4L6CA

Crystal structure of human mitochondrial deoxyribonucleotidase in complex with the inhibitor pib-t
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
201
structure length
201
Chain Sequence
SNAASGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase, mitochondrial
publication title Conformationally constrained nucleoside phosphonic acids - potent inhibitors of human mitochondrial and cytosolic 5'(3')-nucleotidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 67
structure length 201
sequence length 201
ec nomenclature ec 3.1.3.-:
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4l6cA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4l6cA01
2FDRA 4Y2SA 4G63A 4GIBA 4KYTA 4Y2JA 5AI0A 5ALPA 4CNQA 4B6JA 2GMWA 2B30A 2C8LA 5IT4A 4UU0A 2HI0A 2Q5EA 2RAVA 1Z88A 3R09A 1FEZA 1RQNA 1YNSA 3QUQA 2FPSA 3E58A 2HF2A 3I76A 3NIWA 4E88A 2BDUA 2HOQA 4F72A 2G07A 4L6CA 3KDPA 4NV0A 3S6JA 3WKAA 3MPOA 1ZS9A 3DDHA 1WPGA 4OCZA 3QX7A 1EK2A 3RFUA 2AGVA 2YFYA 4YIHA 5ALTA 4AS3A 3W5BA 4HAIA 3OCXA 3NUQA 1NRWA 3SLRA 4EZEA 1QQ7A 3ZX4A 3QNMA 2RB5A 3ZVNA 2EAUA 2ZXEA 3KOOA 3DNPA 5AKJA 3ZW7A 3W5AA 2PKEA 1YS9A 4YCMA 4BX3A 3SMVA 5IS2A 4HGQA 5AVYA 5AVSA 2QYHA 3L1UA 2IOFK 2IOHA 4H1WA 1QYIA 3KZXA 3N8GA 4FYPA 5JJBA 5AI8A 4JB3A 3AR7A 3HYCA 4UAVA 4CF5A 2ZBEA 1IWOA 2G08A 1SWWA 1AQ6A 4ZEWA 3NASA 1Z5UA 4HGOA 2VKQA 5T41A 1F5SA 4YCNA 2YMMA 3SHQA 4XE5A 2JGAA 2NYVA 1X42A 3L8FA 2OYCA 3F9RA 5ALXA 5AVWA 4UM7A 4Y3UA 3ZVLA 2YMQA 3E84A 2GFHA 2DQSA 3UMGA 4FFDA 2G80A 2YJ4A 4NAVA 4F71A 3MC1A 4C4RA 3KC2A 3I6BA 5FP0A 1N9KA 3DV9A 4BX0A 5AVTA 4EENA 2YBDA 1LVHA 3QUCA 3WK9A 1N8NA 1Z4OA 3TLMA 3EF0A 3ET5A 4ZEVA 3QU7A 3WK5A 3RF6A 2HCFA 1ZJJA 2ZOSA 5AM4A 1RDFA 3KBBA 2B8JA 1CQZA 5AKYA 3WK4A 4DWOA 3U7HB 2ZG6A 5ALVA 1Z4MA 3L8GA 4PNHA 4KNVA 2EATA 4NWIA 3AR6A 1TE2A 1L7OA 3N1UA 4Y2TA 3AR4A 4RESA 4UMVA 1PW5A 5AW5A 4QQFA 1J8DA 5AKIA 1YJ5A 4UARA 2GHTA 2CFSA 5AW2A 5AM2A 4AP9A 3L1VA 3QUBA 5ALFA 3K1ZA 2YMLA 2ZBGA 1Z4LA 4ZEXA 2FUEA 1ZRNA 1YV9A 5ALJA 1NF2A 3ET4A 3ZX5A 5IT0A 2FPUA 5AKZA 4XPZA 3ZVMA 5AK5A 2WF9A 3UMCA 4UMDA 2IA5A 2RBKA 2R8ZA 3QUTA 2P69A 4UW9A 5ALDA 5AVVA 2GO7A 2WF5A 2CN1A 2OA0A 3WKDA 2B8EA 2MSNA 2G0AA 3I1YA 3FZQA 1ZD4A 5AI5A 2FPXA 4YIKA 1YMQA 4HGNA 2I54A 4Y2QA 3WKEA 3IJ5A 5AW3A 1WVIA 5ALEA 4YH1A 5ALUA 3E8MA 1Z4KA 5AM3A 2NO5A 1Z4PX 3OCWA 4Y2UA 3E81A 4I9FA 4UMFA 5AVRA 4YGYA 2P9JA 5A3SA 1RMTA 3B9BA 4L6AA 3L0CA 3L7YA 5ALIA 5AVQA 4BEWA 3QU2A 4HGPA 4BYGA 3UM9A 4J03A 5AKHA 4NABA 1LTQA 2RARA 5AW6A 3WK8A 3QU9A 2I7DA 3IRUA 2R8YA 1EK1A 4UMEA 1JUDA 5ALSA 2CFRA 2WHEA 1K1EA 2OM6A 4KX5A 1RMYA 5AK6A 1MH9A 1ZD3A 3ZI4A 2C4NA 2QLTA 3L8HA 5E0OA 2C8KA 3WGUA 3CNHA 3PDWA 2O2XA 5AK3A 2G1AA 5A3QA 4AS2A 3NAMA 2HEGA 1L7NA 3CZ4A 5AKXA 2IYEA 5A3RA 5AVXA 2X4DA 1Z4IA 1Z4QA 1TA0A 2PR7A 4CF4A 3R9KA 5AI6A 3KD3A 3L0YA 3U7GA 5ALZA 3OCZA 2ZBFA 4CF3A 3ED5A 1RLTA 2JAOA 5ALRA 2WF8A 2I33A 3OCYA 4EX6A 1T5TA 2GHQA 5AICA 3WK6A 1U2TA 3N5KA 4JDPA 1T5SA 3NRJA 2FUCA 4OFZA 1QQ5A 3L8EA 4J2TA 2I6XA 5AM0A 1L7PA 1TJ3A 3OPXA 5ALKA 4KN8A 1VFPA 1YDFA 1RKVA 2HO4A 3EF1A 1L6RA 5AESA 1T9ZA 3A1CA 5ALYA 1O08A 3SKYA 3SKXA 3N28A 4EEKA 1TJ5A 5AI4A 2HX1A 3M1YA 3U13A 5ALNA 2HDOA 3SD7A 1NNLA 1Y8AA 1Q92A 3MMZA 2WF7A 2YY6A 3HLTA 4QJBA 1XP5A 1Z4NA 1RRCA 2PQ0A 3PGVA 1XPJA 3U7FB 2R8EA 3AR8A 4C4SA 2FI1A 4UATA 1VJ5A 5ALLA 3AR9A 3ZUPA 2C9MA 4I9GA 3ZTYA 1U02A 4EX7A 3NANA 3QU4A 5AKEA 3ZTWA 2G06A 3AR5A 5AHXA 1RMQA 1Q91A 3ZU6A 2W4MA 2P11A 2MU1A 5ALGA 3OCUA 1ZD2P 5ALMA 2YN4A 4Y2PA 2D2VA 1QH9A 3IB6A 5AW1A 2P27A 2YJ5A 3QGMA 5AVUA 3J7TA 5AM5A 5AIBA 1CR6A 3L5KA 4XQ0A 2YJ3A 3OTQA 4BNDA 3W5DA 5AW4A 2B82A 1U7PA 4O8CA 3FVVA 3FM9A 2OBBA 3I28A 4DFDA 3L0BA 1RQLA 3W5CA 3ESRA 3P96A 5AI9A 3QYPA 1XVIA 3BA6A 4Y2XA 2YMPA 4RETA 3FPBA 3A1EA 2AUTA 3SF0A 1TJ4A 3N07A 1WZCA 3WKBA 2O9JA 5ALQA 3M9LA 4UASA 3ONNA 2WF6A 4Y2YA 4BEVA 3A3YA 2JAUA 2CFTA 2ODAA 4DW8A 2W43A 2JAWA 3D6JA 4IFTA 5AKLA 5AVZA 2HF7A 4NFLA 2WM8A 4BKMA 5ALOA 4HGRA 4CE6A 4OHFA 4UM5A 2ZBDA 4IG4A 3MN1A 2AH5A 1RPZA 2G09A 3EWIA 1S8OA 2I55A 2C88A 3AR2A 3GYGA 4BX2A 3ZWKA 5AW0A 3U26A 1O03A 3R4CA 4C4TA 4EELA 3OCVA 1RLMA 2EARA 1Z4JA 5ALWA 2B1QA 3BWVA 3B8EA 2NO4A 4DCCA 4XOUA 4HYTA 1U2SA 4KX3A 3QU5A 2BY4A 1ZRMA 4YCLA 4MWOA 3PCTA 3UMBA 1SWVA 2BDEA 3AR3A 4G9BA 1U7OA 2YJ6A 1J97A 4UAUA 3FGOA 4KNWA 3DAOA 4L57A 1WR8A 4GXTA 3WK7A 3QXGA 5AM1A 1Z5GA 1RC8A 4Y2RA 1L8OA 1KYTA 3U7EB 1VJRA 4FE3A 4Y2VA 1RLOA 5AW8A 2AMYA 2FPRA 2W11A 3VAYA 3ZWDA 1ZOLA 2FPWA 1L7MA 5AIAA 3B9RA 2HHLA 2FEAA 1RKQA 2Q4TA 4BNDB 4UU1A 2HSZA 2R8XA 5AW9A 2Q4RA 3PGLA 3FPSA 4MUMA 2IOFA 2JARA 1ZD5A 3A1DA 1L8LA 5AK4A 4BBJA 1SU4A 3NALA 2B1RA 3ESQA 3EPRA 4OD0A 5AW7A 2B0CA 3WGVA 5AKKA 5AKGA 1S2OA 1QQ6A 2WFAA 2I34A 3U19A 3WKCA 5ALHA 1RKUA 3QLEA
chains in the Genus database with same CATH superfamily
