4L6CA

Crystal structure of human mitochondrial deoxyribonucleotidase in complex with the inhibitor pib-t
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
201
structure length
201
Chain Sequence
b'SNAASGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase, mitochondrial
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
publication title Conformationally constrained nucleoside phosphonic acids - potent inhibitors of human mitochondrial and cytosolic 5'(3')-nucleotidases.
pubmed doi rcsb
total genus 67
structure length 201
sequence length 201
ec nomenclature ec 3.1.3.-:
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4l6cA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4l6cA01
2FPWA 3AR4A 4YCLA 2FEAA 3WK6A 1ZRNA 5ALQA 1QH9A 2OBBA 2G09A 5AW6A 3ZVNA 3ZUPA 5AVXA 4BYGA 2YJ3A 2C88A 4QJBA 1NF2A 1Z4QA 2ZOSA 3L0CA 3BA6A 2G07A 3DAOA 5JJBA 2HDOA 3D6JA 2QLTA 4UW9A 2W11A 2HF7A 3WK4A 4C4RA 3PCTA 4FFDA 4HGQA 5ALWA 3L7YA 1SWVA 4KYTA 5ALXA 4RESA 1QQ7A 4CF5A 2AMYA 3SMVA 1Z5UA 4DCCA 2FDRA 2I6XA 3MPOA 4Y2JA 3SKYA 4B6JA 3ESQA 2WF9A 5AKKA 3ED5A 4BX3A 4EX7A 4F72A 5ALKA 3R4CA 1CQZA 5ALSA 3U7HB 2C8KA 2YMQA 2NO4A 3NASA 5AHXA 4ZEWA 3KZXA 3ET4A 2RARA 5AW9A 4MUMA 5AKZA 3N07A 2GHTA 3UMBA 1RQNA 3OPXA 2JARA 4C4SA 3J7TA 5AVUA 3L1UA 1CR6A 4XPZA 1RRCA 3A1EA 1EK2A 2CFRA 1Z88A 5ALTA 5AIBA 4Y2SA 1ZOLA 4J2TA 3AR7A 2I7DA 1WZCA 4NFLA 1U2SA 5ALEA 2IOFA 2IYEA 2ZBFA 4AS2A 4XQ0A 3QXGA 5A3QA 3UMCA 2R8XA 1Z4KA 2G80A 2AH5A 3DDHA 4BKMA 4UM5A 2O9JA 4XOUA 2EATA 1U02A 3IB6A 4Y2TA 5ALHA 3WK9A 4Y2XA 1RMQA 3QUTA 3FPSA 3U19A 3KOOA 4NV0A 5AI8A 3CNHA 4I9FA 5AK4A 3ZX4A 4OD0A 1YNSA 1PW5A 3K1ZA 4FE3A 2CFSA 1SWWA 3R9KA 3L5KA 4I9GA 2WHEA 1T5TA 2YN4A 3CZ4A 1Z4MA 4PNHA 4UMDA 5ALRA 4L6AA 4HGPA 2HX1A 3UMGA 3L0BA 4GIBA 3ZTYA 1KYTA 3OCZA 1Z4PX 5ALGA 5AI4A 1ZD5A 2B82A 4ZEXA 2C9MA 2C8LA 4EZEA 3N1UA 2NO5A 3BWVA 2HEGA 2P69A 2Q4RA 2YY6A 3F9RA 1XVIA 5ALLA 1QQ5A 3AR5A 2CFTA 3B9RA 2CN1A 3QU2A 3FPBA 3WKEA 4UATA 1L7NA 2NYVA 3SF0A 4NWIA 1JUDA 2HI0A 5A3RA 1RC8A 2EAUA 2HSZA 3WKAA 1VFPA 1ZRMA 5AI9A 3NALA 2OA0A 2ZXEA 5IT4A 5AK5A 1IWOA 2PR7A 2YJ6A 4G63A 1WPGA 5AM1A 5AM5A 5ALMA 3W5DA 3ESRA 3E81A 2PQ0A 3QU5A 3IJ5A 5AICA 3MC1A 5AKIA 2WF7A 1L7PA 3ZW7A 2BY4A 1EK1A 1LTQA 4Y2RA 1O03A 4Y2UA 4YH1A 5AVYA 3L8GA 1ZD4A 1S8OA 1F5SA 2RB5A 3PGVA 2MU1A 4DWOA 2G0AA 2JAUA 2W43A 3I6BA 5AI5A 3NRJA 2B30A 3N28A 1MH9A 2B8JA 1YJ5A 3QUBA 2GMWA 4NABA 2R8YA 3WGVA 3ZX5A 4JB3A 3IRUA 5AKXA 4HGRA 1N9KA 2OM6A 3E8MA 5AI6A 1L8LA 2WF6A 5ALDA 5ALIA 3U7EB 2HCFA 3AR2A 3QLEA 4BNDB 4UMFA 1Z5GA 1ZD3A 3OCYA 3GYGA 3W5BA 4DFDA 5E0OA 2MSNA 3L8FA 2O2XA 3SKXA 1RKQA 3N8GA 2WFAA 5FP0A 2ZG6A 5AKHA 3OCUA 4Y3UA 3OCXA 3QUQA 3QYPA 5AW5A 4L57A 3AR8A 2Q4TA 1RLTA 4OCZA 3L8EA 4BNDA 4UAUA 1TJ5A 3AR6A 5AKYA 3I1YA 5AW3A 3QUCA 2P9JA 3FVVA 5ALJA 3AR9A 3WKDA 1VJRA 3KD3A 1J8DA 1LVHA 4JDPA 1WR8A 1RLOA 1ZJJA 4IFTA 4AS3A 1K1EA 2JGAA 1U7PA 2BDUA 2FUEA 2C4NA 1U7OA 2YJ5A 3WKBA 3A1DA 3B9BA 4EELA 5AK6A 1Q91A 3L8HA 1WVIA 2YMMA 3I28A 3NUQA 3M1YA 5AVRA 5ALZA 4BEWA 4L6CA 4EEKA 5A3SA 2HF2A 2AGVA 4Y2PA 4KX5A 4E88A 3TLMA 3AR3A 1QQ6A 1X42A 3VAYA 3OCWA 2FPRA 2BDEA 5IT0A 5AW7A 2R8EA 4XE5A 3QX7A 3ZWKA 2YJ4A 2PKEA 3WK5A 3U13A 1S2OA 3L0YA 1ZD2P 5AVTA 3EF0A 3EPRA 3QU9A 4CF4A 5ALFA 5AM0A 3ZTWA 2EARA 1TJ3A 2ODAA 3P96A 4OFZA 2B1RA 2P11A 3U26A 3I76A 1T5SA 5AW8A 1RLMA 4F71A 3RF6A 3RFUA 5AKLA 1Z4OA 4UU0A 2YBDA 2FPUA 4Y2YA 2IOFK 3HLTA 1VJ5A 2YMLA 4HGOA 4QQFA 4CNQA 3QU7A 3U7FB 4KN8A 5AK3A 3OTQA 5AKGA 1RPZA 4CF3A 2HHLA 4ZEVA 2QYHA 3QU4A 1Z4LA 1RDFA 2YFYA 3WGUA 4HYTA 3WKCA 3ONNA 5AM2A 3MN1A 5ALPA 4UU1A 4YGYA 4BX0A 3FM9A 5ALUA 2AUTA 2VKQA 1YDFA 1YMQA 4GXTA 4Y2QA 2JAOA 1Z4NA 2G08A 4UARA 5IS2A 3FZQA 4KNVA 4BBJA 2FUCA 5AVWA 1U2TA 2I33A 3A1CA 4IG4A 4HAIA 3B8EA 5AW0A 3DNPA 3ZWDA 3WK7A 3OCVA 5ALYA 2ZBGA 3PGLA 3SLRA 3ZVMA 3QGMA 1TA0A 2Q5EA 4UAVA 1NNLA 3KDPA 1YS9A 2WF8A 5AIAA 3ZVLA 4YIKA 2OYCA 1NRWA 2ZBDA 4UMEA 3ZI4A 3DV9A 3E58A 3WK8A 2X4DA 3U7GA 4YIHA 1TE2A 4BX2A 1O08A 2B1QA 3S6JA 5ALNA 5AESA 4H1WA 3KBBA 4DW8A 2FI1A 1XPJA 3R09A 4J03A 1T9ZA 5AKJA 4CE6A 2DQSA 5AVVA 2HOQA 3KC2A 5T41A 3SD7A 2W4MA 3FGOA 2I54A 2ZBEA 1L6RA 1Z4IA 3A3YA 1L7MA 1RKUA 2IOHA 3W5AA 3NAMA 2HO4A 5AM4A 3EWIA 3N5KA 5AKEA 4EX6A 4NAVA 4RETA 5AW4A 1TJ4A 2P27A 4UMVA 3M9LA 3NANA 5ALOA 3W5CA 3NIWA 3UM9A 4KNWA 2RAVA 2B0CA 4G9BA 4BEVA 1RQLA 5ALVA 2I55A 2B8EA 3ET5A 4AP9A 1Q92A 1FEZA 4KX3A 1YV9A 2GFHA 2G06A 1L7OA 4HGNA 2I34A 4OHFA 1Z4JA 1ZS9A 3MMZA 2GHQA 4YCMA 1SU4A 2WM8A 1Y8AA 2GO7A 1L8OA 2FPSA 1QYIA 5AW2A 2RBKA 3HYCA 1AQ6A 2FPXA 4MWOA 4FYPA 5AVSA 4C4TA 5AVZA 1N8NA 3PDWA 1J97A 4O8CA 3QNMA 2G1AA 1RKVA 3E84A 5AM3A 2IA5A 3SHQA 3EF1A 3ZU6A 5AW1A 1RMTA 4YCNA 2D2VA 2WF5A 4UASA 3L1VA 5AI0A 2R8ZA 4Y2VA 1XP5A 2YMPA 4EENA 2JAWA 4UM7A 5AVQA 1RMYA
chains in the Genus database with same CATH superfamily
