1K7WA

Crystal structure of s283a duck delta 2 crystallin mutant
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
449
structure length
449
Chain Sequence
TDPIMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLEKISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQLIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNPLDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFSTGASLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALTPEMLATDLALYLVRKGVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSISPQFSSDVSQVFNFVNSVEQYTALGGTAKSSVTTQIEQLRELMKKQKEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords delta 2 crystallin
publication title Mutational analysis of duck delta 2 crystallin and the structure of an inactive mutant with bound substrate provide insight into the enzymatic mechanism of argininosuccinate lyase.
pubmed doi rcsb
source organism Anas platyrhynchos
molecule tags Lyase
total genus 186
structure length 449
sequence length 449
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.1: Argininosuccinate lyase.
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF14698 ASL_C2 Argininosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 1k7wA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 1k7wA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 1k7wA02
1TJUA 4APAA 2J91A 2RJSA 1GKMA 1YISA 3OCEA 4BABA 1KQ7A 5F91A 1EB4A 3GTDA 3BHGA 2VD6A 3R6YA 3R6QA 4EEIA 4FFXA 4V2RA 1DCNA 2OHYA 2PTRA 4C5RA 4ADMA 2O78A 3RD8A 2O6YA 1B8FA 5F92A 3NZ4A 1GK3A 2E9FA 2O7BA 4C5UA 3QBPA 2QGAB 1J3UA 5HW2A 1RE5A 2RJRA 4HGVA 4FLCA 2HVGA 1YFMA 4APBA 4C6GA 1FURA 1K62A 3R6VA 3NO9A 1U16A 3CZOA 1YFEA 4BAAA 1DOFA 4EFCA 1TJWA 2NYFA 1K7WA 3KDYA 1C3UA 4NLEA 1T6PA 3UNVA 1XWOA 3GZHA 4NSLA 3KDZA 2O7FA 1HY1A 4ADLA 1T6JA 5EYVA 1U15A 2O7EA 1HY0A 2QVEA 1TJ7A 2FUSA 3TV2A 4C5SA 3E04A 1FUOA 4CQ5A 2NYNA 2YIIA 1TJVA 2PFMA 4MX2A 2PTQA 4V2QA 3OCFA 2PTSA 1C3CA 3RRPA 5D6BA 1GK2A 1FUPA 1JSWA 1AUWA 1VDKA 1FUQA 1Q5NA 1Y2MA 1GKJA 1I0AA 1W27A 5EYTA 2X75A 2O7DA 3C8TA
chains in the Genus database with same CATH superfamily
1TJUA 4APAA 1Q92A 2J91A 2RJSA 3F4SA 1GKMA 1YISA 4YIKA 3OCEA 4BABA 1KQ7A 5F91A 1EB4A 4L57A 3GTDA 4L6AA 3BHGA 2D28C 2VD6A 1T9HA 3R6YA 3R6QA 4EEIA 4FFXA 4V2RA 2YV5A 1DCNA 2I7DA 2OHYA 2PTRA 1MH9A 4NFLA 4C5RA 4L6CA 3CRW1 4ADMA 2O78A 2FENA 2JARA 3RD8A 2O6YA 3U19A 1B8FA 5F92A 5M0JA 3NZ4A 1GK3A 2E9FA 1U0LA 2O7BA 4C5UA 3QBPA 2QGAB 3F4TA 1J3UA 5HW2A 1RE5A 2RJRA 4HGVA 4FLCA 2HVGA 2VL7A 2JAWA 1YFMA 4APBA 4C6GA 4WNLA 1FURA 3U13A 1Z4MA 1K62A 3R6VA 3NO9A 1U16A 