4L6CA

Crystal structure of human mitochondrial deoxyribonucleotidase in complex with the inhibitor pib-t
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
201
structure length
201
Chain Sequence
SNAASGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 5'(3')-deoxyribonucleotidase, mitochondrial
publication title Conformationally constrained nucleoside phosphonic acids - potent inhibitors of human mitochondrial and cytosolic 5'(3')-nucleotidases.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 201
sequence length 201
ec nomenclature ec 3.1.3.-:
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4l6cA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4l6cA01
2G06A 2WF9A 3AR6A 1Z4MA 2OA0A 5AKGA 5ALGA 2NO4A 4Y2YA 4AS3A 3AR5A 3ZUPA 5AKXA 5ALHA 3ZVLA 1YNSA 4QJBA 1TJ4A 2HX1A 3EF1A 3WKAA 2I6XA 1U2TA 3ZX4A 3ZVMA 4KN8A 4Y3UA 4JB3A 2GHQA 1EK2A 2VKQA 2I33A 4YCLA 2WF5A 2G0AA 3PDWA 3MPOA 1S2OA 5AW2A 1XPJA 2WM8A 3VAYA 5ALDA 1Z4NA 2HO4A 2MSNA 2ZBEA 3RFUA 2B8JA 4BBJA 3NUQA 4Y2QA 1TE2A 1T5TA 3NASA 1RC8A 4UU1A 3I76A 4UW9A 3A1EA 3FZQA 4EELA 5A3RA 3AR7A 2C8LA 1VJRA 3N28A 1U02A 4OHFA 1TJ3A 1L7MA 1ZD2P 2I34A 2FUEA 4Y2PA 5AKYA 2PR7A 3W5AA 4YCNA 4EENA 1JUDA 2WHEA 4EZEA 1Z4OA 2B0CA 2X4DA 3QU7A 4E88A 1O08A 2I54A 2C4NA 3WK9A 5AVRA 3W5BA 5AVTA 2HEGA 2HF2A 3HYCA 4ZEWA 2Q5EA 4KX5A 2Q4TA 2B1QA 4XE5A 5AK3A 3ONNA 2YN4A 4BX0A 4Y2TA 5ALKA 1Z4KA 3W5CA 1ZD3A 1XP5A 5JJBA 3CNHA 3ZTYA 4CNQA 5AKIA 5AW4A 4XPZA 4UMDA 1J8DA 1Z4IA 1X42A 4UU0A 2FI1A 1U2SA 5AHXA 5ALEA 5AKEA 1U7PA 2JARA 2HF7A 2G08A 2YMQA 4UARA 2QLTA 3L8EA 4UMVA 4XOUA 3WKDA 2GO7A 1NRWA 2B8EA 4RESA 3L8HA 5AM4A 4DFDA 3HLTA 2YFYA 5AICA 2CFSA 2HCFA 3QUCA 3I6BA 2I7DA 1QH9A 2ZBGA 3KC2A 3QLEA 4HYTA 1L7OA 3WK4A 5AM2A 1XVIA 3R09A 1TJ5A 4NAVA 3D6JA 3UMGA 1RMTA 1Z4PX 2FPWA 4BNDB 1QQ5A 4BEVA 4HGPA 2FPXA 4IG4A 3UMCA 3ESRA 3QU9A 4I9GA 2I55A 2R8XA 3KDPA 2YJ6A 5FP0A 2P9JA 3ZW7A 2AUTA 3S6JA 1CQZA 2YMLA 4NWIA 3A1DA 5ALMA 3FVVA 1YDFA 1FEZA 2HSZA 4UMEA 5AW7A 5ALWA 4JDPA 4BNDA 4BKMA 1ZRMA 1RLOA 3ET4A 2PKEA 3OCVA 1Q92A 1RQLA 5ALPA 2OYCA 4NABA 5ALJA 3B9RA 1ZD5A 4IFTA 1RLMA 4UMFA 4DWOA 4YCMA 2EAUA 5AVQA 2FEAA 3MMZA 5AVWA 2R8EA 1L7NA 2C9MA 1CR6A 2WF8A 3BA6A 4UATA 1YMQA 1RKVA 4DCCA 3SKXA 2OBBA 4FE3A 3OCWA 3OCZA 2RAVA 2FPUA 3K1ZA 5AI5A 2C88A 5AM3A 3NIWA 5AESA 5AVUA 4C4TA 5AM5A 4KNVA 4RETA 1ZOLA 1S8OA 4OCZA 3WK8A 2B1RA 2W43A 3W5DA 1RDFA 2CN1A 1PW5A 5AIBA 3N07A 5AW3A 2JAWA 4Y2VA 3E84A 2P11A 5AVXA 3QUBA 5AVYA 3ZVNA 5E0OA 4HGOA 5IT0A 3B9BA 1RPZA 4KX3A 1N9KA 2ODAA 3U7HB 2W11A 5ALXA 3ZTWA 3N1UA 3NALA 2GFHA 3QUTA 3L0BA 5AM1A 3E8MA 2JAOA 2D2VA 4O8CA 1RMQA 2OM6A 4FFDA 4B6JA 2GHTA 3KOOA 5ALFA 5AVZA 4L6CA 2ZBDA 1Z88A 5AKHA 4QQFA 3IJ5A 5AW0A 5A3SA 4KNWA 3N5KA 1NNLA 3QU4A 2BY4A 1EK1A 3SHQA 3AR9A 2G1AA 3OCUA 3KBBA 3IRUA 4CF5A 3AR3A 4NV0A 1U7OA 3U7FB 1YS9A 3IB6A 1IWOA 5ALOA 4PNHA 5AI0A 2IOFK 4AP9A 3PGLA 1RLTA 5AIAA 5ALLA 2JGAA 3U26A 3U19A 1ZS9A 4YGYA 2DQSA 2FDRA 4NFLA 4YIKA 4UAUA 4HGNA 2FPSA 5ALRA 3WGUA 1NF2A 3PGVA 5AKZA 1WZCA 1Y8AA 2G09A 5AVSA 3QYPA 2W4MA 2HI0A 3KD3A 3WKCA 3KZXA 2HOQA 1YJ5A 3DDHA 4Y2XA 4Y2SA 5AVVA 1RKUA 