2GHIA 2BSQA 1PGOA 1OVGA 4K2HA 1RADA 1Z2AA 3KR9A 1Y82A 2AEJA 4PLPA 1M34A 4XQCA 4BLWA 3C98A 1BHJA 1FVFA 1QP4A 1YI0A 1KO7A 1PTJA 3PUWA 2IDKA 1GGMA 3TOZA 4BYGA 4FQ5A 2C9BA 4I1IA 2C88A 4NULA 1JB9A 4TS9A 3U44B 1T9GR 2ZRFA 3EGXB 2N9UA 4TV9F 5BSRA 3VKGA 1CQIA 2ZT5A 4GMFA 1FX0B 2FP3A 3IESA 1ONPA 1WS6A 3TW0A 3IQGX 4RX1A 3UEOA 1CUDA 5BW8A 1LDEA 1ISPA 4OFBA 4L8FA 2DF8A 4N3NA 3SYKA 1XWOA 4D0LB 1P4AA 1UBFA 1J8QA 2R47A 2HDOA 2Q8NA 2W6MA 2ZSUA 4IIXA 5CVCA 1DL5A 1OMOA 3BMOA 3HCAA 3LA8A 5HIAA 3AJAA 5A0VA 2OHIA 3I9OA 3IVCA 1US8B 2HF7A 3L7AA 4JWKA 2EKZA 2QN1A 5ALWA 2F1JA 2AG6A 4XTCS 2GCPA 4OUDB 1B3BA 3F78A 1XX6A 2Z04A 4MRVA 2QSYA 3H11A 3N53A 1ZJWA 1QO7A 4QQRA 3PWSA 1OIXA 1T2FA 2H4XA 3UA4A 1WTCA 3CNNA 4PCVA 3MPOA 3N2LA 5IDQA 4UDXX 3ORFA 2PXAA 5JVDB 1GY8A 2QXUA 1RSZA 5ALKA 2HNBA 1D3AA 1XGKA 2LVBA 5BUQA 2EJVA 2FRDC 1W29A 3DL4A 4IWYA 2OHGA 4RZ3A 3EC1A 3OE4A 4FP9A 4NI5A 5GONA 1K6MA 6LDHA 3N07A 2GHTA 4N5NA 1SD1A 1RQNA 2OQ2A 4REOA 1PYOA 1UM8A 4AX4A 1MEEA 4CJXA 1CQJB 1X3SA 3KR2A 1YS1X 4RZQA 2A84A 3IPYA 4C30A 1P5JA 3X43A 2Q27A 1RRCA 1VSQA 1FFWA 3AV0B 4EWLA 5JSKA 4UOQA 1I5OA 1Z88A 4RSHA 1WL8A 6Q21A 1TF7A 4ZMRA 4EL5A 2I2AA 3L84A 4KG7A 4N1AA 3K4HA 1TZMA 3AF5A 3AEQA 2FMIA 5BV1A 3VHRA 1YAHA 4MICA 1OUMA 1XJCA 3K9NA 3U9SA 1Y89A 1RQ2A 4LYDA 3WC4A 3TKAA 1AQYA 1NLZA 4WNAA 4QWMA 3GZNB 1NYQA 2KSQA 2YASA 1BA3A 1NUQA 4KJXA 3TE7A 3AZPA 5GM2A 1AJEA 1EE1A 2BOVA 1Z4KA 2W71A 2DBRA 3NTUA 1HETA 2AH5A 4YCAA 3DDHA 1NFRA 1E79A 1RYZA 1RZRA 1J0DA 4BL5A 3LL7A 1U02A 2A5JA 2X0IA 4M46A 2KYRA 3C97A 3WGOA 3M4NA 3H75A 5ALHA 4CKYA 2ZPTX 1NQ5A 1T8TA 2FW9A 3QUTA 3EF3A 4N47A 3TGPA 1UBNA 3I9V1 1ZUIA 4BWGA 2I71A 2XUIA 4NV0A 3KO8A 3MQFA 3DDUA 1DV2A 2EJTA 2Y93A 3DV2A 1ND5A 5AWFC 3I2IA 5C8YB 1YKGA 3ZOKA 3FR7A 1X7ZB 4Q3OA 1WV1A 2JGJA 3TAXA 2YVUA 4TKLA 4MVCA 4HWOA 4KGDA 2QK4A 4G5OA 5D1NA 2O8FA 2DWPA 3AMVA 1QB7A 3EN0A 1JIJA 2QD5A 3HYLA 5CJJA 2YN4A 4JP5A 4PZCA 2AHRA 2NU6A 4M1WA 2H1RA 5FBZA 5JQGB 2DHRA 2PV7A 2OBFA 4JC4A 2H54A 2JBAB 1NM5A 3OURA 2GTPA 4HJRA 1XMIA 1QIEA 3L0BA 3LIPA 2VJCA 4XIJA 3SU8A 4E4YA 1U5AA 4Q47A 1CIVA 1NRIA 2RKBA 1ECGA 1KJWA 4RO0A 5F3RA 4CLOB 1VMEA 5I4BA 2P9EA 2CMGA 1E66A 1FNCA 4ZEXA 4KU4A 2G25A 2X3UA 2REXB 1DOHA 2WVHA 2NUAA 2QNBA 3AESA 3IUYA 3P8ZA 4PLYA 1KO8A 5EKUA 4ILEA 3JQRA 4EA6A 4EHAA 4L72A 1G3QA 3EA4A 3GGPA 3LBFA 4WACA 1XZBA 2LPMA 2C9CA 3N8KA 4CYMA 2QG4A 2MTBA 1P0PA 1RRGA 2IBMA 3N6XA 4HRAA 1TAUA 3RKUA 1AUPA 1YB1A 2YNMA 5B7PA 2HIMA 1SEVA 3TV2A 3RSZA 2IV7A 1NVFA 2BTOA 2Q6OA 3EGDA 1IXKA 1ZUD1 2BT4A 5FOQA 1K6EA 3QK7A 1I7QB 4JI7B 4O4HA 4QFDA 4HATA 3AFIA 3PQ7A 3IMEA 1KDVA 5A62A 3ZU5A 3MAJA 4YCSA 1P29A 3L7IA 4E7OA 1EVEA 4ZXFA 1DWOA 3ACCA 4F3YA 1O5OA 1G18A 1ZH2A 5FAXA 1I7LA 1T6BY 1ZONA 4RAQA 2QLBA 5AK5A 5LR6A 1MZPA 3K1YA 1K63A 1NOKA 1T3TA 2ZI9A 4JYBA 1G21A 4N0PA 5G4LA 3VSDA 3ZKWA 4BMSA 3MWDB 3N6RA 1HFWA 2AFHE 3ZE7A 4CLEA 5AICA 4GRAA 1ZHFA 3DVLA 3D3NA 2HQRA 5AKIA 3LW7A 1QE0A 4WOBA 2YX1A 3K0SA 3FHJA 4Y6RA 3RVKA 2PTSA 5JCJD 1HYEA 2XNDD 4IVQA 3DOEA 1HA3A 4K3UA 2A59A 3K9QO 1RAIA 3OPMA 4F9FA 3JRXA 4F4CA 2R25B 1JTFA 5JWOA 2D7JA 2QVLA 3ZZUA 1LV7A 1QQTA 3G9XA 1OA0A 1VG0B 3LNTA 4B33A 4KPYA 4Q3LA 3I5YA 1U0BB 3DBHA 4I50B 3TAHA 4BQNA 1NXQA 4O5AA 1QH1B 1TEZA 3ZHXA 1VC2A 2PRKA 3E3MA 3QVMA 4LWPA 4MA5A 2O4CA 4G0QA 5CVUA 1E2GA 4QOJA 3K5HA 4DSZA 2GMWA 1GJRA 1AGYA 1QFMA 3WHLA 3TRHA 5H3CA 4FEGA 2WEKA 3ADKA 2A92A 4DQVA 1QFZA 3DWFA 4BVEA 2PKCA 3DWIA 3LHDA 2JFPA 5LJLA 2Z09A 1JG7A 3NIBA 5ALDA 5GQSA 1QRTA 2QGZA 2GM9A 3BJEA 1OTXA 1T0JB 1TF5A 1T5DX 1X1CA 4TLBA 3WZLA 3IYLW 1Y3IA 2YIJA 4S1OA 5JCXA 3VJMA 1RPNA 1Z3CA 2WSSD 3HJFA 1WV0A 1N2GA 5CGZA 4UMFA 1ZD3A 1TEVA 2I7XA 2F55A 1V47A 5EQDA 2XZOA 4QYIA 4LMRA 3W5BA 3OQOA 1LPPA 1SBQA 4Z2AA 3AVPA 3E70C 4KQ2A 3AVQA 4YCCA 1HXHA 1W2HA 3LC1O 4AKGA 2X8JA 2B94A 4HSEA 1GKLA 2HDNB 3I8XA 3HDHA 2GCGA 1FVXA 3FWYA 2FPIB 2ONYA 4R9RA 4GLBA 3SJCA 1DNPA 1GVHA 2QZZA 3CPSA 4IF4A 1AQNA 4LZLA 2V0CA 2ZS7A 1BEZA 1QVRA 4F9EA 5KX5F 1ZIOA 4QG3A 4EYGA 2ZI5A 3OICA 1AUVA 3D8TA 3OWXA 2IP4A 3HMKA 4LE0A 2QPLA 3EXHC 1JPNA 4IMJB 4CHTA 1KSHA 4UUPA 4BHTA 1NLYA 3DGFC 3LLMA 1K1EA 4O2LA 4NC9A 3MAAC 3PNSA 4AX8A 3M33A 1T0UA 3HY3A 4EKYA 4C5CA 1U7PA 5JPDA 4MP3A 2F64A 1K6IA 3QVXA 4OJMX 5BV7A 2BDTA 5JECA 2DB3A 5JJKA 1U7OA 2CXXA 4L0MA 3OU2A 1PLLA 2I65A 1ENYA 5JPIA 1IHYA 1PYDA 4KE7A 5CCBA 4BXOA 1J0EA 3HNRA 4NK4A 1J1ZA 1GIAA 1U8AA 5L51A 5M7EA 2LWIA 3AFOA 4Q4HB 3R23A 4TM7A 5HG0A 3S99A 2HRQA 1E3LA 2IYNA 1WETA 3HK2A 3KEMA 1NUHA 3OT1A 4GLLA 4POAA 1P7YA 1CRWG 4KR0A 3NBQA 1TPYA 1XZIA 1KFBB 3JX9A 4Y2PA 5HXAA 4ALLA 3MCAA 2BWJA 2GPNA 5EE0A 1X42A 4GPIB 4W9MC 1FSPA 2CUZA 4MUBA 4PC6A 4PLWA 4YUYA 4FM9A 3RSCA 1Z12A 5TY0A 3K6JA 4HT3B 4NG4A 1W94A 3ABRB 1D2RA 2ZVPX 1AKWA 3LO5A 4O2AA 1BE8A 4QBHA 3I2GA 3MUFA 5KJEA 3ZLVA 2HU2A 2C9DA 1DFIA 1SUAA 1RFLA 1R0CA 2KS6A 3EODA 1X80A 4QT4A 2ZUEA 1BN6A 2OV4A 3NM4A 2F3RA 1JEEA 2LV8A 2R2AA 2VHZA 4J7XA 4PAMA 1IPEA 5JC1A 4NEGA 3ZTWA 4BN0A 4C0KA 1WXHA 2BF7A 1EWQA 3TKLA 3JTMA 1MB3A 4KTTE 4LI0A 3BXHA 4P38A 4QBGB 5KTSA 1U2DA 1Z56C 2ILTA 4N01A 3GFSA 4BNHA 3HLKA 1FYWA 4JLKA 1R10A 3V33A 5CPBA 5BNFA 3D6UA 3TCNA 2IPLA 2AJCA 4TWBA 2A5YB 1FJHA 4M99A 4QYMA 3L0DA 1ZM9A 4Y0NA 1J09A 2IOFK 3PFNA 3HLTA 1VJ5A 2I4OA 3ZJVA 2DETA 1NBWB 1XRNA 3NETA 4S1NA 3R8CA 3TQCA 4KN8A 2O2IA 1ZN2A 2FSHA 2MR5A 2HJSA 1T0PA 2PR2A 1F2UB 1ONBA 2YYYA 4GPTA 4JYMA 3SPXA 4LF6B 4JR1A 4G5HA 1V5FA 2SHKA 3K92A 3GGDA 2BGUA 4MMXB 4TL7A 