1K7WA

Crystal structure of s283a duck delta 2 crystallin mutant
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
449
structure length
449
Chain Sequence
TDPIMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLEKISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQLIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNPLDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFSTGASLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALTPEMLATDLALYLVRKGVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSISPQFSSDVSQVFNFVNSVEQYTALGGTAKSSVTTQIEQLRELMKKQKEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords delta 2 crystallin
publication title Mutational analysis of duck delta 2 crystallin and the structure of an inactive mutant with bound substrate provide insight into the enzymatic mechanism of argininosuccinate lyase.
pubmed doi rcsb
source organism Anas platyrhynchos
total genus 186
structure length 449
sequence length 449
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.1: Argininosuccinate lyase.
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF14698 ASL_C2 Argininosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 1k7wA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 1k7wA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 1k7wA02
4NSLA 5EYVA 4C6GA 2O6YA 2PTSA 2J91A 1Y2MA 2VD6A 2PTQA 2O78A 2RJSA 4FLCA 3NO9A 1TJWA 4APAA 2NYNA 1GK2A 3R6YA 1FURA 2E9FA 1U16A 1FUQA 3GZHA 1W27A 4V2RA 2OHYA 3KDYA 4HGVA 1YISA 4NLEA 1C3UA 4EEIA 1DCNA 3R6VA 3RRPA 3UNVA 4ADMA 5EYTA 4C5UA 3CZOA 3BHGA 1RE5A 1EB4A 1GKJA 4EFCA 3OCFA 4FFXA 1TJUA 4CQ5A 1XWOA 2O7EA 4ADLA 1TJVA 4BAAA 3KDZA 1HY1A 3RD8A 3OCEA 2FUSA 2O7DA 5F91A 1Q5NA 2QVEA 1KQ7A 2QGAB 1K7WA 2O7BA 1GKMA 1HY0A 2YIIA 3GTDA 3E04A 1VDKA 4MX2A 3QBPA 1GK3A 1B8FA 1T6PA 4BABA 3TV2A 1DOFA 4V2QA 1C3CA 3R6QA 1T6JA 5D6BA 2PFMA 1JSWA 4C5RA 3NZ4A 1AUWA 1I0AA 1J3UA 3C8TA 1YFEA 1YFMA 4C5SA 4APBA 2RJRA 2PTRA 1TJ7A 1FUOA 5HW2A 2HVGA 2X75A 1K62A 5F92A 2O7FA 2NYFA 1U15A 1FUPA
chains in the Genus database with same CATH superfamily
4NSLA 1XMCA 5EYVA 4C6GA 4A15A 2O6YA 2JAWA 3F4SA 2PTSA 2J91A 1Y2MA 4WNLA 5M0JA 2VD6A 1Z4IA 2PTQA 2O78A 3CI0K 2RJSA 4MUMA 4FLCA 3NO9A 1TJWA 4APAA 2NYNA 1Z4LA 1GK2A 3R6YA 1FURA 2E9FA 1U16A 1FUQA 1IW7D 3GZHA 1W27A 4L57A 2FENA 4V2RA 2I7DA 4NFLA 5H8WA 2OHYA 3KDYA 4HGVA 1YISA 4NLEA 1C3UA 4EEIA 1Q91A 1XMDA 1DCNA 3R6VA 3RRPA 3UNVA 4ADMA 5EYTA 4C5UA 3CZOA 3BHGA 1RE5A 1Q92A 1EB4A 1GKJA 1XLYA 4EFCA 3OCFA 1U0LA 4FFXA 1TJUA 2JARA 4CQ5A 1XWOA 4L6AA 1Z4MA 2O7EA 4L6CA 4ADLA 