IBK C;  2PRO A;  2PFM A;  5AE2 A;  2UUB C;  3BWV A;  3B7W A;  2YCB A;  2PN2 A;  1V60 A;  1JSW A;  1M6X C;  3N2Q A;  4JI2 C;  4HGV A;  2BH1 X;  4DCU A;  2HHH C;  1NY8 A;  3TQI A;  1FJG C;  4ODJ A;  4RM3 A;  4NDN A;  4WS9 A;  3DLP X;  4JI4 C;  2P2F A;  4K0B A;  1HR0 C;  1UKK A;  4NXN C;  5DV9 A;  2YWC A;  3GPC A;  3J81 D;  1XRB A;  1K7W A;  1ZB8 A;  4BCA A;  3AF6 A;  5T8S A;  1LQL A;  4X64 C;  2D1T A;  4RLQ A;  4DR1 C;  3SO4 A;  3TV2 A;  3F4R A;  4IR7 A;  4KTT A;  1TJV A;  4NSL A;  4L7I A;  1TH5 A;  2KZ0 A;  3GR0 A;  2WP0 C;  2UXC C;  1USP A;  4DG8 A;  4JYA C;  3H2T A;  4U5Y D;  2V7B A;  1KQ7 A;  3OCE A;  1MD9 A;  3R44 A;  4K0K C;  2CY1 A;  3IEV A;  2MMA B;  2XR1 A;  1U0L A;  5GTD A;  1HNW C;  1HY0 A;  3LNV A;  3VNS A;  2P02 A;  3CI0 K;  4NOZ A;  3OCF A;  2JAR A;  1Z4Q A;  2OBV A;  4NLE A;  2YX1 A;  4R1L A;  4KHP C;  1FLO A;  1WCJ A;  4L6A A;  2D1Q A;  5K8F A;  4OYC A;  3S82 A;  2D1R A;  1V26 A;  2QW0 X;  1LCI A;  4GS5 A;  4PHT A;  5A1I A;  5BSW A;  1FUP A;  4GXR A;  4I9F A;  2PT7 G;  1C3C A;  1DOF A;  1P4E C;  4NXM C;  4GKK C;  3ETO A;  4DV6 C;  1C3U A;  1TJW A;  1Z4L A;  2Y4N A;  3A26 A;  4IQJ M;  2ZM6 C;  4B3M C;  2KZF A;  1IBL C;  4JV5 C;  2QVZ X;  4BSZ A;  4G1I A;  2P2J A;  2DYJ A;  3CW9 A;  2PTQ A;  4ISB A;  2DHM A;  3LNO A;  3UX2 A;  1PG4 A;  5LCI A;  4APA A;  4RMN A;  4RLF A;  4E88 A;  5KEI A;  3O2E A;  2PTR A;  3NYQ A;  3RG2 A;  4L6C A;  1YJ7 A;  2DPL A;  5BSU A;  2YV5 A;  4DCT A;  4NFL A;  4R1M A;  4R0M A;  3TUF A;  2UXB C;  1HNX C;  4OX9 C;  2F4V C;  4DR7 C;  4DV3 C;  3UOW A;  4GXQ A;  2CU6 A;  2MM9 A;  1ULT A;  4JI5 C;  4X62 C;  5AE3 A;  2OPL A;  4LFB C;  4ZJZ A;  2PTS A;  1P4E A;  2ZZM A;  1ZB9 A;  3RV2 A;  2E8C A;  3F4T A;  4LF9 C;  2KDN A;  4MTN A;  1QM4 A;  3PBK A;  5BSM A;  3IML A;  1Z4J A;  2HVG A;  3I08 A;  2E8E A;  2I7D A;  2AYA A;  4GKJ C;  3F4S A;  1T9H A;  2VZE A;  3UZ0 A;  1J5E C;  3PRO C;  2FUS A;  4ADL A;  3U19 A;  1T5D X;  4LE5 A;  3A4I A;  1FUQ A;  5D6B A;  4EAT A;  3UX3 A;  