3RI3A 2OFWA 3NKFA 4CF3A 2AJBA 4A9AA 4Z0HO 1BS1A 3QHPA 3EJWA 4WUTA 4EUNA 1SBZA 4HYTA 4DARA 1OT3A 1NNEA 4WCVA 4E30A 1JAYA 2ZFUA 4WDQA 3W5HA 4XQEA 3DULA 1OBVA 2Q5QA 3IE2A 4HB2A 4QOHA 1IUOA 5L9AA 3BL5A 4RTKA 4E3ZA 1GARA 3GN2A 2AUMA 3EHEA 1QOPB 2BKLA 3O3NB 1OXVA 5IKPA 2XVMA 1WF6A 2PKRA 4YAKA 5K3OA 1ZUNA 1R00A 1T2NA 2HJWA 3FSGA 1R66A 3A58B 2NU9A 1V6AA 3FZQA 4ZARA 1Z0ZA 4YMIA 4AKIA 4CLRB 3G0DA 5AVWA 3N8HA 3CLRD 3A1CA 3G2LA 3BCSA 4MI3A 2NZXA 3SZLA 4D4GA 4EABA 1XQ1A 2QTFA 3SZUA 2PCLA 1N5DA 1NF3A 2ORYA 2FCRA 5D3ZA 4MS3B 4R1PA 3PHHA 1IQUA 1U31A 2CLKB 2DUJA 3F74A 3N3AC 4PGMA 4ATNA 2VZEA 5CFRA 2PUBA 3IAFA 1M6EX 4H77A 3THSA 4Z9FA 2QSUA 3C45A 1AHPA 5FF9A 4L78A 4BGVA 3UKJA 4WSOA 5SICE 3B20A 4IPTA 3S2YA 4YUWA 4KCGA 5BP7A 2O59A 3OO1A 2R6JA 3EXFB 4YR9A 4TYNA 1IBMB 2RFLA 4CZ2A 1G2PA 1QV9A 1H2EA 2OLKA 4NOJA 3CYFA 2PXCA 1GPLA 4K5QA 3P9YA 1NRWA 3KQNA 4FR2A 2EGHA 2BGNA 2IH5A 3HYNA 3DZIA 4P1ZA 5A6VA 3WK8A 3JATB 1R37A 2PRYA 3U7GA 5DCWA 3VYTB 3FBGA 2BONA 2BGJA 5FUQA 4GM0A 3IT3A 4RABA 2IXFA 2VRBA 2WIKA 3PQFA 4PYLA 3NBAA 1GTJ1 1WUKS 2VXOA 2DYKA 4RM2A 1IBRA 1GEEA 3OKFA 5ECDA 1ULSA 1NYLA 3KT3A 3FE2A 2CBXA 1LLFA 1S96A 1V37A 1N2HA 2HC9A 4ARSA 4OMCA 4ZGGA 1O96A 3KE9A 1EVYA 1E4EB 2CXSA 3DBHB 4JMPA 3H7IA 2FP4A 2OCDA 4KVFA 4BFTA 1RZVA 3CMMA 1P5FA 3TGLA 3STVA 2CSUA 3LCMA 3PX2A 4BNKA 4RDIA 1WOMA 2R97A 4ARUA 5KIAA 4GX1A 1Q7GA 4KNYA 3K2EA 2FE4A 3QLTA 3CY6A 1XE3A 2VBFA 4YDSA 3KIPA 1TVEA 2PZFA 1CDOA 3BFPA 3KWLA 4RKYA 4JUCA 2QZPA 1N7IA 3DE4X 5GV7A 3TJMA 1M0WA 3K0EA 1J3UA 3IO3A 4MW6A 4M38A 1M10A 3T5PA 3TI9A 3VSBA 1FEZA 3SR4A 4MR7A 1WNFA 2R1UA 4JIMA 5T64A 1GWNA 2CXNA 3RAGA 4MB0A 4B8WA 3J81A 3GJXC 5A4FS 3D8UA 2IDJA 5KWSA 3A9TA 4NLEA 3A25A 3NP9A 1FFHA 1ZS9A 1A7KA 4G5GA 3OOYA 3SJUA 2EP8A 4MS3A 2P6OA 3ISJA 3SXPA 4DMFA 4ZOEA 2QD4A 3OZ7A 5BW5A 8LDHA 4AP5A 4UTRA 2YC2C 4BPBA 1U2ZA 3BWCA 1KH3A 3SX0A 1PEYA 1OYVA 4NCHA 3G2MA 3JVEA 2JHGA 4K9PA 1RKXA 1KYXA 3UUGA 2PTGA 2G17A 4QPDA 2VXBA 3X2EA 1A8SA 1UDRA 4FYPA 1KQ3A 1IN7A 2CNNA 1AKQA 1OXBB 1UMDB 4C4TA 821PA 2IS4A 2K7ZA 4O8CA 1L5YA 1O97D 4BJ1A 4B6QA 4LF5B 1GAWA 5H0IA 4EFDA 4O2BA 2ZSAA 1U0LA 1MG0A 3ONVA 1PL8A 3RVBA 4MV0A 1G0NA 1ZEMA 3ZWXA 1F1BA 3KT0A 4DMHA 4PAWA 2ZI4A 4IGFA 2LBPA 2A78A 5BMVA 1KZ1A 3DEAA 4ETWA 1TZCA 1MH1A 4HAZA 4OB6A 4DCMA 2YV1A 1WB5A 3DHVA 2YJTD 5T4HA 5IABA 3KD2A 1WKCA 4X8OA 4QNMA 1YRYE 4GPAA 2ATVA 2NV6A 2X8AA 3PBKA 2IQIA 1RLIA 1NXOA 3H1AA 3FPKA 3X2SA 1D8TA 2JZNA 3LHKA 1EFCA 1T6ZA 3MXOA 4RMGA 2C4UA 3R5TA 1RS0A 4C6SA 2RGCA 1JQ3A 4IXMA 2YOFA 3C24A 4KK3A 1RE0A 2Z6VA 4BJ5A 3JCZA 4MH0R 1KOFA 3IUMA 3T61A 4L4XA 2MCFA 3EWAA 1GAQA 4X6UA 1PS0A 1J90A 4LSZA 3UYLA 1JDUA 3S0JA 2JCBA 3KSZO 5EP2A 4MCAA 4XPIB 2W2XA 3K0CA 1PAUA 3OQJA 4KK4A 2VG8A 3D7NA 3T5BA 3EY4A 5M5BA 3HWRA 1I4LD 1SB9A 1U2RA 4FBMA 5J58A 5K7SA 1DIBA 3U4QA 3GFTA 5HCNA 1POXA 1PVOA 4HGQA 1PD1A 3AJ9A 5DW0A 4DQXA 5C2JB 1PR0A 1SRQA 3OEHA 2G1KA 3AI3A 3EVDA 2IU3A 3CZQA 1G7CA 2ON6A 3U4IA 2I4IA 1VJ1A 3KNZA 4LC9A 1DADA 5G0UA 4B4OA 3B2QA 4CV1A 2XADA 5K0GA 1ULZA 4PS0A 2J6IA 4NBSA 4UM9D 1WP9A 4JJEA 4J9UE 2OZVA 4EGAA 3FG9A 4OGLA 3ROTA 2ZJAA 4TXHA 2GXUA 4B17A 3N0WA 4Z86A 1W36B 3DEZA 1R7RA 2GVZC 3DNMA 3F0TA 3EZ7A 4GWKA 3T52A 1ZN9A 1OBOA 2TMGA 3BORA 4AKEA 1I0LA 1XELA 4RJKA 1FNNA 5CA1A 4TZ6A 2C03A 3E8SA 4F9TA 3E5NA 4Q4HA 3IIMA 3O8LA 2G5GX 2JZOA 1ZK1A 1Y4SA 3AHCA 5IH7A 3CT6A 2ZSFA 4K81B 4N6OA 3W4IA 3DMNA 2DPGA 2WB2A 3O73A 5AIBA 4MLDA 5FO1A 3LUGA 1OH5A 1RRVA 1ZNXA 3STYA 4QU5A 2NU9B 4UEJA 4MX2A 2ZWPA 2M1XA 1CY8A 4ZXPA 5I8ZA 4BCCA 2O23A 2IEBA 3B85A 3VU8A 1UL1X 2DAPA 4PINA 1TLFA 1XZDA 3DMTA 3CX7A 3O9VA 4JP8A 1IEVA 4AULA 1QH0A 3B6IA 5ICCA 5JNVA 3IUEA 5ABPA 4IDPA 3YASA 1ZIYA 1UZLA 3MFYA 3RVNA 4FC7A 1XTUA 1T1RA 3D6VA 3KJGA 1BRTA 3LU1A 2YZMA 1TFUA 4RHEA 5HVNA 1L3CA 4O5OA 5KYXA 2PZ8A 4OLFA 1OBHA 2A5GA 3WO0A 1U0NA 1DC8A 1DBQA 5IZ4A 3KKNA 3OWHA 5TMPA 2ZBPA 2Z2YA 3QUSA 4YAJA 3KEFA 1U99A 2R86A 1FX0A 3HU2A 4XJXA 4D0RA 1ONSA 2O8CB 2R7NA 2EKBA 1L5WA 2AG1A 2CCKA 2NU8A 1X14A 1Z0IA 5D6NA 2IQ5A 1UC8A 3IEKA 2GVNA 4FGLA 5B53A 4YUZA 1G8GA 1V7PC 3SDSA 2PBFA 3ROXA 3DPUA 3ZE9A 5HQTA 1RXVA 4KMRA 2DPHA 4FZ3A 5HILA 3DE5X 2WR8A 4LHEA 4LV5B 5KYVA 3JQAB 5HK9A 2P2GA 4KXXA 3LQQA 3WL4A 4RCZA 5FBHA 3ERCA 4DNFA 2Y67A 3NDRA 4Y9TA 3WJ1A 3OZIA 4RW0A 2I6QA 1J4AA 5D3MB 2VHJA 5JRZA 2Y1CA 3GGCA 2AOXA 1D2MA 1QGUB 3MUEA 4DXHA 1BHQ1 3BXZA 4H1HA 1VSUA 1EFTA 2HEGA 5CTJA 4OHKA 5LQUA 1G2OA 1NLMA 2B6HA 3VHQA 2YS6A 2FW7A 4INZA 4RMIA 1VHLA 2FG5A 3QE3A 2VJLA 3T34A 4I1SA 5GJWC 1KDZA 4DBLE 4B73A 1NW7A 3KTAB 4DZZA 5HF9A 2VJMA 3W05A 1OILA 5FR1A 3ZZMA 4I46A 3L4JA 2FN8A 2AMJA 4Y1RB 1X1RA 2B2NA 2EF0A 4UVIA 5THXA 4QSHA 4RBNA 5KKNB 1ZZEA 3IQXA 5KYYA 1HYHA 1U7HA 2IZ5A 3MJ4A 4IJMA 3R7BA 3UN1A 4C0LA 1CD5A 2G9ZA 1OZGA 4AZ3A 4K9RA 1I10A 3B13B 3N76A 4U6NA 2ERCA 1GGHA 1GPUA 1KDRA 3ND5A 3WXMA 2WWYA 2A6PA 4RS3A 2XOKD 2IKSA 4Q21A 4WK2B 1JYSA 3LNCA 4H08A 1ENPA 3ESRA 1AN9A 2Q7OE 4JEIA 4KXUA 3DDSA 2WJAA 2A33A 1GP2A 2NU6B 1K4KA 3I01M 4RDHA 4TWRA 2ZI7A 3RYHA 5CFPA 2H16A 2WNIA 3W1VA 3QXSA 2VYVA 2VPZA 2E87A 4G01B 1VGRA 4TRMA 1JVBA 3RG8A 4DYHA 3VVMA 1YGYA 1ORHA 1WCXA 1NMQA 2JGNA 3IDOA 2FG6C 