4RIFA 4TLEA 4XD7A 3IMEA 4YMIA 4I55A 3QEMA 4Y2SA 2AG0A 1QAOA 4YRIA 5B6PA 1T10A 4EQ6B 3R75A 4M60A 4HDKB 4B6JA 2GMWA 2ZUCA 3O94A 1LLCA 2QDKA 1XQWA 3C2QA 5KSYA 3K0FB 1R4NA 5JNSA 3ICQB 3PNPA 4Q6WA 4YBRA 3MWKA 4N40A 5F33A 5HW2A 2RK6A 2WWGA 4P6VF 5GZ3A 2BH2A 4MI9A 3R9XA 4DXHA 3TZCA 2AX3A 3RS9A 1G3MA 2BFCA 4KK4A 1GG5A 2HF2A 4JJGA 4MR8A 1CY4A 5FWXA 1AO0A 3URKA 1Z82A 2P6RA 3BH7A 4BQRA 1YHYA 4L5CA 1FUUA 4RHTA 3E9EA 2WU8A 3W2FA 1QANA 5IJWA 1QVAA 2OZEA 3CINA 3KTOA 4FXPA 1AN0A 1EFHA 2W6OA 5C1DA 5F7OA 3DEAA 4M8KA 2H57A 1ZMXA 2V58A 3AQIA 2VN8A 2J6IA 1Q7CA 2BFNA 3H8WA 4NESA 5GONB 3VNRA 4ZTBA 3EWAA 2EIHA 1AK9A 5GQSA 4M7WA 4HMOA 5SZHB 2JLWA 5IN5A 4L95C 4TYYA 1GM5A 1L4KA 1SOUA 1TK2A 2I7VA 1FMJA 2CHGA 3WL3A 3VPBA 1SVNA 1FUPA 3AK4A 4X3PA 3T7SA 3WLQA 1G7SA 1QYCA 2DETA 2WG0A 4XVRA 4EJMA 1GNQA 4WJKB 2NN3C 3L6DA 4R71A 4IDGA 2DVMA 2D54A 3NTVA 3ADBA 1SVUA 3DWIA 5JAUA 3OQJA 5KC8A 1A4XA 3H4IA 3MELA 2WB2A 3DQPA 5E7JA 3MUNA 3VISA 5AVYA 5I4IA 5K5EA 1M2OB 4S2EA 4J91A 3TXYA 3DTVD 3NEJA 1W76A 3CMMA 4ETNA 1A4IA 3BYZA 5JJBA 1UBFA 3DMRA 4V0OA 2CFIA 4GMGA 3E7WA 2O5EA 1G7RA 1M9NA 1VJDA 5JHGB 1J8FA 4UEKA 1K8YB 3N0TA 1DC6A 5JI3E 1RE0A 4HGOA 3F1KA 5IKEA 1FFDA 1GUAA 4B4OA 1JAZA 1LC0A 2RB4A 1U0GA 3TI9A 3HP7A 1ZN7A 5K0SA 3F9RA 1FDWA 3Q72A 3WJ2A 2UZ1A 1E5LA 4AM8A 2AI1A 2UVPA 1M8KA 2PD4A 3CT4A 3QOYA 4Y3UA 1FYDA 5FBHA 5JSKA 5BURA 2WUVA 4P34A 3TZ6A 2ZRFA 3PTAA 1DUVG 3FB1A 5FOXA 5KYNA 4F96A 1NRXA 2QMEA 3HN2A 4H7JA 3L79A 4R3UC 1MRSA 2B20A 3OZBA 4FEEA 1TF7A 1E0JA 4MRMB 4MW6A 2EJBA 4YQZA 4B73A 3SFTA 4OXIA 1R12A 2VUSA 1OFGA 1N5KA 1PFGA 1SUSA 2M2IA 2X40A 2WU1A 1B6TA 3N8DA 1HFWA 1QC5B 2IELA 3GZ4A 2RHLA 2WA2A 5HRUA 2ZAMA 1B7GO 4YUVA 3KPJA 2H7CA 1Y5NA 2FP4B 1GWNA 3PV0A 1N92A 2PZFA 1NN5A 1CUGA 1AHIA 3SIXA 3B5JA 2GH1A 2GZAA 3QU7A 4R6WA 4ME6A 4UVHA 5ECWA 4FYYA 4WJZA 2VHZA 5DWQA 1N75A 3TXXA 3WMRA 2OG2A 1FUYB 4IIJA 3N3AC 1NLYA 1IIBA 1TFUA 4QHSA 3WGHA 1EVEA 4G5SA 3NTRA 2J9FB 2QZSA 1VPDA 1N6OA 2GXUA 4I5EA 4IP0A 4PLHA 3J81k 4CMJA 3LO8A 5K4AA 2GBPA 3JVEA 1IXYA 5SZIA 4EB8A 2ZIUB 4NDZA 5GONF 2G5CA 5TSDA 4FXOA 2BGIA 5AW5A 4TMFA 4X20A 1KEVA 2C2YA 5ALVA 5ADWA 1QVRA 1ESEA 2P7HA 2HO5A 1XZFA 4LPSA 4IIDA 1RNLA 2H1HA 1A72A 2X8BA 3G85A 3V80A 4BFLA 3WQBA 3H42B 1WSAA 2O0LA 4U5QA 2OFFA 5KZMB 1E9VA 5DOVA 3FIJA 2RHJA 4YPOA 1QIDA 3N76A 5ALJA 1ADBA 2HDWA 4YT2A 3ICOA 2XMRA 2Q28A 3TOXA 1PFKA 1BU5A 2JFBA 5AK5A 2CD9A 4QXPA 3UAXA 2HA5A 3DT8A 2FZKA 1NAHA 3SSOA 1JR3E 3GOQA 4KQJA 4N39A 5T7BA 4XJXA 1QU2A 1M7GA 3CHYA 4BP3A 1ZR2A 1H69A 2ZRKA 2NT3A 4AW9A 2A6PA 4G37A 621PA 5JLJA 4BO4A 3ZWPA 1TJ7A 1DIOB 1R6UA 1JDBC 2XV1A 4D3ZA 4KSBA 4RA6A 4EYSA 3BQNB 3FTCA 3PFGA 4CM7A 3HMKA 2XTJA 5BW5A 1NVAA 5M04A 5DIFA 1NAIA 6PFKA 4F5ZA 1BEEA 3WHKA 3LQQA 4AJPA 3WLKX 3G8CA 2O48X 3E8MA 4MRRA 4B2YA 2X8WA 4MYHA 4LV8B 4JC5A 4WOBA 2Q4BA 1XEWX 1ZZEA 3G89A 3QLUC 1ZBQA 4WEQA 4YFVA 3UXMA 3ZWXA 1G5FA 1GUZA 1ODCA 1GIAA 1YQTA 2IYVA 3H2HA 3OURA 4LXQA 5DEIA 3WIOA 3CA8A 2ZM6B 3O90A 3OHSX 3ORHA 3ZZTA 3VDRA 4DQ0A 3O4HA 3U81A 2P41A 3A6FA 3LT2A 1C30A 3NGMA 4EP1A 4R8LA 3PNVA 4CEJA 3UM9A 1JKMA 2DT5A 2QMOA 4I6JA 4ASUA 2G1UA 3QU9A 4HDMB 2ORVA 5IX8A 1BNCA 1KRHA 2BISA 2Z9DA 3D64A 4QOGA 3UJ7A 1WKVA 4DDMA 1K1EA 1YB6A 3A2MA 3LQ2A 4DQLA 4NS4A 2PL9A 2FZ4A 1EH5A 3UICA 1V2GA 2H29A 1MX9A 2B92A 2O06A 2R86A 3RS3A 4MUJA 3RS2A 3WGUA 4OX9B 2EERA 1IRXA 3HXMA 4KH1A 2VRWA 3A4IA 1WPXA 4GLBA 5JFOA 1QZUA 2GDZA 2QT0A 3O9MA 2G1AA 4O4HB 2HA0A 4WECA 2AT1A 3RBZA 2GBGA 1FP4A 1M6WA 2Z1DA 4PZCA 3SJAA 3AY6A 4AP6A 4LTDA 1NMXA 1T2DA 4UAGA 2PDAA 3M6FA 4O0LA 3EPJA 1IJEA 2O4CA 2PJUA 4IRMA 2J87A 2PSHA 3B9PA 3IPAA 3D8NA 4I3FA 1ESCA 1JTVA 1USVA 2WMYA 3A58B 5CXSA 1V9SA 4YRFA 5JH7B 4BV9A 3WGIA 3ZVKA 1DOAA 4J0QA 1C14A 4MRVA 1WEKA 1PT6A 2GKSA 2C3MA 4HCJA 4UE2A 4BQOA 4WGFA 1B1CA 2W2LD 1N32B 3W3ZB 1PQ4A 2RI0A 2IS1A 3L40A 3DEYX 5EXDA 1U63A 1QQ5A 4UHFA 3VVBA 4WX2B 3D31A 1FOEB 3WR5A 3L7DA 2GN8A 5IK2A 1KJQA 3ETLA 3PQCA 4KGXA 4MITA 4PPQA 2XF8A 3NBYC 2ATCA 4DARA 5I4CA 4IGAA 1M0EA 1V2HE 1GA6A 4NEGA 4R1LA 5CGZA 3PXEA 4BJ1A 3R4VA 2HXSA 1C1HA 3B3FA 3EN0A 4KE7A 4NJMA 5F2OA 3W78A 2OUIA 4IINA 5JS1A 2H54A 3GRFA 4QYIA 2WHPB 4CIVA 4FOLA 4CM8B 1V45E 3GIDA 3SD7A 5C0OE 1HC7A 1A5BB 1NNLA 1ZCJA 1KJYA 5EIWA 3M33A 1Z39A 5DLEA 1PUIA 4X6LA 2PUDA 2G28A 3COPA 4MUKA 1I9GA 1BFUA 4HDRB 4ETIA 1M8FA 3MIZA 4L73A 2C7BA 3VPSA 3REQB 3UAYA 4C88A 5JJCA 1WLYA 1NPYA 4HYYA 5MN6A 1WUJS 2GZMA 1KARA 4GRIA 5DCLA 5JS2A 1CEQA 2QD2A 3K6JA 1U80A 3H7IA 4HDSA 3F90A 3SEZA 3MGAA 4N18A 3TTWA 1WPQA 1OIWA 2OHFA 4YT5A 4CL3A 1UFRA 3V5NA 3L6UA 3D2CA 2N9UA 4LJ7A 1OXBB 1Z63A 5B4VA 3JAKB 4ZN6A 4DYDA 3RRPA 4KQFA 1U2EA 2EGUA 2X22A 2C96A 3BXEA 3N53A 4EG6A 5IAJA 3TNDA 1U2DC 1SZJG 1FXSA 4G6ZA 4JVLA 2XVYA 3LOUA 3M1AA 2IUYA 3HU3A 3GN2A 3ITDA 1PJLA 2MU1A 4NYIQ 1C8KA 5I7WA 4MUGA 2XUDA 4UHKA 3OCUA 2BGGA 2GHRA 3ZGYA 1LPSA 3VC1A 3A2KA 2BGNA 3ZLVA 1VE3A 1WABA 2NW6A 1J5EB 4F21A 1S5PA 4U1RA 3G2HA 1OFIA 1JFFA 1OLSB 4K1XA 1L1RA 1JA1A 1L4BA 3DOOA 5AJVB 2HDNB 1T0HB 2R5FA 5KOJB 1CR6A 1XJWA 2BZGA 3JPWA 3WFIA 4C08A 3A36A 1N0UA 5BN4B 5JW6A 5IDWA 2FZ5A 1T2UA 2DKOA 3WI7A 2ZUSA 1A7JA 2CNLA 1EX9A 5JH7F 2Q1WA 3KQTA 4FWIB 3UJNA 3QE4A 3KQYA 2A0XA 5K3CA 1FFYA 3TL3A 3PXCX 3HN6A 4FR0A 3IP3A 4XFDA 2XYPA 3B6KA 2QN2A 3H99A 2O3RA 2DE0X 3AJ8A 4CUKA 4ESHA 2HU2A 1G6KA 1Z75A 1CRWG 1F8GA 5FBQB 4HD8A 1E4EA 3DEZA 2R11A 4PHHA 5B3AA 4DLAA 5T67A 5EJEA 1R5OA 2FK8A 4RJ2A 1Y7IA 3OI7A 1N3YA 1C9EA 4RHXA 1AXEA 2A0KA 3AX6A 5TMBA 