1WF3 A;  1IBM C;  4I9G A;  1FUR A;  2P2M A;  4ZLP A;  5IWA C;  3TR3 A;  1Q91 A;  3IPL A;  3DHV A;  4PUH A;  1RG9 A;  3E04 A;  5K85 A;  2P20 A;  1AMU A;  5KYV A;  1HY1 A;  3K6R A;  1Z4K A;  1BA3 A;  1I94 C;  3AF5 A;  2OO4 A;  2E8F A;  2P2B A;  3U13 A;  4B3T C;  1VDK A;  4DR2 C;  5BUQ A;  3G7S A;  2E0G A;  2VQF C;  1XMO C;  2D7V A;  1Z4M A;  1U15 A;  1K0R A;  1PA4 A;  3CQ1 A;  4DCV A;  4DUY C;  1GPM A;  5T8T A;  3E7W A;  3L8C A;  2D28 C;  4JI0 C;  1N36 C;  4D57 A;  1N32 C;  4MX2 A;  1ML8 A;  3EQ6 A;  2WD9 A;  1HH2 P;  1J3U A;  1MH9 A;  1JOS A;  4DR4 C;  4PZP A;  4DCS A;  1YFE A;  1T5H X;  3NO9 A;  1MDF A;  1XRA A;  4D56 A;  2OPL B;  2X75 A;  2D1S A;  1MDB A;  5JRH A;  4DV7 C;  4D4I A;  2JAW A;  2JAU A;  4FUQ A;  2P2Q A;  4FTF A;  5HW2 A;  3A9U A;  1XNR C;  1Z4I A;  3CQ2 A;  1WH9 A;  4PRO C;  3JAM D;  5BSV A;  3VNQ A;  5A19 A;  5A2Q D;  4DV5 C;  4FUT A;  1V25 A;  2Y27 A;  4TPS B;  1UWD A;  1I0A A;  5CZX A;  1VEH A;  2YWB A;  3VNR A;  2UU9 C;  3R9X A;  1KKG A;  1Q5N A;  1MKY A;  4MWO A;  2QVY X;  5IFI A;  3NI2 A;  4DR3 C;  1HNZ C;  2CXC A;  3NYR A;  5KYT A;  4LF7 C;  3PES A;  3R6V A;  3GKU A;  1MXA A;  1N34 C;  1XNQ C;  3LGX A;  4JM1 A;  5BUR A;  2BJO A;  1XRC A;  3FCC A;  1U16 A;  1O92 A;  4PUG A;  2MCQ A;  4L2Z A;  5BST A;  3R9W A;  3T1Y C;  3RRP A;  1VLA A;  1TJU A;  2ONF A;  1L2F A;  1N33 C;  5FLX D;  3DAY A;  4BBY A;  4DV1 C;  3BHG A;  3C5E A;  4PUI A;  5F91 A;  2EGT A;  4EFC A;  4EEI A;  3E7X A;  4DR6 C;  3R6Q A;  2QGA B;  4YIK A;  4JI8 C;  3CQ3 A;  4X65 C;  2ZZN A;  2UXD C;  2Y4O A;  2QVX X;  5AE1 A;  4HPV A;  4B3S C;  4LFA C;  1O90 A;  1RY2 A;  3NPD A;  3LUS A;  1K62 A;  1FUG A;  3TDE A;  4X66 C;  4L57 A;  2ASB A;  4B3R C;  2E7G A;  2M5H A;  4JI7 C;  4L4Q A;  1Z4P X;  2M5O A;  2NCL A;  4KTV A;  1N2F A;  4D4G A;  3A25 A;  2JAO A;  4YIH A;  1XS3 A;  1NYE A;  4MH4 A;  4G37 A;  1MXC A;  4YHH C;  2VQE C;  4DUZ C;  1USP B;  2VSQ A;  4JI1 C;  4BC9 A;  1FUO A;  4WV3 A;  4YY3 C;  5CZV A;  2UUA C;  3IEU A;  2UUC