3CZOA 1YFEA 4E88A 4A15A 4BAAA 1DOFA 4EFCA 1TJWA 2NYFA 2VSFA 1Z4PX 1Z4LA 4MUMA 5M0IA 1K7WA 3KDYA 1C3UA 1Z4KA 4NLEA 1T6PA 3UNVA 1IW7D 1XWOA 3GZHA 1XL8A 4NSLA 1Z4QA 3KDZA 2O7FA 3CRVA 1HY1A 4ADLA 4MWOA 1XMDA 1T6JA 5EYVA 1U15A 2O7EA 1HY0A 1XLYA 2QVEA 1TJ7A 2FUSA 4IQJM 3TV2A 4C5SA 5H8WA 3E04A 1XL7A 1FUOA 1Z4IA 1Z4JA 3BWVA 4CQ5A 2NYNA 4YIHA 2JAOA 3CI0K 1TJVA 2YIIA 2PFMA 4MX2A 1XMCA 2PTQA 4V2QA 3OCFA 2FELA 2PTSA 1C3CA 3RRPA 5D6BA 2D27A 1GK2A 1FUPA 1JSWA 1AUWA 1VDKA 1FUQA 1Q5NA 1Y2MA 1GKJA 1Q91A 1I0AA 1W27A 2JAUA 2RCNA 5EYTA 2X75A 3F4RA 2O7DA 3C8TA
chains in the Genus database with same CATH topology
1TJUA 4APAA 2J91A 2RJSA 1GKMA 1YISA 3OCEA 4BABA 1KQ7A 5F91A 1EB4A 3GTDA 3BHGA 2VD6A 3R6YA 3R6QA 4EEIA 4FFXA 4V2RA 1DCNA 2OHYA 2PTRA 4C5RA 4ADMA 2O78A 3RD8A 2O6YA 1B8FA 5F92A 3NZ4A 1GK3A 2E9FA 2O7BA 4C5UA 3QBPA 2QGAB 1J3UA 5HW2A 1RE5A 2RJRA 4HGVA 4FLCA 2HVGA 1YFMA 4APBA 4C6GA 1FURA 1K62A 3R6VA 3NO9A 1U16A 3CZOA 1YFEA 4BAAA 1DOFA 4EFCA 1TJWA 2NYFA 1K7WA 3KDYA 1C3UA 4NLEA 1T6PA 3UNVA 1XWOA 3GZHA 4NSLA 3KDZA 2O7FA 1HY1A 4ADLA 1T6JA 5EYVA 1U15A 2O7EA 1HY0A 2QVEA 1TJ7A 2FUSA 3TV2A 4C5SA 3E04A 1FUOA 4CQ5A 2NYNA 2YIIA 1TJVA 2PFMA 4MX2A 2PTQA 4V2QA 3OCFA 2PTSA 1C3CA 3RRPA 5D6BA 1GK2A 1FUPA 1JSWA 1AUWA 1VDKA 1FUQA 1Q5NA 1Y2MA 1GKJA 1I0AA 1W27A 5EYTA 2X75A 2O7DA 3C8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TJU A;  4APA A;  2J91 A;  2RJS A;  1GKM A;  1YIS A;  3OCE A;  4BAB A;  1KQ7 A;  5F91 A;  1EB4 A;  3GTD A;  3BHG A;  2VD6 A;  3R6Y A;  3R6Q A;  4EEI A;  4FFX A;  4V2R A;  1DCN A;  2OHY A;  2PTR A;  4C5R A;  4ADM A;  2O78 A;  3RD8 A;  2O6Y A;  1B8F A;  5F92 A;  3NZ4 A;  1GK3 A;  2E9F A;  2O7B A;  4C5U A;  3QBP A;  2QGA B;  1J3U A;  5HW2 A;  1RE5 A;  2RJR A;  4HGV A;  4FLC A;  2HVG A;  1YFM A;  4APB A;  4C6G A;  1FUR A;  1K62 A;  3R6V A;  3NO9 A;  1U16 A;  3CZO A;  1YFE A;  4BAA A;  1DOF A;  4EFC A;  1TJW A;  2NYF A;  1K7W A;  3KDY A;  1C3U A;  4NLE A;  1T6P A;  3UNV A;  1XWO A;  3GZH A;  4NSL A;  3KDZ A;  2O7F A;  1HY1 A;  4ADL A;  1T6J A;  5EYV A;  1U15 A;  2O7E A;  1HY0 A;  2QVE A;  1TJ7 A;  2FUS A;  3TV2 A;  4C5S A;  3E04 A;  1FUO A;  4CQ5 A;  2NYN A;  2YII A;  1TJV A;  2PFM A;  4MX2 A;  2PTQ A;  4V2Q A;  3OCF A;  2PTS A;  1C3C A;  3RRP A;  5D6B A;  1GK2 A;  1FUP A;  1JSW A;  1AUW A;  1VDK A;  1FUQ A;  1Q5N A;  1Y2M A;  1GKJ A;  1I0A A;  1W27 A;  5EYT A;  2X75 A;  2O7D A;  3C8T A; 
#chains in the Genus database with same CATH topology