2G07A 3WK5A 5AKKA 1ZD4A 2WF7A 3E81A 1SWWA 3B8EA 1WPGA 4Y2RA 2WFAA 4CE6A 2WF6A 1Z4JA 3QX7A 3U7GA 5ALYA 3U7EB 3ET5A 2ZOSA 2O9JA 3WKEA 3ESQA 3L0CA 3L8FA 2YMMA 3L8GA 3ZX5A 2FPRA 2R8ZA 2BDUA 3N8GA 3PCTA 4CF3A 5AK5A 3R4CA 5AW8A 2C8KA 5ALZA 1RKQA 1T9ZA 3F9RA 3M1YA 1L8OA 3SF0A 4J2TA 1J97A 1MH9A 2YJ5A 4YH1A 3SMVA 4I9FA 4GXTA 2ZXEA 1N8NA 5AW9A 2CFTA 2RBKA 2QYHA 3ED5A 1YV9A 3CZ4A 3QU5A 1LTQA 4GIBA 3U13A 1WR8A 4F71A 1RRCA 5ALQA 1ZRNA 3DV9A 3WK6A 4C4RA 4CF4A 5ALVA 4L57A 3AR2A 3EF0A 2YY6A 4UM7A 5AI4A 5AW6A 5AW5A 3J7TA 4BX2A 3UMBA 2PQ0A 4G9BA 4BYGA 4AS2A 1WVIA 1O03A 4FYPA 4ZEVA 2EARA 5ALTA 1VFPA 3WKBA 1KYTA 3UM9A 4OFZA 1L8LA 3E58A 4KYTA 3OTQA 1TA0A 2NYVA 1Z4LA 3L1VA 3A3YA 1ZJJA 1QQ6A 2P69A 3QUQA 3ZWKA 2EATA 3FPSA 5AK4A 4Y2UA 3TLMA 2CFRA 3OPXA 5IT4A 1AQ6A 4EX7A 5A3QA 3SKYA 1VJ5A 1Z5GA 2BDEA 4J03A 5AI8A 3ZU6A 4MWOA 3NANA 1L7PA 2Q4RA 2IOFA 3L5KA 2O2XA 4HAIA 3QNMA 4BEWA 2FUCA 1SWVA 2B30A 3FM9A 4BX3A 1QYIA 4MUMA 2GMWA 3P96A 2HDOA 1K1EA 3DNPA 3BWVA 4F72A 4L6AA 4XQ0A 1QQ7A 5AKLA 3R9KA 4EX6A 3WGVA 2G80A 3SD7A 3EPRA 3L0YA 2B82A 2P27A 2AGVA 1Z4QA 3QU2A 3AR4A 3OCXA 2YMPA 2RB5A 4DW8A 2YJ4A 4OD0A 4HGRA 3MC1A 5ALIA 1T5SA 1RMYA 3NAMA 3A1CA 3M9LA 4UASA 3L1UA 4UAVA 2ZBFA 5ALSA 4YIHA 1L6RA 3OCYA 2IA5A 3WK7A 3I1YA 1Z5UA 5AI6A 1LVHA 1RQNA 5T41A 5ALNA 2ZG6A 1Q91A 2JAUA 3SLRA 3GYGA 1F5SA 5AI9A 5AW1A 5AK6A 5IS2A 3FGOA 5AM0A 3FPBA 2AMYA 3L7YA 4EEKA 2IOHA 2R8YA 3I28A 3QGMA 3ZI4A 4HGQA 3EWIA 5AKJA 4ZEXA 1SU4A 3QXGA 4G63A 5ALUA 2MU1A 3AR8A 3ZWDA 3RF6A 2YJ3A 2IYEA 3DAOA 4H1WA 3MN1A 2RARA 2NO5A 2AH5A 3NRJA 4UM5A 2HHLA 2YBDA 4C4SA 4Y2JA
chains in the Genus database with same CATH superfamily
1Z26A 3W06A 3LX6A 1XTJA 3E3LA 5JLAA 3CR7A 3UJPA 4E2XA 1JDZA 1S1CA 2H1VA 3OFND 1RXYA 3CMCO 4DBVO 1WP4A 2HA7A 4MMYB 3IKTA 4M8SA 1CRZA 5DYYA 4PLWA 3PE4A 1UFVA 3VR4H 2J3KA 3AR5A 1IVYA 3CNEA 3C8TA 1GZHB 2GBCA 4MS3A 3TPFA 4ND8A 2WIDA 3SBXA 4RLSA 1ZNXA 3TDKA 3UAXA 4GLJA 5EHXA 4AT1A 3TUJC 3JZMA 5JXWA 1JLMA 4D3YA 4B3CA 3EVNA 3AVPA 3FNFA 1NP3A 4P98A 1ADYA 4C0LA 5K3BA 1DIHA 5KYUB 1ADFA 4MW6A 3P2IA 3A2LA 3VZDA 3HJUA 2EKPA 2Q3LA 5TE9A 1OB5A 3FYSA 2WUWE 2QUAA 2Q2NA 4CDMA 2PE5A 2GO1A 2VHYA 3UT6A 1XWWA 3QMMA 1JSCA 5BVGA 5I9IA 5ALDA 4M89A 4I1RA 2W2LD 2BFFB 1E1MA 3EEYA 3MAJA 3MT7A 3SYRA 4Y2QA 8MHTA 1DV2A 2XF8A 3CLTC 5CK4A 4WXRA 2IH5A 4CN9A 4MCAA 2VRNA 1CZUA 5GOTA 1EDDA 3BREA 1JDJA 1P6QA 4PZDA 1E61A 3EISA 3MTGA 5G1PA 1ONPA 2HMAA 1N5LA 2NADA 4TKVA 1ATZA 4QOSA 4HXFB 1VJRA 2IHVA 4F9TA 2GCOB 2VDUE 3DHYA 1U94A 2IJGX 3G2PA 4OGGA 3AIMA 4XVQA 5U1PA 1GGKA 1UBHS 2YHBA 1P6UA 5B3AA 3ZHVA 4B3RB 3R75A 1JIVA 4TV8B 1LQTA 1DMSA 4L8VA 2QUJA 2PA0A 3MCVA 3EVTA 2CDCA 2J9ZB 5LLSA 5AKYA 3ESYA 4XB2A 4EG8A 3IR7A 4EG4A 4W6ZA 4AKHA 1T6ZA 3P0HA 4IQ0A 1UOOA 3C3WA 2B0CA 3QVSA 4BVFA 3NP9A 5B6PA 1A1SA 1KFEB 1NNI1 1F60A 1O08A 5AVRA 3ODGA 1G3IA 3HYCA 2D7CA 4QQKA 1W73A 5AO9A 3EYWA 4B4KA 1PFYA 3N87A 2QN3A 4R8LA 3UXMA 5HK8A 4DCPA 1IM8A 3UVEA 3L1IA 3RU2A 4UHBA 1JSRA 3ZGOA 2QRQA 4CM1A 3CB4A 4ZJPA 4CEHB 3TLXA 2P77A 5HG0A 4BFWA 3JVVA 3ADDA 3A28A 2PL9A 1Y9JA 1P2VA 2WWGA 3FYTA 4C7KA 4OI2A 4OHRA 1E6EA 4C6HA 3GLGE 3BWEA 3F6PA 1U9YA 