4G4GA 4HLUC 3V7UA 2R6HA 2WINI 4ADSG 3BFJA 5JZMA 4KWEA 2FOIA 4RTPA 2CLLB 2H4ZA 2VBCA 2ZJ2A 4DCNA 1Q0RA 3O83A 1T9HA 5CFQA 3D5QA 4Q93A 1C3UA 3G8CA 1YKSA 3W5UA 2G4VA 5TMBA 1FP6A 1Z13A 3KTDA 1IG0A 2Q3FA 4KIFA 1WB6A 4HAXA 2G5TA 3DJFA 3BPSA 1IXRC 3ZN2A 3CB4A 4JI5B 4CWAA 4MHOA 4O3FA 1NBMA 2OZLB 3FBWA 3EPPA 4JB3A 1E2JA 2UVPA 1NW4A 1AS2A 1P5RA 2OC4A 2ZTUA 3MWLA 4E4RA 3I5UA 1BXGB 4EVQA 1NZDA 2RSLA 2YV5A 3R0XA 4MGKR 5IJ9B 3RC3A 1PKEA 4U2GA 5DGTA 3P52A 2FKNA 2VJYA 3KHTA 5EZQA 4BNJA 5I51A 1FTWA 1UJMA 1JF8A 1GL9B 2PGJA 2XGMA 3F6CA 4U0JA 4XX1A 4OF4A 1IEXA 1G16A 3F8WA 3IP8A 3IIEA 1G21B 3NCTA 4MWZA 4WZZA 3RIXA 3WRYC 4D9BA 1ABFA 3K0HA 4JP3A 1XTIA 2Y0BA 1GG5A 2VO1A 3T1YB 1BWSA 1DC3A 3W3AH 3NAGA 4PYJA 1GPAA 1E5XA 4LGYA 5HIJA 3I1YA 4L02A 5AW3A 1UT8A 2D5LA 1H94A 4PZ0A 1N5IA 1KAGA 2AEMA 4PU0A 3UBMA 1E2EA 2CLDX 1Y9DA 2D5AA 1LVHA 3E82A 4U0KA 1WR8A 2PYIA 2WMOB 3LD9A 4RK4A 1HDYA 4XM1A 2GZ1A 1ZAYA 1ZK4A 2VBIA 4G8DA 3VO1A 3ROMA 3WJ7A 3B1JA 3H99A 1K7XB 3H3XA 3MWYW 4OXQA 4FKZA 4LC1A 5CHYA 1MAWA 3RTCA 1NBME 5FB3A 1P62B 1DDGA 4BUCA 4GE3A 4FFMA 1JPJA 1M2OA 3OLWA 1D1PA 4I4TB 1XWWA 2C5HA 3TAUA 1R2QA 3UT6A 1M6NA 4DILA 4DZTA 1ZW6A 1NW5A 3HXLA 4HN2A 2BM8A 2GJ4A 2YHIB 3ZY5A 1ZY2A 2QTMA 2D5CA 1U16A 3GUZA 3X1WA 4PX2A 1OASA 3CTPA 5FNVA 3NMUF 5IT5A 2R84A 2HHHB 4IUCS 4XWAA 2O6HA 1NF8A 1ZVMA 3TNFA 1VLLA 1G3RA 3TZCA 1QQ6A 5IM4A 2O2JA 1H2ZA 1GZHB 4OIFA 4TM8A 1S1MA 2JGRA 1C3OA 1IK6A 1YS6A 2IWHA 1I7DA 1NPDA 4X24A 4KB5A 4LWQA 4OHOA 5TJHA 3VNSA 4DA7A 3ETDA 3FTQA 1MQSA 2A1UB 2PKEA 2P6UA 2QHXA 5KREA 4UULA 3VPGA 2D4HA 2J4DA 2ZRPA 1T6XA 2JJYA 4MVJG 3TFOA 3T7JA 1Z2PX 4UQPA 1GUDA 1H2WA 3JASA 1HNXB 1WMFA 2P11A 3RTDA 1QX3A 2MSLA 3KQPA 3RJZA 4ZVUA 1NJ2A 2B83A 5C8VA 4EI7A 3IL2A 2QL5A 1Q21A 3L0ZA 2C0CA 4EPRA 2XX3A 3L04A 2PO5A 4UU0A 4BBAA 5KHOC 4TX1A 1RQPA 1T6NA 2IHNA 3CXUA 2PD4A 5FKJA 1GG9A 3ZVKA 2GPJA 3VC2A 4B3IA 1KY4A 1ST3A 1OFUA 3K32A 4KYUA 3ETLA 5HBGA 4NSLA 1ZVJA 5REQB 2CV0A 3NDBB 1X1BA 1KOGA 3CN7A 4XWTA 4YONB 4AZTA 2CDRA 1ST2A 1U8CB 4R6WA 2WD9A 3IBSA 1QGAA 5CT6A 4OI2A 1O57A 2QE6A 3O4RA 3HCDA 1M7BA 1K75A 3NP7A 2GEVA 5CVJA 4YXWD 4EF4A 5KNDH 1MAVA 1OZFA 3NH6A 3KT6A 2ILVA 5A5DA 2HGSA 3AVXA 2HCBA 2P2LA 5BR4A 5MN5A 1Y9AA 1IIBA 5B2EA 3AVWA 2V7QA 1RI5A 1FCJA 1KVSA 4V02A 1R5BA 2DG2A 4PLGA 4UEWA 4DVJA 1EHCA 1E1CA 1G5TA 3K7EA 2PU5A 1U65A 3AY3A 4GXTA 5HQ3B 1VPLA 2D06A 2X9GA 4O3MA 4UARA 3K30A 4UKDA 4ZCLA 4A73A 5HF6A 1Y80A 2XB2A 2B3DA 2FSSA 2XLCA 3TIGA 4UTOA 2CHEA 1KPGA 1YR8A 1HDCA 5DI9A 3K5PA 2WWTA 5CLQA 3ZWDA 5HWSA 4KREA 3OCVA 1BVHA 3HI4A 4IJKA 3I04A 3ZVMA 3P9RA 4RQAA 4WFJA 2MR6A 2VJQA 3WRYA 2YXNA 1W36D 4KIGA 3GU3A 4ZO9A 4Z7OB 4UBLA 1D0IA 4LMPA 3UV3A 2GEFA 3O47A 2VEOA 2WTEA 1HQKA 2BEVA 4IV0A 3QLJA 3ZJ4A 3BIOA 3AFNA 2QP9X 4YJGB 2CNKA 3G7UA 2OYCA 1TCUA 2QTLA 4QUEA 4DSNA 1KC1A 1YI1A 2WP8J 4MVJM 1T1EA 5HJ2A 4LZNA 3AL2A 5K2OA 5LSAA 3NHPA 1NW3A 3NHYA 1SKYE 4OGGA 3KSMA 3SX2A 1JVNA 2C2YA 2PPVA 2REBA 4YIHA 1AV7A 3EXIB 4ZMSA 4RVDA 3RW9A 2IEYA 3TDNA 3S6JA 2ZVJA 4BB5A 2XUJA 1HNNA 4C05A 4FOOA 1X77A 5AESA 1CZUA 1D2CA 1O4VA 3V8RA 1QHHA 3DLIA 3I3SR 1K2VN 1HRDA 4XXHA 2VCEA 2A86A 2FK8A 2ZPUA 4IJQA 4RD4A 1S3IA 3GLIE 1VYHA 3EH2A 1N33B 2EQ5A 3DV0B 4ABYA 3V2IA 1Q3KA 2ZRGA 1XD8A 1KMCA 3FNEA 3KAKA 3N9IA 4PPNA 4UCQA 3VVLA 2QGNA 4J29A 4W5JA 3HB5X 1YVDA 1C1XA 2W4MA 1RWKA 2ZU6A 3KOXA 1YB5A 2VWGA 4RCVA 1EUDA 4CG3A 4EJFA 3W3ZB 1OR8A 3E27A 4QGGA 4L07A 1G8AA 3KYJB 3KB1A 4LGCA 1Z18A 5EI5A 3ZCTA 4XYLA 3GPLA 3K9GA 3FKQA 4I4CA 1MRSA 4NH0A 4RD3A 2IYZA 1WPRA 3KQQA 3Q72A 4EAAA 3EWIA 1WXXA 5EESA 4WASA 4QOSA 3WMFA 1DKMA 2FPPA 4E0BA 4WHMA 5D87A 3LA6A 2OD9A 2NNWB 3LVFO 1G5IA 3AHFA 5IZCC 1ZH4A 2GBGA 5IAOA 3Q40A 1G8YA 3REQA 4UDYX 3CVUA 3ZHQA 4QU0A 5HM6A 1BKSB 2Z4TA 1NXSA 1RJ9B 2JLXA 4N3AA 3TTVA 3VR1A 4BNYA 4QBFA 1IJBA 1FUYB 2YTZA 4PBRA 3EYWA 3OCJA 4YRPA 4EPXA 4ZOQI 5EJEA 4CEIB 1ZCBA 2TMKA 3QTBA 5LD2B 2YOHA 1QTIA 5DSTA 1YR2A 3L6EA 3IPLA 3S8MA 1IULA 3E7XA 1IWPB 5PNTA 3VTKA 2H2IA 2YXEA 5FNVB 2VQ6A 3DAGA 1SU4A 5EWJA 5FPTA 7GPBA 4E5DA 4F5WA 1EHIA 3G5LA 3WDMA 1ZITA 2YVLA 2NADA 2LR0A 2XXJA 4KQ6A 3WBBA 3BM5A 3SDBA 5FOUA 3UPUA 2HDHA 5BSEA 3U5ZB 3SBEA 1XTBA 3PXBA 3GH3A 5DBHX 5F2OA 1GNPA 5K0LA 5FBKA 4BGUA 4BV8A 1PG2A 3N3BC 1VYTA 1C3OB 4D45A 3GLFE 1DZ3A 2AG8A 2WFZA 2IKQA 2X58A 3FSGD 3H2ZA 1K2WA 1L2TA 3PDIA 4KIWA 5B6PA 5CRIA 1R3UA 2KLHA 2XXAB 2D2VA 1XTJA 4KAJA 3JR3A 2KBEA 2MYUA 4LBZA 1HYGA 1VKZA 4I08A 1R4AA 3RYFB 1M2OB 4WGGA 4DLPA 1XKLA 2B6NA 3EDQA 1BCRB 3MT7A 4K6HA 1A9PA 2UDPA 3TS1A 4QGFA 3PDIB 1MAHA 4ALNA 2YRXA 1OIVA 2FEAA 4AUMA 4YCLA 4DJTA 4HCJA 2V6MA 4AXBA 3BWEA 3PIDA 2J6BA 4DDWA 1KO5A 2Y4NA 4X3CA 1PIWA 1U9YA 1JHPA 2HFKA 4YAFA 1A7UA 1L5KA 5AW6A 3HXKA 4GNRA 5CB8A 2YWFA 3C6QA 3A6KA 3ELBA 5ETJA 2AF3C 4DY6A 2JI4A 1MX1A 1WXIA 1JECA 2GWRA 2FW6A 2HMYB 3TZKA 4D5EA 2XUDA 1SVMA 4PV7A 5CUQA 3KPJA 1C3VA 2C5AA 2H3HA 1N9GA 2WPDA 3COZA 4JQOA 1OXUA 2EX4A 3HB1A 2ECPA 2XT9A 1ZK0A 1VHDA 1SO8A 2H17A 2XQIA 3WQRA 1EGAA 3BXXA 3ONWA 3TGWA 2CEAA 4ENTA 1FNBA 4P32A 5LQKA 1N32B 3R24A 1CEQA 3EQ8A 1ZI8A 4P4NA 3KDAA 3X3HA 4CDMA 3SR0A 3J81k 3BHNA 5FWNA 3V55A 1KWGA 3DLPX 4YV1A 3IMFA 2R85A 3MGGA 5K05A 