2D27A

Structure of the n-terminal domain of xpse (crystal form i4122)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
148
structure length
148
Chain Sequence
MEQRSAETRIVEALLERRRLKDTDLLRARQLQAESGMGLLALLGRLGLVSERDHAETCAEVLGLPLVDARQLGDTPPEMLPEVQGLSLRFLKQFHLCPVGERDGRLDLWIADPYDDYAIDAVRLATGLPLLLHVGLRSEIDDLIERWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords type II secretion ATPase XpsE
publication title Structure and Function of the XpsE N-Terminal Domain, an Essential Component of the Xanthomonas campestris Type II Secretion System
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Protein transport
total genus 43
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2005-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.70 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Ribonucleotide Reductase Protein R1; domain 1 2d27A01
3.30.300.160 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2d27A02
2D28C 2BH1X 4PHTA 2D27A
chains in the Genus database with same CATH superfamily
3F4SA 4ZLPA 1JSWA 4PUGA 5HW2A 3B7WA 2UUAC 2E8FA 5KYTA 2P2BA 4G1IA 4D56A 3UZ0A 2CY1A 4MWOA 2D1TA 1P7LA 1N34C 3AF6A 4BCAA 2ZZNA 1RG9A 5FLXD 4PROC 4RVOA 3OCEA 1Z4MA 2HVGA 3C8TA 3AF5A 4GXRA 4RVNA 3VNRA 4EFCA 2KZ0A 2UXCC 3E04A 5BUQA 4XX2A 3CW8X 1MXBA 2P2JA 4YY3C 1P4EC 1XS3A 3LNVA 1YFEA 4DR1C 4RM3A 1FURA 1MDFA 1KQ7A 4PUHA 3NYRA 5E7QA 3R6QA 1IW7D 4LE5A 1FUPA 3E7WA 3A26A 2WD9A 1QWIA 4L6AA 3CJEA 4TPSB 3DHVA 5AE1A 4NDNA 4DV5C 2E7GA 2P20A 2VZEA 3CQ1A 4D57A 1Z4IA 1MDBA 3GZHA 4L6CA 2JAWA 3QBPA 3A9VA 3O2EA 2P02A 3PESA 4DR5C 5LMUC 1IBKC 2Y4OA 2I7DA 2V7BA 2YCBA 1XRCA 3GR0A 5K85A 2QVXX 4IZ6A 1U15A 2D28C 2QL8A 4EEIA 1MXAA 1NYEA 1QM4A 4BC7A 4X65C 4DR4C 1HNWC 3CI0K 3T1HC 1KKGA 2MM9A 3A25A 3AY0A 4B3TC 3IMLA 2F4VC 4KHPC 3GTDA 2BJOA 4JYAC 1O9TA 1VDKA 1DCNA 4I9FA 4BSZA 2JARA 1C3UA 2ZZMA 5F91A 4B3MC 4X64C 3OTOC 1FLOA 1ZB9A 2D27A 3RRPA 3ETCA 3TV2A 1N2FA 1AUWA 4IR7A 3JAMD 1RY2A 2WP0C 5IFIA 1I94C 3GKUA 3LNOA 2OPLB 5F92A 4NXMC 1MKYA 4D4IA 4B3RC 3E7XA 2PFMA 5BUSA 4B3SC 3TUFA 2DYJA 1VLAA 3RG2A 1M6XC 1PA4A 3LGXA 1RE5A 2UU9C 4YIHA 4DUZC 2FUSA 1HY1A 4BC9A 4LFAC 1XNRC 1Z4KA 4L7IA 2E0GA 4OXIA 4K0KC 4DV7C 