2D27A

Structure of the n-terminal domain of xpse (crystal form i4122)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
148
structure length
148
Chain Sequence
MEQRSAETRIVEALLERRRLKDTDLLRARQLQAESGMGLLALLGRLGLVSERDHAETCAEVLGLPLVDARQLGDTPPEMLPEVQGLSLRFLKQFHLCPVGERDGRLDLWIADPYDDYAIDAVRLATGLPLLLHVGLRSEIDDLIERWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of the XpsE N-Terminal Domain, an Essential Component of the Xanthomonas campestris Type II Secretion System
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Protein transport
molecule keywords type II secretion ATPase XpsE
total genus 43
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2005-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.70 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Ribonucleotide Reductase Protein R1; domain 1 2d27A01
3.30.300.160 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2d27A02
2BH1X 2D27A 2D28C 4PHTA
chains in the Genus database with same CATH superfamily
1M6XA 3TR3A 4BBYA 5LMUC 1O92A 1MDBA 2QGAB 3LNVA 1MKYA 4BCAA 5A19A 3CW8X 3E7XA 3I08A 4NXMC 3EQ6A 1N33C 4APBA 4JI6C 4GS5A 1P7LA 2QW0X 2E8FA 4LFBC 1MXAA 4X62C 1XRBA 1FUPA 3N54B 4JM1A 3R6QA 4MWOA 4KTVA 4DR1C 4MUMA 4EEIA 4DR5C 3E7WA 4OX9C 2JNVA 4MH4A 1EGAA 2YCBA 2UU9C 1L2FA 1UKKA 3CJEA 2ASBA 2VQFC 1Z4LA 2RCNA 4RLQA 1PG3A 3R9XA 1NYEA 4X65C 1Z4PX 4IQJM 4HPVA 1Z4KA 2WP0C 4D4IA 3G7SA 2M5OA 5H9UA 4FUQA 4JI4C 1HR0C 4X66C 4FTFA 3DHVA 3E04A 1LCIA 2BH1X 4ZJZA 4XX2A 2ZZMA 2KZFA 1YFEA 4LFAC 4IR7A 1VDKA 3TV2A 2UXCC 5AE2A 5K85A 4NSLA 3IEUA 1T5HX 1J5EC 1Z4IA 4RVNA 4YY3C 5BUQA 4JYAC 3TUFA 3L95X 2V7BA 3DAYA 3AF6A 4DV2C 4TPSB 3U13A 2OO4A 4PUIA 2MCQA 3GR0A 2P20A 1M6XC 2PN2A 1T5DX 3PESA 2P2QA 5BSVA 1ULTA 2D1RA 2Y4NA 2P02A 3UX3A 2QVYX 3A9VA 2OPLA 1MD9A 4EATA 4WV3A 5BR8C 3IMLA 1FUQA 4L7IA 4ADMA 3J81D 4B3SC 1ZB8A 5D6BA 1TJ7A 4NOZA 2PTQA 5DV9A 5E7QA 4L4QA 1MDFA 1I94C 5AE3A 1AUWA 1Q5NA 1VLAA 2VZEA 5A1IA 2ONFA 5LMNC 3FCCA 1TJVA 5A2QD 1XRCA 4DV3C 1HNWC 4EFCA 3UX2A 4G37A 4DCTA 3A25A 3N2QA 1IB8A 2D1SA 2JAWA 5KEIA 2KZ0A 1WH9A 4L6AA 5A1GA 1C3CA 1XNRC 4JI5C 3VNSA 2QL8A 3VNRA 2HHHC 1TH5A 1HH2P 1NY8A 3LUSA 3UZ0A 3RV2A 4DV7C 2MM9A 