1K7WA

Crystal structure of s283a duck delta 2 crystallin mutant
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
449
structure length
449
Chain Sequence
TDPIMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLEKISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQLIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNPLDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFSTGASLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALTPEMLATDLALYLVRKGVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSISPQFSSDVSQVFNFVNSVEQYTALGGTAKSSVTTQIEQLRELMKKQKEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords delta 2 crystallin
publication title Mutational analysis of duck delta 2 crystallin and the structure of an inactive mutant with bound substrate provide insight into the enzymatic mechanism of argininosuccinate lyase.
pubmed doi rcsb
source organism Anas platyrhynchos
molecule tags Lyase
total genus 186
structure length 449
sequence length 449
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.1: Argininosuccinate lyase.
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF14698 ASL_C2 Argininosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 1k7wA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 1k7wA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 1k7wA02
3OCFA 3RD8A 1FUPA 1TJVA 4NLEA 1RE5A 4ADLA 1U16A 3RRPA 2O78A 4C5SA 1AUWA 1W27A 1K62A 2RJRA 3TV2A 2NYFA 2O7DA 4C5UA 1EB4A 1U15A 1TJWA 1YFMA 2PTRA 1JSWA 1FUOA 1J3UA 3GZHA 3R6YA 1TJ7A 2FUSA 1TJUA 5D6BA 5EYTA 4NSLA 1C3UA 3C8TA 3BHGA 3KDYA 2O7EA 1GK2A 1GKJA 4CQ5A 5F91A 3OCEA 3E04A 2E9FA 2VD6A 4V2RA 1VDKA 1Y2MA 2RJSA 2X75A 1K7WA 2QVEA 1FUQA 2YIIA 4FFXA 1T6JA 4V2QA 2J91A 4BAAA 4FLCA 4APAA 1DOFA 1C3CA 5HW2A 4C6GA 4ADMA 3NZ4A 1YFEA 5F92A 4MX2A 1GKMA 1Q5NA 1HY1A 2PTSA 3CZOA 2OHYA 1KQ7A 4EFCA 2O6YA 2PTQA 2PFMA 4BABA 3NO9A 3R6QA 2HVGA 3R6VA 1B8FA 1YISA 1XWOA 2QGAB 3QBPA 1T6PA 2O7BA 1HY0A 1FURA 4HGVA 3GTDA 2NYNA 2O7FA 1GK3A 4APBA 3UNVA 1DCNA 5EYVA 1I0AA 4EEIA 3KDZA 4C5RA
chains in the Genus database with same CATH superfamily
3OCFA 4A15A 3RD8A 1FUPA 1T9HA 1U0LA 1Z4LA 3F4RA 4L57A 2JARA 1TJVA 4L6AA 4NLEA 4MWOA 1RE5A 4ADLA 3U13A 1IW7D 1U16A 3CI0K 3RRPA 2O78A 4C5SA 1AUWA 1W27A 1K62A 2RJRA 5M0JA 3TV2A 4MUMA 3BWVA 2NYFA 3CRVA 2O7DA 2VL7A 1Z4MA 4C5UA 1EB4A 1U15A 2D28C 1Z4PX 1Q91A 1TJWA 1YFMA 2PTRA 1JSWA 1FUOA 1J3UA 3GZHA 4NFLA 1Z4IA 3F4SA 3R6YA 1TJ7A 2FUSA 2JAOA 1TJUA 5D6BA 5EYTA 2YV5A 4NSLA 1XL8A 1C3UA 5M0IA 3C8TA 2JAWA 3BHGA 3KDYA 2JAUA 2RCNA 1GK2A 2O7EA 1GKJA 2I7DA 4CQ5A 