4NFLA 1I0AA 5ADZA 1AMUA 1J5EC 4ZJZA 3NPDA 3R9XA 5AE2A 3R9WA 1HNZC 4GS5A 1TJWA 2JMPA 4JI4C 3VNQA 2QVZX 4DUYC 4KTVA 1USPB 1FJGC 1V60A 4MX2A 4DV6C 5BR8C 3TR3A 4RMNA 1IB8A 3T1YC 4DR2C 2DHMA 3GPCA 4PHTA 1FUOA 1PG4A 5JRHA 1TH5A 1Z4LA 2P2QA 2JAOA 4JI3C 3I08A 4WS9A 2EGTA 3CQ3A 3NYQA 3U13A 1M6XA 3A4IA 3RV2A 5D6BA 3EERA 3OCFA 1MXCA 1YFMA 2E5LC 4DG8A 3PROC 5A2QD 1T5HX 2PTQA 1EGAA 4KTTA 5H9UA 1UKKA 1TJ7A 4L57A 1XHJA 1Q91A 4LF4C 4NXNC 4OYCA 4MTNA 1PG3A 5T8SA 4L4QA 5BSMA 4X62C 5AE3A 1BA3A 3ETOA 3TDEA 4FUTA 3CQ2A 3J81D 3UX2A 3DAYA 2YV5A 5BSTA 2D1SA 4JI1C 4GKJC 3R6VA 3CW9A 2E8CA 5BSUA 1XWOA 1Q5NA 2P2FA 2ZM6C 1WCJA 2JAUA 2PTSA 1LCIA 4LF9C 3DLPX 4DV1C 2M5HA 5KYVA 4D4GA 4R1LA 2AYAA 4NLEA 1O92A 5KEIA 4BBYA 1WF3A 4JV5C 4OX9C 2YWCA 2PTRA 3C5EA 3GR1A 4DCSA 4APAA 1IBMC 3NI2A 3SO4A 1IBLC 3H2TA 1HR0C 1XRAA 2HJGA 1Q92A 1JOSA 2MMAB 4HPVA 4LFBC 1LQLA 5BSWA 1O93A 1V26A 2E8EA 5CZVA 2DPLA 2X75A 3FCEA 3J80D 3R44A 3FCCA 2OO4A 1Z4PX 1YJ7A 2VQEC 4ISBA 1GPMA 4RLFA 2NCLA 3IEVA 5LCIA 4JI5C 2UXDC 4NOZA 1C3CA 1K7WA 3N2QA 3IPLA 4DG9A 1O90A 4JI8C 1J3UA 2Y27A 3A9UA 5BSRA 1HH2P 2E9FA 1HNXC 2BH1X 2UUBC 1XRBA 2Z51A 3I07A 3LAXA 4APBA 2RCNA 4DR7C 2OBVA 4LFCC 2QW0X 4DCUA 4LF8C 3U19A 4AQYC 1U0LA 4LF6C 3L8CA 4JM1A 3VNSA 2XR1A 4DV0C 4ADMA 4LF5C 3S82A 4I9GA 5CZXA 2YX1A 4DV4C 4MUMA 3TQIA 4FUQA 3UOWA 1PU1A 2PN2A 4R0MA 1Z4JA 1UWDA 2ASBA 1TJUA 4RLQA 3NO9A 3RD8A 3LUSA 1VEHA 5A1GA 4LF7C 1MD9A 2MCQA 1N33C 4HGVA 4WV3A 3BWVA 2ONFA 4PUIA 5IT9D 2CXCA 4YIKA 1ML8A 3K6RA 5IWAC 1DOFA 2KZFA 5BSVA 3UEBA 2D1QA 4DR6C 3L95X 4E88A 1WH9A 4RM2A 4JI6C 1L2FA 4G37A 1N32C 4R1MA 2KDNA 2VSQA 2D7VA 1HY0A 4NSLA 2PT7G 3EQ6A 4DV3C 2OPLA 4DV2C 4ODJA 1T5DX 4JI0C 4ADLA 1MH9A 5GTDA 5BURA 4G36A 3BHGA 3N54B 1N36C 1FUGA 3PBKA 4JI7C 1NY8A 2CU6A 5LMNC 3KXWA 5DV9A 4GXQA 2JNVA 1K62A 3UX3A 1P4EA 4L2ZA 4DCTA 5K8FA 2PROA 4MH4A 4K0BA 4DCVA 3F4RA 4EATA 2UUCC 4YHHC 4X66C 2VQFC 4DR3C 1Z4QA 2M5OA 5A1IA 4PZPA 3G7SA 4IQJM 4GKKC 1V25A 2QGAB 1USPA 3F4TA 5A19A 2UXBC 1TJVA 1ZB8A 2HHHC 2YWBA 2ATWA 1ULTA 4FTFA 1XMOC 1XMQC 4U5YD 1T9HA 4JI2C 1K0RA 1U16A 2QVYX 2Y4NA 2D1RA 1FUQA 1XNQC 5T8TA 2P2MA 3IEUA
chains in the Genus database with same CATH topology