3P5BA 4NCAA 3DBIA 1AG9A 3ZE6A 5SY9A 5COAA 2OHIA 2PYIA 1LV7A 1B14A 3HGTA 2IY8A 2I7CA 3L8YA 5MHTA 1M34B 5BUCA 3P9YA 1EP3B 2JIQA 4WW0A 4TS4A 1PFQA 5H82A 4ADSG 2BMEA 1B0UA 1PN3A 3MMSA 3V1NA 2Y2VA 3ORSA 2JFOA 2ZRPA 3CH5A 3TUJC 5KNBD 2FLWA 4XWWA 3VNUA 1Q1ZA 5CM8B 2CE2X 1FXUA 3DG9A 2O7VA 1XTRA 4ZGGA 5FR1A 5K09A 5K3OA 1V6SA 3EFEA 1KPGA 3M6AA 3CEPB 1SCIA 3AIIA 1CPYA 1A50B 2JFGA 4RF2A 5KVQA 1JLRA 4F3KA 2PR2A 1E7WA 4R41A 4AN1A 1JG1A 3VI4B 3NNDA 2LGJA 3M5CA 2JJQA 4I1IA 3CEAA 1ZMBA 5LQUA 1DHTA 1KZYC 1XU4A 4FKMA 1YKGA 3PRHA 5CXQA 3P0RA 3H2ZA 6REQB 3TJZA 5AW0A 4ZVQA 3NORA 1I9CA 3NEPX 4X7RA 5EJMA 5DP1A 3R4CA 2GLTA 3E2IA 1GPLA 3KZOA 3COVA 3OCVA 4CMHA 1R2QA 2RJNA 5K8TA 3ZLJA 1MB9A 1G9TA 4KWHA 1S2NA 2NO4A 2CVPA 3AY3A 2JGMA 5K8VA 4YCAA 4X5OA 3UAZA 1JSCA 2KHZA 2E49A 3MJDA 2H0AA 1F9EA 1KZ9A 3FI9A 4EUNA 3HDJA 1JJVA 3AINA 1QE0A 4FSHA 4KVZA 3THYA 4OIMA 2XQVA 3DEHA 5EE0A 2COKA 1Q7BA 3CSDA 3FPKA 2ZJ0A 2XUGA 1YS6A 4AKSA 4H7PA 3PTLA 2SBTA 4G2NA 1ADYA 4KL8S 2PE5A 4X1YB 4XSHA 2Z43A 5E6RB 3DKRA 5EMJA 3LVFO 2C5HA 4DMKA 1VI5A 1LPBB 3CLTD 2PUEA 2WAAA 4MWCA 4YI3A 2D13A 4EHIA 1L8OA 4Z53A 1UMBA 3O0DA 2FMXA 2KBFA 1JHAA 1QKKA 2OFWA 3CVJA 4Y2VA 4Y7CA 3N9IA 3E03A 3V1TC 4BNLA 5JAPA 4K2HA 1KZ6A 3V4SA 3LCVB 3AEUB 3DM5A 1M1YB 2LVBA 2H06A 3IT0A 2FSGA 2MINA 3N8HA 3C24A 4LXYA 5ANRB 4MROA 4KAJA 2ZIFA 1JX6A 4DBZA 1JXQA 3MWEA 1V11B 1IXSB 2FEAA 2EG9A 2GCOB 2IU4A 2FKAA 3IMKA 2JCSA 2XA2A 3DYIA 3NC0C 1I1NA 3TNLA 4B3BA 3LTNC 2CW5A 5LDDC 5BMVB 3K2BA 3AQ4A 3A1DA 3BK1A 1NJ6A 3V2GA 4X8MA 1A04A 1XWOA 4KGZA 4P3NA 4XX0B 2FNAA 3M5WA 4H4DA 2YYZA 4MV6A 1TFRA 2QS9A 1CZKA 3ID6C 4D57A 3BFJA 3MGCA 5G3YA 3TZEA 2X4GA 2VL7A 2K2QB 3EEQA 3HB4X 3HZHA 3QHAA 4K9RA 3E70C 3RS5A 1Y4UA 1B4DA 1VCOA 2OP1A 1ACJA 2IZ5A 2QK4A 3EPLA 1Z0ZA 3LA8A 3U48A 2ZSDA 2I34A 2DTDA 2HY7A 1E0DA 2QN9A 4GPD1 4FLMA 3ZGLA 1OPXA 3F6BX 3K6SB 2PMWB 3O3OB 4Z9FA 4QGFA 5BWCA 4ETMA 1E60A 2VEOA 3BERA 1E9CA 3EJ6A 3Q7SA 1G3UA 5L3QB 5H8WA 1DOZA 2IW1A 3IVCA 4KYTA 4Q7QA 4IDOA 3OBBA 5CDTA 3HYRA 4CNQA 3WYEA 1A5SB 3OECA 1ACMA 1EE9A 1N2EA 2IXFA 2VIIA 3T38A 1RRFA 3D3WA 4OH1A 1O6BA 1ORWA 2PFSA 3KYDA 3OE7A 4MS4A 4UQOA 3WOVA 1LK5A 2Q9BA 1MB3A 4M1QA 3DTYA 1FEZA 4IR7A 3ZE0B 4E2WA 1E96A 4P1ZA 1LXCA 1Q95A 3HJBA 2HZ7A 3U17A 2J1LA 4XR4A 4ZYYA 1P2BA 1C50A 4TWJA 5B1EA 2ZT5A 2NSLA 4LWPA 2PCLA 3LYAA 4PPYA 4RFVA 1W2GA 3AY0A 4KXQA 1REQB 1MPXA 2C29D 4AF8A 4N0EA 3K9LA 4JB2A 4MO2A 3TRIA 1YZGA 2QAJA 5AXDA 3WKAA 4ER5A 4NF2A 1D1SA 4TTSA 2X4LA 3ZYZA 3BTUA 1L8QA 1XDDA 2GRUA 3B89A 1QIMA 4N5MA 1DBQA 3RFUA 1L2TA 1UP6A 2C97A 2JLXA 1XZIA 1FDIA 4Y6LA 3JYOA 4NQZA 1SVIA 3CKMA 3DNMA 1PFUA 2ZVDA 1H5UA 2GZSA 2VHXA 4TL9A 3O73A 5K2OA 4KZKA 1PS9A 3PUYA 3DFIA 4KXFB 2JIPA 3O91A 1IEQA 3QX3A 2QPLA 1FVHA 3THWA 4GFDA 3LL4A 4FC7A 1IE3A 1FNMA 3D1LA 1RWMA 1XZKA 2XCUA 4GC9A 2WWIA 3NJ4A 4MLCA 4MWEA 2NLOA 2QW0X 3OFJA 5GVSA 2YWRA 2ZBUA 2AFIA 4HGQA 1Z7YA 4I50A 3QIVA 2H31A 4BVLA 2QTHA 5K0NA 4P33A 3GDOA 4MS1B 3GR6A 3LT5A 1CQPA 3GFSA 3DBOB 1QYIA 3MINA 5HZGA 4Z3OA 3L8CA 3NBKA 4RADA 1IOWA 1L5VA 2WIGA 3BKWA 3EDRA 4BOYA 3VDXA 5BMVF 5K6RA 2A0YA 3S2GA 1U9JA 4RVDA 2HA2A 3DO8A 3CEJA 3M1LA 1EUZA 3AHCA 1Z5UA 2UUOA 1VL6A 1ZL0A 3D2LA 4UREA 2WIKA 5T41A 1FLDA 1YS4A 2HRQA 2P5UA 4D96A 1DAKA 4WCDA 2VWHA 1VFNA 3KWFA 3ZGXA 4YP5A 5EZQA 2GN4A 5J59A 3ZBQA 5J43A 4P2BA 4C0JA 4M0KA 3DBRA 2ZU0C 4ML3A 3FETA 3ODPA 5EY5B 3VPHA 3HDYA 3W3AH 1G98A 4K5QA 5EMLA 3ZR4B 2HQSA 4L85A 1JG4A 3UMGA 2JKZA 3MTQA 3CUUA 4FFWA 3S2ZA 5JU6A 1IUKA 3GFQA 3IT2A 3MLBA 3SC3A 1NNI1 4TRNA 5KTOA 4AB1A 4G0XA 2LKDA 1N9KA 2G9NA 4AIIA 2I2WA 3DA8A 4BX0A 4G9GA 1RACA 2AB0A 1C0LA 1LVHA 5FCDA 2I62A 3IKLA 1K6IA 2W2MA 3PPXA 5TQJA 3ETHA 1QF9A 3R6LA 2JFWA 4EGAA 5C8YA 2Q1TA 4EG8A 2BFWA 4OI2A 4DC0A 4GS5A 3TDNA 1DBSA 2Y27A 1BGXT 3CJQA 3Q3CA 2PRYA 1RZ3A 1GO2A 1T1EA 4DMGA 5H9VA 3UXYA 5HTOA 1CRQA 1NVMB 1UBUS 2GJ8A 3DPUA 2IGBA 3GEEA 2QVLA 1C1YA 2ZYHA 3LBNA 3GMIA 4PNPA 5BWBA 4GMXA 3LZDA 4MB6A 4BASA 4XQ9A 4PZLA 1X3LA 4L22A 2NXJA 3PUXA 3KKKA 3TE6A 2H2AA 3DBLB 1LQ2A 1U3UA 5JAHA 2PSEA 5J9FA 2X3YA 3T7AA 1Z8HA 5FTJA 2ZREA 1YF3A 1CVLA 3BA1A 1HLDA 1MQ9A 1PJSA 4JJKA 4DMRA 5AW2A 2N47A 1FK8A 1RWXA 3LX8A 3P9RA 4ZXFA 4BVAA 4CQMD 2Y92A 2WR8A 1VGVA 5EPUA 2N1MA 4RQBA 2Q49A 1K63A 4B4DA 1Z4LA 3KPWA 1E5QA 2P75A 1L4NA 3FDFA 1TMYA 1JDPA 1NUAA 2XD9A 1QIHA 1WPRA 4LJRA 1OU0A 2XCIA 2X2EA 4ZVMA 3VSBA 2BMFA 1X1BA 3ZVMA 4LGMA 4TLBA 3MS4A 3NR2A 1FTWA 1OE0A 3ACBA 3DE7X 3NXSA 3Q2KA 3VKVA 2JLUA 1ZLXA 4HS9A 5ALDA 3KTAB 4HGYA 9ATCA 5KTMA 4H1UA 3MTBA 3A8TA 4X24A 1OXSC 5F91A 1N5OX 2ODBA 1XEAA 4HAWA 1HDEA 4GLFA 4CVNA 5JMTA 1H9BA 4TKLA 3KQPA 1BD3A 2YIJA 4Z2AA 1WU8A 1MOQA 4QHYA 4S1VA 3S40A 4F6RB 4DJJA 1NOKA 3BS4A 1TC1A 4GMDA 4Y9RA 4NDNE 1GKUB 1P8JA 4KFRA 4C4YA 1VE5A 3A25A 3G0CA 3CVWA 2J08A 2QJFA 3LK6A 5CT4A 5ALUA 3VKFA 5UKDA 2OV1A 2FXIA 4YJGA 3GJQA 1Q44A 5JXHA 3B1VA 4HAUA 3T7RA 1X1QA 1KMQA 1GY8A 4UPEA 1QF6A 3B1FA 2VJPA 3D7KA 4LDAA 3ROMA 1BXGA 2BAGA 1KS9A 1CWUA 3F1LA 3TRKA 1X3SA 2E82A 2QVYX 4A91A 2PTHA 3DV0B 4HHEA 1PEAA 4AZ0B 4WESA 2Q46A 3H8JA 2JNWA 4L6AA 1PEDA 2ODTX 2HNBA 1YJBA 5CCBA 1GNLA 1ZM7A 3QU2A 4UD2A 3WGOA 1GUFA 2ZR7A 3F46A 4NABA 