1XRAA 4DR4C 1PG4A 1USPA 3A4IA 3S82A 2DYJA 2UUBC 2P2BA 5IFIA 1O90A 4L2ZA 4K0BA 1K62A 3BWVA 1O93A 1C3UA 3C5EA 2ATWA 4DV4C 1HNXC 3RRPA 4NFLA 1WCJA 3PBKA 4LF4C 2VQEC 4DUYC 1FUOA 1FURA 2VSQA 1TJUA 4E88A 3F4RA 2I7DA 4DG9A 2Y4OA 1K0RA 3RG2A 4YHHC 1U0LA 2CU6A 1XMQC 1PU1A 1HNZC 1Q92A 4KTTA 3SO4A 4K0KC 2JMPA 4LF5C 2D7VA 4MTNA 2P2JA 2HJGA 2JAUA 4G1IA 4OYCA 3NYQA 5BSMA 4BC7A 3NYRA 3TQIA 1YFMA 4R0MA 2ZM6C 4R1MA 3GPCA 3I07A 5KYTA 2KDNA 3OCEA 3O2EA 4R1LA 4BSZA 4ISBA 1N36C 4ODJA 1Z4QA 4DUZC 2XR1A 1IBMC 2CXCA 3GR1A 3IEVA 1IW7D 5T8TA 4ADLA 2D27A 4JI8C 4NDNA 4B3MC 4DG8A 4DV5C 5BSWA 2BJOA 2UXDC 4DV6C 4DR2C 1U16A 3CI0K 4PHTA 5BURA 3DLPX 5CZVA 2P2FA 1K7WA 4U5YD 2E8CA 1N32C 3PROC 3LAXA 3IPLA 4GXRA 2PFMA 3EERA 3UOWA 1N34C 4B3TC 4NXNC 3NI2A 3KXWA 4YIKA 3F4TA 3R6VA 1FLOA 1U15A 5BSUA 2QVZX 2QVXX 3ETOA 1MH9A 1VEHA 2E9FA 1V60A 2D1TA 3C8TA 1DOFA 5IT9D 4DCUA 2Z51A 1AMUA 2JAOA 2OPLB 4LF6C 2ZZNA 4L6CA 3AY0A 5ADZA 1Z4MA 3H2TA 3L8CA 4OXIA 1LQLA 3CQ2A 4JI7C 1P4EC 4GXQA 4D56A 4WS9A 4DCVA 1IBKC 3BHGA 3T1YC 5FLXD 3U19A 1I0AA 1YJ7A 1DCNA 1XNQC 4DR6C 4DCSA 4D57A 1P4EA 5F92A 2PTSA 4BC9A 1Z4JA 1QWIA 4ZLPA 3R44A 1V25A 4NLEA 1XMOC 1J3UA 5BSTA 4DV1C 4RLFA 1HY0A 3A26A 1WF3A 5T8SA 2E0GA 4GKKC 2YX1A 3LNOA 2PROA 3LGXA 5AE1A 2F4VC 2MMAB 4PZPA 2NCLA 1MXCA 4JI0C 1IBLC 2PT7G 4PUHA 5K8FA 2EGTA 5CZXA 4LF9C 1HY1A 5BUSA 1V26A 4D4GA 1TJWA 1ZB9A 4DV0C 1MXBA 4RM2A 3CQ1A 5KYVA 1O9TA 1QM4A 4HGVA 4APAA 4JI1C 2UUCC 1KQ7A 4DR7C 1XS3A 1UWDA 3TDEA 1XWOA 5JRHA 3NPDA 4G36A 2CY1A 3CQ3A 4LFCC 4RMNA 1FJGC 4PROC 5IWAC 2D28C 3J80D 4FUTA 4YIHA 3FCEA 3R9WA 2X75A 4LE5A 1JOSA 4JI2C 3ETCA 4I9GA 3UEBA 2YWBA 1BA3A 3QBPA 1GPMA 2P2MA 2OBVA 4LF8C 5GTDA 2HVGA 5BSRA 5HW2A 3AF5A 4X64C 3T1HC 3B7WA 4IZ6A 4GKJC 2JARA 1KKGA 2UUAC 2E5LC 2WD9A 1N2FA 4KHPC 2DPLA 1RY2A 2AYAA 2E7GA 2M5HA 3GTDA 1PA4A 4JI3C 4MX2A 1Q91A 1T9HA 3K6RA 4DR3C 2FUSA 3JAMD 2YV5A 3NO9A 5LCIA 3OTOC 4JV5C 2D1QA 2Y27A 3A9UA 3CW9A 4RM3A 2YWCA 4AQYC 3OCFA 2E8EA 1RE5A 2UXBC 3GZHA 5F91A 1FUGA 4L57A 1ML8A 2DHMA 4I9FA 3F4SA 4LF7C 4B3RC 2PTRA 1USPB 4RVOA 3GKUA 1XHJA 4PUGA 1JSWA 3RD8A 1RG9A 3VNQA
chains in the Genus database with same CATH topology