1MX1A 4LZNA 4E5VA 1FA9A 1SBYA 1RPAA 2ZAIA 3FFXA 1NM5A 3CZRA 1EGMB 3WAGA 2XDQA 1AO3A 5K51A 3L0DA 1F12A 3T7AA 1NVWQ 4MRMA 3OPYI 4CM4B 2GF2A 4AECA 4WRRA 4YCJA 5F3WB 3DWIA 3WV5A 3QVUA 3K73O 2JARA 4HEHA 3W2GA 4BECA 3IUJA 2PS1A 4MS4A 2FZ4A 4I99A 1ZA2A 4UM8B 4PNPA 2IDZA 2BH9A 1HYEA 3TQTA 5CA1B 4AN1A 1S9DA 3ZXSA 3IO5A 6REQA 3VISA 1T9AA 2EXXA 5A4MS 3THYA 1A2BA 2JHCA 3I6ZA 1MHPA 3MLBA 5AM4A 2ZYWX 4TLMB 1L7VC 2A7XA 2YIDA 4BGIA 4TV9F 3ZKWB 5CCBA 1SMKA 4KRXA 5AICA 3UMVA 2NTNA 1B4DA 2QSUA 2AUMA 4NEQA 2PVCA 1O3YA 2D06A 2O5RA 3DKVA 3EGDA 4WEOA 3UFXB 3LDHA 5AM2A 3RASA 3UOAB 4JJAA 4R2IA 2FZCA 1BW9A 4LIPD 4BY9E 4ZHQF 3PL1A 3SSMA 3VUFA 3AQ4A 1WIWA 4RCYA 3WFZA 1GG2A 2MYPA 3DQPA 4LJSA 4Q21A 4GPD1 3ZK9A 1GAXA 3L6RA 1NPTO 4TRRA 4Q6WA 5A5GA 5DM2A 2XJ9A 1GADO 5JVDA 1DRKA 4P34A 2QD2A 5GONA 2GVDC 5CFMA 4LBVA 4CL0A 4EW1A 1WBBA 3PA6A 2OHIA 1YJCA 2JBHA 1A7JA 2IU3A 3PXAA 1YE5A 2E55A 1UMKA 1CQZA 3CVVA 1Q5NA 4LXUA 3AIKA 3FCAA 4M3NA 1CZNA 1BE1A 2O4UX 2RFLA 3TB6A 1HQYE 2F17A 1MT0A 2VSNA 3W1WA 2Z5VA 3WB1A 1AGXA 5IN5A 2ZRFA 3WQRA 4DB2A 3U7QA 3GT7A 1ODSA 4FLEA 4HX9A 1XROA 2RAUA 1I8TA 4UPVA 1TTTA 1O5OA 1MO6A 3MCUA 4NBWA 4DC9A 5C7LO 1EP3B 1BMFD 2O0KA 1YSCA 4CG3A 4NABA 1MAAA 2D6FA 4LZOA 5LZ2A 4GYKA 2IZ5A 1IBKB 3I32A 4MLPA 3F97A 4R8KA 1XYGA 4U39A 3TJMA 3ECSA 4WIAA 3HU2A 5GGYA 1CUVA 1PDWA 1R5JA 2C9MA 2NU8A 1JPVA 5P21A 3NBFA 1Y4SA 4MIEA 1G8HA 1JG6A 1I0IA 1RJWA 4N65A 5CEFA 1POWA 1NFRA 2O3TA 1C3CA 1B41A 3C3AA 3MW8A 4RVNA 3AKZA 2P9TA 1I1OA 2Q1TA 5KVQA 3R3UA 2J07A 4MUFA 1F1BA 3FVTA 4IDDA 2I4RA 1IE3A 1UBSB 3D3WA 3P4YA 4P08A 3BMXA 3RS5A 2B5WA 3A06A 2HHCA 2OZKA 3I1FA 4KU4A 4OFBA 3U7RA 2WWIA 1YVPA 1LNSA 2H1SA 1TUGA 4KODA 2R1TB 4O2AB 5A5DA 3SFTA 5BYAA 3G0HA 1ZWKA 2EIHA 3LIPA 2N42A 5JD5A 4HDMA 2FRXA 2VPZA 2QQFA 4U7JA 4YDHB 3H19A 1L5GB 4W1PA 5KHOC 3CYFA 3IE2A 3OCEA 1NULA 3JD2A 5KX5A 1GFIA 2C82A 2G4CA 1UM8A 2AR9A 3T34A 2H7XA 3WB2A 3F49S 3M3DA 1MENA 1ND5A 2VP0A 4BP3A 2XQGA 3E53A 4IOMA 1QDUA 3CF2A 3MNFA 2OZEA 2W8BB 1Y6QA 2J0EA 3I3OA 5IT0A 3GGDA 3A2KA 2WKSA 3I2KA 1M34B 4JKIA 1A27A 1WB4A 3FZEA 3SZUA 3PFHA 2C7RA 3PXGA 3U7HB 4F96A 4UXJA 3C4QA 2C9BA 4DIBA 2O8BB 4DLVA 1DQSA 1YTUA 3S3TA 2QN9A 1IL0A 3ZHOA 3K1JA 1OUMA 2AG8A 1E77A 4CU2A 3HU1A 1B16A 1U3UA 4WOJA 1K3UB 1EM8B 3OZEA 2V7EA 4X1YB 3V42A 3VTFA 4LMRA 3TLGB 4BMCA 1I6WA 1PD1A 2ZBDA 2VNSA 4DJAA 1NAHA 1V1MA 4XA8A 1UDWA 2FPIA 2FJPA 3ISJA 2M9MA 4XWOA 3LIIA 4D7AA 4MYDA 2Y8EA 1E66A 5DK6A 4D4KA 4TX1A 1LKZA 2P5TB 5CPBA 1AZSC 3CUYA 4RFVA 3CNQS 2BI7A 2PFSA 3AR9A 3M1AA 1RYFA 1BKDR 3PNQA 2X0EA 4C0BA 3W9SA 1VI2A 5FFMA 2Q7OE 4MI3A 4OEHA 4XLLA 3DGFC 1TK3A 2FHSA 5AD1A 1CUAA 3FHTA 2CNOA 2RGYA 3V8MA 2H7VA 3FB4A 1WCIA 3C41J 3IB6A 2WYHA 3L40A 4JLVA 1UP7A 1XCOA 2VT6A 3RV4A 3U61B 1FRQA 1P1JA 2P30A 4PNHA 2DHRA 3G6WA 5CBPA 5KVCA 1FFGA 4F97A 3I9FA 1NVTA 1M2OA 1CE8A 1SVUA 4R84A 1Y8RA 1SKMA 4F3YA 2ODEA 2JGAA 3ROXA 4KXLA 1AJEA 1RIFA 4R1TA 1UJCA 1X7DA 3K92A 1K7YA 3T12A 3DH0A 2R00C 2H92A 2FPSA 3I01A 1WS6A 3X2FA 3IOEA 4PZUA 3TXYA 1BMTA 1YDMA 3HJRA 1I36A 2GN9A 1Z8NA 1GYPA 3Q7QA 2OR3A 1NRJB 2AR7A 3HC7A 3C98A 2RJNA 3K7EA 4LWZA 5EE3A 2BLLA 2RMKA 3A8TA 1RU3A 3BB1A 