4UNIA 1PWEA 3A1SA 1CUSA 5JR3A 5KJCA 5IYZF 5F91A 1JV2B 3HN6A 5BRAA 1MJGM 3Q6IA 3GRUA 1JEYB 4WY8A 1GPKA 5EP3A 2EBHX 4EPYA 4F4IA 1E2UA 1GAEO 2G67A 1MDBA 4H0CA 4NE7A 3A0UA 2Y2VA 2FFHA 3AW9A 3ZKWB 4C7OA 2I6UA 1E5LA 5DE3A 1TM1E 2M6SA 2HL6A 3LXXA 4QFBA 4PW0A 2HA7A 2ZGVA 4CODB 2JIZD 1PFKA 4X1KA 4TL8A 3AKZA 4MYDA 1IE3A 1RHRA 1USIA 2VS1A 4XAQA 5EWMA 3GVPA 5K0SA 1K8ZB 4J4BA 3K8OE 2CY0A 1QIKA 4QAQA 3DO6A 5KYTA 1MQAA 2QLMA 3LPMA 1TJWA 1VTKA 1ZX1A 1SXJB 1FL9A 1ZN8A 3J7TA 6YASA 1RQRA 4R1NA 4WWHA 3UAOA 4LRUA 5K6TA 1JYEA 3OQ6A 2HM7A 2FE1A 1A9OA 2MYTA 4BKQA 3T94A 1RZ3A 2DFLA 4G65A 1F3LA 5FRDA 5DYYA 1H5NA 5T4FA 4YXFA 1N0IA 2MSCB 3FFWA 4KLAA 1YZYA 5DMXA 5ICGA 2QMEA 4NBUA 5JNTA 2IY7A 3HR7A 3S7ZA 3WLKX 3NVKI 4RTOA 1E9VA 3QXHA 3L6BA 2HLDD 3L4BC 5TGDA 1VLQA 4J91A 4ERNA 3KQMA 3EIEA 3QTTA 3ZK7A 4M9CA 1NDQA 4RDCA 2R0QC 5C35A 5EJ5A 4LDAA 4P98A 4C7VA 1RMQA 5JXIA 2AI2A 3BBPA 3ILYA 1FJGB 1TOAA 4QO8A 1E6EA 1X7WB 1OLXB 2G4LA 3QNWA 4DV6B 1JDTA 3W3AD 1W76A 3WGLA 4GD3Q 1Q0LA 1QP0A 3F9IA 5KAPA 2B35A 2GXAA 2AZMA 2FGKA 1N5MA 2OWDA 3BCUA 4TYMA 2IW1A 1YGPA 2YXBA 2AVNA 4FIZA 4PRYA 4AZSA 4EI9A 3PTLA 3G8AA 4LJSA 4MJ7A 4ZK6A 1KWKA 4V03A 3SSOA 1G9SA 3O6VA 1N3IA 4FE3A 4LQCA 2W4IA 2ZZKA 4LJ8A 2HWWA 1B73A 3B2EA 2QJTA 2V5AA 2G63A 5DOZA 5KB3A 4E14A 1GPYA 2C59A 5A2GA 4RIGA 3OE5A 5BRNA 2HYDA 5E0KB 5ERGB 1CLEA 3T9BA 1Y3CE 4BO8A 5SZHB 1UUFA 2HX1A 4Y1EA 3UMGA 2C5FA 3DDNA 3EIOA 2RGYA 3O1IC 5TT1A 4WK4B 4PGFA 4ER0A 1N77A 1Z4PX 1KEUA 4J75A 3SCZA 2NYAA 3I64A 4LHXA 3GUHA 4MGZR 4BMOB 4LOJA 5HIMA 3DMYA 2X19A 3NVMB 1R16A 4YAEA 2PYDA 1RYEA 2Y1XA 4TRRA 5EA2A 4DBLC 3CVVA 1E99A 2Q4BA 3QPWA 1N6KA 4B7XA 1NUTA 1NXVA 5HBRA 3KVRA 1ORDA 3GIDA 3IOBA 2PX2A 3BILA 4OLHA 4G86A 4C0XA 1XLWA 4U3JA 3D4LA 4W5TA 3DCNA 3BN3A 4YGYA 1E5VA 1JQBA 1ECCA 4P08A 3BMNA 2EFEB 3FUTA 2DJIA 3QU2A 4QYSA 3BJRA 4ZI7A 1DX4A 1LH0A 3DPSA 2Q4EA 4FI3C 4PTZA 1BVYF 2JKVA 3IE0A 2FLVA 3IIJA 1KNQA 3FY4A 4N6NA 4A6DA 3AU9A 5KYXB 3K05A 4MUEA 1ZR4A 2JFHA 4G2TA 4OQMA 3IQIX 5B6JA 3H9QA 3AHIA 3CWQA 4QUGA 1KQ7A 1BMQA 4B71A 2BHSA 3ZLUA 4TTRA 4DR5B 4KR6A 1ECBA 2QSJA 2R11A 2Q5OA 1AO3A 4ZI7B 1X1DA 1KO1A 1COZA 3MUOA 4LK2A 4PHHA 4BLQA 1NA5A 3ZKAA 3DLCA 8OHMA 3FWKA 4MUNA 1B0UA 1UXKA 4EH1A 4HZUB 3PRHA 2WU8A 4F6LA 1QK3A 2O2GA 3KQHA 3A26A 4GI3A 4KMMA 2O8EA 1F0YA 3FROA 2PUJA 4JLBA 4DGQA 1S3GA 4JVNA 4JKIA 5EXXA 3MMPA 3O9MA 1L7PA 5C32A 1IIRA 3WLLA 1MVLA 2X76A 3QENA 3M81A 3QELB 5EZYA 4N3GA 5F4BA 3T3NA 4X44A 1Y7IA 3SG0A 1IY2A 2VDUE 4PPGA 4RPIA 4WJKB 4BX8A 1ZD4A 1ZM7A 1VI5A 3DBRB 1Y5IA 3VSEA 1DX9A 4DV3B 2ZYTX 4MYSA 1Y8QA 3D8BA 1QMPA 1OX4B 1T4CA 2SICE 1R6DA 1Z38A 4BV2A 4M1QA 5H9WA 2DWUA 5IMBA 4ASUD 1FDVA 3L8YA 4MI9A 1ES9A 4WOKA 5B1EA 2JEOA 1IY0A 3NBUA 4IFIA 3C3AA 1SA0B 1RE1A 3A9VA 3ADOA 3OIVA 4OA8A 5CA0A 2COUA 3O03A 2RHLA 1FTSA 3LG2A 4KQMA 4YAOA 5DNCA 3T3HA 2FMUA 4YRJA 1OX4A 1T4CB 3HADA 3PEYA 2IHYA 2ZK7A 1HE4A 2J7KA 2DP4E 1M6WA 1PLJA 2YBEA 3JPYA 1HY3A 2NGRA 3JQ6A 1O3YA 1W0KA 4IV5A 3I12A 4X54A 4X95A 5FT9A 3RK0A 5FA5A 4DBZA 1W47A 5TPWA 4ZQBA 4IF6A 1VLJA 3TTYA 2IHUA 3CPHA 4KPGA 4FFPA 3PC6A 4DLSA 2I8AA 2V45A 1HMPA 3KYDB 2E48A 4BFYA 2AMLA 4N7RA 5F76A 2X0RA 2JLVA 3G2PA 2DLDA 4EZBA 1MXHA 2BFEB 4F2HA 3P0HA 3ZV5A 3T7TA 2AZXA 4ZQFA 2XTAA 3N8GA 5TF0A 3WDLA 3PEUA 3C3MA 3H86A 3KL2A 4Y3UA 3QYPA 1GQYA 2YY5A 4ID9A 1BA2A 4GKJB 1TUBA 5FBRB 1EAYA 1VE5A 2P35A 2O05A 1J9ZA 2OGUA 1LSOA 5FOWA 3RLFA 1A69A 2GN0A 3MBKA 4BNDA 1XZNA 2CJPA 4NKRA 4G1FA 5ICSA 2CVPA 3IR7A 3L43A 1V48A 1ZRSA 4DV5B 1VJRA 1JLHA 1EK0A 5H9VA 3E9NA 4BFCA 3TTTA 1U1FA 4LOLA 4H7IA 4WECA 3PPYA 3TEJA 1GO2A 1L7RA 2BCEA 1NBIA 4K6MA 3R76A 1Q1NA 4LRSB 2OV2A 1X8XA 1RJDA 2ZPAA 4ILKA 4OLJA 4EHHA 1WDTA 4P92A 4GXRA 3NWOA 4CN8A 3H9CA 3KPVA 3KZNA 3HA5A 3OI7A 1DAHA 4FCWA 3B3JA 1FRQA 1ZN7A 2RI6A 3NEPX 4IDHA 2P9CA 1RM0A 3DP7A 4RIFA 5C3UA 4C89A 2FNAA 2O0HA 4KUEA 1E58A 5JFTA 4TT3A 1LI4A 1UDXA 3NOOA 4KDFA 5FO0A 3ZR4B 2XGJA 4L6CA 1BMFA 1PEAA 2NSYA 1M1NB 2I4TA 3HRKA 2HF2A 2VJKA 3INTA 2AI3A 3NVDA 4MQ6A 1B0ZA 5A05A 3V6LA 4OX9Y 2R4UA 2WKRA 3M6XA 2ZRJA 3CURA 1WD7A 3Q98A 1MR3F 3F5DA 4C0JA 2BFCB 2XB6A 3EZLA 4US1R 5LZ8A 3QKIA 4ZEMA 5IT0A 3THYA 1SU8A 4HDKA 5AW7A 3DFFA 1MAAA 2AI1A 2Q0QA 2XVAA 3B48A 3EZYA 3M6FA 2OP1A 3OA0A 3R3UA 4G8JA 4QJ4A 3DAHA 4YRFA 3WGQA 1IMJA 4LJ9A 4XARA 3UAWA 3SC6A 2C2HA 4ENQA 2AYXA 1NQOA 1JNYA 3P9IA 3C48A 1E9DA 2ZROA 3ZE1B 3EQ9A 3HJRA 1AG9A 1EZ4A 2ZAIA 4HX9A 4Q4AA 5E1BA 3RU7A 1YZ3A 3NHWA 2QU7A 3Q6MA 1V2HE 3B6ZA 3MGKA 4R0NA 5HK8A 1NFQA 2E18A 1UOQA 4KRXA 3NGXA 5F73A 3CPEA 3GFPA 4KXQA 1ODJA 4FE7A 5FCDA 3SJ7A 2QRVA 3LWZA 3WLPA 3PXCX 4U7JA 2PT7A 4DA0A 3A04A 2QR5A 3W7VA 2IUUA 5H83A 3OAAA 1I14A 2FA9A 1F20A 1U81A 1M8KA 2WD7B 2BGRA 3LKDA 4E09A 4RKFA 5EIBD 5HTKA 2Z5LA 1FBNA 1I51A 3FLMA 4U00A 4AUNA 5AK3A 4FHGA 2KM1A 4NZYA 3E9EA 2V3CC 3BJIC 1LF5A 1RWNA 4F5YA 3A4TA 3JR7A 1YE5A 1LRLA 1R0WA 1XTVA 1SCNE 3CH7A 4RM3A 3MS4A 2IF0A 5ENVA 1O0BA 2VHYA 5LQRA 4J0IA 3BVPA 3IAHA 2XXAA 2H5IA 4II7A 5IULC 2YNMD 2GN9A 2GD2A 1GFSA 1SOMA 2QRHA 2V6IA 4KXMA 4P5DA 1E3TA 4WCFB 6REQA 2IYVA 1J49A 3N6VA 1NI4B 2JGKA 3QMPA 1S5PA 1YFZA 1LB1B 1O1YA 3DPIA 4PZUA 2B69A 4QE3A 4RFLA 4YQFA 2N1MA 