3DLHA 3WICA 2CJWB 2DJIA 3LUHA 3Q88A 1ISMA 4P53A 1C3JA 1RP7A 1DCNA 2FSSA 2PKYX 3W5VA 4JQSA 1X1SA 3ANTA 3G88A 3WG9A 4EUFA 3O2JA 4JBXA 1DQSA 1FDTA 1Z17A 4FP9A 1E0AA 2L82A 2WSLA 4H0NA 4E2XA 3EMBA 2WILA 4W6ZA 1E3QA 3RGGA 3QG5A 4RKRA 5DGXA 1EJBA 1U8YA 3V9AA 4D3FA 1JGTA 1BVUA 2ZB3A 1BQ3A 2ZB4A 3EZ6A 5CX1A 3W9SA 3KS9A 4TXJA 4B35A 1TMKA 4RABA 1DAOA 3EQZA 4BFTA 2H4HA 2ZIVB 1SXIA 1ZRHA 1YB4A 3ZJYA 3B78A 1C0KA 1QH8A 3C3AA 3LGXA 3FDJA 4HR7A 3MHTA 1NYQA 1E79A 1G3QA 1L7NA 5TT0A 5TXGA 4ARZB 1Q50A 2E4UA 3GRZA 4UDOA 3ZBTA 1D9XA 4EUEA 4MIKA 2LZ0A 1U28C 1Y8CA 4R5MA 3LT1A 4OLFA 1VRWA 1D3AA 3TR5A 4C03A 4DTIA 1GLNA 2ECPA 1RTKA 5AI6A 3W77A 3NBFA 4NDAA 2PKQO 3U7GA 4GOLD 1QYRA 4KQ1A 1USGA 3IEPA 3OCZA 1C9DB 1GZ4A 5EXXA 2QGFA 1C9MA 4GNRA 2RAUA 4EX6A 5IMBA 5AICA 3FRHA 5LDHA 2O5CA 1NX6A 3B1YA 5IC5A 2CC2A 1T5SA 1HG1A 2XIQA 2ZB7A 1M5UA 1L7PA 3HJGA 2YV3A 4OV6B 4CHGA 6CHYA 1NA5A 5B58C 3Q9NA 4UULA 3WGKA 2UYYA 3OOEA 3TEMA 2R47A 4W9MC 2YNMD 1PR4A 2ZI5A 4G89A 2X9NA 5KYYB 1TDJA 2CXTA 3I9OA 4JR0A 4H7FA 1I3LA 4H16A 4OQPA 2JG3A 4F06A 4WPGA 1L5GB 4C5AA 1BTOA 4ZAZA 3SX0A 1FX0B 1Y4AE 2ZZKA 1XD2B 4V0NA 2QE6A 3QEOA 4FDTA 2AR7A 1NYLA 3I12A 3GYBA 4OFWA 4XIYA 1Y7PA 2QX4A 2V5UA 1G64A 4JASB 2Z98A 3SC4A 2DPLA 5BRJA 3MMZA 3PEFA 3ZE1B 4ZGWA 3PRYA 1SQ0A 1N2GA 3OQ1A 4QJBA 2F43A 2PZMA 3R6DA 3A1UA 2E55A 3DHEA 3RBAA 2BTQA 3RUFA 2I91A 1UJ2A 1JBEA 4IO0A 1KO4A 2Q2WA 5DJ5A 1OB2A 3O1HB 1JALA 5EHXA 2Q9UA 4A0FA 2WWHA 3U7FB 3GB9A 2WIBA 3D0OA 1AHPA 3T54A 4ZHQB 1B8VA 5BQ5A 2K7FA 3K71B 4Q01A 3J80A 3KL2A 3F78A 4GZ5A 2BM9A 3ZGVA 1U2ZA 1WM1A 3I1JA 1GPMA 3IEKA 1PWZA 5FNZA 4KV7A 4YC7A 4EMUA 5AOBA 1HA3A 2ZRAA 5E6UB 3KLMX 4EX7A 2ETXA 3DJFA 4NV3A 3G13A 5FLYA 4XYMA 2CZQA 2CMFA 3V6LA 5DX0A 1U3DA 4D3YA 4ZJPA 2ATXA 3ZDBA 4MA4A 1XTIA 2G06A 5AHXA 1B8PA 3PHHA 2AOUB 3CLVA 4EG5A 1KQFA 1BX1A 4RQAA 1AUQA 4IV0A 1XC7A 2XYGA 3P0JA 2XWSA 3CNEA 1WSWA 4Q4LA 1CR0A 2P6NA 3ZU6A 1XWIA 3COJA 4PSUA 5AVZA 2CZGA 3PCRB 1N25A 2AEFA 8ABPA 2VPYA 3DZCA 2Z3WA 3WSTA 3P71T 1PJ8A 3C14C 3FGNA 5DNAA 4OI1A 3IA2A 1NFQA 3IUMA 4OUDA 3DEJA 3H11B 1IHPA 1YH3A 3UA3A 3UKDA 4GF5A 2WZCA 4RTRA 1UMCB 2P78A 3KP1A 1THGA 4X1IA 5U1PA 1YQUA 4V0MA 2LD4A 4KODA 1CEXA 1O6FA 3QE0A 3LBFA 4OQFA 2ZUBA 4AO6A 4WY8A 2XADA 1YZFA 4GI3A 7GPBA 1IHUA 2PGOA 2WT9A 3AB8A 1VMAA 3JASA 4HLQB 5HG0A 5LP6B 3FVVA 1ZUD1 3GT0A 3PGMA 4O2LA 4S1WA 4Q12A 5HRCA 3DH0A 4QDZA 2EC5A 3I9LA 2ZRLA 4WOPA 4L28A 3I2GA 1X1TA 3SX4A 4Z1OA 4B3RB 1XKXA 1Z74A 3DKPA 1G8FA 3OUZA 4OF4A 1QOQB 4R1NA 3NWPA 4Z1MA 1OXTA 4H60A 1QQAA 1N5RA 1QLJA 1Z0AA 3HI4A 4C1NA 3GLFA 2LW7A 3BFPA 3MMNA 1JQBA 1R6AA 1RYFA 4TMTA 4CCWA 1W36C 3U09A 2D0IA 2FMTA 2NT4A 2QRPA 4N5HX 2IDMA 5B2ZA 3SIPA 2AZMA 3B3QA 4PZUA 5JWRA 4RC9A 3WIVA 2X0NA 1NXOA 5FUYA 1OU4A 4FGSA 4IMPA 3DDSA 2R8OA 2YHIB 3LLSA 3AG5A 2V1UA 2I80A 3U4IA 4MTCA 1FU4A 3F4BA 2JIMA 2X1MA 3VSAA 4DW8A 2IUSA 2AFHA 2IZ6A 4HNRA 1C9KA 4IPTA 3W2EA 2C03A 1W73A 1KP9A 2C04A 2QUKA 3KYJB 2QAGB 2WVJA 3EG9B 4RFSA 3EEIA 2XCQA 4O0MA 2FW1A 4NFLA 2WM8A 1FUQA 2WJVA 4MUYA 2HSEA 4ZHQF 2AH5A 1RRPA 2G09A 3KJHA 1JIXA 4K6GA 4MVCA 5JH7A 1JPUA 5C5CA 2ZSFA 2WTUA 1O58A 3DTVA 1ODJA 2OENG 3EVNA 3QKWA 1O0SA 1PSDA 1RAIA 2EJWA 1Z29A 1VPLA 2BLNA 3GV0A 4TROA 4ZO4A 2NXEA 3WHLA 4I9NA 2VQFB 4C4TA 2G63A 4LMRA 5BYAA 3MWDA 4RK6A 4AY2A 1T1SA 4H7EA 4KAAA 1NATA 4RVFA 3EXEA 4ZT7A 5FPQA 2VEDA 3SJBA 3DKKA 5CUQA 3ILHA 4BNGA 4F3RA 3SMQA 5CVTA 1U2SA 2VZ9A 5JECA 2IPXA 3Q3IA 1TVCA 4U3JA 1QR2A 1TEXA 3MOIA 4EZIA 4Z4FA 2WP0A 1CY2A 3PCTA 5K0BA 1C0PA 2BE9A 5HW0A 3LVQE 1PGJA 5TS3A 3I5YA 1BDHA 5KSPA 1J97A 3LBYA 1WV0A 5B55A 1NXQA 1I2CA 4QTYA 5JANA 5H16A 4UNRA 1RADA 4L57A 1S3IA 3DWFA 2VF2A 3IPXA 1FUEA 3Q9UA 4HRXA 4V0SA 4QTZA 5F64A 5GJVC 4RHEA 1JG3A 4A26A 4DWJA 3NTUA 2H1CA 3HJAA 3K09A 4LJSA 1OLXB 1LTHR 2VNJA 4J1TA 3KG2A 2Z83A 4R8SA 1NLZA 2O0MA 1NW5A 4GI2A 4F4HA 5LP6F 1DARA 1DDIA 1L4YA 1RQ7A 2QKYA 4M1KA 3KSMA 3OKCA 5ENDA 3G0HA 3CLKA 5SZJA 1Q5NA 1Q83A 2ZQYA 3MRXA 2HJ9A 3S81A 4JMPA 1MAHA 1KWKA 1E58A 1G7TA 4HMPA 4PYIA 1ARZA 1NC3A 3GNLA 3PUIA 5AYVA 4JXXA 5A0TA 4RTLA 1PK7A 2FEXA 4CKBB 4PCUA 4DV2B 4FBLA 5EMHA 3HZRA 3ONVA 4OU5A 5K3SA 1DJLA 1BEUB 3MEQA 2AKEA 1Z6QA 3EH2A 2NUPB 1XEXB 1H1LA 2IOFA 1DIGA 4B3HA 2AC4A 2TS1A 1USKA 5JAQA 3H2BA 4MV5A 2WIAA 2JKYA 4YJKA 5F73A 4B6EA 2QWXA 3FJYA 4MW4A 3EGXA 4QFDA 2CFCA 4B2LA 2PU7A 1RYZA 5A4JA 1GADO 2V03A 1NMSA 4CU2A 3FSGD 2RH9B 4H08A 4INAA 4PFJA 2IS4A 1BXKA 2FEMA 3EXIB 1G0OA 1ZOOA 1W44A 2AN1A 2BM8A 3HCPA 4C6RA 3V34A 4OQLA 3K5HA 5G0TA 3WTCA 1G21A 1ZI6A 3T6KA 1AKUA 3K9GA 2EX1A 3O21A 4RD0A 3ROTA 3WKCA 5ALHA 4CM3A 4FFRA 4IDNA 5GADl 2Q8QA 4EWLA 3L49A 4XI9A 2Q6VA 4MULA 3F9IA 1VKJA 1ZCBA 2QW8A 4L0MA 4YMTA 1AMUA 4BE7B 1GGMA 2ADOA 1O94C 4FR2A 4Q9HA 5B6JA 1TKBA 2O6LA 2ZRGA 5BNZA 5LOVA 2YY7A 3V1UA 2OQRA 3DW1X 1VDKA 4ZXPA 1GZ5A 1JYSA 4IZIA 1AIPA 3T0FA 3PNQA 1T36B 3HNRA 2HI0A 2Q5EA 5CX4A 4AZWA 3R76A 2Y2UA 3ENKA 4PWYA 3ZV5A 2Q29A 3R74A 5DSTA 3CRZA 1E4VA 3GRPA 5K01A 1TEVA 1XVAA 1L7QA 2P5YA 2LV8A 4C2BA 3NIWA 4M1ZA 2Z5LA 1WB9A 1ZD9A 1OWMA 4FWBA 2CVFA 1W59A 2HOQA 3ORRA 1SVOA 4IS2A 4E5NA 3CCCA 2HV9A 4KE9A 4YACA 3VDQA 4Q1VA 4BRWA 3Q2OA 4C0AC 3KIPA 