3F4SA 4ZLPA 3B7WA 2UUAC 2E8FA 5KYTA 2P2BA 4G1IA 4D56A 3UZ0A 2CY1A 2D1TA 1P7LA 1N34C 3AF6A 4BCAA 1RG9A 5FLXD 4PROC 4RVOA 3AF5A 4GXRA 4RVNA 3VNRA 2UXCC 5BUQA 4XX2A 3CW8X 1MXBA 2P2JA 4YY3C 3LNVA 4DR1C 4RM3A 1MDFA 3NYRA 5E7QA 1IW7D 4LE5A 3E7WA 2WD9A 1QWIA 3CJEA 4TPSB 3DHVA 5AE1A 4NDNA 4DV5C 2E7GA 2P20A 2VZEA 4D57A 1MDBA 3A9VA 2P02A 3PESA 4DR5C 5LMUC 1IBKC 2Y4OA 2V7BA 2YCBA 1XRCA 3GR0A 5K85A 2QVXX 4IZ6A 2D28C 2QL8A 1MXAA 1NYEA 1QM4A 4BC7A 4X65C 4DR4C 1HNWC 3T1HC 1KKGA 4B3TC 3IMLA 2F4VC 4KHPC 2BJOA 4JYAC 1O9TA 4I9FA 4BSZA 4B3MC 4X64C 3OTOC 1ZB9A 2D27A 3ETCA 1N2FA 4IR7A 3JAMD 1I94C 1RY2A 2WP0C 5IFIA 3GKUA 2OPLB 4NXMC 1MKYA 4D4IA 4B3RC 3E7XA 5BUSA 4B3SC 3TUFA 2DYJA 1VLAA 3RG2A 1PA4A 3LGXA 2UU9C 4DUZC 4BC9A 4LFAC 1XNRC 4L7IA 2E0GA 4OXIA 4K0KC 4DV7C 5ADZA 1AMUA 1J5EC 4ZJZA 3NPDA 3R9XA 5AE2A 3R9WA 1HNZC 4GS5A 4JI4C 2JMPA 3VNQA 2QVZX 4DUYC 4KTVA 1USPB 1FJGC 4DV6C 5BR8C 3T1YC 4RMNA 4DR2C 3GPCA 4PHTA 1PG4A 5JRHA 2P2QA 4JI3C 3I08A 4WS9A 2EGTA 3NYQA 3A4IA 3RV2A 3EERA 1MXCA 2E5LC 4DG8A 3PROC 5A2QD 1T5HX 1EGAA 4KTTA 5H9UA 1UKKA 4LF4C 4NXNC 4OYCA 4MTNA 1PG3A 5T8SA 4L4QA 5BSMA 4X62C 5AE3A 1BA3A 3ETOA 3TDEA 4FUTA 3J81D 3DAYA 5BSTA 2D1SA 4JI1C 4GKJC 3CW9A 2E8CA 5BSUA 2P2FA 2ZM6C 1LCIA 4LF9C 3DLPX 4DV1C 5KYVA 4D4GA 4R1LA 2AYAA 1O92A 5KEIA 4BBYA 1WF3A 4JV5C 4OX9C 2YWCA 3C5EA 3GR1A 4DCSA 1IBMC 3NI2A 3SO4A 1IBLC 3H2TA 1HR0C 1XRAA 2HJGA 1JOSA 4HPVA 4LFBC 1LQLA 5BSWA 1O93A 1V26A 2E8EA 5CZVA 2DPLA 3FCEA 3J80D 3R44A 3FCCA 2OO4A 1YJ7A 2VQEC 4ISBA 1GPMA 4RLFA 3IEVA 4JI5C 2UXDC 4NOZA 3N2QA 3IPLA 4DG9A 1O90A 4JI8C 2Y27A 3A9UA 5BSRA 1HH2P 1HNXC 2BH1X 2UUBC 1XRBA 3I07A 3LAXA 4DR7C 2OBVA 4LFCC 2QW0X 4DCUA 4LF8C 4AQYC 4LF6C 3L8CA 4JM1A 3VNSA 2XR1A 4DV0C 4LF5C 3S82A 4I9GA 5CZXA 4DV4C 3TQIA 4FUQA 3UOWA 2PN2A 4R0MA 2ASBA 4RLQA 3LUSA 5A1GA 4LF7C 1MD9A 1N33C 4WV3A 2ONFA 5IT9D 2CXCA 1ML8A 5IWAC 2KZFA 5BSVA 2D1QA 4DR6C 3L95X 1WH9A 4RM2A 4JI6C 1L2FA 4G37A 1N32C 4R1MA 2VSQA 2D7VA 2PT7G 3EQ6A 4DV3C 2OPLA 4DV2C 4ODJA 1T5DX 4JI0C 5GTDA 5BURA 4G36A 3N54B 1N36C 1FUGA 3PBKA 4JI7C 5LMNC 3KXWA 5DV9A 4GXQA 4L2ZA 4DCTA 5K8FA 2PROA 4MH4A 4K0BA 4DCVA 3F4RA 4EATA 2UUCC 4YHHC 4X66C 2VQFC 4DR3C 5A1IA 4PZPA 3G7SA 4IQJM 4GKKC 1V25A 1USPA 3F4TA 5A19A 2UXBC 1ZB8A 2HHHC 2YWBA 2ATWA 1ULTA 4FTFA 1XMOC 1XMQC 4U5YD 4JI2C 1K0RA 2QVYX 2Y4NA 2D1RA 1XNQC 5T8TA 2P2MA 3IEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D28 C;  2BH1 X;  4PHT A;  2D27 A; 