4BBYA 5LMUC 1O92A 1MDBA 3LNVA 1MKYA 4BCAA 5A19A 3CW8X 3E7XA 3I08A 4NXMC 3EQ6A 1N33C 4JI6C 4GS5A 1P7LA 2QW0X 2E8FA 4LFBC 1MXAA 4X62C 1XRBA 3N54B 4JM1A 4KTVA 4DR1C 4DR5C 3E7WA 4OX9C 4MH4A 1EGAA 2YCBA 2UU9C 1L2FA 1UKKA 3CJEA 2ASBA 2VQFC 4RLQA 1PG3A 3R9XA 1NYEA 4X65C 4IQJM 4HPVA 2WP0C 4D4IA 3G7SA 5H9UA 4FUQA 4JI4C 1HR0C 4X66C 4FTFA 3DHVA 1LCIA 2BH1X 4ZJZA 4XX2A 2KZFA 4LFAC 4IR7A 2UXCC 5AE2A 5K85A 3IEUA 1T5HX 1J5EC 4RVNA 4YY3C 5BUQA 4JYAC 3TUFA 3L95X 2V7BA 3DAYA 3AF6A 4DV2C 4TPSB 2OO4A 3GR0A 2P20A 2PN2A 1T5DX 3PESA 2P2QA 5BSVA 1ULTA 2D1RA 2Y4NA 2P02A 2QVYX 3A9VA 2OPLA 1MD9A 4EATA 4WV3A 5BR8C 3IMLA 4L7IA 3J81D 4B3SC 1ZB8A 4NOZA 5DV9A 5E7QA 4L4QA 1MDFA 1I94C 5AE3A 1VLAA 2VZEA 5A1IA 2ONFA 5LMNC 3FCCA 5A2QD 1XRCA 4DV3C 1HNWC 4G37A 4DCTA 3N2QA 2D1SA 5KEIA 1WH9A 5A1GA 1XNRC 4JI5C 3VNSA 2QL8A 3VNRA 2HHHC 1HH2P 3LUSA 3UZ0A 3RV2A 4DV7C 1XRAA 4DR4C 1PG4A 1USPA 3A4IA 2UUBC 2DYJA 3S82A 2P2BA 5IFIA 1O90A 4L2ZA 4K0BA 1O93A 3C5EA 2ATWA 4DV4C 1HNXC 3PBKA 4LF4C 2VQEC 4DUYC 2VSQA 3F4RA 4DG9A 2Y4OA 1K0RA 3RG2A 4YHHC 1XMQC 1HNZC 4KTTA 3SO4A 4K0KC 2JMPA 4LF5C 2D7VA 4MTNA 2P2JA 2HJGA 4G1IA 4OYCA 3NYQA 5BSMA 4BC7A 3NYRA 3TQIA 4R0MA 2ZM6C 4R1MA 3GPCA 3I07A 5KYTA 4R1LA 1N36C 4ISBA 4BSZA 4ODJA 4DUZC 2XR1A 1IBMC 2CXCA 3GR1A 3IEVA 1IW7D 5T8TA 2D27A 4JI8C 4NDNA 4B3MC 4DG8A 4DV5C 5BSWA 2BJOA 2UXDC 4DV6C 4DR2C 4PHTA 5BURA 3DLPX 5CZVA 2P2FA 4U5YD 2E8CA 1N32C 3PROC 3LAXA 3IPLA 4GXRA 3EERA 3UOWA 1N34C 4B3TC 4NXNC 3NI2A 3KXWA 3F4TA 5BSUA 2QVZX 2QVXX 3ETOA 2D1TA 5IT9D 4DCUA 1AMUA 2OPLB 4LF6C 5ADZA 3H2TA 3L8CA 4OXIA 1LQLA 4JI7C 4GXQA 4D56A 4WS9A 4DCVA 1IBKC 3T1YC 5FLXD 1YJ7A 1XNQC 4DR6C 4DCSA 4D57A 4BC9A 1QWIA 4ZLPA 3R44A 1V25A 1XMOC 5BSTA 4DV1C 4RLFA 1WF3A 5T8SA 2E0GA 4GKKC 2PROA 3LGXA 5AE1A 2F4VC 4PZPA 1MXCA 4JI0C 1IBLC 2PT7G 5K8FA 2EGTA 5CZXA 4LF9C 5BUSA 1V26A 4D4GA 1ZB9A 4DV0C 1MXBA 4RM2A 5KYVA 1O9TA 1QM4A 4JI1C 2UUCC 4DR7C 3TDEA 5JRHA 3NPDA 4G36A 2CY1A 4LFCC 4RMNA 1FJGC 4PROC 5IWAC 2D28C 3J80D 4FUTA 3FCEA 3R9WA 4LE5A 1JOSA 4JI2C 3ETCA 4I9GA 2YWBA 1BA3A 1GPMA 2P2MA 2OBVA 4LF8C 5GTDA 5BSRA 3AF5A 4X64C 3T1HC 3B7WA 4IZ6A 4GKJC 1KKGA 2UUAC 2E5LC 2WD9A 1N2FA 4KHPC 2DPLA 2AYAA 1RY2A 2E7GA 1PA4A 4JI3C 4DR3C 3JAMD 3OTOC 4JV5C 2D1QA 2Y27A 3A9UA 3CW9A 4RM3A 2YWCA 4AQYC 2E8EA 2UXBC 1FUGA 1ML8A 4I9FA 3F4SA 4LF7C 4B3RC 1USPB 4RVOA 3GKUA 1RG9A 3VNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BH1 X;  2D27 A;  2D28 C;  4PHT A; 