1EGAA 1C5KA 3GRCA 1JJAA 1SZPA 1M6VA 3K09C 5FO0A 5I47A 1BMQA 1QGAA 4J1TC 4KQXA 4OCZA 1LTKA 4EUHA 3CB4A 2TMYA 4O4IA 2CGEA 4NYMR 5ECDA 2QU7A 2HXYA 2ZB2A 4FE4A 2AV6A 1KEZA 4IQFA 4KWTA 2J3JA 4L4UA 1F2UA 4EITA 4YB8A 5HR5A 1J56A 4B3CA 4E08A 2B83A 3IIIA 4YAGA 1BCSB 3WWZA 1C1DB 1HYBA 3DHYA 3E53A 3GRUA 3H4VA 4XVHA 2DWPA 3OZSA 4YMSA 4BO9A 4MJLA 4IMRA 2WWTA 5JVDB 4YRNA 4IH1A 3DNPA 5AKJA 2SCUA 1ZLYA 2IHJA 4QIHA 5BWLA 3OMLA 1JWBB 4YV2A 2V9ZA 2IU0A 1T8YA 2V6BA 1U7WA 2DF8A 1LX7A 4CLRB 4B3GA 3BK2A 5IS2A 3EVBA 5EWMB 1LSOA 3HKBB 3KWJA 4ND7A 3TD9A 1K75A 5LMNB 4GECA 3AHIA 4F3CA 1YJXA 3HRKA 4BNTA 4EHLA 5ADVA 1ZGJA 2AQKA 4PXSA 4ZO7A 2KLHA 2C3UA 3RVKA 3RJZA 4P7FA 1E3SA 4QLAA 3AM5A 4UTRA 3BH6A 2R6R1 3KKZA 5FQNA 1QGYA 3Q0EA 3PLRA 1DT3A 3A6PC 3IJRA 5M2QA 1V1JA 2GPJA 3ZCXA 3IVGA 1QNFA 5KHAA 2FYTA 4Y0VA 2J5XA 5J5AA 4DJTA 3N3BC 5D2CA 5B1DA 4RTQA 2I78A 1NQXA 1ONOA 2PD3A 2XRYA 3U7IA 4FK8A 3V32A 4AULA 3QEAZ 4I1RA 4Z9YA 3HCCA 3ICPA 5HCIA 3T4PA 1Y1RA 4HLCA 2Q1SA 2JJYA 2CHQA 2IXDA 4B81A 4JC0A 2DPYA 4E11A 1DV1A 4OAQA 1DNPA 1ZUNB 1LNZA 2XUAA 4YUXA 5CDYA 2OBNA 3C3CA 1KFEB 1KSFX 3RK1A 3U5ZB 4P38A 1KMIY 1ZQ1A 2VJQA 3HCAA 3IC5A 3BRQA 4OA5A 4UCQA 2C4KA 4WLOA 5AUQA 3ZC3A 5A06A 2BOVA 2HV8A 1U3WA 5JMPA 1M5RA 1C4KA 1TIPA 2BEWB 2FMUA 2XQJA 3ACDA 5DTQA 1S8FA 4U9IS 5A9RA 1ID8A 2GPSA 2KQUA 1UIRA 2REOA 3CBQA 4HATA 3MG9A 4UNQA 5F5LA 3Q8KA 1HNWB 1D1PA 3BWDD 4LXXA 2F90A 5TMDA 1C41A 3AHHA 4K9LA 4QYSA 3ET5A 1A9RA 5FLKA 3RTAA 5G1PA 1EEXB 3TLMA 4V1CB 2HWYA 4YXFA 2KMLA 4BIMA 4OTZA 4QOHA 5JDIA 4PM4A 1CQZA 2P1RA 2H2IA 2QTTA 3WWOA 3SJCA 3SJ7A 2PUWA 2E4YA 4MDHA 4X93A 2X9QA 3G9UA 3KYCB 1DRKA 1EDDA 1TE2A 3ONFA 2EZ8A 4DADA 4RESA 4WT7A 2ZRDA 1XCBA 1U1GA 2O54A 1DVRA 2XMSA 3IGFA 4XVCA 1O9HA 1FLAA 1NF3A 2GK4A 4H4EA 3S55A 2Q1UA 3OCJA 1TZ2A 1DC7A 4QPPA 4OMDA 1H8ED 1II8A 1N6RA 1RYHA 4AYXA 4YAIA 3QYAA 4MINA 2F1KA 1WXGA 2ZBGA 3DL7A 3Q1LA 4ZEXA 2Y05A 1K2VN 1M1UA 4G65A 4XRRA 4GUAA 5K4HA 3GG9A 3ZNNA 5JVDF 4Z51A 7ADHA 2MSEB 4C7JA 5C7LO 1KDZA 1NJFA 2HMUA 3IESA 1JQEA 4RXUA 2NYAA 4UM8B 8ATCA 2C9YA 4DR6B 2AEEA 5E7IA 3AI2A 1QHNA 1FA9A 3OG9A 2CN1A 2I03A 2M6RA 4S24A 4WHMA 1HE4A 4LZOA 2R751 4HDNB 4MKRA 3I73A 4JX8A 4MWSA 4MYTA 4D80A 1WXXA 1QORA 1U9IA 2MR6A 3IUYA 5HWSA 3GGCA 4TVKA 3LVBA 3HFGA 1R9GA 3NYIA 2GVDC 3FFAA 3OESA 4DLUA 4UBKA 5IAKA 2VCYA 1C3OB 3LU1A 3NATA 3QUAA 4RCVA 3U0VA 3QF4B 1DG9A 3KQSA 1GSOA 2ZIWB 4FYXA 4OKIA 4RWZA 3F5QA 3PE4A 4WXEA 2A9OA 3UUFA 4A82A 5JAZA 3B1KA 1AF4A 5D3MA 1Q1GA 1Z5VA 2B94A 4ZZ1A 4R9RA 1WVIA 3G0BA 1MQ8B 3OIUA 5IAEA 3F4KA 2YJTD 3KRTA 2IPNA 3W9YA 3UCXA 3Q11A 3JWIA 3E81A 4UMFA 1YO6A 4A03A 4CQNA 5HIAA 3ASZA 1YZVA 1ISPA 2VJKA 4W7IA 5JD5A 4QG3A 4ZOEA 4YNBA 1ORTA 1ST3A 1VHQA 2KX7A 2ZJOA 3AW9A 3QVGA 1U65A 2I66A 3FW1A 4G0ZA 1M76A 1RRKA 5AR1A 4BYGA 3VKHA 2X8JB 1WMEA 1F7UA 2YC4C 2PKXA 1EK1A 3M4XA 3DZ8A 5FX2A 1TQ8A 1ZWKA 1ZOPA 4GPBA 1MH9A 1BMDA 2VTVA 5KNBA 2C3YA 4DREA 4ERXA 1HE5A 4QEDA 3TX6A 1PFVA 2BGJA 2GZHA 4WXRA 5JDIC 3UAWA 1SC4A 1XEFA 2JL1A 4KQHA 3GLIA 2CL6X 2WD9A 3DUWA 3L7CA 4WQMA 4RQUA 3WHIA 3ELWA 4FLEA 1V3UA 5BR1A 1RBZA 3DONA 3P9IA 2AXEA 4ZK6A 5CBPB 4QOFA 3SBOA 2C4WA 3ABRB 3QFHA 3ROGA 3WE7A 1S7GA 1OA1A 2OXIA 1CVIA 4EGSA 1I5RA 5CFMA 1RXUA 3R7NA 3ZU3A 3PGJA 4NL4H 5A4DA 3VR0A 1TA0A 2MT9A 2HYDA 3KD3A 5KQMA 5EUMA 3UWMA 3EIHA 4DB4A 3WTBA 3MNFA 2ZBFA 1T8WA 2ZS8A 1RLTA 4TL7A 1KPHA 2KPOA 4YWHA 4MHTA 3CCFA 1VYTA 2GNPA 1QWSA 2ZPTX 3PYXA 4WLFA 2AEMA 1RPNA 1BOOA 2AW5A 3EPHA 1PGNA 4YJ2B 1EQUA 2YWJA 1YCDA 5K0LA 4YR7A 2OVBA 1NLMA 4RTJA 3ZJVA 2CXPA 3BZWA 2DMRA 4CN9A 2FPKA 5TVGA 3T9BA 2NVUA 1S2DA 4KRYA 5HFAA 3KAQA 3T5DA 2BHLA 2NQTA 3RC2A 4CDNA 5GIPE 3ILXA 4EW3A 5MGBA 4IDBA 5K99A 4ACBA 3OLWA 4ETWA 2Y1WA 2KLBA 2XVMA 3KHUA 4M0DA 4QICA 5BO5A 2WIDA 5HCUA 3VRHA 1E69A 5TPZA 4J0EA 1QRTA 2Z5VA 1E2PA 1EJ0A 3KEMA 1L5QA 3KHTA 1LBEA 2PHZA 1GFSA 3BWBA 3B6MA 3EB9A 4E15A 4WNAA 3C0KA 4JY7A 4MMXB 4M38A 3CM0A 3ZCPA 5IUKC 1BVHA 2CVOA 2HUPA 1XMPA 5C80A 3GLGA 2CF6A 1WX1A 1G7CA 1GTVA 1HYEA 2QRUA 1PL8A 5U4QA 3TGPA 1E4YA 3AERA 1HURA 4JUBA 1J8MF 4R54A 4Y2HA 1ZOSA 2IPLA 3U44A 2F1OA 5SZKB 1HE3A 2Z3ZA 5FLXA 3LDHA 1Y6JA 3FYUC 2FWPA 1IVNA 4JJAA 2D4AA 4Y2GA 1UKAA 1E1RA 4LWQA 4LA4A 2IHBA 4KPFC 2GAAA 1KYQA 3JSXA 3FUXA 3ZWQA 4CMKA 3GLHA 2EL7A 1FPMA 1B8NA 3UV6A 1WETA 2BFBA 3GDWA 2GBCA 5AKEA 2COEA 3ZY3A 3AR5A 2ATIA 3CF4G 4HB0A 2FX5A 4MKHA 4Y1FA 3U31A 5L95A 2HK9A 1DDGA 3DOCA 3K1JA 4DR7B 2NU8A 2W4MA 3DOIA 4WBXC 2IP1A 4FW9A 4MUAA 3IUBA 4IJKA 4TOIA 3WL8A 4EF5A 4PN7A 4YRDA 4A1FA 4YA6A 4ENQA 4FPXA 3ITNA 5BP7A 1MB0A 1K3TA 3OKFA 4IOJA 3HY3A 2PLNA 1X9GA 2C61A 2GRAA 1E99A 2P4SA 3O7MA 3FVWA 3GBSA 4CM6A 3K2IA 3VQTA 1T34A 2AJTA 3NC4A 5AM5A 3C1TA 5K8JB 1SHKA 3ELYA 1JR6A 3DWEX 4AZ3B 2B5OA 4BQFA 4HXYA 4M36A 1E3MA 1Z6YA 4L5IA 2SECE 2Q2VA 2WYIA 2VDJA 4TSKA 1M66A 3WNVA 3D0KA 3FM9A 1SEPA 2OBYA 1G63A 4F9FA 3BREA 4DFDA 1KP3A 2BEVA 4L8LA 3WGMA 2WLTA 3B2NA 4JU9A 4BLTA 4E1VA 1SRRA 3ETEA 5C3MA 1EAYA 3CSUA 3AJDA 4YJ2F 5G02A 3QYPA 5KVSA 2AJDA 2ZWAA 3BGIA 4LVUA 1EDEA 4IVPA 2QRVA 1U04A 1L4FA 1LH0A 1GL7A 1MCZA 2GBLA 4WD3A 3P8ZA 3ZW9A 5HKAA 1SXQA 1NW8A 1OHHA 4DIDA 1UQTA 1T6BY 1KFKB 1L4MA 