5F91A 4WNLA 3OCEA 3E04A 3U19A 2E9FA 2VD6A 4V2RA 1VDKA 1Y2MA 2RJSA 2X75A 1K7WA 2QVEA 1FUQA 2YIIA 4FFXA 2FENA 2D27A 1T6JA 4V2QA 2J91A 4BAAA 4FLCA 2FELA 4APAA 1Z4QA 1DOFA 1C3CA 1XL7A 5HW2A 3F4TA 4C6GA 4ADMA 3NZ4A 1YFEA 5F92A 4MX2A 1GKMA 5H8WA 1Q5NA 1HY1A 2PTSA 1XLYA 3CZOA 2OHYA 1XMDA 4YIHA 1KQ7A 4EFCA 2O6YA 2PTQA 2PFMA 4L6CA 4BABA 3NO9A 1XMCA 3R6QA 2HVGA 3R6VA 1B8FA 1YISA 1XWOA 3CRW1 2QGAB 3QBPA 1T6PA 2O7BA 1HY0A 1Z4JA 1FURA 2VSFA 4IQJM 4HGVA 3GTDA 2NYNA 2O7FA 1GK3A 4APBA 4E88A 3UNVA 1DCNA 1MH9A 4YIKA 5EYVA 1I0AA 4EEIA 3KDZA 1Q92A 4C5RA 1Z4KA
chains in the Genus database with same CATH topology
3OCFA 3RD8A 1FUPA 1TJVA 4NLEA 1RE5A 4ADLA 1U16A 3RRPA 2O78A 4C5SA 1AUWA 1W27A 1K62A 2RJRA 3TV2A 2NYFA 2O7DA 4C5UA 1EB4A 1U15A 1TJWA 1YFMA 2PTRA 1JSWA 1FUOA 1J3UA 3GZHA 3R6YA 1TJ7A 2FUSA 1TJUA 5D6BA 5EYTA 4NSLA 1C3UA 3C8TA 3BHGA 3KDYA 2O7EA 1GK2A 1GKJA 4CQ5A 5F91A 3OCEA 3E04A 2E9FA 2VD6A 4V2RA 1VDKA 1Y2MA 2RJSA 2X75A 1K7WA 2QVEA 1FUQA 2YIIA 4FFXA 1T6JA 4V2QA 2J91A 4BAAA 4FLCA 4APAA 1DOFA 1C3CA 5HW2A 4C6GA 4ADMA 3NZ4A 1YFEA 5F92A 4MX2A 1GKMA 1Q5NA 1HY1A 2PTSA 3CZOA 2OHYA 1KQ7A 4EFCA 2O6YA 2PTQA 2PFMA 4BABA 3NO9A 3R6QA 2HVGA 3R6VA 1B8FA 1YISA 1XWOA 2QGAB 3QBPA 1T6PA 2O7BA 1HY0A 1FURA 4HGVA 3GTDA 2NYNA 2O7FA 1GK3A 4APBA 3UNVA 1DCNA 5EYVA 1I0AA 4EEIA 3KDZA 4C5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OCF A;  3RD8 A;  1FUP A;  1TJV A;  4NLE A;  1RE5 A;  4ADL A;  1U16 A;  3RRP A;  2O78 A;  4C5S A;  1AUW A;  1W27 A;  1K62 A;  2RJR A;  3TV2 A;  2NYF A;  2O7D A;  4C5U A;  1EB4 A;  1U15 A;  1TJW A;  1YFM A;  2PTR A;  1JSW A;  1FUO A;  1J3U A;  3GZH A;  3R6Y A;  1TJ7 A;  2FUS A;  1TJU A;  5D6B A;  5EYT A;  4NSL A;  1C3U A;  3C8T A;  3BHG A;  3KDY A;  2O7E A;  1GK2 A;  1GKJ A;  4CQ5 A;  5F91 A;  3OCE A;  3E04 A;  2E9F A;  2VD6 A;  4V2R A;  1VDK A;  1Y2M A;  2RJS A;  2X75 A;  1K7W A;  2QVE A;  1FUQ A;  2YII A;  4FFX A;  1T6J A;  4V2Q A;  2J91 A;  4BAA A;  4FLC A;  4APA A;  1DOF A;  1C3C A;  5HW2 A;  4C6G A;  4ADM A;  3NZ4 A;  1YFE A;  5F92 A;  4MX2 A;  1GKM A;  1Q5N A;  1HY1 A;  2PTS A;  3CZO A;  2OHY A;  1KQ7 A;  4EFC A;  2O6Y A;  2PTQ A;  2PFM A;  4BAB A;  3NO9 A;  3R6Q A;  2HVG A;  3R6V A;  1B8F A;  1YIS A;  1XWO A;  2QGA B;  3QBP A;  1T6P A;  2O7B A;  1HY0 A;  1FUR A;  4HGV A;  3GTD A;  2NYN A;  2O7F A;  1GK3 A;  4APB A;  3UNV A;  1DCN A;  5EYV A;  1I0A A;  4EEI A;  3KDZ A;  4C5R A; 
#chains in the Genus database with same CATH topology