3C3YA 3C5VA 1XI2A 1QIFA 2Q62A 2ZRDA 3DT6A 3KZXA 4ND2A 4OYLA 5E9AA 5CDFE 1Z6AA 2E4WA 5FWNA 1C3OA 5JIBA 4BPBA 3LCJA 3H5OA 1COZA 1XLTC 4RU1A 3SJBA 4UOZA 1D9ZA 1E60A 1YJ8A 2QL7A 3F7MA 3LBNA 4WZBE 1XVAA 3GU3A 4JVMA 4G4GA 4DCMA 1ZITA 2Z5GA 2WF6A 3ABQB 3HDHA 3NDPA 4V0RA 5FT9A 4LKOA 3U5ZB 1JJBA 4K81B 1Y5MA 5H7XA 1I3KA 3H9JA 1B2LA 1Y4DE 1I3NA 1UKYA 2ZOSA 1XNJA 1M1YA 2PEYA 1B8PA 3HYRA 4JLUA 1F4PA 4CEJA 5A9RA 4RD2A 5DW0A 2PNJA 1L5VA 3VC7A 2JFYA 3R4CA 3A2MA 3JVIA 2NTJA 3NM6B 2NSHA 1KJQA 1YI1A 2FOIA 2P8SA 1H4QA 1S3IA 1I10A 1Z56C 2R5NA 1WLYA 4KL8S 4ZCMA 2FQQA 3BRWD 1J0BA 3DMHA 2ZUTA 2YV5A 5J4KA 3C4JA 1A5TA 1VLQA 2Q8PA 4S1TA 1N7JA 2FSFA 1C4OA 3TL3A 1N3YA 3QU5A 3CEPB 3T1NA 2ENUA 4CLRB 1DBIA 5G3YA 5I7WA 3SDZA 3K09A 1VC2A 4HQNA 2D13A 3FKSD 3JQEA 2C7QA 2Y9PB 1KYIA 1Q1QA 4G0ZA 1TLFA 1IWPB 1Y3HA 4X20A 4AZ0A 1WVMA 3ODPA 1ZMXA 1VIDA 2QVCA 4HOYA 1UBOS 3BEDA 3J7TA 2HIMA 4RMNA 4Y6GB 5HEKA 3JWPA 2BZGA 1QH1A 1N0HA 1UJ4A 4EW3A 4L1KA 3AFIA 1WZEA 3CF4G 1V5WA 3IMFA 4RHXA 5CA0A 3OLWA 3VYSB 1FUEA 5ELLA 3A0RB 1XJ0A 3OX4A 4N9WA 1QV6A 4QXOA 4MH0R 3OJXA 4XUDA 5ALTA 5M7EA 2DUUA 1VMDA 2B3TA 2H4YA 3PUKA 1XZNA 5CHYA 2LGJA 3VU3A 1OU0A 2Q7XA 3F5MA 3E58A 3MSXA 2VK1A 4FQ7A 2OVFA 5C31A 3GPDG 4TLCA 2FFRA 4EQ6A 2PWAA 2NYVA 1JZSA 2ZIVB 3U4IA 3TX2A 2D0OB 4OK5A 4B6FA 1KP9A 4FMPA 3QVJA 3OECA 4ABTA 5JFOA 1WCV1 2UV8A 1BJTA 4R9UC 5THXA 5JSHA 1MG5A 3DWGA 5BQFA 1K9VF 3AHJA 4BO5A 2EKLA 2NOAA 1Y6FA 3KPUA 1RYYA 2YJZA 1JQDA 1OFTA 1S8NA 4NAHA 4DXAA 5T6BA 4E31A 2WB2A 2C29D 1YBHA 2I2CA 2TMGA 3FSJX 3PHLA 3E3AA 4AG5A 3DL4A 3OPYA 2AFIB 4L9RA 3IPLA 1XLUA 5FJJA 5GIOE 4EECA 1JAHA 1PEYA 1L4KA 3ICWA 4IQ4A 2QTMA 1JQAA 1USWA 4KO8A 6NULA 3VH2A 5JHHB 4LVCA 4E22A 1T3SA 2IHTA 2IYNA 2VNAA 1FX1A 2ZE6A 1UM9B 3FETA 4CMAA 2W2PA 4X1IB 1MNAA 5DULA 3LSTA 4FILA 5GM2A 4UULA 1YHYA 1XZQA 2C54A 1PFWA 4R2LA 4PXYA 4PF1A 4XR9A 3HKBA 5TQ2B 4A2PA 2CUTA 3T99A 3PC6A 4YBRA 1V8BA 2PGIA 4DCVA 5F5LA 1OAKA 4CVNA 4YP6A 4TSFD 2Q1UA 4W9NC 5CVUA 5ITVA 1GTRA 1ORRA 3BL5A 3N8IA 4EHLA 3CJQA 1HYGA 4NULA 2GJAA 3PWSA 3VR6D 1SVLA 1PR2A 2HHJA 5KREA 4I4CA 4JT4A 3E4DA 1NYTA 4DA6A 1RWNA 4MRAA 1MGOA 1M10A 1NR7A 1GGNA 5H9VA 4TLAA 1FP4B 1CXZA 2RC5A 5CURA 3VOBA 1R9NA 2X19A 5LP6C 4D4LA 2KBFA 3GG2A 1JYSA 5AQEA 5IT9A 1OR8A 3ED1A 1ZC3A 5KCMA 2OYRA 1M6VB 3IURA 5ALIA 3TLAA 1SB8A 1GKYA 2OGTA 4HLDA 3HXQA 1VLLA 3KLNA 4M9XA 1Q1BA 1USKA 3L82B 1PQ4A 3E3OA 3QTBA 4LW8A 3Q8KA 1QFYA 1FXWF 1AUVA 1E62A 2CMFA 1QCYA 2IV7A 3OCYA 1GVNB 2OCXA 1R8QA 3FD8A 1AQJA 3QZUA 4DA9A 1LVHA 2ZRIA 4ID9A 4Z99A 2R60A 3UB2A 3AKCA 2OILA 1I0AA 4II2A 4HSEA 1SR8A 4JL6A 4NCKA 3QUSA 1ZH8A 4JJ6A 1JWBB 3R24A 4DLUA 2J7PA 1VMEA 4X85A 3ZUGA 3FPJA 4G4IA 4HNAB 3PEVA 2QW0X 4U8GA 1HUQA 5C7IO 1PJ4A 2Z4RA 4TYNA 5HM6A 1KWGA 1YHZA 5F78A 1FZTA 3UQZA 3L7YA 3IAHA 1DEXA 1W5TA 4DLXA 3KAJA 5G41A 3DVAA 2B6NA 3LO5A 4X7BA 3R9IA 3I92A 4AKIA 4LXYA 5JAIA 4BC1A 1ZU5A 5CD9A 3EWIA 2JI4A 1C2YA 1NZJA 3JQ9C 4KE9A 5AKJA 3U3XA 3UAWA 3WGIA 4GKBA 1AQUA 3B5IA 4FDTA 5HGJA 3AR8A 4KRGA 2BONA 3MCTA 1TU4A 1IULA 3WP1B 3FNHA 5KTTA 4K9RA 1NN1A 3BF8A 4XRRA 1CBUA 2EJVA 4RGBA 1RXIA 3SXJA 3WBFA 1T5OA 4ZOCA 2ZZMA 1DINA 2QM0A 