#chains in the Genus database with same CATH topology
 3F4S A;  4ZLP A;  1JSW A;  4PUG A;  5HW2 A;  3B7W A;  2UUA C;  2E8F A;  5KYT A;  2P2B A;  4G1I A;  4D56 A;  3UZ0 A;  2CY1 A;  4MWO A;  2D1T A;  1P7L A;  1N34 C;  3AF6 A;  4BCA A;  2ZZN A;  1RG9 A;  5FLX D;  4PRO C;  4RVO A;  3OCE A;  1Z4M A;  2HVG A;  3C8T A;  3AF5 A;  4GXR A;  4RVN A;  3VNR A;  4EFC A;  2KZ0 A;  2UXC C;  3E04 A;  5BUQ A;  4XX2 A;  3CW8 X;  1MXB A;  2P2J A;  4YY3 C;  1P4E C;  1XS3 A;  3LNV A;  1YFE A;  4DR1 C;  4RM3 A;  1FUR A;  1MDF A;  1KQ7 A;  4PUH A;  3NYR A;  5E7Q A;  3R6Q A;  1IW7 D;  4LE5 A;  1FUP A;  3E7W A;  3A26 A;  2WD9 A;  1QWI A;  4L6A A;  3CJE A;  4TPS B;  3DHV A;  5AE1 A;  4NDN A;  4DV5 C;  2E7G A;  2P20 A;  2VZE A;  3CQ1 A;  4D57 A;  1Z4I A;  1MDB A;  3GZH A;  4L6C A;  2JAW A;  3QBP A;  3A9V A;  3O2E A;  2P02 A;  3PES A;  4DR5 C;  5LMU C;  1IBK C;  2Y4O A;  2I7D A;  2V7B A;  2YCB A;  1XRC A;  3GR0 A;  5K85 A;  2QVX X;  4IZ6 A;  1U15 A;  2D28 C;  2QL8 A;  4EEI A;  1MXA A;  1NYE A;  1QM4 A;  4BC7 A;  4X65 C;  4DR4 C;  1HNW C;  3CI0 K;  3T1H C;  1KKG A;  2MM9 A;  3A25 A;  3AY0 A;  4B3T C;  3IML A;  2F4V C;  4KHP C;  3GTD A;  2BJO A;  4JYA C;  1O9T A;  1VDK A;  1DCN A;  4I9F A;  4BSZ A;  2JAR A;  1C3U A;  2ZZM A;  5F91 A;  4B3M C;  4X64 C;  3OTO C;  1FLO A;  1ZB9 A;  2D27 A;  3RRP A;  3ETC A;  3TV2 A;  1N2F A;  1AUW A;  4IR7 A;  3JAM D;  1RY2 A;  2WP0 C;  5IFI A;  1I94 C;  3GKU A;  3LNO A;  2OPL B;  5F92 A;  4NXM C;  1MKY A;  4D4I A;  4B3R C;  3E7X A;  2PFM A;  5BUS A;  4B3S C;  3TUF A;  2DYJ A;  1VLA A;  3RG2 A;  1M6X C;  1PA4 A;  3LGX A;  1RE5 A;  2UU9 C;  4YIH A;  4DUZ C;  2FUS A;  1HY1 A;  4BC9 A;  4LFA C;  1XNR C;  1Z4K A;  4L7I A;  2E0G A;  4OXI A;  4K0K C;  4DV7 C;  4NFL A;  1I0A A;  5ADZ A;  1AMU A;  1J5E C;  4ZJZ A;  3NPD A;  3R9X A;  5AE2 A;  3R9W A;  1HNZ C;  4GS5 A;  1TJW A;  2JMP A;  4JI4 C;  3VNQ A;  2QVZ X;  4DUY C;  4KTV A;  1USP B;  1FJG C;  1V60 A;  4MX2 A;  