1B4DA 5IYZA 4DSTA 2YFQA 5E3JA 1DKRA 3E9RA 4GICA 4RK0A 1FDSA 5F23A 4TYQA 1I2CA 1UMCA 4HDMB 4OSEA 2R1VB 2CNLA 4YC7A 1XEWY 1KPHA 3DFUA 1UBOS 5E7QA 1R8JA 2O3QA 1KK0A 3V7YA 3W2IA 2D1QA 4HEJA 1JBKA 3K1TA 3NBKA 3BT7A 5CX1B 4YO8A 3HFSA 2ZWIA 3F49S 4YP0A 5FORA 4HQRA 4HB3A 5J1TB 2A94A 4FJ0A 3PCXA 4G89A 2I4RA 2C83A 2G5PA 1CT9A 3RH0A 2ATIA 1ZXLA 4F7DA 1ZCJA 4GO1A 1LY1A 2HSDA 2WF8A 3LQRA 4NPAA 4BIMA 4ABTA 3I9LA 1WY7A 3O92A 2XVXA 3PXEA 4RHUA 5IRCD 5JZVA 3LP6A 3LVRE 4LNAA 4FW9A 3WIEA 1C9MA 3AI2A 5D01A 3AQ4A 3NH9A 5HS4A 1XFDA 3DD5A 1UFRA 4RIHA 2AL7A 3RO7A 5JLAA 1O08A 5KVCA 2VATA 2ATCA 2YCLA 3KKQA 4JZKA 4HFMA 2Z58A 3EXAA 4PM4A 4C9BA 2DR2A 3F5QA 4WCFC 2NP6A 4DLLA 3FXAA 1X8KA 1M1YE 1RNLA 4MV4A 4GOXA 3DKRA 1CIPA 3GLIB 1R0SA 2JFWA 4PLVA 3ZD7A 4DNOA 4JT9A 1Z0FA 4QICA 4RF2A 4CE6A 4YAGA 1GPMA 3FVTA 5TB5A 5DZSA 4FSHA 3P26A 1W4AA 2CDCA 3SD7A 5TV2A 4D4JA 5K99A 1MJNA 2X6QA 3O1HB 1SUBA 2R6FA 3SK0A 1FYFA 5CBKA 3FTPA 4UHCA 1U6IA 1WSDA 2O2HA 4I55F 4N9QA 3UT5A 5KTYA 2BE7A 2EFHB 2QE7D 3SHFA 3VYVA 2WV7A 3BCRA 1DPFA 2ZSBA 3M6UA 1EG2A 4W82A 1SA0A 4D99A 3IURA 1QNFA 3KLBA 3NJ4A 4TMZA 3Q5GA 1AURA 4XIYA 5BV2P 1BVRA 1OLUA 4Z9BA 4B82A 1WCYA 2IIQA 3GGJA 2OOSA 3PWZA 4OATA 3S29A 4I1PA 3IUNA 3WRXA 3ZQJA 2QBYA 1LUAA 5FI5A 3KDSE 3W5CA 5FJJA 3RYIA 1OY1A 2FZCA 3A06A 3Q3JB 2IZ0A 2OHJA 4RVOA 3I01A 3H11B 1XZAA 4E5KA 2H4WA 4ZHQA 3NT2A 2EF1A 3OT4A 4IDNA 3DQQA 1GZ7A 4OQNA 2UYQA 4U5QA 3C4VA 2GEKA 1E2DA 1GQOA 1J70A 1Y3FE 2EVWX 4X6LA 1GNRA 2GA8A 1P18A 3BQ9A 4QUHA 1WUJS 1OT5A 1IVNA 1YRBA 3RR2A 4IHJA 3MT0A 4YJ3F 5CLLA 3B7GA 4NS4A 2I5PO 3DFZA 4MVJP 2QL6A 3CW2A 1DSSG 3D1VA 3ROEA 2V54A 4F91B 3EZFA 2JFNA 4EMSA 3LTNC 5I9MA 5CH3A 3PI6A 1GD1O 4FBGA 1HF3A 4ZZ0A 3H0CA 4GI7A 1UBCA 2Z4SA 3H0EA 2I8LA 4MRPA 4TWAA 4D0NA 1ZGHA 4HZIA 3E84A 3QVKA 4DCUA 5AM3A 5H70A 1TEXA 1LWOA 4PZYA 3ZIDA 4LMBA 3X0DA 4HNRA 1PFGA 1RXYA 2C2XA 4WRRA 3H2HA 5L3SB 1UJBA 3VI3B 4BB6A 2I2WA 3FGZA 4JOCA 3P9SA 1SIOA 2FB9A 1OW3B 2GZMA 3NHLA 4W1SA 4C4PA 2JAWA 2JW5A 3E2IA 2P3OA 4LAFA 3RJ9A 2CXRA 3SJAA 4EENA 3TX2A 1N57A 4A2QA 4RJTA 2ID4A 3E03A 1UQUA 2HZ7A 4XGIA 4EY7A 2FAXA 3DO5A 4IDAA 1VLMA 4O63O 1QH9A 4U2FA 4ZCQA 5I01A 3E04A 1JAZA 2FKAA 2ADMA 1F7UA 5GGYA 3TZLA 1L5QA 4TLAA 2VTEA 1EFVB 1G8FA 2W2TA 1H05A 1NF2A 4MUYA 2OGWA 4JLPA 5JANA 2UAGA 2BEWA 3LVQE 2HRDA 1VMKA 4LCJA 4KQXA 4P36A 1XVAA 1OZ0A 1EUCB 1U9IC 2QRZA 2P8JA 4GKVA 2QP3A 5KYUB 3DAOA 4L4RA 2PZKA 4RVSA 4AN4A 3DBVO 5DFAA 4H3HB 1VKOA 2DFVA 1UOEA 3DAYA 4UOEA 1HX7A 1QHGA 1XA0A 2ODWA 3AC0A 3FWHA 4PX5A 3LCJA 1L5OA 4KIJA 2VFAA 3N59A 3V4SA 4B46A 4IGAA 1Y63A 1N6NA 5ECGC 4R2KA 4EJSC 1D09A 3OHPA 1LBIA 3LXUX 2EFDB 2F3PA 1QS0B 3SMVA 3RTGA 1E7RA 1SUPA 4DCCA 3S68A 4AKSA 4JJKA 4TXJA 1FYVA 3R44A 3AG5A 3AL0C 2XEDA 1P5ZB 2NAFA 3VAZA 3JYLA 4HDCA 4YACA 4BWVA 5A5GA 1UXHA 3PE6A 4BP9A 1OFTA 1PJQA 1TVMA 1U8TA 4J90A 1FDUA 2WIJA 3Q5EA 3W9SA 1J0BA 5D1HA 1J6UA 5JAPA 3FYCA 2VP4A 1NP6A 3GARA 1AF4A 3HN7A 4HLNA 4PZAA 4Z4CA 2WP0A 1C5KA 5HFNA 4AD8A 4RTMA 3P9NA 3ESAA 1JGTA 2JARA 3SDZA 3AO0B 5ESXA 2VL7A 3W6ZA 3PF8A 1NP3A 1LI7A 4PO8A 4L8GA 4YJ2B 5EUBA 1WU7A 3PHCA 3H2BA 2XQJA 5JC8A 3C3CA 3SQNA 3RT1A 2X5OA 3RU9A 4KKXB 5T3YA 4GGMX 4ZO4A 4F12A 1YR9A 5ALEA 2PFSA 4B7UA 2IOFA 3N2ZB 2HA2A 4KAXA 3E15A 4GUDA 4W5WA 4ZEOA 3WB9A 1ML3A 1PQ4A 1UBKS 1VMDA 1SCAA 3HVHA 3M3PA 1A8UA 1A2OA 1U2EA 4JZYA 4KQGA 4V0RA 3ZV7A 4ER6A 1Z63A 2JJQA 2WWRA 4OOEA 2QQFA 5EFOA 1L8AA 1HDRA 2COEA 4AW9A 2FR8A 4HN9A 4YB8A 3VPXA 4HEQA 3CVXA 2IPMA 3IB6A 3FPGA 5AOCA 4R7ZA 3EOBI 2QRJA 4WIAA 1LBEA 2CVFA 2Q8PA 4QX6A 1YDEA 1DQZA 2XB9A 3KKKA 3RC8A 2BRUA 2EWVA 3FPSA 1WB9A 3TINA 3IR5A 4G4JA 1R8SA 4JXJA 3M5WA 4A8JB 5KJ1A 4B31A 3MLEA 1G41A 3GC6A 4ZTZB 4TYYA 1RRKA 3I0NA 1OGJA 4TMTA 4L5AA 4C7MA 5E4FA 1HDOA 2P5SA 1ZVKA 4ODIA 1FMTA 3K0AA 3UJHA 4CKBA 3PUZA 3A6GA 1JKJA 3PG5A 4CI0B 3Q3VA 2Y0EA 3CZ4A 3SQMA 1EBUA 3TX6A 3WWCA 3WYFA 4BFSA 4EUFA 5KTPA 4CQNA 4KL8S 4WESB 3GJRA 4TKZA 1T26A 3WGGA 3ZY2A 1F51E 1W1WA 3FOEC 3QEBZ 1OAOC 1RLUA 2V3WA 5BQPA 4B47A 1Q15A 3G2JA 3TZ6A 1W25A 1V1MB 2C4HA 2VPPA 3GUYA 4PXAA 5IFKA 5B7GA 1Z74A 5JHHB 1CU1A 1B14A 2RC6A 1CZOA 1QYVA 2F67A 1O9HA 3HVJA 5LP6B 1RYDA 2ZTHA 2O0KA 4QVKA 3D0RA 4FGZA 3BMXA 5DX1A 1WBBA 4QDUA 3M89A 2QLNA 4BQRA 4UE6A 4D8TA 3K8YA 3EZXA 3W2TA 2EEZA 1KZ7B 2ONCA 2WC1A 1BG6A 3M83A 1I36A 1VI2A 3E9QA 4CFYA 3DLHA 2FZ5A 4K6OA 4TTIA 4J1NA 5E2IA 2CN1A 1KMMA 2IYYA 3V4VB 3HJAA 1OXSC 3C8DA 1F5NA 1HE3A 3ENZA 1E98A 3FGNA 1V4VA 3HZRA 5KYWA 1XAJA 4I81A 1PG0A 2V0GA 1T0HB 2ZT7A 3K94A 4C2BA 4E07A 4OBBA 1PZFA 2LDBA 3EDRA 1EB9A 1URPA 2GOYA 4AAYA 4ERXA 2NVUA 1YS7A 5K3FA 1QIMA 3RRXA 3QW4B 1G6OA 3TIFA 3TQQA 3W78A 1I7PA 3DS8A 4X60A 1R9JA 4OP2A 4HWPA 3M3DA 5CYPA 3CLRC 3FPEA 3HR8A 4KW7A 1UKAA 2XYHA 3DMDA 3OZUA 3Q15C 4Q24A 4CUKA 2XZTA 2ZXEA 3SWWA 1CQXA 2D1FA 1P6UA 5IC6A 5AM1A 1WD5A 3MXTA 2ZXUA 1YO6A 5ALMA 3F73A 3DC2A 3LH5A 3QA3E 2VWQA 3X1YA 1UJ2A 2CLMB 2OHOA 3NORA 4YJHA 2D7CA 1MFZA 3QW2A 1GVNB 1EWYA 2ZWOA 3CZ9A 2PQ6A 4KQKA 1EK1A 1LTQA 5HFJA 5GY7A 3M4ZA 4RSRA 5KC9A 1RBMA 4Y2GA 4X7PA 2HSJA 4GE0A 1TRKA 3FF1A 4BGDA 3LT2A 2JCSA 1HT1E 1V96A 1FPQA 4X90A 1U3TA 2IHBA 2EU8A 2H8GA 2J87A 3CSSA 4WFIA 