#chains in the Genus database with same CATH topology
 1M6X A;  3TR3 A;  4BBY A;  5LMU C;  1O92 A;  1MDB A;  2QGA B;  3LNV A;  1MKY A;  4BCA A;  5A19 A;  3CW8 X;  3E7X A;  3I08 A;  4NXM C;  3EQ6 A;  1N33 C;  4APB A;  4JI6 C;  4GS5 A;  1P7L A;  2QW0 X;  2E8F A;  4LFB C;  1MXA A;  4X62 C;  1XRB A;  1FUP A;  3N54 B;  4JM1 A;  3R6Q A;  4MWO A;  4KTV A;  4DR1 C;  4MUM A;  4EEI A;  4DR5 C;  3E7W A;  4OX9 C;  2JNV A;  4MH4 A;  1EGA A;  2YCB A;  2UU9 C;  1L2F A;  1UKK A;  3CJE A;  2ASB A;  2VQF C;  1Z4L A;  2RCN A;  4RLQ A;  1PG3 A;  3R9X A;  1NYE A;  4X65 C;  1Z4P X;  4IQJ M;  4HPV A;  1Z4K A;  2WP0 C;  4D4I A;  3G7S A;  2M5O A;  5H9U A;  4FUQ A;  4JI4 C;  1HR0 C;  4X66 C;  4FTF A;  3DHV A;  3E04 A;  1LCI A;  2BH1 X;  4ZJZ A;  4XX2 A;  2ZZM A;  2KZF A;  1YFE A;  4LFA C;  4IR7 A;  1VDK A;  3TV2 A;  2UXC C;  5AE2 A;  5K85 A;  4NSL A;  3IEU A;  1T5H X;  1J5E C;  1Z4I A;  4RVN A;  4YY3 C;  5BUQ A;  4JYA C;  3TUF A;  3L95 X;  2V7B A;  3DAY A;  3AF6 A;  4DV2 C;  4TPS B;  3U13 A;  2OO4 A;  4PUI A;  2MCQ A;  3GR0 A;  2P20 A;  1M6X C;  2PN2 A;  1T5D X;  3PES A;  2P2Q A;  5BSV A;  1ULT A;  2D1R A;  2Y4N A;  2P02 A;  3UX3 A;  2QVY X;  3A9V A;  2OPL A;  1MD9 A;  4EAT A;  4WV3 A;  5BR8 C;  3IML A;  1FUQ A;  4L7I A;  4ADM A;  3J81 D;  4B3S C;  1ZB8 A;  5D6B A;  1TJ7 A;  4NOZ A;  2PTQ A;  5DV9 A;  5E7Q A;  4L4Q A;  1MDF A;  1I94 C;  5AE3 A;  1AUW A;  1Q5N A;  1VLA A;  2VZE A;  5A1I A;  2ONF A;  5LMN C;  3FCC A;  1TJV A;  5A2Q D;  1XRC A;  4DV3 C;  1HNW C;  4EFC A;  3UX2 A;  4G37 A;  4DCT A;  3A25 A;  3N2Q A;  1IB8 A;  2D1S A;  2JAW A;  5KEI A;  2KZ0 A;  1WH9 A;  4L6A A;  5A1G A;  1C3C A;  1XNR C;  4JI5 C;  3VNS A;  2QL8 A;  3VNR A;  2HHH C;  1TH5 A;  1HH2 P;  1NY8 A;  3LUS A;  3UZ0 A;  3RV2 A;  4DV7 C;  2MM9 A;  1XRA A;  4DR4 C;  1PG4 A;  1USP A;  3A4I A;  3S82 A;  2DYJ A;  2UUB C;  2P2B A;  5IFI A;  1O90 A;  4L2Z A;  4K0B A;  1K62 A;  3BWV A;  1O93 A;  1C3U A;  3C5E A;  2ATW A;  4DV4 C;  