4DV6 C;  5BR8 C;  3TR3 A;  4RMN A;  1IB8 A;  3T1Y C;  4DR2 C;  2DHM A;  3GPC A;  4PHT A;  1FUO A;  1PG4 A;  5JRH A;  1TH5 A;  1Z4L A;  2P2Q A;  2JAO A;  4JI3 C;  3I08 A;  4WS9 A;  2EGT A;  3CQ3 A;  3NYQ A;  3U13 A;  1M6X A;  3A4I A;  3RV2 A;  5D6B A;  3EER A;  3OCF A;  1MXC A;  1YFM A;  2E5L C;  4DG8 A;  3PRO C;  5A2Q D;  1T5H X;  2PTQ A;  1EGA A;  4KTT A;  5H9U A;  1UKK A;  1TJ7 A;  4L57 A;  1XHJ A;  1Q91 A;  4LF4 C;  4NXN C;  4OYC A;  4MTN A;  1PG3 A;  5T8S A;  4L4Q A;  5BSM A;  4X62 C;  5AE3 A;  1BA3 A;  3ETO A;  3TDE A;  4FUT A;  3CQ2 A;  3J81 D;  3UX2 A;  3DAY A;  2YV5 A;  5BST A;  2D1S A;  4JI1 C;  4GKJ C;  3R6V A;  3CW9 A;  2E8C A;  5BSU A;  1XWO A;  1Q5N A;  2P2F A;  2ZM6 C;  1WCJ A;  2JAU A;  2PTS A;  1LCI A;  4LF9 C;  3DLP X;  4DV1 C;  2M5H A;  5KYV A;  4D4G A;  4R1L A;  2AYA A;  4NLE A;  1O92 A;  5KEI A;  4BBY A;  1WF3 A;  4JV5 C;  4OX9 C;  2YWC A;  2PTR A;  3C5E A;  3GR1 A;  4DCS A;  4APA A;  1IBM C;  3NI2 A;  3SO4 A;  1IBL C;  3H2T A;  1HR0 C;  1XRA A;  2HJG A;  1Q92 A;  1JOS A;  2MMA B;  4HPV A;  4LFB C;  1LQL A;  5BSW A;  1O93 A;  1V26 A;  2E8E A;  5CZV A;  2DPL A;  2X75 A;  3FCE A;  3J80 D;  3R44 A;  3FCC A;  2OO4 A;  1Z4P X;  1YJ7 A;  2VQE C;  4ISB A;  1GPM A;  4RLF A;  2NCL A;  3IEV A;  5LCI A;  4JI5 C;  2UXD C;  4NOZ A;  1C3C A;  1K7W A;  3N2Q A;  3IPL A;  4DG9 A;  1O90 A;  4JI8 C;  1J3U A;  2Y27 A;  3A9U A;  5BSR A;  1HH2 P;  2E9F A;  1HNX C;  2BH1 X;  2UUB C;  1XRB A;  2Z51 A;  3I07 A;  3LAX A;  4APB A;  2RCN A;  4DR7 C;  2OBV A;  4LFC C;  2QW0 X;  4DCU A;  4LF8 C;  3U19 A;  4AQY C;  1U0L A;  4LF6 C;  3L8C A;  4JM1 A;  3VNS A;  2XR1 A;  4DV0 C;  4ADM A;  4LF5 C;  3S82 A;  4I9G A;  5CZX A;  2YX1 A;  4DV4 C;  4MUM A;  3TQI A;  4FUQ A;  3UOW A;  1PU1 A;  2PN2 A;  4R0M A;  1Z4J A;  1UWD A;  2ASB A;  1TJU A;  4RLQ A;  3NO9 A;  3RD8 A;  3LUS A;  1VEH A;  5A1G A;  4LF7 C;  1MD9 A;  2MCQ A;  1N33 C;  4HGV A;  4WV3 A;  3BWV A;  2ONF A;  4PUI A;  5IT9 D;  2CXC A;  4YIK A;  1ML8 A;  3K6R A;  5IWA C;  1DOF A;  2KZF A;  5BSV A;  3UEB A;  2D1Q A;  4DR6 C;  3L95 X;  4E88 A;  1WH9 A;  4RM2 A;  4JI6 C;  1L2F A;  4G37 A;  1N32 C;  4R1M A;  2KDN A;  2VSQ A;  