C;  4DV0 C;  5LMN C;  3N54 B;  3FCE A;  4DV4 C;  5A1G A;  3L95 X;  1QWI A;  2D27 A;  1RE5 A;  4LF8 C;  3QBP A;  2JMP A;  3A9V A;  2HJG A;  2E9F A;  1YFM A;  5F92 A;  5BSR A;  1P7L A;  2ATW A;  4MUM A;  2QL8 A;  5LMU C;  3I07 A;  3OTO C;  5ADZ A;  4LFC C;  4ADM A;  1PG3 A;  2JNV A;  4DG9 A;  4DV2 C;  1MXB A;  1DCN A;  4RVN A;  4JI6 C;  3GZH A;  2E5L C;  1M6X A;  1TJ7 A;  5H9U A;  2RCN A;  1EGA A;  4RVO A; 
#chains in the Genus database with same CATH homology
 5E7Q A;  4XX2 A;  3CJE A;  4AQY C;  3T1H C;  4G36 A;  1O9T A;  4BC7 A;  3EER A;  5BR8 C;  4LF6 C;  4LF4 C;  1O93 A;  3LAX A;  3CW8 X;  5BUS A;  3J80 D;  4OXI A;  3KXW A;  4JI3 C;  4DR5 C;  3ETC A;  3GR1 A;  4RM2 A;  1XMQ C;  1IW7 D;  4LF5 C;  4IZ6 A;  5IT9 D;  1IBK C;  2PRO A;  5AE2 A;  2UUB C;  3B7W A;  2YCB A;  2PN2 A;  3N2Q A;  4JI2 C;  2BH1 X;  4DCU A;  2HHH C;  3TQI A;  1FJG C;  4ODJ A;  4RM3 A;  4NDN A;  4WS9 A;  3DLP X;  4JI4 C;  2P2F A;  4K0B A;  1HR0 C;  1UKK A;  4NXN C;  5DV9 A;  2YWC A;  3GPC A;  3J81 D;  1XRB A;  1ZB8 A;  3AF6 A;  4BCA A;  5T8S A;  1LQL A;  4X64 C;  2D1T A;  4RLQ A;  4DR1 C;  3SO4 A;  3F4R A;  4IR7 A;  4KTT A;  4L7I A;  3GR0 A;  2WP0 C;  2UXC C;  1USP A;  4DG8 A;  4JYA C;  3H2T A;  4U5Y D;  2V7B A;  1MD9 A;  3R44 A;  4K0K C;  2CY1 A;  3IEV A;  2XR1 A;  5GTD A;  1HNW C;  3LNV A;  3VNS A;  2P02 A;  4NOZ A;  2OBV A;  4R1L A;  4KHP C;  2D1Q A;  5K8F A;  4OYC A;  3S82 A;  2D1R A;  1V26 A;  2QW0 X;  1LCI A;  4GS5 A;  4PHT A;  5A1I A;  5BSW A;  4GXR A;  4I9F A;  2PT7 G;  4NXM C;  4GKK C;  3ETO A;  4DV6 C;  2Y4N A;  4IQJ M;  2ZM6 C;  4B3M C;  2KZF A;  1IBL C;  4JV5 C;  2QVZ X;  4BSZ A;  4G1I A;  2P2J A;  2DYJ A;  3CW9 A;  4ISB A;  1PG4 A;  4RMN A;  4RLF A;  5KEI A;  3NYQ A;  3RG2 A;  1YJ7 A;  2DPL A;  5BSU A;  4DCT A;  4R1M A;  4R0M A;  3TUF A;  2UXB C;  1HNX C;  4OX9 C;  2F4V C;  4DR7 C;  4DV3 C;  3UOW A;  4GXQ A;  1ULT A;  4JI5 C;  4X62 C;  5AE3 A;  2OPL A;  4LFB C;  4ZJZ A;  1ZB9 A;  3RV2 A;  2E8C A;  3F4T A;  4LF9 C;  4MTN