1HNX C;  3RRP A;  4NFL A;  1WCJ A;  3PBK A;  4LF4 C;  2VQE C;  4DUY C;  1FUO A;  1FUR A;  2VSQ A;  1TJU A;  4E88 A;  3F4R A;  2I7D A;  4DG9 A;  2Y4O A;  1K0R A;  3RG2 A;  4YHH C;  1U0L A;  2CU6 A;  1XMQ C;  1PU1 A;  1HNZ C;  1Q92 A;  4KTT A;  3SO4 A;  4K0K C;  2JMP A;  4LF5 C;  2D7V A;  4MTN A;  2P2J A;  2HJG A;  2JAU A;  4G1I A;  4OYC A;  3NYQ A;  5BSM A;  4BC7 A;  3NYR A;  3TQI A;  1YFM A;  4R0M A;  2ZM6 C;  4R1M A;  3GPC A;  3I07 A;  5KYT A;  2KDN A;  3OCE A;  3O2E A;  4R1L A;  4BSZ A;  4ISB A;  1N36 C;  4ODJ A;  1Z4Q A;  4DUZ C;  2XR1 A;  1IBM C;  2CXC A;  3GR1 A;  3IEV A;  1IW7 D;  5T8T A;  4ADL A;  2D27 A;  4JI8 C;  4NDN A;  4B3M C;  4DG8 A;  4DV5 C;  5BSW A;  2BJO A;  2UXD C;  4DV6 C;  4DR2 C;  1U16 A;  3CI0 K;  4PHT A;  5BUR A;  3DLP X;  5CZV A;  2P2F A;  1K7W A;  4U5Y D;  2E8C A;  1N32 C;  3PRO C;  3LAX A;  3IPL A;  4GXR A;  2PFM A;  3EER A;  3UOW A;  1N34 C;  4B3T C;  4NXN C;  3NI2 A;  3KXW A;  4YIK A;  3F4T A;  3R6V A;  1FLO A;  1U15 A;  5BSU A;  2QVZ X;  2QVX X;  3ETO A;  1MH9 A;  1VEH A;  2E9F A;  1V60 A;  2D1T A;  3C8T A;  1DOF A;  5IT9 D;  4DCU A;  2Z51 A;  1AMU A;  2JAO A;  2OPL B;  4LF6 C;  2ZZN A;  4L6C A;  3AY0 A;  5ADZ A;  1Z4M A;  3H2T A;  3L8C A;  4OXI A;  1LQL A;  3CQ2 A;  4JI7 C;  1P4E C;  4GXQ A;  4D56 A;  4WS9 A;  4DCV A;  1IBK C;  3BHG A;  3T1Y C;  5FLX D;  3U19 A;  1I0A A;  1YJ7 A;  1DCN A;  1XNQ C;  4DR6 C;  4DCS A;  4D57 A;  1P4E A;  5F92 A;  2PTS A;  4BC9 A;  1Z4J A;  1QWI A;  4ZLP A;  3R44 A;  1V25 A;  4NLE A;  1XMO C;  1J3U A;  5BST A;  4DV1 C;  4RLF A;  1HY0 A;  3A26 A;  1WF3 A;  5T8S A;  2E0G A;  4GKK C;  2YX1 A;  3LNO A;  2PRO A;  3LGX A;  5AE1 A;  2F4V C;  2MMA B;  4PZP A;  2NCL A;  1MXC A;  4JI0 C;  1IBL C;  2PT7 G;  4PUH A;  5K8F A;  2EGT A;  5CZX A;  4LF9 C;  1HY1 A;  5BUS A;  1V26 A;  4D4G A;  1TJW A;  1ZB9 A;  4DV0 C;  1MXB A;  4RM2 A;  3CQ1 A;  5KYV A;  1O9T A;  1QM4 A;  4HGV A;  4APA A;  4JI1 C;  2UUC C;  1KQ7 A;  4DR7 C;  1XS3 A;  1UWD A;  3TDE A;  1XWO A;  5JRH A;  3NPD A;  4G36 A;  2CY1 A;  3CQ3 A;  4LFC C;  4RMN A;  1FJG C;  4PRO C;  5IWA C;  2D28 C;  3J80 D;  4FUT A;  4YIH A;  3FCE A;  3R9W A;  2X75 A;  4LE5 