2D7V A;  1HY0 A;  4NSL A;  2PT7 G;  3EQ6 A;  4DV3 C;  2OPL A;  4DV2 C;  4ODJ A;  1T5D X;  4JI0 C;  4ADL A;  1MH9 A;  5GTD A;  5BUR A;  4G36 A;  3BHG A;  3N54 B;  1N36 C;  1FUG A;  3PBK A;  4JI7 C;  1NY8 A;  2CU6 A;  5LMN C;  3KXW A;  5DV9 A;  4GXQ A;  2JNV A;  1K62 A;  3UX3 A;  1P4E A;  4L2Z A;  4DCT A;  5K8F A;  2PRO A;  4MH4 A;  4K0B A;  4DCV A;  3F4R A;  4EAT A;  2UUC C;  4YHH C;  4X66 C;  2VQF C;  4DR3 C;  1Z4Q A;  2M5O A;  5A1I A;  4PZP A;  3G7S A;  4IQJ M;  4GKK C;  1V25 A;  2QGA B;  1USP A;  3F4T A;  5A19 A;  2UXB C;  1TJV A;  1ZB8 A;  2HHH C;  2YWB A;  2ATW A;  1ULT A;  4FTF A;  1XMO C;  1XMQ C;  4U5Y D;  1T9H A;  4JI2 C;  1K0R A;  1U16 A;  2QVY X;  2Y4N A;  2D1R A;  1FUQ A;  1XNQ C;  5T8T A;  2P2M A;  3IEU A; 
#chains in the Genus database with same CATH homology
 3F4S A;  4ZLP A;  3B7W A;  2UUA C;  2E8F A;  5KYT A;  2P2B A;  4G1I A;  4D56 A;  3UZ0 A;  2CY1 A;  2D1T A;  1P7L A;  1N34 C;  3AF6 A;  4BCA A;  1RG9 A;  5FLX D;  4PRO C;  4RVO A;  3AF5 A;  4GXR A;  4RVN A;  3VNR A;  2UXC C;  5BUQ A;  4XX2 A;  3CW8 X;  1MXB A;  2P2J A;  4YY3 C;  3LNV A;  4DR1 C;  4RM3 A;  1MDF A;  3NYR A;  5E7Q A;  1IW7 D;  4LE5 A;  3E7W A;  2WD9 A;  1QWI A;  3CJE A;  4TPS B;  3DHV A;  5AE1 A;  4NDN A;  4DV5 C;  2E7G A;  2P20 A;  2VZE A;  4D57 A;  1MDB A;  3A9V A;  2P02 A;  3PES A;  4DR5 C;  5LMU C;  1IBK C;  2Y4O A;  2V7B A;  2YCB A;  1XRC A;  3GR0 A;  5K85 A;  2QVX X;  4IZ6 A;  2D28 C;  2QL8 A;  1MXA A;  1NYE A;  1QM4 A;  4BC7 A;  4X65 C;  4DR4 C;  1HNW C;  3T1H C;  1KKG A;  4B3T C;  3IML A;  2F4V C;  4KHP C;  2BJO A;  4JYA C;  1O9T A;  4I9F A;  4BSZ A;  4B3M C;  4X64 C;  3OTO C;  1ZB9 A;  2D27 A;  3ETC A;  1N2F A;  4IR7 A;  3JAM D;  1I94 C;  1RY2 A;  2WP0 C;  5IFI A;  3GKU A;  2OPL B;  4NXM C;  1MKY A;  4D4I A;  4B3R C;  3E7X A;  5BUS A;  4B3S C;  3TUF A;  2DYJ A;  1VLA A;  3RG2 A;  1PA4 A;  3LGX A;  2UU9 C;  4DUZ C;  4BC9 A;  4LFA C;  1XNR C;  4L7I A;  2E0G A;  4OXI A;  4K0K C;  4DV7 C;  5ADZ A;  1AMU A;  1J5E C;  4ZJZ A;  3NPD A;  3R9X A;  5AE2 A;  3R9W A;  1HNZ C;  4GS5 A;  4JI4 C;  2JMP A;  3VNQ A;  2QVZ X;  4DUY C;  4KTV A;  1USP B;  1FJG C;  4DV6 C;  5BR8 C;  3T1Y