1K7WA

Crystal structure of s283a duck delta 2 crystallin mutant
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
449
structure length
449
Chain Sequence
TDPIMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLEKISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQLIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNPLDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFSTGASLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALTPEMLATDLALYLVRKGVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSISPQFSSDVSQVFNFVNSVEQYTALGGTAKSSVTTQIEQLRELMKKQKEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutational analysis of duck delta 2 crystallin and the structure of an inactive mutant with bound substrate provide insight into the enzymatic mechanism of argininosuccinate lyase.
pubmed doi rcsb
source organism Anas platyrhynchos
molecule tags Lyase
molecule keywords delta 2 crystallin
total genus 186
structure length 449
sequence length 449
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.1: Argininosuccinate lyase.
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF14698 ASL_C2 Argininosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 1k7wA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 1k7wA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 1k7wA02
4APBA 2O78A 3KDYA 1TJWA 1RE5A 3R6QA 1YISA 3RRPA 2NYNA 1T6JA 4C5SA 3KDZA 1HY1A 4APAA 4NLEA 3R6VA 4EEIA 1Q5NA 1Y2MA 3CZOA 1AUWA 2O7EA 2PTSA 3R6YA 1HY0A 3NO9A 4BABA 1VDKA 1I0AA 4NSLA 1W27A 1K7WA 4BAAA 1C3CA 1B8FA 1GKMA 2RJRA 4FFXA 2QVEA 1YFEA 4MX2A 1FURA 1GK3A 5EYVA 5F92A 3TV2A 1EB4A 5HW2A 1DCNA 2PFMA 1XWOA 1T6PA 4FLCA 1YFMA 1K62A 3NZ4A 1TJ7A 1DOFA 4CQ5A 2VD6A 2J91A 1J3UA 2O7BA 2FUSA 3E04A 2HVGA 1JSWA 2O7DA 4V2QA 4C5UA 3RD8A 4HGVA 2PTQA 1GKJA 1FUOA 2O6YA 4C6GA 5EYTA 1FUQA 2O7FA 3GTDA 2NYFA 2X75A 3QBPA 3C8TA 1GK2A 3OCFA 1U16A 1KQ7A 4ADMA 2PTRA 5F91A 3BHGA 2E9FA 4ADLA 1TJVA 1FUPA 3UNVA 5D6BA 4C5RA 1TJUA 2OHYA 4V2RA 1C3UA 4EFCA 1U15A 3OCEA 2QGAB 3GZHA 2YIIA 2RJSA
chains in the Genus database with same CATH superfamily
4APBA 2O78A 3KDYA 1TJWA 4YIHA 1RE5A 3R6QA 1YISA 1Z4LA 3RRPA 3CI0K 2NYNA 1T6JA 1XMDA 4C5SA 3BWVA 3KDZA 2JAUA 1HY1A 2JAWA 4APAA 4NLEA 3R6VA 4EEIA 1Q5NA 2VL7A 1Y2MA 2RCNA 3CZOA 1AUWA 2O7EA 2PTSA 3R6YA 3CRW1 4L57A 4A15A 1HY0A 3NO9A 4BABA 2D28C 1VDKA 1I0AA 1T9HA 4NSLA 1W27A 1K7WA 4E88A 4BAAA 1MH9A 3F4RA 1C3CA 1B8FA 1GKMA 1XL7A 2RJRA 4FFXA 1Z4MA 2QVEA 1Q91A 1YFEA 4MUMA 2JARA 2VSFA 4YIKA 4MX2A 1U0LA 1FURA 1GK3A 5EYVA 5M0JA 5F92A 3TV2A 1EB4A 5HW2A 1DCNA 3CRVA 