A;  1JOS A;  4JI2 C;  3ETC A;  4I9G A;  3UEB A;  2YWB A;  1BA3 A;  3QBP A;  1GPM A;  2P2M A;  2OBV A;  4LF8 C;  5GTD A;  2HVG A;  5BSR A;  5HW2 A;  3AF5 A;  4X64 C;  3T1H C;  3B7W A;  4IZ6 A;  4GKJ C;  2JAR A;  1KKG A;  2UUA C;  2E5L C;  2WD9 A;  1N2F A;  4KHP C;  2DPL A;  1RY2 A;  2AYA A;  2E7G A;  2M5H A;  3GTD A;  1PA4 A;  4JI3 C;  4MX2 A;  1Q91 A;  1T9H A;  3K6R A;  4DR3 C;  2FUS A;  3JAM D;  2YV5 A;  3NO9 A;  5LCI A;  3OTO C;  4JV5 C;  2D1Q A;  2Y27 A;  3A9U A;  3CW9 A;  4RM3 A;  2YWC A;  4AQY C;  3OCF A;  2E8E A;  1RE5 A;  2UXB C;  3GZH A;  5F91 A;  1FUG A;  4L57 A;  1ML8 A;  2DHM A;  4I9F A;  3F4S A;  4LF7 C;  4B3R C;  2PTR A;  1USP B;  4RVO A;  3GKU A;  1XHJ A;  4PUG A;  1JSW A;  3RD8 A;  1RG9 A;  3VNQ A; 
#chains in the Genus database with same CATH homology
 4BBY A;  5LMU C;  1O92 A;  1MDB A;  3LNV A;  1MKY A;  4BCA A;  5A19 A;  3CW8 X;  3E7X A;  3I08 A;  4NXM C;  3EQ6 A;  1N33 C;  4JI6 C;  4GS5 A;  1P7L A;  2QW0 X;  2E8F A;  4LFB C;  1MXA A;  4X62 C;  1XRB A;  3N54 B;  4JM1 A;  4KTV A;  4DR1 C;  4DR5 C;  3E7W A;  4OX9 C;  4MH4 A;  1EGA A;  2YCB A;  2UU9 C;  1L2F A;  1UKK A;  3CJE A;  2ASB A;  2VQF C;  4RLQ A;  1PG3 A;  3R9X A;  1NYE A;  4X65 C;  4IQJ M;  4HPV A;  2WP0 C;  4D4I A;  3G7S A;  5H9U A;  4FUQ A;  4JI4 C;  1HR0 C;  4X66 C;  4FTF A;  3DHV A;  1LCI A;  2BH1 X;  4ZJZ A;  4XX2 A;  2KZF A;  4LFA C;  4IR7 A;  2UXC C;  5AE2 A;  5K85 A;  3IEU A;  1T5H X;  1J5E C;  4RVN A;  4YY3 C;  5BUQ A;  4JYA C;  3TUF A;  3L95 X;  2V7B A;  3DAY A;  3AF6 A;  4DV2 C;  4TPS B;  2OO4 A;  3GR0 A;  2P20 A;  2PN2 A;  1T5D X;  3PES A;  2P2Q A;  5BSV A;  1ULT A;  2D1R A;  2Y4N A;  2P02 A;  2QVY X;  3A9V A;  2OPL A;  1MD9 A;  4EAT A;  4WV3 A;  5BR8 C;  3IML A;  4L7I A;  3J81 D;  4B3S C;  1ZB8 A;  4NOZ A;  5DV9 A;  5E7Q A;  4L4Q A;  1MDF A;  1I94 C;  5AE3 A;  1VLA A;  2VZE A;  5A1I A;  2ONF A;  5LMN C;  3FCC A;  5A2Q D;  1XRC A;  4DV3 C;  1HNW C;  4G37 A;  4DCT A;  3N2Q A;  2D1S A;  5KEI A;  1WH9 A;  5A1G A;  1XNR C;  4JI5 C;  3VNS A;  2QL8 A;  3VNR A;  2HHH C;  1HH2 P;  3LUS A;  3UZ0 A;  3RV2 A;  4DV7 C;  1XRA A;  4DR4 C;  1PG4 A;  1USP A;  3A4I A;  2UUB C;  2DYJ A;  