C;  4RMN A;  4DR2 C;  3GPC A;  4PHT A;  1PG4 A;  5JRH A;  2P2Q A;  4JI3 C;  3I08 A;  4WS9 A;  2EGT A;  3NYQ A;  3A4I A;  3RV2 A;  3EER A;  1MXC A;  2E5L C;  4DG8 A;  3PRO C;  5A2Q D;  1T5H X;  1EGA A;  4KTT A;  5H9U A;  1UKK A;  4LF4 C;  4NXN C;  4OYC A;  4MTN A;  1PG3 A;  5T8S A;  4L4Q A;  5BSM A;  4X62 C;  5AE3 A;  1BA3 A;  3ETO A;  3TDE A;  4FUT A;  3J81 D;  3DAY A;  5BST A;  2D1S A;  4JI1 C;  4GKJ C;  3CW9 A;  2E8C A;  5BSU A;  2P2F A;  2ZM6 C;  1LCI A;  4LF9 C;  3DLP X;  4DV1 C;  5KYV A;  4D4G A;  4R1L A;  2AYA A;  1O92 A;  5KEI A;  4BBY A;  1WF3 A;  4JV5 C;  4OX9 C;  2YWC A;  3C5E A;  3GR1 A;  4DCS A;  1IBM C;  3NI2 A;  3SO4 A;  1IBL C;  3H2T A;  1HR0 C;  1XRA A;  2HJG A;  1JOS A;  4HPV A;  4LFB C;  1LQL A;  5BSW A;  1O93 A;  1V26 A;  2E8E A;  5CZV A;  2DPL A;  3FCE A;  3J80 D;  3R44 A;  3FCC A;  2OO4 A;  1YJ7 A;  2VQE C;  4ISB A;  1GPM A;  4RLF A;  3IEV A;  4JI5 C;  2UXD C;  4NOZ A;  3N2Q A;  3IPL A;  4DG9 A;  1O90 A;  4JI8 C;  2Y27 A;  3A9U A;  5BSR A;  1HH2 P;  1HNX C;  2BH1 X;  2UUB C;  1XRB A;  3I07 A;  3LAX A;  4DR7 C;  2OBV A;  4LFC C;  2QW0 X;  4DCU A;  4LF8 C;  4AQY C;  4LF6 C;  3L8C A;  4JM1 A;  3VNS A;  2XR1 A;  4DV0 C;  4LF5 C;  3S82 A;  4I9G A;  5CZX A;  4DV4 C;  3TQI A;  4FUQ A;  3UOW A;  2PN2 A;  4R0M A;  2ASB A;  4RLQ A;  3LUS A;  5A1G A;  4LF7 C;  1MD9 A;  1N33 C;  4WV3 A;  2ONF A;  5IT9 D;  2CXC A;  1ML8 A;  5IWA C;  2KZF A;  5BSV A;  2D1Q A;  4DR6 C;  3L95 X;  1WH9 A;  4RM2 A;  4JI6 C;  1L2F A;  4G37 A;  1N32 C;  4R1M A;  2VSQ A;  2D7V A;  2PT7 G;  3EQ6 A;  4DV3 C;  2OPL A;  4DV2 C;  4ODJ A;  1T5D X;  4JI0 C;  5GTD A;  5BUR A;  4G36 A;  3N54 B;  1N36 C;  1FUG A;  3PBK A;  4JI7 C;  5LMN C;  3KXW A;  5DV9 A;  4GXQ A;  4L2Z A;  4DCT A;  5K8F A;  2PRO A;  4MH4 A;  4K0B A;  4DCV A;  3F4R A;  4EAT A;  2UUC C;  4YHH C;  4X66 C;  2VQF C;  4DR3 C;  5A1I A;  4PZP A;  3G7S A;  4IQJ M;  4GKK C;  1V25 A;  1USP A;  3F4T A;  5A19 A;  2UXB C;  1ZB8 A;  2HHH C;  2YWB A;  2ATW A;  1ULT A;  4FTF A;  1XMO C;  1XMQ C;  4U5Y D;  4JI2 C;  1K0R A;  2QVY X;  2Y4N A;  2D1R A;  1XNQ C;  5T8T A;  2P2M A;  3IEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...