1A76A 1XX6A 3EXHB 4TV8B 3W7VA 1EIWA 2ZTLA 1WIWA 5EHGA 2IE8A 1XTVA 3NKLA 5A9TA 1VECA 5G0WA 1M54A 1TAUA 1Y1QA 1MIOB 1TO6A 3TO5A 3USZA 3NRBA 2O3UA 2VNIA 3U4DA 3BK7A 3QA3E 1I0ZA 3MJTA 4ZT6A 1ZM2A 3GFRA 2AZTA 1GITA 2W2KA 2H2WA 3KKMA 1D2MA 1M1NA 1ZW6A 2O0JA 2IYZA 3FLEA 3U7QA 4C22A 1NXWA 3TAUA 2BI8A 2YBEA 1N9GB 5AKLA 4CRWB 2DR0A 4WN3A 4YMVA 3B6ZA 5F76A 1KJNA 2BZSA 2GAFA 4FSXA 2E85A 4BKMA 2OYSA 5A5VA 1KVRA 1LCIA 2ZBDA 3DUFA 3VHXB 2PS3A 3RC9A 2WSMA 4NG4A 1II0A 2EFCB 1JG6A 2QRLA 3AEQA 2CUNA 3ANYB 3DE5X 3LPLA 4GYYA 4JYZA 2JGIA 1P9WA 2AR0A 5EZ6B 3H8VA 1C3CA 2CEKA 2ZR9A 2JJMA 4DCJA 3GGJA 3U9LA 4F97A 2H4WA 3OOSA 5G53C 1ISGA 2QTVB 1LK0A 3G02A 4QXMA 4DIFA 5DGIA 1B0PA 2E1RA 2X0EA 1M67A 2A5JA 3Q8LA 1UFKA 4NE7A 2YW9A 3O7WA 2PXXA 3ES9A 3TECE 4OYYA 1JDVA 3VO8A 1YB2A 1XHEA 3FDZB 3HRIA 2P6PA 1U1DA 5AUOB 1DLJA 3BCUA 4I3GA 4LJKA 1U4OA 4JL8A 5LQCA 3SXUA 2IITA 3A1SA 2QRGA 5HFNA 4QQKA 5TPWA 3I37X 4LJYA 4E4YA 4P36A 2RGAA 2FZLA 2RHHA 3BSFA 4OQYA 4TWIA 5AM1A 2RE8A 1MV5A 1JIUA 2X0IA 1T24A 4IXMA 4LVCA 1RC8A 2P9QA 1Z83A 5D5PA 1FLNA 3HE3A 5BORA 3M9WA 2ZYUX 2LWIA 1W5TA 1NKVA 4HEHA 2PO5A 4AJ2A 3F9CA 4AROA 5AW8A 1CJVC 4ESEA 2AMYA 1B76A 5ESDA 1O77A 1X6VA 4K9KA 2J3DA 5JNUA 1PLKA 4BFVA 1XLWA 2VBCA 5JSUA 2UUAB 5AFSA 5TJ9A 2ZJZA 4ER0A 5KWIA 1FZTA 1Z6GA 1LNQA 3M4YA 1L5ZA 3PFWO 1W29A 1NE2A 4KFSA 1Z73A 2JZNA 1Q15A 5G3ZA 2N46A 1X94A 3HBJA 1AB6A 2B4AA 3U3DA 1L5SA 3PB3A 1DBPA 3L3BA 4TV8F 13PKA 1GXSA 1E6LA 3IEMA 1OWOA 3R24A 4XEHA 3KZVA 2ECFA 1TQ6A 1CLUA 3IV7A 3KZKA 3PL1A 1U90A 4Y1EA 4Z0HO 1QRRA 1V37A 2FN8A 4CQMA 1BXRB 1M6YA 1GTJ1 4PR3A 1XXHE 4KPGA 4WACA 2ZUEA 1E2EA 4EFKA 2JHCA 2OFOA 1QLHA 1BC5A 3SOZA 3H87A 1SA0A 1YDWA 1QQ6A 4NU5A 1E3EA 3LDGA 1T5LA 4HPXB 3O4IA 3X1KA 4BCCA 4EHDA 1J1UA 5AHOA 4LF8B 4NK5A 5FADA 4EPRA 2W4QA 3RWOA 3DM9B 1I1QB 2DH6A 4S12A 4IJMA 1XK7A 4KDCA 2RHGB 1QZXA 2HWKA 1LDMA 3P9CA 4XM1A 3GWZA 4A3SA 3QI2A 5C5DA 1AUVA 4QU9A 1PJ2A 4K9SA 1ZM9A 3WL6A 4EGCB 3OD1A 5DN6A 3H1BA 5C8XA 3FLMA 4HBZA 4DB2A 3HRHA 1NVUQ 4YRLA 2X75A 1L7VC 4K05A 3TCKA 1WXIA 4Z6KA 1H4QA 1GTSA 2Q62A 2CYAA 4GT1A 2C0CA 2RAVA 3Q15C 4M21A 1QS0B 2WSSD 3CVVA 4IG9A 2PT5A 3AKEA 5B30A 2DP4E 1QFXA 2FPLA 4LWOA 3NI2A 1ZHFA 2FPSA 1XAHA 2DBQA 2ZRQA 3S2YA 1V9LA 5KKNB 1AE1A 4UVDA 4TMYA 2ZRMA 4G1FA 1I4OA 3QXCA 1Y4SA 4UUNA 4YQEA 3AESA 4IIFA 4HF7A 3ROKA 1QO9A 3EZ2A 2VTEA 1DKPA 4ND1A 4RAOA 3PEEA 5HJ2A 3SLGA 4F5WA 1L4UA 1LY1A 3U7JA 3ZZUA 1UPUA 2ODEA 3PIRA 4J1SA 2V45A 1ZGZA 4G26A 5B12A 4BFSA 1TKCA 1T3HA 3BOSA 3PQ5A 1INLA 4CJXA 1K7FB 1NRWA 2YXPX 4PIMA 1R9MA 3MGKA 2V1XA 2E5FA 2O8EA 3O8OB 1YZ3A 2Y6UA 3OLVA 4PPGA 4OM7A 3WFZA 5KDLA 2PANA 3RFCA 4F93B 5KNLA 5CA1A 3VR5A 1ULAA 3FPLA 4KRXA 3RTEA 4Z9XA 1HO3A 3EIXA 3UK2A 2ZAIA 1XZLA 1I2ZA 3B8HA 5B4UA 3EA5A 3IKMB 4JLVA 3A27A 4JSYA 4KVAA 1VSTA 4MUNA 3L43A 3BF8A 1F2VA 5J58A 1PTJC 1RHUA 2OOSA 3NPMA 3HXPA 4RY0A 4XASA 5EE1A 4P92A 1CIPA 4GSKA 5AI8A 1OTXA 2QY9A 3SC6A 1BXZA 1U8AA 4LRXA 3IP7A 5EPEA 3IBYA 2FFJA 1L7BA 2GA8A 3ANSA 1HSZA 2AKAB 3NASA 3RAEC 2XVZA 1IN4A 4C2TA 3K16A 5L40A 1ENZA 3IE1A 3TDKA 1XKLA 5DSZA 3GWGA 4OJTA 2F4VB 1T8UA 2HB6A 3I8SA 3JQDA 4XE5A 3TBFA 2NYVA 1M0TA 2M6SA 2NYUA 4KPUA 1ZUIA 4NBSA 4JVNA 4LJ6A 4QEKA 1B3RA 1LI7A 1ZK1A 2EFDB 2XOKD 3LRXA 4W99A 4UQLA 2JBAB 5FTKA 2YNMA 3D43A 5FL7D 3SXJA 1E2MA 5HMLA 4GH5A 4M0CA 4CL0A 3IAHA 4C0WA 5DBGA 2CLOB 4KXYA 2C94A 2YJ4A 4Q9DA 5EP1A 4UPVA 5IYZA 1GV1A 1M33A 3MC1A 3PWTA 1L5WA 2P2LA 4XIJA 1AKRA 3NLLA 2M6LA 2GM9A 1LRJA 2CNWA 4OL0A 5BQ3A 4NV1A 2C07A 4I5IA 2BI4A 2O3SA 5ARDA 5HK9A 1NXXA 5K4GA 3DFFA 2XR1A 4EPTA 3HADA 1JA0A 1AMNA 2C8JA 2P9EA 1SVLA 2FF5A 3DDWA 2BBOA 4PCLA 3CRMA 4E6EA 2VJMB 3D4NA 5FR2A 3EF0A 3TBKA 3MILA 5LQSA 4BKUA 2HCFA 4LTNA 4D9IA 2GCGA 3ZY5A 3AEXA 1JB9A 5EWLB 1R18A 1MO4A 3A9WA 3FMVA 2ZG6A 4PAMA 5A02A 5BRAA 4HC4A 2IZ0A 1BCRB 1NOJA 2WKWA 3AUUA 3BCRA 2WE8A 3KQOA 1OI2A 1XYYA 1X80A 3CF6R 1A9TA 3WB9A 1QE5A 2B1IA 2DBVO 1I1HA 2OR3A 3LF1A 4OL9A 3GVPA 3AR4A 2QMQA 2YWGA 1W85B 2XAUA 2GTIA 4EKGA 2H07A 1NOIA 3SVTA 3BD6A 4QQFA 2PSSA 4YP1A 4E4RA 4H6PA 5I9LA 3GUHA 3M0EA 2VDNB 3VC2A 3ETNA 2C2BA 2VAWA 5H1YA 3ZQ4A 4DLYA 2JDID 2XQGA 2G4CA 2PO7A 4QRHA 1T9GR 1ZRNA 4M1WA 5CLGA 5E4FA 3AF3A 3HJTA 3M3PA 4QT4A 1TA9A 1RPJA 1XQ6A 5CLJA 3PPVA 3D0QA 3V4RA 4BLOA 4EG4A 1UIMA 1MG0A 4W1RA 2P4HX 5MF6A 4KHZA 2H63A 3WDKA 1EESA 1SQ6A 3DCJA 1FP1D 4ZCMA 1RS0A 1USUA 3SDZA 4RGQA 3O75A 2O2YA 4PF1A 1Q1QA 4DN6A 5AHWA 4B5LA 2BD0A 3NUZA 5BWMA 3RARA 1COWA 2GSDA 1W8IA 4PAWA 1LKZA 3QJGA 4KO4S 2R7MA 4RTNA 4LRYA 4G4SP 4F4DA 3K8OE 4CIXA 1A2OA 2D2FA 3BRWD 1HKUA 3F7MA 3KNZA 4HGNA 4K9QA 1OKKD 4DT1A 1IZ7A 1OVGA 2GWRA 2V6JA 4Y2QA 2NU6B 3FVQA 4EO7A 5CD1A 5AW3A 5ALEA 3BMNB 1I3CA 3PHIA 1G9XA 1KF0A 1T3ZA 5IG2A 1C4WA 2OXFA 4GR5A 1E1KA 1NF9A 2BGUA 3NWEA 4Y2UA 2G5TA 4L1KA 4L5YA 2C98A 3INYA 4WKOA 5KTYA 1V5IA 3AF1A 3O4GA 1ZXLA 2IF0A 3T5TA 3L4EA 4Z54A 4WZBA 4CKYA 4RHFA 4JFRA 4MOWA 1U3TA 1JBQA 3U3KA 1EU1A 3IQGX 4AO8A 1T1GA 4EG0A 3WK8A 5B7QA 3I72A 1O4VA 3U49A 3RGWS 1GU0A 3DC7A 1D03A 4G9EA 3ADCA 1XZHA 4MTLA 4PZDA 4TN5A 3MJSA 2OM6A 4HUQA 4DJ5X 3NWOA 4B6FA 5A5FA 4GC5A 1KE1A 4EZBA 2R6HA 3C8MA 2H59A 2WD7B 5DU2A 2GYYA 