2R7NA 5DCWA 3C7CB 4AULA 1NVGA 1UPCA 1HL3A 1NSFA 2J3IA 1TMKA 2RHMA 5B7NA 2R7KA 4Y2JA 1HQKA 2OKGA 3D3EA 5I9BA 5TQ0B 3KV1A 3P7MA 3AR6A 1Z4MA 4H1HA 1RRFA 3A1SA 4MUIA 1NY6A 4X61A 1UINA 3A7EA 4BGDA 3AX6A 5A9SB 2KS6A 4L9AA 4QT0A 5KHLB 4DMMA 4DMRA 3H9CA 2FRDA 4GLBA 2OT3B 2H4WA 2F1KA 4JWTA 2VNIA 4UFPA 3L7OA 1NL3A 4HH3C 2AF4C 3A6ZA 2XKKA 3WSTA 1LX7A 1MIHA 1TW3A 2G28A 3EIWA 1KS9A 1W0JA 2YOFA 3N6VA 1GL6A 2JC3A 2OBYA 3RYIB 5J9FA 4CG0A 1TJVA 1L4EA 3NQ41 2ZSJA 3ETLA 4OXQA 4EKDA 5EWMB 5EJMA 4YT5A 4TTQA 5AUQA 3RRBA 1ZISA 4YUAA 2X8JB 3TRKA 3VR2D 2ZBEA 5EKDA 1R6XA 5DYGA 5LQAA 4DV1B 3ZD8A 1XKTA 4MZXA 1JFRA 1QYVA 4PFQA 1G60A 4MKIA 4R1NA 5IX8A 3I83A 2YOHA 3SHWA 1PL7A 3USES 1HLPA 1Y7HA 1JL3A 2R6AA 4HDSB 2PWYA 2NX2A 3THSA 3SZLA 3A9UA 3NC1C 2CUKA 1PHRA 1ICIA 2EOAA 3HNOA 2H5IA 1TD9A 3IBTA 3OSZA 2XYGA 4JMLA 4TV8F 5F7ZA 3U37A 4XCVA 4IHJA 1IB0A 1VKJA 2QVBA 3A6FA 1AQIA 3N28A 4GICA 4UHHA 3JZAA 1ADGA 1S3FA 4GNKA 3V8EA 4X66B 5EFOA 1K5GA 1SUPA 2Q3DA 2XYPA 1U0SY 2GZMA 2I76A 1NQAO 2VZ8A 4RZXA 3QBEA 3EZXA 1G21E 3IKJA 2W6JD 1JX6A 1WMEA 2C5HA 1KRHA 3WAKA 4QOJA 8ADHA 1NWHA 1ZD9A 2HBQA 4JS0A 4OMCA 5BQOA 4J94A 4IBOA 2BMWA 1S96A 3H9GA 3Q3VA 2W4IA 4P82A 3BWMA 4V0NA 2PUVA 3JAWB 5E9QA 3DD1A 1LWOA 2QTVA 5DT9A 5LMCA 1NN3A 3PWTA 4M0FA 2WBLC 3R6DA 4LMBA 2OK7A 5FTMA 521PA 3ZOKA 3EUEA 4GUDA 3KZKA 5AK3A 4C4ZA 4I55A 2VP6A 5ALKA 1KR5A 3IQXA 3MD9A 3QITA 4MPPA 3ZBTA 2VCYA 4MYSA 5IJ9A 1E4OA 4G0WA 1YZVA 2H4JA 1KAGA 3AY6A 3W78A 4TVBA 3WLSA 4PLVA 2HA2A 2GHRA 1QGDA 4XGRA 2PS9A 1OX5A 3ANNA 3EXAA 4XPZA 3ZI7A 1LH0A 1TZCA 2Q21A 4UMDA 2Q8QA 5C18A 1SXJE 1EXWA 3CUEF 4FK8A 4MVJG 4NI5A 4UE3S 3ZHBA 4CCAA 1H2XA 3RUEA 4YRNA 5CLFA 1WDLA 1GKLA 1XRNA 5CA1F 1AIPA 2DFNA 1MOSA 1P4JA 3KPYA 1IBCA 4GSYA 2PH7A 1L5HA 4UHEA 2R5FA 3KQSA 1Q1EA 4MO9A 3E2PA 4KMOA 3MOIA 3UHPA 2FWNA 1PKEA 5KWJA 3O3OB 5TMBA 4JSTA 5AJUA 4EPWA 3KALA 2Z2IA 4GEKA 3A9RA 5JI3E 1OROA 1MV8A 2FWAA 4PU0A 3HCPA 2PXHA 1XVLA 1YQTA 2I3GA 2ZKIA 4UREA 3UOGA 1DXQA 3GZJA 1ENPA 2YC4C 4RMGA 2C8JA 1K5PA 1XVIA 3EFOA 3JYQA 1M2FA 3AMVA 4B3MB 2XUIA 4D44A 2ASEA 3TPZA 3AWIA 4ZVRA 1QYDA 3WGHA 1ZA1A 1ZD1A 1OPRA 2BIFA 3IHKA 1LBSA 1E20A 4D45A 3U49A 5M2QA 1VHWA 2VJCA 3F6SA 4A8JC 3E5HA 1VSQA 4EVIA 5HQ3B 4GDFA 1N75A 3IJPA 5JDCC 5EWJB 2Y0CA 1K9SA 1E2JA 5CX4A 5GJBA 5EJAA 1NYLA 1HETA 3KS9A 5FR1A 1B15A 1SXJC 4NWIA 4CKCA 4HYEA 5ALMA 4WZAA 1CUUA 1V95A 2QPTA 1HDYA 3C6QA 3TQRA 2NYUA 4QNRA 3CZAA 4QHYA 3R7NA 2E9SA 2K5UA 2QTZA 3CTPA 4IIDA 3Q6MA 3UIEA 2BSQA 4NK5A 1IXKA 2QZ9A 3VR5A 3B1FA 4F3KA 4M1ZA 2ECKA 3FCXA 2CFOA 3MHPA 3WNVA 3GWGA 1SHKA 1C1DB 2HMVA 1JE0A 1JQBA 3B2QA 2G77B 1V4NA 1R0KA 3OFJA 4JD5A 4F9GA 2Q07A 1L5WA 1CNFA 2YWGA 2Q2OA 1KEUA 2NGRA 4NHEA 3L06A 4KQ1A 1UFKA 1EZ1A 2PUBA 1UXKA 3JAKB 4DV5B 5FFFA 1MXHA 3BFKA 3O3CA 3PTLA 2BDTA 4TMYA 4CM8A 2O2EA 4FFBB 4KQEA 3K0AB 1G8SA 4B4WA 5HDQA 2XUQA 1OSNA 4BBZA 3DVSX 4MVWA 4O2AF 2Z95A 1WCWA 4DVJA 3RVKA 4KXYA 1A5AB 3GCGA 3GGGA 1IUOA 2UKDA 4OCZA 1H69A 3D6AA 3MLAA 1NMEA 1I2CA 1RPJA 2V98A 2WHPA 3KYCB 4FGUA 4R1SA 2I3BA 4RL6A 5EMNA 3QMWA 1ZH6A 4ARSA 4EY6A 1YZLA 1R0YA 3FMPB 3K2BA 4CGZA 1N8SA 2F62A 4Y7CA 2NXWA 4M1YA 5JG7A 3MOSA 1A3CA 