1TJVA 4BAAA 3KDZA 4IQJM 3CRVA 2RCNA 1HY1A 1XL8A 3RD8A 3OCEA 2FUSA 3CRW1 2O7DA 5F91A 1Q5NA 5M0IA 2QVEA 2VL7A 1KQ7A 2QGAB 1Z4QA 1K7WA 1Z4PX 2O7BA 1GKMA 1HY0A 2YIIA 3GTDA 2YV5A 3E04A 1VDKA 4MX2A 2FELA 2JAOA 3QBPA 1MH9A 1GK3A 1B8FA 3F4RA 3BWVA 1T6PA 4BABA 3TV2A 1DOFA 4V2QA 1C3CA 4YIHA 3F4TA 3R6QA 1XL7A 1Z4JA 1T6JA 1T9HA 2D28C 5D6BA 4YIKA 4MWOA 4E88A 2PFMA 1JSWA 4C5RA 3NZ4A 1AUWA 1I0AA 1J3UA 3C8TA 1YFEA 1YFMA 2JAUA 4C5SA 4APBA 2RJRA 1Z4KA 2PTRA 2D27A 1TJ7A 1FUOA 5HW2A 2VSFA 3U19A 2HVGA 3U13A 2X75A 1K62A 5F92A 2O7FA 2NYFA 1U15A 1FUPA
chains in the Genus database with same CATH topology
4NSLA 5EYVA 4C6GA 2O6YA 2PTSA 2J91A 1Y2MA 2VD6A 2PTQA 2O78A 2RJSA 4FLCA 3NO9A 1TJWA 4APAA 2NYNA 1GK2A 3R6YA 1FURA 2E9FA 1U16A 1FUQA 3GZHA 1W27A 4V2RA 2OHYA 3KDYA 4HGVA 1YISA 4NLEA 1C3UA 4EEIA 1DCNA 3R6VA 3RRPA 3UNVA 4ADMA 5EYTA 4C5UA 3CZOA 3BHGA 1RE5A 1EB4A 1GKJA 4EFCA 3OCFA 4FFXA 1TJUA 4CQ5A 1XWOA 2O7EA 4ADLA 1TJVA 4BAAA 3KDZA 1HY1A 3RD8A 3OCEA 2FUSA 2O7DA 5F91A 1Q5NA 2QVEA 1KQ7A 2QGAB 1K7WA 2O7BA 1GKMA 1HY0A 2YIIA 3GTDA 3E04A 1VDKA 4MX2A 3QBPA 1GK3A 1B8FA 1T6PA 4BABA 3TV2A 1DOFA 4V2QA 1C3CA 3R6QA 1T6JA 5D6BA 2PFMA 1JSWA 4C5RA 3NZ4A 1AUWA 1I0AA 1J3UA 3C8TA 1YFEA 1YFMA 4C5SA 4APBA 2RJRA 2PTRA 1TJ7A 1FUOA 5HW2A 2HVGA 2X75A 1K62A 5F92A 2O7FA 2NYFA 1U15A 1FUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NSL A;  5EYV A;  4C6G A;  2O6Y A;  2PTS A;  2J91 A;  1Y2M A;  2VD6 A;  2PTQ A;  2O78 A;  2RJS A;  4FLC A;  3NO9 A;  1TJW A;  4APA A;  2NYN A;  1GK2 A;  3R6Y A;  1FUR A;  2E9F A;  1U16 A;  1FUQ A;  3GZH A;  1W27 A;  4V2R A;  2OHY A;  3KDY A;  4HGV A;  1YIS A;  4NLE A;  1C3U A;  4EEI A;  1DCN A;  3R6V A;  3RRP A;  3UNV A;  4ADM A;  5EYT A;  4C5U A;  3CZO A;  3BHG A;  1RE5 A;  1EB4 A;  1GKJ A;  4EFC A;  3OCF A;  4FFX A;  1TJU A;  4CQ5 A;  1XWO A;  2O7E A;  4ADL A;  1TJV A;  4BAA A;  3KDZ A;  1HY1 A;  3RD8 A;  3OCE A;  2FUS A;  2O7D A;  5F91 A;  1Q5N A;  2QVE A;  1KQ7 A;  2QGA B;  1K7W A;  2O7B A;  1GKM A;  1HY0 A;  2YII A;  3GTD A;  3E04 A;  1VDK A;  4MX2 A;  3QBP A;  1GK3 A;  1B8F A;  1T6P A;  4BAB A;  3TV2 A;  1DOF A;  4V2Q A;  1C3C A;  3R6Q A;  1T6J A;  5D6B A;  2PFM A;  1JSW A;  4C5R A;  3NZ4 A;  1AUW A;  1I0A A;  1J3U A;  3C8T A;  1YFE A;  1YFM A;  4C5S A;  4APB A;  2RJR A;  2PTR A;  1TJ7 A;  1FUO A;  5HW2 A;  2HVG A;  2X75 A;  1K62 A;  5F92 A;  2O7F A;  2NYF A;  1U15 A;  1FUP A; 
#chains in the Genus database with same CATH topology