A;  1QM4 A;  3PBK A;  5BSM A;  3IML A;  3I08 A;  2E8E A;  2AYA A;  4GKJ C;  3F4S A;  3UZ0 A;  2VZE A;  1J5E C;  3PRO C;  1T5D X;  4LE5 A;  3A4I A;  4EAT A;  1WF3 A;  1IBM C;  4I9G A;  2P2M A;  4ZLP A;  5IWA C;  3IPL A;  3DHV A;  1RG9 A;  5K85 A;  2P20 A;  1AMU A;  5KYV A;  1BA3 A;  1I94 C;  3AF5 A;  2OO4 A;  2E8F A;  2P2B A;  4B3T C;  4DR2 C;  5BUQ A;  3G7S A;  2E0G A;  2VQF C;  1XMO C;  2D7V A;  1PA4 A;  1K0R A;  4DCV A;  4DUY C;  1GPM A;  5T8T A;  3E7W A;  3L8C A;  2D28 C;  4JI0 C;  1N36 C;  4D57 A;  1N32 C;  1ML8 A;  3EQ6 A;  2WD9 A;  1HH2 P;  1JOS A;  4DR4 C;  4PZP A;  4DCS A;  1T5H X;  1XRA A;  1MDF A;  4D56 A;  2OPL B;  2D1S A;  1MDB A;  5JRH A;  4DV7 C;  4D4I A;  4FUQ A;  2P2Q A;  4FTF A;  3A9U A;  1XNR C;  4PRO C;  1WH9 A;  3JAM D;  5BSV A;  3VNQ A;  5A19 A;  5A2Q D;  4DV5 C;  4FUT A;  1V25 A;  2Y27 A;  4TPS B;  5CZX A;  2YWB A;  3VNR A;  1KKG A;  2UU9 C;  3R9X A;  1MKY A;  2QVY X;  5IFI A;  3NI2 A;  4DR3 C;  1HNZ C;  2CXC A;  3NYR A;  5KYT A;  4LF7 C;  3PES A;  3GKU A;  1MXA A;  1N34 C;  1XNQ C;  3LGX A;  4JM1 A;  5BUR A;  2BJO A;  1XRC A;  3FCC A;  1O92 A;  4L2Z A;  5BST A;  3R9W A;  3T1Y C;  1VLA A;  2ONF A;  1L2F A;  1N33 C;  5FLX D;  3DAY A;  4BBY A;  4DV1 C;  3C5E A;  2EGT A;  3E7X A;  4DR6 C;  4JI8 C;  4X65 C;  2UXD C;  2Y4O A;  2QVX X;  5AE1 A;  4HPV A;  4B3S C;  4LFA C;  1O90 A;  1RY2 A;  3NPD A;  3LUS A;  1FUG A;  3TDE A;  4X66 C;  2ASB A;  4B3R C;  2E7G A;  4JI7 C;  4L4Q A;  4KTV A;  1N2F A;  4D4G A;  1NYE A;  4MH4 A;  4G37 A;  1MXC A;  4YHH C;  2VQE C;  4DUZ C;  1USP B;  2VSQ A;  4JI1 C;  4BC9 A;  4WV3 A;  4YY3 C;  5CZV A;  2UUA C;  3IEU A;  2UUC C;  4DV0 C;  5LMN C;  3N54 B;  3FCE A;  4DV4 C;  5A1G A;  3L95 X;  1QWI A;  2D27 A;  4LF8 C;  2JMP A;  3A9V A;  2HJG A;  5BSR A;  1P7L A;  2ATW A;  2QL8 A;  5LMU C;  3I07 A;  3OTO C;  5ADZ A;  4LFC C;  1PG3 A;  4DG9 A;  4DV2 C;  1MXB A;  4RVN A;  4JI6 C;  2E5L C;  5H9U A;  1EGA A;  4RVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...