2HCTA 2P8SA 3AJEA 2ZAGA 3PD0A 4OSPA 5E1DA 2EKZA 2JLBA 5FORA 5FJIA 5HQ3A 5ABPA 2WM3A 2G4LA 2DHDA 1EA7A 5E38A 2RONA 2D1QA 5AK3A 1P5HA 1OW3B 2FCAA 4MB2A 3B60A 1MBZA 4HZIA 1J00A 2HEGA 4K6FA 2J45A 3MCZA 5ED0A 4IXTA 4XYEA 2NXCA 3LPCA 4JLUA 1CUYA 4OK5A 3DVSX 1SBNE 1OQAA 4GQAA 4KDRA 3L07A 2VAVA 3DLIA 1J39A 2JAQA 3I6YA 2XUKA 3EMDA 4NPHA 4DRXB 4BO2A 1ZINA 4CV2A 5KTSA 2ERXA 4BGDA 1U15A 3D7RA 4D9NA 4YP6A 2Y67A 1IOVA 5C53B 2WJZB 3CVYA 3QSYA 2R1VB 3S4YA 3BXPA 2VATA 4RS4A 2R68A 4LKOA 5EJ2A 2ZKLA 1FXWA 2VPZA 3RSQA 5K0TA 4JDPA 1ZISA 5CK4A 3CUKA 4BKPA 1J8QA 4P7JA 3VYWA 2JIBA 2I6XA 3DC2A 3SXUB 3MW8A 1GZVA 4R83A 1A7KA 1HFEL 1TJ3A 2LCQA 1W0CA 1E3WB 3JQPA 2ENUA 1P81A 4FR5A 1RHQA 4WI1A 1YDFA 1CUHA 1RKVA 4ZVVA 2O7RA 4ZT4A 3HEAA 5A6SB 2V98A 5BOSB 3A06A 4H1TA 3FG9A 2QNBA 5ALYA 3RHTA 4E07A 2IX3A 1F60A 4DANA 1VMEA 1NBAA 2CV0A 2WUGA 3QHQA 1KDRA 2ZYVX 4J6FA 4UZSA 1XVLA 1Z6XA 2V54A 3WOHA 3WYCA 5JSFA 2WFLA 1CQJA 1E18A 1XTUA 5ALNA 2OFXA 3F6PA 2BIFA 1OX4B 3K1YA 1XZJA 2IYPA 5H3CA 3FBGA 4M22A 4NOLA 1DMRA 5HMMA 3R9IA 4ZWNA 2GN9A 5KYXA 2F64A 3LWZA 1CBUA 2DR3A 1PJ3A 5FI1B 4Q4HA 4BVHA 3UUGA 4CKWA 4ZC1A 3RABA 1IRIA 2R8PA 3O82A 2FOLA 4BX9A 4LZPA 4C4SA 1D09A 1YOBA 3CJTA 4N3CA 2FN3A 2AFRA 2YUTA 1JQJC 2YZ7A 1OMOA 2X2FA 4BKOA 4YVFA 1DQRA 1JU9A 1P3DA 3AOEA 3CR8A 4R2HA 4RVOA 5BSEA 4OVKA 3T3GA 5JG7A 1NP7A 4EFLA 3KOUA 4UFNA 5M29A 3E8SA 1XU7A 1O87A 2O8DA 1ZU4A 1H2XA 2VT6A 2XMBA 3HO8A 4P2GA 4I08A 5FPPA 3FSGA 1RMQA 1IN1A 1W7AA 5C5IA 3T0GA 3MBOA 1YFZA 2JD2A 4L76A 2SHKA 1G19A 4HMQA 3HUDA 3AGQA 4OBXA 5ALGA 1GAXA 3I23A 1N57A 3KVRA 4RKEA 4M87A 4Q7EA 2MWMA 1FSGA 1E8DA 4JLSA 1KE2A 4BDSA 1JLLB 1MJHA 1FJ2A 1ZSNA 2IT1A 3JR3A 5AUPB 5HHTA 2FPIB 1EFAA 1GTRA 3GJSA 4K88A 4OJKA 1UZAA 3DOEA 2PWBA 3PDIA 2J30A 2YTZA 3CC8A 2WSIA 1TX4B 4CCAA 2VPXA 2VRCD 1KI4A 4QODA 3S2UA 1N7JA 3NHMA 3SSMA 3KAPA 1MABB 1ECBA 3GEPA 3FJOA 1V3QE 2HCRA 1Z2EA 1SG0A 2WIJA 4M7RA 1NC1A 5IHPA 1ZOIA 1YAHA 4LYEA 4A8PA 1H4VB 1MNQA 3K0SA 4RJJA 5JEEA 3TPZA 1DINA 1UP7A 2XE8A 5DKFA 4DHEA 5KJ6A 5KMGB 1FW6A 5EZ5A 1C3VA 1PJCA 5AI9A 4Y2XA 2EP8A 4INOA 4TTJA 1T26A 2I8CA 4TLLB 3SKVA 4D0LB 1YVPA 4I1VA 2CJPA 5FBWB 3AVTA 1YZQA 3BM5A 3U3ZA 2VNAA 1DAFA 3RUIA 3GLSA 1KYVA 3ANNA 4BZWA 1K5PA 1HDXA 5TF4A 1QQTA 4UBMA 4QYXA 5JDCC 2EKPA 5KDDA 1SHUX 5FOWA 2O9JA 3TR6A 3AY7A 2E87A 4C5BA 3HA7A 4NBTA 4PGMA 1HXHA 1IATA 4M9CA 4NSLA 1O96A 2XDQB 3UT0A 3E7FA 3ENVA 1DDOA 4PCVA 4AMZA 1A3CA 4Y2YA 3DL4A 2OK7A 1BZYA 3AHFA 5IASA 5KNDA 4GRDA 2JAUA 4Y9UA 2ZVQX 2XGJA 4HDKA 4JC8A 1X0XA 1HH4A 4HFJA 3K0FA 4QUJA 4X6YA 1Z62A 2ID9A 3FRIA 1J8VA 3I9KA 1KXZA 1NP3A 4GM4A 4GWKA 3VPGA 3T1VA 2IVFA 2I4RA 2JK1A 4JCCA 4D4GA 4NI5A 4URVR 2Q21A 4YY3B 4HEA1 2OFPA 2EF1A 4IG4A 4JEIA 1QJ4A 4HSGA 1JW9B 1PJAA 3VUEA 1NW7A 4MVJG 2BZ1A 1MHPA 2YN0A 1HEUA 1IHOA 3OSUA 4REQB 1SBZA 1KDYA 3UGKA 3I58A 4KRFA 4LRUA 1HDZA 3ENZA 3S1LA 3UJHA 4BX2A 1WJGA 4DUYB 4JQCA 4Q9KA 2PVCA 4BVKA 1YNOA 2GN0A 1BG6A 2QTGA 2A7QA 2N0SA 3P1JA 3RSSA 4BFWA 4NCHA 3WMEA 2PNFA 4MVJD 4DJFC 1YS2X 4EMTA 1GTMA 5F92A 2EX4A 2EARA 5GONA 5JWOA 1ILEA 1AZSC 2GDJA 3WY9A 5E4YA 1KORA 2BKUA 4IX9A 3ILSA 3SAJA 3FKQA 4M2LA 3OF3A 4KX3A 3R44A 5H7XA 4F4IA 3IEVA 3VX3A 1W6RA 1XJ0A 2A57A 1OD6A 1TTHA 3B53X 5EZSA 1ZA1A 4UZEA 2DYKA 1WL8A 1JXOA 3DMPA 1PG2A 3GRKA 2BDEA 1K6MA 3A6DA 4J7UA 3JQ9A 2KB0A 4KMSA 2O1SA 1R9NA 1SVKA 4Q7LA 2QGNA 5C35A 3LDAA 1UPTA 1ECGA 1VMKA 1WXDA 1FFSA 2ZROA 1II9A 5TEVA 3TLJA 1PNVA 2FWAA 2Y8EA 4FYHA 3WK7A 4MDYA 1JG2A 1T0PA 2CNNA 5I7RA 4N01A 2CNKA 3GT3A 2UZIR 2UVQA 5DW3A 1KOGA 3OPNA 1BA2A 1XDGA 5LYYA 1APBA 2VHQA 4MDFA 3LQYA 5DBIA 1E6KA 1A88A 1P44A 2CKDA 2YUIA 1QV6A 2ZIXB 2XJ4A 3HDVA 3IQWA 5FXMA 2C5LA 3V2HA 3GJ0A 4DNQA 4IWXA 5CW1A 5HP4A 4I1PA 2Q3DA 5EHZA 3RS0A 4ACAA 3G17A 4XIGS 4AY6A 1CP2A 3I2FA 2HADA 2XCTB 1QLWA 3C3YA 3QXXA 2WTXA 1QV9A 3FWZA 3ZQ6A 3L2OB 3WFJA 2V8OA 3A9RA 2ZU6A 2I8LA 3VJMA 2H5EA 4HWKA 2H4YA 3PNOA 2EFEB 3DT6A 1MX1A 3QSGA 1EFUA 3FPSA 3F74A 3ZHVA 3EGVA 1TF2A 2C7VA 1JSRA 3COWA 2Y0DA 2H85A 1P0IA 3D1VA 1ML4A 3CRRA 3VYUB 1HE1C 3WDMA 3KEFA 1KYIA 4A23A 4BBJA 4R2LA 3HFRA 1RWQA 4FCVA 4JUIA 3DBHB 1H8EA 2VA8A 3LDUA 1XZDA 3LKVA 3M6LA 1MXFA 4OQQA 5K51A 3VZCA 3R3WA 1S2OA 1PT9A 3TSCA 3U4GA 1QC5A 2JFNA 1KAOA 5IVPA 1SMKA 5HA5A 2XVAA 3NO9A 1M2WA 3U80A 5C1IA 2FP4A 2GZ2A 2QN6A 3BGWA 2AD5A 1TUEA 2FFHA 3E05A 5HJ5A 2JC3A 4WK6A 1MT0A 1W19A 1T6XA 2WU0A 1UXJA 3VKUA 3QLEA 4KYIB 2VOJA 3G9QA 5HKKD 4U7WA 3W90A 2FQWA 2QTCA 1ZJ5A 2VHWA 2F55A 2GTHA 4QHTA 2ZPUA 2B8WA 4XTRA 2PA0A 1HZZA 2AK3A 1FVFA 3H05A 4RELA 3SPXA 1N9ZA 5FNVB 1CR1A 3T9AA 2H1OA 4HQFA 1EWKA 2OK8A 1AKWA 3F4LA 4P08A 3VVLA 4NCIA 3TSYA 4A8JC 4MRSA 4X60A 3BD8A 5IAGA 2VJDA 4HZUB 3ANXA 4EQZA 2Y1GA 1V5FA 2P68A 1YNSA 2WVAA 3T5BA 1O0BA 2H51A 1F1BA 3JQ9C 4V0QA 2TMKA 4ODIA 2A1UB 4AC9A 1UINA 2OAEA 2RCYA 4DQXA 1JQDA 2G07A 2O23A 1EA5A 1I5OA 2PZBA 1BWPA 3IUJA 3S6JA 4DY4A 3EGEA 4DEVA 1KJIA 3ZJTA 5IJ9B 4NNOA 2XQFA 4RK0A 5I48A 3G5TA 2ZAOA 1HT3A 3MCUA 3R3SA 1OFTA 4HQRA 3KSAC 1XQ9A 2C4MA 3L8ZA 4YJ3B 3UYLA 3NNNA 4P81A 1QIKA 1KY2A 2H18A 3S44A 4GYWA 2IHYA 5JYEA 1U98A 1G8PA 3R20A 4UU1A 3CMCO 1ZONA 1I3KA 5CT8A 3KB6A 1YTUA 4W9NC 1CHNA 2GPYA 