3S82 A;  2P2B A;  5IFI A;  1O90 A;  4L2Z A;  4K0B A;  1O93 A;  3C5E A;  2ATW A;  4DV4 C;  1HNX C;  3PBK A;  4LF4 C;  2VQE C;  4DUY C;  2VSQ A;  3F4R A;  4DG9 A;  2Y4O A;  1K0R A;  3RG2 A;  4YHH C;  1XMQ C;  1HNZ C;  4KTT A;  3SO4 A;  4K0K C;  2JMP A;  4LF5 C;  2D7V A;  4MTN A;  2P2J A;  2HJG A;  4G1I A;  4OYC A;  3NYQ A;  5BSM A;  4BC7 A;  3NYR A;  3TQI A;  4R0M A;  2ZM6 C;  4R1M A;  3GPC A;  3I07 A;  5KYT A;  4R1L A;  1N36 C;  4ISB A;  4BSZ A;  4ODJ A;  4DUZ C;  2XR1 A;  1IBM C;  2CXC A;  3GR1 A;  3IEV A;  1IW7 D;  5T8T A;  2D27 A;  4JI8 C;  4NDN A;  4B3M C;  4DG8 A;  4DV5 C;  5BSW A;  2BJO A;  2UXD C;  4DV6 C;  4DR2 C;  4PHT A;  5BUR A;  3DLP X;  5CZV A;  2P2F A;  4U5Y D;  2E8C A;  1N32 C;  3PRO C;  3LAX A;  3IPL A;  4GXR A;  3EER A;  3UOW A;  1N34 C;  4B3T C;  4NXN C;  3NI2 A;  3KXW A;  3F4T A;  5BSU A;  2QVZ X;  2QVX X;  3ETO A;  2D1T A;  5IT9 D;  4DCU A;  1AMU A;  2OPL B;  4LF6 C;  5ADZ A;  3H2T A;  3L8C A;  4OXI A;  1LQL A;  4JI7 C;  4GXQ A;  4D56 A;  4WS9 A;  4DCV A;  1IBK C;  3T1Y C;  5FLX D;  1YJ7 A;  1XNQ C;  4DR6 C;  4DCS A;  4D57 A;  4BC9 A;  1QWI A;  4ZLP A;  3R44 A;  1V25 A;  1XMO C;  5BST A;  4DV1 C;  4RLF A;  1WF3 A;  5T8S A;  2E0G A;  4GKK C;  2PRO A;  3LGX A;  5AE1 A;  2F4V C;  4PZP A;  1MXC A;  4JI0 C;  1IBL C;  2PT7 G;  5K8F A;  2EGT A;  5CZX A;  4LF9 C;  5BUS A;  1V26 A;  4D4G A;  1ZB9 A;  4DV0 C;  1MXB A;  4RM2 A;  5KYV A;  1O9T A;  1QM4 A;  4JI1 C;  2UUC C;  4DR7 C;  3TDE A;  5JRH A;  3NPD A;  4G36 A;  2CY1 A;  4LFC C;  4RMN A;  1FJG C;  4PRO C;  5IWA C;  2D28 C;  3J80 D;  4FUT A;  3FCE A;  3R9W A;  4LE5 A;  1JOS A;  4JI2 C;  3ETC A;  4I9G A;  2YWB A;  1BA3 A;  1GPM A;  2P2M A;  2OBV A;  4LF8 C;  5GTD A;  5BSR A;  3AF5 A;  4X64 C;  3T1H C;  3B7W A;  4IZ6 A;  4GKJ C;  1KKG A;  2UUA C;  2E5L C;  2WD9 A;  1N2F A;  4KHP C;  2DPL A;  2AYA A;  1RY2 A;  2E7G A;  1PA4 A;  4JI3 C;  4DR3 C;  3JAM D;  3OTO C;  4JV5 C;  2D1Q A;  2Y27 A;  3A9U A;  3CW9 A;  4RM3 A;  2YWC A;  4AQY C;  2E8E A;  2UXB C;  1FUG A;  1ML8 A;  4I9F A;  3F4S A;  4LF7 C;  4B3R C;  1USP B;  4RVO A;  3GKU A;  1RG9 A;  3VNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...