1TVKA 4YO8A 3IELA 5D00A 1NUPA 1DZIA 5FFNA 2PWZA 3GVCA 1IYZA 2JEOA 3O8NA 2CNBA 1YTLA 4L76A 1XAGA 4BO9A 2D3TA 2HPAA 3W9YA 4F2DA 5HPYB 1J49A 2PKYX 4I4TB 3IBYA 4EYEA 4KX3A 1KS2A 2F3PA 1GPYA 2O7SA 4MMZB 4BB5A 1AV7A 2X0RA 1OJ7A 2W70A 1X70A 1WB5A 3JX9A 3N1UA 3JRXA 4TSKA 1VLMA 4LGCA 5KB3A 3T5PA 3EH1A 2HLDA 2P65A 3EW9A 1XT6A 4PNZA 2BM0A 2FW7A 2NN3C 2VRCA 3KJXA 3KKOA 2JAOA 1Q3HA 1L5OA 3NV9A 5EIWA 1V5EA 3RAEC 3N07A 1N2SA 1DRJA 3KOOA 4GPBA 1VSUA 3HUUA 3IQIX 3VDQA 4B09A 2UXCB 2C31A 3HEAA 3B48A 2XKAA 3KKZA 1T0UA 1BXZA 5AJWA 4BUZA 4HH4A 1AQNA 2YWXA 3BE8A 3AOEC 4KVFA 3I23A 3H9UA 3PC3A 3QELB 3AEKB 1Z2EA 2G70A 1TZKA 2FG7C 4NYJQ 4NV0A 1M73E 1H0SA 1HYQA 5CJPA 4ONEA 1VKRA 1X38A 4MX2A 2GM9A 3QXXA 4S1VA 4AJJA 5GWXA 4MQEB 1LA2A 4Q82A 1DAHA 4F60A 3THWB 1BDMA 1Z75A 4N1AA 4BFZA 4AZSA 5LFAA 4FX5A 3PGLA 2JKVA 4AY5A 2BGWA 2Z56A 4EFNA 1Y81A 4FJ0A 4KHPB 5DMXA 1ZJ6A 4KSYA 1FFAA 1GNLA 1QJCA 1J2EA 4L75A 5TGTA 2DLNA 3KOWA 1Z0ZA 3H83A 2AG6A 4RD4A 3PFFA 2YV4A 4PLTA 5EIHA 4HGNA 1NPYA 2XY4A 3AETB 3PITA 4EEXA 2J3HA 2G6TA 3KUXA 5ALRA 2C2BA 2OXRA 2OE2A 3HZOA 4YROA 3F7NA 4GNRA 5FQNA 5ARCA 3DE0X 4C03A 2GN6A 1XMSA 2Q0XA 2EWWA 3CSUA 3H2BA 1F2TA 5A62A 4A8JB 2CWWA 3UPUA 1UJBA 1CSEE 3SFVA 2COEA 2BV3A 4QULA 3CF6R 3LQYA 1XJWA 2ZYVX 2PL1A 4BL5A 1MB2A 2FKNA 1LVUA 4Y2XA 1F7VA 1SXJB 2OAP1 1Q12A 1LBIA 4FHGA 5IP5A 5JC8A 3UJ3X 2GI4A 3V7NA 5IWCA 5HKOA 5JJKA 5IAJA 2Y99A 3M2PA 3TSOA 1DRWA 4FW9A 3VPXA 1QG2A 1OHHA 3LVBA 3IVGA 3FVRA 1SCIA 1TMGE 4GKJB 2BUCA 2FPGB 3ENZA 3EHDA 3X43A 2O8CB 3VPFA 3OPVA 2ICAA 1LDEA 2GN2A 1OC4A 3BXXA 3EXHA 4NIMA 1VL0A 1J2RA 3ROFA 2FPLA 1E5VA 3EMVA 2NPOA 4RQTA 1P44A 4W7HA 1RVV1 3MQ2A 3Q12A 4GHWA 3MJDA 4WX2B 5AXBA 3PSHA 3ZCRA 1PUJA 4CEIA 1YIDA 2FRVA 4WK2B 3BJRA 4LHSA 2FMHA 3AI3A 4REOA 4YK7A 4GDMA 3RUCA 4ETWA 3LGXA 4EHJA 2V59A 4DSOA 3LPMA 3EVGA 1J97A 2FWMX 3ICVA 4OHBA 4DRYA 5D2CA 3SCZA 4JLBA 2ZXEA 4EUKA 2HQSA 3PGKA 4B73A 3RFXA 4H4DA 2GLTA 5IF9A 4Q0MA 2CFTA 1OH6A 3OZAA 5LZ8A 3UMRA 2D0DA 2EP5A 3AFHA 3RI3A 1E7QA 3L7BA 5M5BA 3RS2A 5L51A 1S0UA 1N2HA 2RHRA 3DV9A 1DCNA 1DCFA 4UUBA 4POOA 5EP4A 4AQYB 3EF0A 1OZFA 2VG8A 2YY6A 4TMZA 1NMYA 4ZDJA 3KB6A 3LL7A 1V11A 1G42A 4YACA 2FEOA 5JATA 4DWWA 1KQFA 2DFLA 2HUNA 2C5GA 2CLHB 3EVZA 3GFPA 1JDUA 5IKOA 3RIHA 3HLYA 1X7ZA 1XYYA 1PJLA 5EL0A 5B2FA 2VK8A 4TL6A 4B8YA 1PJSA 1K8XB 3GD5A 4D0SA 1H3FA 1HC7A 3EZYA 3KZVA 2EX1A 5C8VA 2LUOA 3EBPA 4X6LA 3KQWA 3KQTA 1U0BB 2OCBA 2Z8ZA 2AW5A 2XHEA 3IE1A 4JELA 1GTG1 2YV2A 1QQ6A 1ILWA 1P0CA 3FPSA 5FBVB 4WBXC 5BW6B 4XCXA 2CFRA 1AKTA 3OPXA 4Y1FA 5IT4A 5J2UB 3ETGA 1HY1A 4R3UC 5GINE 3U4GA 1E3SA 5FBRB 2NU6A 3L1HA 1DUVG 3GARA 1WNTA 4YO7A 1RZVA 5LDGA 4XSVA 1FNDA 3K0BA 1KK3A 2WW8A 3PEUA 2IOFA 2CXRA 4JJFA 2LIPA 5BN5B 1M7HA 4IJVA 5BSKA 4C04A 3EC2A 1ZBQA 2JGEA 3H1FA 4Y2GA 3TZCA 2WSYB 4BX3A 1VLVA 4OGWA 1UMCB 4G5HA 3GRVA 4YRTA 3JQ7A 4ZT4A 4BQEA 2GMWA 1JFFA 2IVZA 3CZCA 3PNSA 3WWZA 1Z0SA 4B3XA 4W5QA 1EUDB 1IZYA 2OUKA 2YVUA 2PKXA 4P4SA 4F72A 4L6AA 5JXJA 4Y30A 4ARVA 1SD5A 2X2FA 4MQ6A 5JZVA 2IIQA 2G80A 4OUDB 1DE0A 1BG6A 3EPRA 3L0YA 1CD5A 1J09A 3AU9A 3EQ9A 2GJ9A 4N0DA 4QICA 1L5ZA 5EQJB 1GPNA 3KG2A 3BTSA 3H5NA 