 3OCF A;  4A15 A;  3RD8 A;  1FUP A;  1T9H A;  1U0L A;  1Z4L A;  3F4R A;  4L57 A;  2JAR A;  1TJV A;  4L6A A;  4NLE A;  4MWO A;  1RE5 A;  4ADL A;  3U13 A;  1IW7 D;  1U16 A;  3CI0 K;  3RRP A;  2O78 A;  4C5S A;  1AUW A;  1W27 A;  1K62 A;  2RJR A;  5M0J A;  3TV2 A;  4MUM A;  3BWV A;  2NYF A;  3CRV A;  2O7D A;  2VL7 A;  1Z4M A;  4C5U A;  1EB4 A;  1U15 A;  2D28 C;  1Z4P X;  1Q91 A;  1TJW A;  1YFM A;  2PTR A;  1JSW A;  1FUO A;  1J3U A;  3GZH A;  4NFL A;  1Z4I A;  3F4S A;  3R6Y A;  1TJ7 A;  2FUS A;  2JAO A;  1TJU A;  5D6B A;  5EYT A;  2YV5 A;  4NSL A;  1XL8 A;  1C3U A;  5M0I A;  3C8T A;  2JAW A;  3BHG A;  3KDY A;  2JAU A;  2RCN A;  1GK2 A;  2O7E A;  1GKJ A;  2I7D A;  4CQ5 A;  5F91 A;  4WNL A;  3OCE A;  3E04 A;  3U19 A;  2E9F A;  2VD6 A;  4V2R A;  1VDK A;  1Y2M A;  2RJS A;  2X75 A;  1K7W A;  2QVE A;  1FUQ A;  2YII A;  4FFX A;  2FEN A;  2D27 A;  1T6J A;  4V2Q A;  2J91 A;  4BAA A;  4FLC A;  2FEL A;  4APA A;  1Z4Q A;  1DOF A;  1C3C A;  1XL7 A;  5HW2 A;  3F4T A;  4C6G A;  4ADM A;  3NZ4 A;  1YFE A;  5F92 A;  4MX2 A;  1GKM A;  5H8W A;  1Q5N A;  1HY1 A;  2PTS A;  1XLY A;  3CZO A;  2OHY A;  1XMD A;  4YIH A;  1KQ7 A;  4EFC A;  2O6Y A;  2PTQ A;  2PFM A;  4L6C A;  4BAB A;  3NO9 A;  1XMC A;  3R6Q A;  2HVG A;  3R6V A;  1B8F A;  1YIS A;  1XWO A;  3CRW 1;  2QGA B;  3QBP A;  1T6P A;  2O7B A;  1HY0 A;  1Z4J A;  1FUR A;  2VSF A;  4IQJ M;  4HGV A;  3GTD A;  2NYN A;  2O7F A;  1GK3 A;  4APB A;  4E88 A;  3UNV A;  1DCN A;  1MH9 A;  4YIK A;  5EYV A;  1I0A A;  4EEI A;  3KDZ A;  1Q92 A;  4C5R A;  1Z4K A; 
#chains in the Genus database with same CATH homology
 3OCF A;  3RD8 A;  1FUP A;  1TJV A;  4NLE A;  1RE5 A;  4ADL A;  1U16 A;  3RRP A;  2O78 A;  4C5S A;  1AUW A;  1W27 A;  1K62 A;  2RJR A;  3TV2 A;  2NYF A;  2O7D A;  4C5U A;  1EB4 A;  1U15 A;  1TJW A;  1YFM A;  2PTR A;  1JSW A;  1FUO A;  1J3U A;  3GZH A;  3R6Y A;  1TJ7 A;  2FUS A;  1TJU A;  5D6B A;  5EYT A;  4NSL A;  1C3U A;  3C8T A;  3BHG A;  3KDY A;  2O7E A;  1GK2 A;  1GKJ A;  4CQ5 A;  5F91 A;  3OCE A;  3E04 A;  2E9F A;  2VD6 A;  4V2R A;  1VDK A;  1Y2M A;  2RJS A;  2X75 A;  1K7W A;  2QVE A;  1FUQ A;  2YII A;  4FFX A;  1T6J A;  4V2Q A;  2J91 A;  4BAA A;  4FLC A;  4APA A;  1DOF A;  1C3C A;  5HW2 A;  4C6G A;  4ADM A;  3NZ4 A;  1YFE A;  5F92 A;  4MX2 A;  1GKM A;  1Q5N A;  1HY1 A;  2PTS A;  3CZO A;  2OHY A;  1KQ7 A;  4EFC A;  2O6Y A;  2PTQ A;  2PFM A;  4BAB A;  3NO9 A;  3R6Q A;  2HVG A;  3R6V A;  1B8F A;  1YIS A;  1XWO A;  2QGA B;  3QBP A;  1T6P A;  2O7B A;  1HY0 A;  1FUR A;  4HGV A;  3GTD A;  2NYN A;  2O7F A;  1GK3 A;  4APB A;  3UNV A;  1DCN A;  5EYV A;  1I0A A;  4EEI A;  3KDZ A;  4C5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...