 1TJU A;  4APA A;  1Q92 A;  2J91 A;  2RJS A;  3F4S A;  1GKM A;  1YIS A;  4YIK A;  3OCE A;  4BAB A;  1KQ7 A;  5F91 A;  1EB4 A;  4L57 A;  3GTD A;  4L6A A;  3BHG A;  2D28 C;  2VD6 A;  1T9H A;  3R6Y A;  3R6Q A;  4EEI A;  4FFX A;  4V2R A;  2YV5 A;  1DCN A;  2I7D A;  2OHY A;  2PTR A;  1MH9 A;  4NFL A;  4C5R A;  4L6C A;  3CRW 1;  4ADM A;  2O78 A;  2FEN A;  2JAR A;  3RD8 A;  2O6Y A;  3U19 A;  1B8F A;  5F92 A;  5M0J A;  3NZ4 A;  1GK3 A;  2E9F A;  1U0L A;  2O7B A;  4C5U A;  3QBP A;  2QGA B;  3F4T A;  1J3U A;  5HW2 A;  1RE5 A;  2RJR A;  4HGV A;  4FLC A;  2HVG A;  2VL7 A;  2JAW A;  1YFM A;  4APB A;  4C6G A;  4WNL A;  1FUR A;  3U13 A;  1Z4M A;  1K62 A;  3R6V A;  3NO9 A;  1U16 A;  3CZO A;  1YFE A;  4E88 A;  4A15 A;  4BAA A;  1DOF A;  4EFC A;  1TJW A;  2NYF A;  2VSF A;  1Z4P X;  1Z4L A;  4MUM A;  5M0I A;  1K7W A;  3KDY A;  1C3U A;  1Z4K A;  4NLE A;  1T6P A;  3UNV A;  1IW7 D;  1XWO A;  3GZH A;  1XL8 A;  4NSL A;  1Z4Q A;  3KDZ A;  2O7F A;  3CRV A;  1HY1 A;  4ADL A;  4MWO A;  1XMD A;  1T6J A;  5EYV A;  1U15 A;  2O7E A;  1HY0 A;  1XLY A;  2QVE A;  1TJ7 A;  2FUS A;  4IQJ M;  3TV2 A;  4C5S A;  5H8W A;  3E04 A;  1XL7 A;  1FUO A;  1Z4I A;  1Z4J A;  3BWV A;  4CQ5 A;  2NYN A;  4YIH A;  2JAO A;  3CI0 K;  1TJV A;  2YII A;  2PFM A;  4MX2 A;  1XMC A;  2PTQ A;  4V2Q A;  3OCF A;  2FEL A;  2PTS A;  1C3C A;  3RRP A;  5D6B A;  2D27 A;  1GK2 A;  1FUP A;  1JSW A;  1AUW A;  1VDK A;  1FUQ A;  1Q5N A;  1Y2M A;  1GKJ A;  1Q91 A;  1I0A A;  1W27 A;  2JAU A;  2RCN A;  5EYT A;  2X75 A;  3F4R A;  2O7D A;  3C8T A; 
#chains in the Genus database with same CATH homology
 1TJU A;  4APA A;  2J91 A;  2RJS A;  1GKM A;  1YIS A;  3OCE A;  4BAB A;  1KQ7 A;  5F91 A;  1EB4 A;  3GTD A;  3BHG A;  2VD6 A;  3R6Y A;  3R6Q A;  4EEI A;  4FFX A;  4V2R A;  1DCN A;  2OHY A;  2PTR A;  4C5R A;  4ADM A;  2O78 A;  3RD8 A;  2O6Y A;  1B8F A;  5F92 A;  3NZ4 A;  1GK3 A;  2E9F A;  2O7B A;  4C5U A;  3QBP A;  2QGA B;  1J3U A;  5HW2 A;  1RE5 A;  2RJR A;  4HGV A;  4FLC A;  2HVG A;  1YFM A;  4APB A;  4C6G A;  1FUR A;  1K62 A;  3R6V A;  3NO9 A;  1U16 A;  3CZO A;  1YFE A;  4BAA A;  1DOF A;  4EFC A;  1TJW A;  2NYF A;  1K7W A;  3KDY A;  1C3U A;  4NLE A;  1T6P A;  3UNV A;  1XWO A;  3GZH A;  4NSL A;  3KDZ A;  2O7F A;  1HY1 A;  4ADL A;  1T6J A;  5EYV A;  1U15 A;  2O7E A;  1HY0 A;  2QVE A;  1TJ7 A;  2FUS A;  3TV2 A;  4C5S A;  3E04 A;  1FUO A;  4CQ5 A;  2NYN A;  2YII A;  1TJV A;  2PFM A;  4MX2 A;  2PTQ A;  4V2Q A;  3OCF A;  2PTS A;  1C3C A;  3RRP A;  5D6B A;  1GK2 A;  1FUP A;  1JSW A;  1AUW A;  1VDK A;  1FUQ A;  1Q5N A;  1Y2M A;  1GKJ A;  1I0A A;  1W27 A;  5EYT A;  2X75 A;  2O7D A;  3C8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...