1FFCA 1PJZA 1UQTA 3O8BA 3K96A 2ZXUA 2RONA 3GNQA 1MX5A 4HGRA 3URMA 4RJKA 4MHTA 3W8NA 2GPBA 1T9DA 1LBTA 3II6X 5JUWA 1R6DA 1E3MA 2HZBA 1BGXT 1I4TD 4RM2A 4RVSA 2IYTA 2AOUB 4NSNA 4QGHA 2DC1A 5IYZA 2Y0DA 2V6GA 4Q05A 5DTMA 4WLOA 1XALA 3ONDA 1TYCA 5ALSA 1XELA 1OIXA 1EHYA 4YJ3B 4U2KA 4R31A 1LJ8A 4K9DA 4BO6A 4MA4A 3SBDA 1CEXA 3A6PC 3LP6A 4C1BA 1VJGA 2CY0A 4P7FA 3ADBA 4G0VA 1SBQA 5EUBA 4YYZA 4KFCA 1N33B 3LP5A 3Q9NA 5DWDA 5F9MA 2AKEA 2H7CA 1Y5RA 2PEZA 2ZREA 2ACVA 3CLRD 2BMAA 4GWGA 4I46A 4YV7A 5E7JA 1LI4A 3IDSA 3MFQA 5AK6A 2FLKA 3UT0A 2UVDA 4EMSA 4ZI2A 4R6WA 4YRQA 3TZQA 1L7DA 3MWEA 4E07A 3EUFA 2G63A 3CUTA 2AMYA 3AL2A 3QHQA 2AN3A 2R8YA 4DNPA 1YUMA 1XHEA 3R6WA 1MPXA 1N2CE 4YQYA 3ROGA 2A3RA 3CXUA 1TCVA 3OC0A 4HGQA 1T0JB 4OL9A 3DYVA 4BX9A 3TOVA 5BN1A 3NOQA 2PUTA 3PJEA 3PNBA 4YECA 3KRTA 5FAKA 2REQB 3PPIA 5K3OA 1L8QA 2TECE 1VIMA 4DKJA 3ZGZA 1T1SA 2IQIA 1PJTA 1Y98A 2X0JA 1W35A 5B64A 1Z0UA 1ZONA 1CS0B 1KHTA 2WIAA 3BIJA 3DKRA 4GLFA 4LHEA 4UU7A 4PR3A 1Q74A 3SR3A 3Q8LA 4Y1RA 3G49A 5AMXA 1BYIA 4BNZA 1UDRA 4PTYA 3EVDA 1EAMA 4CKYA 3EPJA 1XEAA 4G37A 3NU1A 3IJEB 3AL0C 4QX6A 3ZE0B 3I42A 2G9QA 5B3JC 5LOVB 4N03A 4OQFA 1X8XA 3A7DA 3LHIA 3U1BA 3WRXC 3TOZA 1YS1X 3QTLA 4B76A 5DTIA 2VCEA 3A04A 5TR9A 2V55B 3JASB 2YXEA 2YXBA 3EJ6A 3KQYA 2REBA 5FPKA 1N77A 3FBGA 3ZIAA 1ST3A 2JD1A 2E21A 4PHFA 2YDYA 2AG5A 3HUDA 3EG5A 2XB6A 3A6DA 3G89A 2DKOA 1JHMA 4Q1DA 2WWTA 1VCMA 3WMRA 1KPIA 4Z4GA 5I3CA 3QLJA 3WADA 2CL6X 2JFOA 2XT9A 1M0SA 2GZHA 4RGQA 5HFJA 4JLNA 1R15A 5JPCA 4J9UE 1NLYA 2HA5A 4HO1X 4Y6RA 2QROA 4ZV7A 4CTNA 4QFDA 1TEXA 1TE2A 3WJAA 2EIXA 3IP8A 5EE5B 1N7IA 2OZVA 4B5LA 4BZXA 4ZTUB 2DEUA 2QVYX 1IJFA 1XMJA 4M1OA 2MSKA 4UU1A 5D1HA 5H4HA 1KZHA 1JKMA 4JI3B 5B57C 1KI2A 2V3CC 5CX1A 1TT7A 4DY6A 1Z8HA 1UDXA 2GD6A 4JSRA 4A2WA 1BRMA 3A6GA 5DGIA 1HEUA 4XAQA 3D7RA 3F8TA 3JR3A 3HSSA 2BMDA 1VYVA 3JD4A 3NWPA 4UDYX 1CUZA 1ZD2P 2WP0A 1ZUNA 4LTMA 3BE5A 1NF8A 3I73A 4ZKEA 2PR2A 2BHSA 3ZDZB 3OZIA 5BRJA 1BXGA 4X0EA 2FQ1A 3MJEA 2GYYA 5IEJA 3TW4A 3K2IA 5DZSA 4MTLA 4MVJI 4MWEA 2H9YA 4PXAA 5I4IA 4MV6A 5DRTA 4GI7A 4ALKA 1RPTA 1W4BA 3LX8A 4Q1VA 3X1DA 3ABSB 2ATCA 2VSOA 1UWCA 1EGAA 1U7DA 4QNNA 4DZTA 3BHGA 2GPAA 4EYQA 4YPOA 5IVKA 3F6RA 2C5AA 1SHZA 2XZDA 4IXTA 3V4LA 4BJ3A 4D0LB 1NNEA 4Q9DA 4I3GA 4XE5A 1OPXA 2AG0A 2AZXA 2BHLA 2XB8A 1PEAA 1GAWA 1SG6A 4UBKA 1TQDA 3RVRA 5FWXB 1JG4A 2NZVG 4D9HA 1MLDA 1GZ5A 3QIVA 5DK4A 4CNQA 1G20B 3CZ9A 2G0NA 1G6KA 4MULA 2VTKA 2BTOA 1YRQA 2WUDA 2J59A 2JK1A 2O7QA 2XGMA 3F90A 3NRBA 3QE0A 4KV7A 4QGAA 4V0LA 1ULUA 4WOPA 2GPYA 3DPSA 3KELA 4GWKA 1T8WA 3ZCUA 3WB0A 1P81A 1ZFNA 2Y0PA 2ZITA 3HR4A 1W8DA 3O94A 4LHZA 1XZDA 3R7SA 1E99A 3RFFA 1XTPA 4U7PB 4BB9A 4QUGA 4F4IA 3JQRA 1E9DA 4TZ0A 4C4YA 3D0RA 3BK1A 1XDGA 2C92A 4OL0A 1MC1A 1OA1A 2HPVA 4UARA 3SWWA 3F5DA 1EUQA 1YCGA 3OM0A 5EEGA 4YYEA 4E33A 1CB0A 1IJBA 5TVKA 1RM0A 4G01B 4KPUA 4I6JA 4NF2A 2D3WA 2Q2WA 3G9QA 4URUR 3ZQKA 3B38A 5JCZA 2QE6A 3KEOA 2H4XA 1ZMOA 4IDNA 2GAFA 4ZEMA 5JSUA 1OB2A 4MP3A 3IX7A 1E96A 4HGYA 3VHXA 4F2HA 4WWHA 1BDHA 1QP0A 2CSXA 1BNCA 3JRWA 3LY7A 3W4IA 1BTOA 1JTVA 2Y1WA 3DBHA 3EG9B 1CT9A 5T57A 2NAFA 4C0QC 3OFKA 4JEHA 