2PFMA 1XWOA 2D27A 1T6PA 4FLCA 1Z4IA 1YFMA 1K62A 3NZ4A 1TJ7A 1DOFA 2JAOA 4CQ5A 2VD6A 2J91A 1J3UA 2O7BA 2FUSA 4NFLA 4WNLA 3E04A 2HVGA 1JSWA 1XLYA 1Z4QA 2O7DA 2FENA 4V2QA 1Q92A 4C5UA 3RD8A 2YV5A 4HGVA 2PTQA 1GKJA 1FUOA 2O6YA 4C6GA 5EYTA 1FUQA 2O7FA 3GTDA 2NYFA 1Z4PX 2X75A 4L6AA 3QBPA 3U13A 3C8TA 1GK2A 3OCFA 1U16A 4IQJM 1KQ7A 1Z4JA 4ADMA 3U19A 2I7DA 2PTRA 5F91A 3BHGA 2E9FA 4ADLA 1IW7D 1TJVA 5H8WA 3F4TA 1FUPA 5M0IA 3UNVA 5D6BA 3F4SA 4C5RA 1TJUA 1XMCA 2OHYA 4V2RA 4L6CA 1C3UA 1Z4KA 4EFCA 1U15A 3OCEA 4MWOA 2QGAB 3GZHA 2YIIA 2FELA 1XL8A 2RJSA
chains in the Genus database with same CATH topology
4APBA 2O78A 3KDYA 1TJWA 1RE5A 3R6QA 1YISA 3RRPA 2NYNA 1T6JA 4C5SA 3KDZA 1HY1A 4APAA 4NLEA 3R6VA 4EEIA 1Q5NA 1Y2MA 3CZOA 1AUWA 2O7EA 2PTSA 3R6YA 1HY0A 3NO9A 4BABA 1VDKA 1I0AA 4NSLA 1W27A 1K7WA 4BAAA 1C3CA 1B8FA 1GKMA 2RJRA 4FFXA 2QVEA 1YFEA 4MX2A 1FURA 1GK3A 5EYVA 5F92A 3TV2A 1EB4A 5HW2A 1DCNA 2PFMA 1XWOA 1T6PA 4FLCA 1YFMA 1K62A 3NZ4A 1TJ7A 1DOFA 4CQ5A 2VD6A 2J91A 1J3UA 2O7BA 2FUSA 3E04A 2HVGA 1JSWA 2O7DA 4V2QA 4C5UA 3RD8A 4HGVA 2PTQA 1GKJA 1FUOA 2O6YA 4C6GA 5EYTA 1FUQA 2O7FA 3GTDA 2NYFA 2X75A 3QBPA 3C8TA 1GK2A 3OCFA 1U16A 1KQ7A 4ADMA 2PTRA 5F91A 3BHGA 2E9FA 4ADLA 1TJVA 1FUPA 3UNVA 5D6BA 4C5RA 1TJUA 2OHYA 4V2RA 1C3UA 4EFCA 1U15A 3OCEA 2QGAB 3GZHA 2YIIA 2RJSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4APB A;  2O78 A;  3KDY A;  1TJW A;  1RE5 A;  3R6Q A;  1YIS A;  3RRP A;  2NYN A;  1T6J A;  4C5S A;  3KDZ A;  1HY1 A;  4APA A;  4NLE A;  3R6V A;  4EEI A;  1Q5N A;  1Y2M A;  3CZO A;  1AUW A;  2O7E A;  2PTS A;  3R6Y A;  1HY0 A;  3NO9 A;  4BAB A;  1VDK A;  1I0A A;  4NSL A;  1W27 A;  1K7W A;  4BAA A;  1C3C A;  1B8F A;  1GKM A;  2RJR A;  4FFX A;  2QVE A;  1YFE A;  4MX2 A;  1FUR A;  1GK3 A;  5EYV A;  5F92 A;  3TV2 A;  1EB4 A;  5HW2 A;  1DCN A;  2PFM A;  1XWO A;  1T6P A;  4FLC A;  1YFM A;  1K62 A;  3NZ4 A;  1TJ7 A;  1DOF A;  4CQ5 A;  2VD6 A;  2J91 A;  1J3U A;  2O7B A;  2FUS A;  3E04 A;  2HVG A;  1JSW A;  2O7D A;  4V2Q A;  4C5U A;  3RD8 A;  4HGV A;  2PTQ A;  1GKJ A;  1FUO A;  2O6Y A;  4C6G A;  5EYT A;  1FUQ A;  2O7F A;  3GTD A;  2NYF A;  2X75 A;  3QBP A;  3C8T A;  1GK2 A;  3OCF A;  1U16 A;  1KQ7 A;  4ADM A;  2PTR A;  5F91 A;  3BHG A;  2E9F A;  4ADL A;  1TJV A;  1FUP A;  3UNV A;  5D6B A;  4C5R A;  1TJU A;  2OHY A;  4V2R A;  1C3U A;  4EFC A;  1U15 A;  3OCE A;  2QGA B;  3GZH A;  2YII A;  2RJS A; 
#chains in the Genus database with same CATH topology