3FHLA 3IBFA 3RS9A 2DRIA 4CMAA 2GJAA 3AU8A 2J3IA 4DWOA 3FH0A 1JHDA 5AUOB 5JOQA 4KBYA 2ETVA 3GZHA 2EL9A 4YJKA 3WTBA 3HLYA 1DMRA 5FYQA 2O5EA 1E20A 1MH9A 3NHZA 5B1IA 1QPGA 1HORA 1VKNA 3TNDA 5DNVA 4B5KA 3QKRA 4PGGA 7ADHA 1GDDA 2ISSD 1T91A 2R8YA 2WUEA 3DEHA 1A4XA 3H8JA 2Q2NA 4LRYA 4LYFA 1XP8A 4K9KA 1LFDB 4F97A 1FLAA 3RWBA 5COAA 5EYPB 1QWOA 1OKKD 2CE7A 4G81A 1O97C 1IONA 1QF9A 2ALJA 2WF6A 3NX4A 4HLUA 5AOAA 1U3VA 2V7QD 3GVCA 3W3AA 1JG3A 3JQ9A 2MOKA 4Q7QA 4JBYA 4B3XA 4ZOLA 3ENKA 3Q7RA 4JLOA 4Q37A 1WZIA 4J0JA 4OHRA 2HWKA 3OOEA 4B09A 1P8AA 3KZ1E 4ITRC 4FHCA 3D7KA 2J3DA 1YNOA 3F3MA 4GOLD 4NX2A 3SKXA 4CKEA 3GT0A 1BN7A 2NO7A 4G41A 4H7PA 2WFAA 4YDHB 5BSWA 4F2PA 4P0PB 3O9ZA 3PLRA 2GFQA 4I3FA 4UBOA 1U3DA 1CDDA 1XMPA 3REFA 3ZHBA 4E70A 1E94E 2PK3A 1NW9B 1N7GA 1RYYA 4C6TA 1CP2A 1PDVA 2IYSA 2O2EA 4CEHA 1Z17A 1P44A 3H87A 1Z29A 3OP1A 5H7XA 3G13A 4Q3KA 2B5VA 2QAGB 4CIVA 3G88A 1BGXT 2AOWA 3NUGA 3RSSA 1SIBE 2ZXFA 3R6TA 3ZI0A 1MC4A 2JCGA 3DH0A 5ELLA 4RIIA 1XEXB 3H6KA 2D6FA 2BDUA 2FUEA 2ARKA 1Y6JA 4P3KA 3RSOA 4EBBA 4MRAA 3CVYA 2Z6AA 1DDOA 1J06A 1DV1A 1F0KA 2P68A 1L0BA 3LF1A 1Y8RA 5DK6A 4AICA 2UYYA 1PN3A 1GGNA 3GTDA 1K9VF 3GCZA 1SBNE 1F6BA 3L8HA 4KBFA 5B3AA 1TYZA 5LLSA 3AX6A 4MWTA 4QLBA 1XROA 1E79D 3O4GA 3JU3A 1NRXA 2J59A 3ZWVA 2W2NA 3TVTA 4CM1A 5WRFA 5D84A 3HZHA 2VP6A 3PPIA 4H59A 4H6WA 4QWWA 5F7OA 2GK3A 4JA2A 4W5OA 5CCDA 2XUAA 2Y71A 4GECA 4HNAA 1NIJA 4M2LA 3MLAA 3V1MA 1G63A 5K9ZA 1FZQA 4KQFA 4BC1A 4B3BA 2NTVA 1H2BA 3CXRA 2QX9A 3ISTA 3KKLA 2BEJA 4Q3DA 4WLOA 4J4HA 3U7IA 4N39A 3VTAA 1YD7A 2QM0A 2PZEA 1IB6A 2Q7DA 2DR0A 1C1DA 3FAZA 5BSHA 3BH6A 3D2CA 4WUVA 2MT9A 2YJ4A 3TOCA 1W1IA 3ZG6A 1KZGB 3CRVA 5HCUA 2X0FA 3BHGA 2CSXA 3P0IA 2F48A 3I1IA 1ZD2P 3SEZA 4MQFA 3AM4A 1D4ZA 2PT6A 1IZ0A 2O0LA 4A6PA 1XHEA 4PQFA 4DDUA 5CB6A 4Q00A 3K70C 4MTCA 1YR3A 2OE2A 1T5SA 2G0NA 5CLGA 4F71A 3DVQX 1NW6A 1W6UA 2JIPA 4Q02A 3EOZA 4GWLA 4WKBA 3QG1A 1UWKA 1S1CA 4JR2A 4AZ0A 2O52A 2V8BA 1HDZA 1EP9A 4P80A 4G0PA 3THOA 1E3JA 5SYAA 2VF2A 1K9SA 2DLNA 3OTIA 4LJ7A 2ZJ6A 1HZZA 1YTUA 3SLGA 1RJFA 2I3BA 4NYMQ 4EY6A 3WJAA 2YY7A 4ECAA 1CY1A 2DUMA 3LXMA 3CVOA 1C81A 5JAZA 3LFHA 2C3UA 4HBZA 3SJBA 1RIIA 4A1OA 3CIOA 4TZKA 3TEFA 2OD7A 4L85A 4ZEVA 3EAQA 1NUPA 3ZOZA 3P4UA 2OK8A 1MIOB 3R0QA 5KNCA 2GPAA 4HBGA 4L8WB 4NMLA 4C43A 4FTWA 3EC2A 3KXDA 5F1KA 4BY9E 3IUBA 3DXYA 4PLCA 4QRHA 1UBRS 2Y27A 1T4DA 4WXHA 3F90A 1NLFA 1TMOA 1EG7A 5BSKA 1CV2A 2X9NA 1YDFA 3I2FA 1NJ1A 5JALA 4JSYA 4NYIR 1PL6A 4OUDA 4ZRMA 3U61B 4LFAB 2ZSHA 3M1AA 4V2IA 4D4KA 5KEIA 3IAS1 4A10A 1BJKA 4BLVA 4TSFA 2FUCA 4BBJA 1CS0A 5FLKA 1GA4A 5EIBC 5LLTA 1V35A 1W49A 2R7AA 3TW4A 3VYRB 1IZYA 1JLKA 1ZBDA 3QPDA 2HTEA 3MTGA 3O3MB 3MJFA 4M0CA 4D9IA 1CHNA 2EL7A 2OYSA 3C41J 2KMLA 4O2RA 1Q0QA 3FYTA 3AF4A 4GMKA 3SIXA 3DCJA 3H1BA 1K97A 1CEEA 3I05A 3T95A 4NBWA 2AG0A 2LGJA 3ENWA 4HF7A 4WW0A 1GFZA 1MX3A 4TQGA 1GL7A 1M1YA 2IYUA 2M2IA 2VYVD 3RBAA 3V9AA 1YS9A 4BEJA 2N0SA 5JQGF 4YYZA 4MPPA 5JXHA 4QAJA 3UMYA 2V9CA 1YQGA 3HDVA 3THWA 4AMZA 3HCPA 1JKFA 5EE9A 3V7WA 3E58A 3F4LA 3TWOA 4G0ZA 2QY9A 4KYVA 4PYNA 5FWDA 1DAFA 2CXOA 3OBIA 3X2FA 4JSTA 2NTYC 1FU8A 3CFYA 5AQ1A 1O94A 4B9EA 3F96A 1K5GA 3KBBA 1KOJA 1P31A 3H6HA 3OZWA 3P2KA 5DLPA 5DWDA 1C0LA 5FV4A 2W6CX 5ECWA 3WO1A 1XZPA 1BX0A 2OECA 3WAJA 4PCLA 4AMGA 1X13A 5LZ5A 1VYVA 4QEKA 2G9UA 1MT3A 1XJ0A 3LX8A 1JHAA 2FUSA 3HA2A 3HSSA 4TKVA 3OQVA 4HDMA 4PHTA 3ILVA 4K9QA 2WU4A 5A4DA 5I7AA 3OU7A 4PQEA 5BUZA 8MHTA 2VAXA 3CH6A 3WWDA 5K0ZA 3T99A 1WMEA 1WEKA 5K09A 2ZRKA 2H2DA 3D3QA 3O8DA 5BOSB 1ZFNA 4RY0A 4P54A 2J45A 1PJZA 3LV8A 3OJLA 3OZFA 1M76A 1KQOA 2BPOA 3E9DA 3HEBA 4A0RA 5AW4A 1NWCA 4D9MA 3INYA 1Z16A 1M7GA 2JEYA 4NZPA 2AC4A 4MVJA 3TL6A 3CR3C 1DO2A 3GNSA 1FBTA 4EEIA 4EHKA 2HLHA 4GM1A 3O8CA 3GR6A 4RH0A 3OD5A 3AIIA 4OVKA 1KI6A 3CUSA 1PL0A 1U80A 1GNQA 3C16C 3M1LA 4FR0A 4G9EA 1FVHA 5CVDA 2GFHA 5AVKA 5IN5A 1B93A 3WLSA 4C0BA 5KJFA 5L7WA 4ER5A 5FUYA 1TZBA 5E1DA 4QVIA 4BEBA 1L4HA 4HKTA 2FMFA 3HC7A 4JUAA 3OQHA 5JZOA 4CLDA 3M4XA 1T13A 3C7KA 4C14A 3AVTA 2WT8A 1ATIA 1BJTA 1Q95A 3OX2A 4G84A 3TTSA 5B5SA 2GILA 3HJUA 2HK8A 2DE0X 3HJGA 4OH1A 5EZYF 5C7OO 2ZYDA 1CXZA 1QKKA 5A9SA 4OMFG 1E9FA 2BFBA 1PZMA 4Z0PA 4M0KA 3AETB 5G0WA 3I8SA 1SU7A 1JLSA 2FEWB 5E3IA 4A91A 5CEJA 1ZOIA 1QH8A 521PA 3R3HA 2QVYX 3ZHCA 4DUGD 3K70B 1Z22A 1I32A 3JQBC 5IVHA 2IA5A 1U3CA 4MR9B 3LQYA 4XUGB 2PJZA 3K15A 3IJPA 1L5SA 4YCNA 1HPLA 4V39A 1ZGAA 3R7NA 1Y6GA 1JAIA 3STXA 4FFSA 1TW3A 3U9LA 1QHSA 1DVRA 1NNUA 1BJRE 5IT9A 5TR9A 3BAZA 4EA7A 1E32A 1HURA 5GAJA 3TQHA 4OQQA 1B8VA 1YB6A 1Z0AA 1CY2A 5JXJA 4RQUA 1H69A 2AHOA 5E8RA 2H2AA 1CERA 1I3KA 2VZLA 2YQZA 4L28A 2AQHA 4UCXA 4C2AA 1N8SA 3C5EA 2IX9A 3C8ZA 4Y6QA 4DM3A 1NSFA 1QRAA 2F1KA 4DLZA 3J80A 2P2DA 4OLAA 1K5HA 4Q03A 5HE8A 4S24A 5TX7A 1VM6A 4MW0A 1V16B 5LKRA 2AN4A 4OQPA 3ICQB 4IHJB 4D44A 5BYKA 2EG5A 2Q07A 3WWZA 1WUYA 3CLSD 4CT0A 1PWYE 5JJBA 5EE1A 1I2BA 5BVGB 2OEPA 1KJJA 1KXZA 3D6JA 3GMSA 4ZZ1A 1FLDA 1SIWA 5DNAA 1N5JA 4MNTA 5B1HA 5KKAA 2HQOA 3KV1A 1CY4A 1UKZA 1GA1A 3UK6A 5ALXA 4HDNA 3WFJA 1K7FB 1KYWA 1UJ5A 1CUWA 1SC1A 4NHOA 4ZQGA 3RF7A 3IQEA 4JD5A 4B4KA 3U4HA 4GH5A 1ZJ5A 2QQ0A 