 4NSL A;  1XMC A;  5EYV A;  4C6G A;  4A15 A;  2O6Y A;  2JAW A;  3F4S A;  2PTS A;  2J91 A;  1Y2M A;  4WNL A;  5M0J A;  2VD6 A;  1Z4I A;  2PTQ A;  2O78 A;  3CI0 K;  2RJS A;  4MUM A;  4FLC A;  3NO9 A;  1TJW A;  4APA A;  2NYN A;  1Z4L A;  1GK2 A;  3R6Y A;  1FUR A;  2E9F A;  1U16 A;  1FUQ A;  1IW7 D;  3GZH A;  1W27 A;  4L57 A;  2FEN A;  4V2R A;  2I7D A;  4NFL A;  5H8W A;  2OHY A;  3KDY A;  4HGV A;  1YIS A;  4NLE A;  1C3U A;  4EEI A;  1Q91 A;  1XMD A;  1DCN A;  3R6V A;  3RRP A;  3UNV A;  4ADM A;  5EYT A;  4C5U A;  3CZO A;  3BHG A;  1RE5 A;  1Q92 A;  1EB4 A;  1GKJ A;  1XLY A;  4EFC A;  3OCF A;  1U0L A;  4FFX A;  1TJU A;  2JAR A;  4CQ5 A;  1XWO A;  4L6A A;  1Z4M A;  2O7E A;  4L6C A;  4ADL A;  1TJV A;  4BAA A;  3KDZ A;  4IQJ M;  3CRV A;  2RCN A;  1HY1 A;  1XL8 A;  3RD8 A;  3OCE A;  2FUS A;  3CRW 1;  2O7D A;  5F91 A;  1Q5N A;  5M0I A;  2QVE A;  2VL7 A;  1KQ7 A;  2QGA B;  1Z4Q A;  1K7W A;  1Z4P X;  2O7B A;  1GKM A;  1HY0 A;  2YII A;  3GTD A;  2YV5 A;  3E04 A;  1VDK A;  4MX2 A;  2FEL A;  2JAO A;  3QBP A;  1MH9 A;  1GK3 A;  1B8F A;  3F4R A;  3BWV A;  1T6P A;  4BAB A;  3TV2 A;  1DOF A;  4V2Q A;  1C3C A;  4YIH A;  3F4T A;  3R6Q A;  1XL7 A;  1Z4J A;  1T6J A;  1T9H A;  2D28 C;  5D6B A;  4YIK A;  4MWO A;  4E88 A;  2PFM A;  1JSW A;  4C5R A;  3NZ4 A;  1AUW A;  1I0A A;  1J3U A;  3C8T A;  1YFE A;  1YFM A;  2JAU A;  4C5S A;  4APB A;  2RJR A;  1Z4K A;  2PTR A;  2D27 A;  1TJ7 A;  1FUO A;  5HW2 A;  2VSF A;  3U19 A;  2HVG A;  3U13 A;  2X75 A;  1K62 A;  5F92 A;  2O7F A;  2NYF A;  1U15 A;  1FUP A; 
#chains in the Genus database with same CATH homology
 4NSL A;  5EYV A;  4C6G A;  2O6Y A;  2PTS A;  2J91 A;  1Y2M A;  2VD6 A;  2PTQ A;  2O78 A;  2RJS A;  4FLC A;  3NO9 A;  1TJW A;  4APA A;  2NYN A;  1GK2 A;  3R6Y A;  1FUR A;  2E9F A;  1U16 A;  1FUQ A;  3GZH A;  1W27 A;  4V2R A;  2OHY A;  3KDY A;  4HGV A;  1YIS A;  4NLE A;  1C3U A;  4EEI A;  1DCN A;  3R6V A;  3RRP A;  3UNV A;  4ADM A;  5EYT A;  4C5U A;  3CZO A;  3BHG A;  1RE5 A;  1EB4 A;  1GKJ A;  4EFC A;  3OCF A;  4FFX A;  1TJU A;  4CQ5 A;  1XWO A;  2O7E A;  4ADL A;  1TJV A;  4BAA A;  3KDZ A;  1HY1 A;  3RD8 A;  3OCE A;  2FUS A;  2O7D A;  5F91 A;  1Q5N A;  2QVE A;  1KQ7 A;  2QGA B;  1K7W A;  2O7B A;  1GKM A;  1HY0 A;  2YII A;  3GTD A;  3E04 A;  1VDK A;  4MX2 A;  3QBP A;  1GK3 A;  1B8F A;  1T6P A;  4BAB A;  3TV2 A;  1DOF A;  4V2Q A;  1C3C A;  3R6Q A;  1T6J A;  5D6B A;  2PFM A;  1JSW A;  4C5R A;  3NZ4 A;  1AUW A;  1I0A A;  1J3U A;  3C8T A;  1YFE A;  1YFM A;  4C5S A;  4APB A;  2RJR A;  2PTR A;  1TJ7 A;  1FUO A;  5HW2 A;  2HVG A;  2X75 A;  1K62 A;  5F92 A;  2O7F A;  2NYF A;  1U15 A;  1FUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...