 4APB A;  2O78 A;  3KDY A;  1TJW A;  4YIH A;  1RE5 A;  3R6Q A;  1YIS A;  1Z4L A;  3RRP A;  3CI0 K;  2NYN A;  1T6J A;  1XMD A;  4C5S A;  3BWV A;  3KDZ A;  2JAU A;  1HY1 A;  2JAW A;  4APA A;  4NLE A;  3R6V A;  4EEI A;  1Q5N A;  2VL7 A;  1Y2M A;  2RCN A;  3CZO A;  1AUW A;  2O7E A;  2PTS A;  3R6Y A;  3CRW 1;  4L57 A;  4A15 A;  1HY0 A;  3NO9 A;  4BAB A;  2D28 C;  1VDK A;  1I0A A;  1T9H A;  4NSL A;  1W27 A;  1K7W A;  4E88 A;  4BAA A;  1MH9 A;  3F4R A;  1C3C A;  1B8F A;  1GKM A;  1XL7 A;  2RJR A;  4FFX A;  1Z4M A;  2QVE A;  1Q91 A;  1YFE A;  4MUM A;  2JAR A;  2VSF A;  4YIK A;  4MX2 A;  1U0L A;  1FUR A;  1GK3 A;  5EYV A;  5M0J A;  5F92 A;  3TV2 A;  1EB4 A;  5HW2 A;  1DCN A;  3CRV A;  2PFM A;  1XWO A;  2D27 A;  1T6P A;  4FLC A;  1Z4I A;  1YFM A;  1K62 A;  3NZ4 A;  1TJ7 A;  1DOF A;  2JAO A;  4CQ5 A;  2VD6 A;  2J91 A;  1J3U A;  2O7B A;  2FUS A;  4NFL A;  4WNL A;  3E04 A;  2HVG A;  1JSW A;  1XLY A;  1Z4Q A;  2O7D A;  2FEN A;  4V2Q A;  1Q92 A;  4C5U A;  3RD8 A;  2YV5 A;  4HGV A;  2PTQ A;  1GKJ A;  1FUO A;  2O6Y A;  4C6G A;  5EYT A;  1FUQ A;  2O7F A;  3GTD A;  2NYF A;  1Z4P X;  2X75 A;  4L6A A;  3QBP A;  3U13 A;  3C8T A;  1GK2 A;  3OCF A;  1U16 A;  4IQJ M;  1KQ7 A;  1Z4J A;  4ADM A;  3U19 A;  2I7D A;  2PTR A;  5F91 A;  3BHG A;  2E9F A;  4ADL A;  1IW7 D;  1TJV A;  5H8W A;  3F4T A;  1FUP A;  5M0I A;  3UNV A;  5D6B A;  3F4S A;  4C5R A;  1TJU A;  1XMC A;  2OHY A;  4V2R A;  4L6C A;  1C3U A;  1Z4K A;  4EFC A;  1U15 A;  3OCE A;  4MWO A;  2QGA B;  3GZH A;  2YII A;  2FEL A;  1XL8 A;  2RJS A; 
#chains in the Genus database with same CATH homology
 4APB A;  2O78 A;  3KDY A;  1TJW A;  1RE5 A;  3R6Q A;  1YIS A;  3RRP A;  2NYN A;  1T6J A;  4C5S A;  3KDZ A;  1HY1 A;  4APA A;  4NLE A;  3R6V A;  4EEI A;  1Q5N A;  1Y2M A;  3CZO A;  1AUW A;  2O7E A;  2PTS A;  3R6Y A;  1HY0 A;  3NO9 A;  4BAB A;  1VDK A;  1I0A A;  4NSL A;  1W27 A;  1K7W A;  4BAA A;  1C3C A;  1B8F A;  1GKM A;  2RJR A;  4FFX A;  2QVE A;  1YFE A;  4MX2 A;  1FUR A;  1GK3 A;  5EYV A;  5F92 A;  3TV2 A;  1EB4 A;  5HW2 A;  1DCN A;  2PFM A;  1XWO A;  1T6P A;  4FLC A;  1YFM A;  1K62 A;  3NZ4 A;  1TJ7 A;  1DOF A;  4CQ5 A;  2VD6 A;  2J91 A;  1J3U A;  2O7B A;  2FUS A;  3E04 A;  2HVG A;  1JSW A;  2O7D A;  4V2Q A;  4C5U A;  3RD8 A;  4HGV A;  2PTQ A;  1GKJ A;  1FUO A;  2O6Y A;  4C6G A;  5EYT A;  1FUQ A;  2O7F A;  3GTD A;  2NYF A;  2X75 A;  3QBP A;  3C8T A;  1GK2 A;  3OCF A;  1U16 A;  1KQ7 A;  4ADM A;  2PTR A;  5F91 A;  3BHG A;  2E9F A;  4ADL A;  1TJV A;  1FUP A;  3UNV A;  5D6B A;  4C5R A;  1TJU A;  2OHY A;  4V2R A;  1C3U A;  4EFC A;  1U15 A;  3OCE A;  2QGA B;  3GZH A;  2YII A;  2RJS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...