4FKBA 4B1FA 5AVJA 3CRNA 4C0AC 2VQFB 3U56A 1US8A 4OH7A 4UTVA 4KWHA 4KC0A 2IF2A 4GP9A 1SJ9A 2CDNA 3TOVA 1BCSB 1BDMA 5TQJA 1ZM3A 1FFEA 3B89A 4Z3KA 4MMZB 1E89A 3JD3A 3NBFA 5A03A 1V3TA 2G8NA 2ZJ5A 4OHMA 4Z4QA 3O90A 3GCGA 1R8XA 4E5PA 1JIVA 1SVKA 3QJGA 1AK9A 4TTQA 3IS3A 2GRAA 3OO0A 2VUTA 1NV8A 4L0DA 3LDUA 5E4YA 5FIUA 3D4BA 3TUZC 4LTNA 1K3FA 2R96A 2PDAA 4WEOA 1B76A 5DX0A 1THGA 2PVCA 3ZDRA 1T8WA 1UAYA 2B78A 2IPAB 3FTNA 5C31A 3WNCA 4ESVA 1D8AA 3CG4A 1JPUA 4NMXB 4C4ZA 1GILA 2RH9B 3GP8A 2CFRA 1OH7A 1IBLB 9LDBA 3E2PA 2W8ZA 3WG9A 1FMCA 2OV1A 4HN4B 4O29A 2G7ZA 1Z45A 2EFYA 4FNAA 4CLRA 4RFSA 1PNRA 1ULHA 1CS0B 1Y34E 3BK2A 1QP7A 4HXGA 4EI8A 1R8YA 3AGPA 4OUKX 5LYJA 1HFEL 1WIWA 2HNAA 2NYUA 3CMCO 3DL2A 3PFKA 3NHUA 1W5TA 1JKIA 3UMSA 1KHTA 2C82A 4QA9A 3NHRA 1SFRA 3DTVA 2G04A 4R2JA 2BMAA 5EZ5A 1CTQA 3SVTA 1ML4A 1FW6A 3T9FA 1UK8A 4J7UA 3GEDA 3CNEA 2NO1A 3OBBA 5FL7D 1HEUA 3K9BA 4K05A 4IKEA 9LDTA 3DD1A 1YJBA 1FX1A 5E3HA 2QD3A 4UBNA 4F4HA 2V55B 2COKA 2ZETA 1NVEA 1G55A 3TLJA 1VIVA 3JVVA 4R6XA 3DZ8A 4AJ1A 2V1UA 4FDLA 3GEPA 1N7JA 4IQ0A 5AT1A 1FFDA 2F3UA 3GQBA 2IU4A 3NAQA 2RGDA 2EJBA 1YNSA 5FUWA 1FYXA 3ANMA 3BBLA 4IBOA 3KTFA 1I5EA 4IVRA 4V0MA 2VQSA 4XSGA 4BGIA 2WSLA 4D0GA 2XCIA 1HTBA 1DJNA 1NULA 4AM8A 2WHEA 4FD3A 2IXAA 1EB8A 3OIGA 1U9ZA 4KLZA 3RS3A 1ZC4A 3S70A 1H5QA 4MLPA 1XEAA 3LUKA 3R3YA 1T8RA 4A82A 1MW9X 2IYOA 4IH4A 2Z4RA 4G2NA 2YDXA 4ENUA 2BR5A 5FYDA 2FF7A 4LOIA 3BE5A 3ZEIA 3IMKA 4G1MB 1SBTA 1YQWA 2D62A 4FONA 2B82A 5HUJA 1GV0A 5KHLB 2PZMA 4DM4A 4JI1B 3A2MA 4JR0A 2Z30A 2B4KA 3AEKA 4FNGA 1FQJA 2QL9A 5IVIA 5DPMA 2DHQA 2DFKB 2QTWB 2P69A 3LLVA 3MTAA 2M98A 3UFBA 4EY3A 3DMTC 3UUWA 4F4UA 3L2OB 2PGDA 2Q5LA 5KNBD 3U17A 4KN9S 1GSIA 3QF7A 2EHDA 2QORA 4MVXA 1M8FA 3HUDA 3O8QB 3RUFA 2CFTA 2OCGA 3WGJA 2ZRIA 2I91A 2HUPA 4NHEA 2ZIXB 5F52A 1EUDB 3CLHA 4TROA 5LP1A 2JFZA 2O7NA 2Q2WA 3FHOA 4Z9XA 4FHEA 4ZT3A 1YHZA 4A3SA 4BNMA 3IP7A 4ZGBA 3FZYA 2RI0A 5K8JB 4P6VF 1OBFO 3FB4A 4EQ6A 1GNLA 1L4MA 2IY8A 2PBLA 1HG1A 4HNQA 4DB4A 1E9BA 3SQXA 3SEFA 4A8JC 2Q1SA 1XU9A 3NALA 1OH6A 3SFTA 1UPBA 1IWOA 1WPGA 3KCQA 4OFXA 4IJUA 4JHXA 2IEIA 2EQBA 1P7VA 3RFFA 5MGBA 5GJCA 1WCV1 1DKPA 2O4UX 1BXZA 1E3QA 1H2YA 4E1BA 1CCWA 1PJ2A 1PT7A 2OO5C 5JCPA 5KVVA 2JIRA 4UD6A 1G19A 1UKCA 3CE6A 5EXEA 2FDXA 2C4WA 1KVUA 1L5GB 2FMXA 3MNFA 3GJ3A 2GDJA 1Y3BE 3UFXA 2GQ0A 2A3NA 4X97A 2WTUA 1AKRA 4O1HA 5F21A 3DDWA 4FFVA 1YL5A 3KVYA 4OJYA 3FYUA 2IL1A 3U09A 1CEYA 3DJYA 3E3NA 2F59A 3U0VA 3WNDA 2G82A 1RYBA 2I7VA 2R8RA 3UQYS 1W59A 3SVLA 3WBFA 2IEGA 2UZ0A 1FFCA 4XX0A 2FJPA 1ZM4A 2GJKA 3T5GA 3K6RA 1L4FA 3F6RA 4BATA 2OSVA 5C52B 5LMNB 2GZDA 5AI5A 2BGLA 5CBPB 2ZB2A 1OGYA 3GNQA 3ZXYA 1GSAA 2QX6A 2EBWA 1U1CA 2XHZA 5LBUA 3CWZA 2V9ZA 4ZWNA 3GXBA 5F64A 1ZNYA 2VP5A 2YRWA 3KQSA 3NIFB 5IYZB 3F8SA 2EZUA 2G83A 5FA6A 2YIMA 2WJWA 4HGRA 4L9AA 4JL5A 3N86A 2VJDA 4XLTA 5J2UF 1PD0A 2VYFA 4LCBA 5DHPA 1KIMA 1GEGA 1X1QA 1CJSA 1PZEA 1J20A 2R1VA 3D8SA 3CGGA 3SYTA 3WWOA 3LYAA 2VK1A 2JLYA 3KEQA 4EZIA 5KNDD 1E4OA 4RV5A 4BB0A 2G28A 1ZI9A 1IH8A 1C9EA 2R1TB 4A15A 4FLFA 4ZO8A 1VL0A 4FUQA 1KGDA 3GYGA 4FGJA 1U0JA 3A1VA 5E95A 2VSOA 4IOKA 2I2BA 4OFWA 3RC2A 2R6R1 4TRJA 4YV0A 1E3IA 3JTEA 2E9SA 1C7EA 1X38A 5A9RA 3TIXB 2J6HA 3ZXUB 4L51A 3PUKA 2JIZA 1RLTA 1EX7A 2MMCA 1EINA 3L8EA 5EPOA 3IC5A 4ZC8A 2OHHA 1FFSA 1MX9A 2XMRA 3R3JA 5CT4A 2CLEB 1SCJA 4YK7A 4TV9B 5HGJA 5IF3A 4P4SA 4RE6A 3JD2A 3EPJA 2ZUUA 3K0FA 4EG4A 4CG1A 1SVNA 4IQFA 3KAJA 2OBMA 2O1WA 3H2GA 4GLOA 2HPZA 4U4AA 2YWGA 3Q8MA 2ZWAA 2E0IA 2GK6A 2C1EA 3Q7EA 3N7AA 3HCBA 2CL6X 2J3QA 5BW6B 5LM3A 1CUYA 3K1AB 3B9BA 4DG8A 4EELA 3K0FB 3U48A 3OJEA 3BDVA 2D3TA 2JDIA 2WVAA 4AO6A 3IEIA 4A8PA 1WUHS 5JMPA 1YHYA 3CEHA 2I3DA 3DZGA 3NUQA 1NJFA 1P33A 2IXGA 4DXDA 5LYYA 1M83A 4RY8A 1NHWA 3O38A 4PQGA 5FH9A 5A3SA 3ITEA 3GVXA 5K8IA 1FXUA 2QTAA 1ISJA 1OAOA 2NU7B 2PKXA 3HUEA 1JEQA 1Q57A 1GZVA 4IICA 1EIWA 1XVVA 4BQFA 5J1SB 3SIPA 4FWTA 2P9QA 2OAQ1 1Z39A 4KVZA 3R5HA 1P1FA 3LGSA 2C5BA 4E1VA 4U9HS 1UZUA 1JSZA 3FRHA 1XNJA 4S2EA 2WTXA 1EUZA 3EIUA 5GJBA 2OY0A 4PAQA 2N46A 3A4VA 4NYIQ 1FDOA 2EKLA 4AJ2A 5CD1A 5FULA 2PUEA 2WU1A 1GV1A 4KO8A 4Y7CA 3T4PA 1B6GA 3WADA 1D2GA 6CHYA 1TRHA 1PP4A 5AM0A 1GUZA 2GRJA 4EJSB 2R9VA 2C8JA 2YWBA 4ZT5A 3ILHA 3K0KA 3UXHA 2GPTA 3AEUA 3NT5A 2XYPA 2B5OA 4PC7A 4BCBA 1L4EA 5J3JA 4DIBA 4OHYA 2CHGA 2W48A 4A27A 3HGQA 2YWXA 3CX8A 4RD0A 4HRVA 4UHJA 5BO5A 2QWXA 4J3NA 3SOZA 2LCIA 2A1TS 3QITA 3KJQA 3BB4A 3N70A 2BMFA 4FOTA 5BQ3A 4ENRA 1Q3TA 1KZ6A 4HGOA 1NYTA 3QMMA 3FDFA 1CW2B 2W6OA 4KR7A 1E59A 4Y1GA 2RB4A 2X0KA 4D4LA 3VO2A 2ZBQA 1W2WB 3ABSB 1HI9A 4BNZA 1EGHA 3RU2A 1VMAA 2JD2A 4RGYA 3WSWA 2B25A 1O9GA 1SBCA 2BFMA 2Q8QA 3JVIA 4E1AA 3CRRA 4ARAA 5FD8A 1N3LA 2YZGA 3AWIA 4BVHA 3FN4A 2CXPA 1RT9A 1OLSA 3PC4A 4YBRA 4DAEA 4NQRA 2PL3A 4IO0A 4Q4DA 1ADBA 1TYCA 2YWRA 1Z33A 1ZD8A 2R4QA 1M3SA 4L4SA 2JH9A 1JL3A 4CI9A 1LDBA 1QVWA 4JBNA 4XJTA 2ZZNA 2C42A 4P2BA 4PG8A 4ZHQF 1B8UA 3ISVA 4NU0A 2CF6A 5IS2A 4WKNA 1C3CA 1P7PA 1I01A 4KO3S 4WMLA 5FTMA 4DC1A 2Z8ZA 4QGBA 2H00A 4PTYA 5CB4A 2GEJA 1U2TA 1H6CA 2HPAA 3BEOA 3I23A 3QKTA 1WCWA 2GSDA 4RY2A 1JR2A 1WXQA 4H7JA 4QGAA 3EEFA 3IAXA 2OXFA