4CMAA 4EYOA 3CN7A 3SF8B 4WLNA 1RSZA 2WSYB 2B1JA 2ST1A 2YXNA 3ZW7A 2PUHA 1SOAA 1CJBA 4H3KB 4UFOA 5EP3A 2PJZA 5L7WA 5DK6A 1LLUA 2ZPAA 3PF8A 3COZA 2XNCA 2PMCA 3MA0A 2X4IA 2VPPA 4C3OB 4ZP1A 2HFKA 1Y7LA 2O2JA 2XA9A 3BDIA 3SM3A 1BRTA 4YAEA 1SCAA 3VR3D 4LY0A 1JR3D 4F6LA 3CVXA 4F45A 1DAPA 1QMGA 1GQQA 1MH1A 1UMKA 2RJ3A 1JXMA 2W2NA 2KS6A 3DTNA 2PTGA 3R0ZA 5EHQA 2WV9A 5FV7A 2QBYA 1TJUA 3PUHA 3PJFA 2PJRA 1X8LA 3ONEA 4MJ3A 4XGRA 1S2LA 1JE1A 2ZBEA 4MQMA 3BZUA 1DSSG 2M32A 1L5HB 1DWOA 2G6BA 3OOHA 1XA0A 4HDMA 3GD7A 1XDUA 3I9V6 1NT4A 3KB1A 1Q2XA 3L7KA 1X42A 3B12A 2IV3A 1K06A 4PU0A 4AG3A 3U2QA 2ZE8A 2VTBB 2CV2A 3HYTA 4KWIA 4WBNA 4DSOA 3EAQA 3ZCTA 4ENTA 3RK4A 4E09A 2HLPA 1FU8A 1LLFA 2C5AA 2VK2A 4Z2YA 1G16A 1XCJA 4YN3A 4EJSB 3V33A 2P3OA 3DR3A 2QTLA 2WG2A 5AJUA 1HZZC 4FN5A 4GVLA 1M10A 1VP3A 3EVGA 1GAQA 4F6CA 4O4HA 3ABQB 2AEJA 2XCRB 1NVVQ 4D25A 1P0FA 3AEZA 5DM1A 1WBBA 2OO7A 2P4UA 4PS0A 3CRW1 4YALA 2FE1A 1HL3A 5FNVF 4ZO6A 2DCUA 4F11A 1BE6A 2ZCVA 3C6KA 2A59A 2ESRA 2H4JA 3DMFA 3EQ8A 1XVVA 3L7AA 3OPMA 3BZBA 4F91B 4YP7A 3ZVRA 1F8UA 2WTNA 2YIDA 1ZI9A 3ELDA 4TTVA 2VI5A 3WRYA 3NETA 5AJYA 3JQCA 1KMNA 2AMJA 3ECSA 4FZ5A 4F3YA 3RUPA 1WW2A 5JZMA 2ZJ2A 4QPZA 5ICSA 3G2JA 3L41A 5CFPA 3QVMA 4MPDA 2J59A 4GPIB 1N2CA 4ZVNA 1I13A 2F6RA 2JRCA 3UGJA 1IEWA 1R27A 3HKEA 3VFDA 3CPSA 4R9UC 4XDYA 1IHXA 3N1UA 2J0UB 2WIFA 4G84A 5MN5A 3TLBA 3R7WB 4GR4A 1EZZA 4PFKA 5LU9A 3PHLA 3SBEA 4DBLC 2EKDA 1OBOA 3JQEA 4YJ3F 3RUHA 5DYYA 4O63O 2O8FA 5IRCD 2UU9B 1T3GA 5ICGA 3R3JA 2QX7A 4RPIA 4CM8A 1DKQA 2EJCA 2B35A 5IT0A 3E15A 1JNXX 2NU9A 1BW9B 4RH3A 1KI6A 3CF4A 2HSGA 3NTQA 1W4BA 3O95A 4JX9A 3LNCA 4X66B 4WCFB 4EGJA 2CUTA 4Q39A 1EX1A 2R8ZA 4DVJA 3R6QA 1L6IA 2A88A 1LFDB 3SNKA 4PHFA 2GJ4A 3OWXA 3EIUA 5KHOC 3EBPA 4J43A 1RTTA 5CNMA 2MSNA 2HIGA 3K9FC 4RIGA 3RSOA 4LC1A 2G0AA 2YZKA 3AETB 1KOFA 2R2GA 3I8OA 3LXMA 4N0QA 4RYDA 3P0FA 5CR9A 3DL2A 3DE1X 2FW7A 3MRVA 1GQYA 1X9IA 1T29A 3OT4A 2BFEB 5M5BA 5DLPA 4YIKA 2GXSA 2VXCA 2XW6A 3LNTA 4OXXA 1P2GA 2GF9A 1GTZA 2FWRA 3I0NA 1G20E 2FPOA 1VBMA 2XITA 3H86A 4KUEA 4LCBA 4YH1A 3JAKA 4P32A 1ZC3A 2BMJA 2A9FA 2BEJA 1Z4KA 3QENA 1JVBA 4M9RA 3S68A 1KMHA 2QZPA 4ARAA 1LUAA 4IYJA 4N5DA 5KYTA 1H9CA 4A16A 2NSJA 2WD8A 3RYIA 1YHNA 2DQYA 4D4LA 1UT8A 1SXGA 2B7BA 1WTCA 4EEZA 1B16A 1KSGA 1JAYA 1EVLA 1ZWLA 3JQQA 1KK0A 1BAPA 1KQPA 3ADKA 1VM6A 1SUIA 1XQYA 4ZCQA 3FF1A 1IH8A 5AKHA 2OGZA 3PE3A 3BGOS 3GZJA 4MWBA 1CJMA 1GP2A 1R0SA 2TRSB 3EIEA 4Z0TA 4BV3A 4OP2A 1G3IA 1N5IA 2O5VA 1FYFA 2PLFA 1HT0A 2UXDB 3TFOA 2CFRA 1OXMA 2EVWX 3G0DA 3QNWA 5LXTB 1HX7A 1ZD3A 2EV9A 3FMOB 3WRYC 3ZI4A 1ICEA 5EYPB 5T4EA 4B7XA 5KOJA 4OHUA 1GVHA 2DTXA 3R5SA 2XWPA 3OMWA 2YVQA 3SX2A 5L8VA 3LXRA 4YV1A 3JYHA 2PIDA 1T13A 3UK6A 1DI0A 2I4LA 4X6XA 3NJRA 2Z08A 3S2IA 2V0GA 2YXBA 1FL9A 3P52A 3R5FA 4EK9A 1N7IA 1SZDA 4OG2A 5E8RA 4RDXA 4JIGA 3UENA 1NI4B 5C7YA 1LEHA 2JASA 1QV7A 2OCXA 2X4DA 3ZH9B 2ES4A 2YKGA 4ZDIA 3DEKA 2FR8C 2AJBA 3UC5A 3RUDA 1ZI8A 2H48A 2ID7A 3HFSA 4DLPA 4RHYA 3URMA 1D0VA 2QL7A 1YI0A 3DZBA 3ZWWA 1I2BA 3JQ7B 2KSQA 4U7DA 4U7PB 5LLDA 3RT1A 1A98A 1WHTA 4AY5A 1JECA 1FFHA 4CTNA 3ZWVA 2G67A 2ZYSA 1T5TA 3FHCB 3PP8A 4X61A 4MP8A 4CLDA 4F7WA 5JS7A 2J0QA 2Q0QA 3FGPA 3L05A 3ASUA 4QDJA 4GI5A 1H6BA 1Y80A 3D0RA 4NTZA 4DLRA 2UXCB 3HACA 1QH0A 5JD6A 3I53A 1NQOA 3O9VA 4BPBA 4XLLA 4ND8B 1PZEA 2VBFA 4KYVA 2AOXA 1VFPA 2H7VA 4JNCA 1C7EA 1N6HA 4GUDA 1V1MB 1WLSA 3D9QX 4O4JB 3OQOA 4IF6A 1V41E 1HM5A 2F8LA 1GYPA 1O08A 4I6EA 5HZHA 3D3NA 4R05A 1XRMA 4LX0A 1ISRA 1XUOA 2WMNB 4BB5A 2XJ9A 1I6WA 3ETJA 3FDIA 3P9KA 5E0KB 5IBQA 4CUZA 1JEQA 4DDVA 2NZ2A 1XTJA 2IYOA 3U13A 1O54A 4K81B 1YOVB 3ZOKA 4WFIA 1PWYE 4MQEA 1E89A 4QX6A 2IKQA 2AG8A 2OCBA 3PUKA 4JJ4A 1JEAA 1XCMA 1GPAA 2B1GA 3D6AA 4KMRA 3RYTC 4CGYA 3CCBA 4UVIA 1RRCA 4MI6A 3E9NA 3W8FA 1TYCA 2AC2A 3R6GA 3RH0A 3L01A 4QDOA 1WCYA 2ZQZA 4RGYA 4B0PA 3OSZA 1G4HA 4NKRA 1Z3CA 5F1KA 4JR1A 4UATA 3UJ3X 3NH9A 2YFQA 1Z15A 3X1YA 4RH0A 4RKYA 4TQ9A 1ADJA 3OT1B 4DCNA 2AK2A 4Q9NA 2O4UX 3UJDA 5LP1A 4OSEA 4EHBA 1EUCB 4N7MA 1IK4A 1X14A 1FFXB 2HJVA 1CUJA 1E6EA 2ANCA 2EQ5A 4COOA 1H42A 4LK2A 1PV1A 1IZ9A 3HDTA 4LHEA 1VRCA 1SXJC 4OAPA 4ALJA 2QP3A 3D4LA 1KEEB 3TIFA 3TZBA 3ZTWA 2PUGA 2FSVC 2X5OA 5LXTF 4B40A 1NNSA 2R1ZA 5E6RA 5IKOA 1DU4A 4AUEA 1W47A 2FP3A 4C4RA 2XCSB 2CK3D 2G82A 4ZQCB 3X1MA 4KR3A 3TCNA 3IUNA 3O47A 1TD1A 3V46A 1UKZA 2V7UA 1EFPB 1HEIA 2VH1A 4B85A 1T0JB 3QBTA 3T3EA 3I5MA 2AWOA 2X9LA 1KZGB 4QJ3A 3GARA 2IEGA 5T8KA 2WT8A 1KEWA 2R7LA 1QH9A 3NBXX 4J0IA 4LXUA 2ZT7A 1QH1B 3DZGA 1HTWA 2BL4A 4EDFA 1QDLB 2P7IA 1M1YA 5EIOA 3OM9A 4LXHA 5CDHA 1R5NA 4O5AA 1YC5A 4D7AA 1QIJA 4G4IA 2QNRA 1XXHB 4OJQA 3MS2A 1S89A 3MYYA 1B8UA 3EA4A 1T0UA 4N9QA 1KJ8A 4O8CA 3QLVC 4OHMA 4I2VA 3N0RA 2WSSA 3SS9X 4DLNA 4RGBA 3X1WA 1OZAA 5CDGA 4XX0A 4KIGA 1UC4B 2C20A 5BXQC 4D26A 3HJHA 4BMZA 4CIAA 4DR4B 2A4KA 4C7VA 1SC9A 1DJPA 4GZLA 5JD4A 4Q4JB 4EKYA 3KQNA 3C3PA 4WZZA 4JQZA 4NE2A 2NZ8A 2I6TA 4QPJC 1F2DA 1U9YA 5EA2A 4X64B 4O4JF 4KTVE 2WOOA 5EUBA 1RXEA 3T7DA 4TZ6A 3FJ1A 1AF7A 1C7QA 2D5AA 2PX5A 2QUIA 1BGWA 4R6XA 5CCDA 2C5BA 3KQUA 4DUZB 1C7FA 2DHRA 4RORA 2ZI7A 3K6SA 2YR0A 4UUOA 1TZBA