1IBMB 2X14A 1U15A 1EHCA 3CINA 1IU9A 4PS0A 3RFCA 3UTDA 4HGPA 3A1WA 3G59A 3UWDA 4BEVA 1ZSNA 4IDQA 4K6KA 4PHHA 4NH0A 5F76A 4UTVA 5C8DA 3CRQA 3CY6A 2WQ7A 1N1MA 3KSRA 3M6FA 4WN9A 3T5BA 4HMOA 1KQNA 1BD4A 1MRNA 1Y9AA 4H60A 5J63A 5KYYA 4ER3A 4LSWA 5LQRA 3S7TA 3WOVA 4BJ1A 3AZPA 4DA0A 4LEIA 4WNCA 2JGFA 3CUVA 4RDCA 4OJYA 4FXOA 2NVWA 1OYOA 3PFNA 1LDMA 2AFHB 4JN6B 3RS8A 3T7IA 3WO1A 3NBXX 4V03A 4A0HA 4D9MA 1JIKA 1ZG3A 1QOPB 4B6SA 2R2GA 4DS3A 4EO7A 3GLIB 4Z4FA 1DJNA 1SUSA 3AESB 3GFVA 3U1TA 5I9SA 5F3RA 2QTBA 4WH0A 4FOPA 1H65A 1RBZA 4W8HA 4W63A 5M04A 3MHTA 2ZIZA 3W8DA 1MB4A 1KZ9A 4YLYA 2PXCA 3ORRA 4W1QA 4HN4B 5AVQA 3QEJA 1VCOA 1O9GA 3E6AA 4PSCA 3GLHE 2C5LA 1UPUA 4LMAA 4GMHA 2DXIA 4LF9B 1JVNA 1LEHA 2Z2JA 3L84A 4OM8A 4ERXA 4RM3A 5LCXA 2W2KA 3EQ6A 4MK4A 3CVXA 4N47A 2ZSBA 3BDIA 3PDHA 2VXBA 1JXOA 2QJOA 5EZQA 1P3JA 1PNOA 3D3NA 3OZVA 4C4PA 3TR6A 5I9NA 1GPWB 3NVKI 4QBGB 5IXYA 3RWBA 3NEYA 1BRTA 1S8OA 1QQAA 1R9JA 5D3ZA 4PYNA 3VNQA 1JIQA 3ZW8A 4CR6A 2E3JA 3OEYA 5JSZB 3IIIA 4KSCA 4IKEA 5TNXA 4RZUA 3AVTA 1FTSA 1L4UA 1M5UA 1TQHA 3W5DA 4MYTA 3UZUA 3JQ8A 4BNVA 1DUSA 1YK0A 3VZSA 2AOTA 4C5BA 2UZ1B 2CXQA 4WKNA 2C2GA 2IDKA 3E1GA 3H1BA 1Z2PX 1PR0A 5K9ZA 1JECA 1QHHA 3H2GA 3KQQA 4I4TF 1L1RA 4J7XA 1WEHA 2J6HA 1MW9X 3JZIA 3Q1KA 2OZPA 5E0OA 5CCXA 3TZEA 3WSVA 2V6FA 1OASA 1QHGA 2PA3A 3QNUA 1C3VA 1VGRA 4WCFA 4NPCA 4QYXA 1GGFA 4BASA 3HGMA 1KY5A 1CVRA 4J07A 5KCZA 2G88A 1H4TA 3V8NA 2CHUA 2GZSA 4HNRA 2XOXA 3R5SA 1H2HA 4TUYA 1T4CA 4UBIA 4ND5A 3PUJA 2EP8A 1I7PA 5IANA 1C30B 1XDWA 4W8GA 3H7AA 3K9BA 2HN9A 1Z82A 3A6LA 3DXYA 5CYFA 3EXIB 4B6JA 1W7AA 2OK8A 1JFSA 5AVZA 2WJPA 5U9CA 4N6GA 3B89A 4BP9A 2JD0A 4QQFA 4ASUD 1L7QA 1OGJA 2MSLA 3LQRA 1XEFA 4OHOA 2ORWA 3AYZB 3HKDB 4KNWA 5L9AA 5E4JA 3OZRA 4ENPA 1CF4A 2VSYA 1RHUA 2IYZA 3AUTA 3FBWA 3IBCA 3DFMA 5LKAA 3GLFA 1G2OA 1IQPA 3RIMA 1YHNA 3PXUA 3ER9A 4OQYA 4QXRA 2NZ8A 4MDEA 3MTAA 3HO1A 3O9ZA 4Q03A 3AJEA 4P92A 1UBLS 3ZE6A 1CUDA 4R5HA 4NOMA 2VJOA 4JUDX 2O2YA 3I12A 5ALOA 1GGEA 1V9CA 4YTEA 4ACBA 4BEBA 2WWWA 1XZEA 4QDOA 1XZLA 2BFAA 2NO1A 2PWPA 2R6JA 4H7IA 5A03A 2GSWA 1U3TA 5ENVA 1DAMA 1V96A 1TLTA 2HF9A 4Q24A 5K0CA 4NFLA 3WIVA 1J90A 1K7EB 3NHAA 4KRFA 1JKJA 1VG9B 1ONNA 3DEYX 5ICMA 1NF2A 4PYQA 2JAPA 1T6YA 3GLKA 3QP9A 5K6AC 3ZYZA 5AKZA 1RJGA 1UAYA 2FGJA 3BQNB 3MOGA 2OFXA 4KMSA 1D04A 3WA7A 2FYTA 1GUBA 2ORYA 4ZVOA 4LF7B 2VBFA 3DNMA 3GVIA 3B6ZA 4GBJA 2C84A 2OXIA 3VPGA 4E5UA 1G5RA 3F5FA 4I8DA 3QE3A 4A1OA 1HLDA 4C7VA 5LIPA 1KI6B 4I81A 2J3JA 2X77A 2N1BA 3WK5A 3SNKA 1YXMA 1UKEA 5BMVB 1C3UA 1J99A 5JNRA 2BI8A 3HRHA 3JWGA 3V8BA 4IUCS 1RI1A 1KSGA 1MABB 6ADHA 1JGTA 3OTWA 4W1RA 4ZU6X 1X7XA 3PEFA 2DH6A 4EM6A 3K0FA 2JIZA 4KV9A 4BO3A 4RTMA 4U2CA 3FPCA 1KE1A 1E1QD 2ZYAA 3PWZA 3TINA 1ZXXA 4BJ6A 2A9QA 4FFPA 4EPRA 5EJ8A 3GUCA 5DM70 1PTJA 3PVZA 1R4MA 2RHDA 3L8FA 3L0CA 1BQ3A 2PIDA 3NAQA 3L8GA 1E1LA 2H4FA 2NYAA 3FDZA 3IQEA 5KYXB 4QZVA 3I09A 2F9LA 2OB2A 4WD3A 3ZVKA 2RCNA 2J8ZA 1TL7C 1JR4A 2QI9C 1NXXA 2QZJA 2WAAA 3PCRB 3QWFA 2X7XA 3WL5A 3WV4A 3EK2A 3ZCXA 1NV9A 5CDUA 1OYYA 4MS1B 1SHJA 1E8DA 2P35A 1NSYA 2XSZA 1CY8A 1NDUA 1MH9A 3EE6A 4C07A 3LBIA 3PQ7A 4O4HA 4N5HX 5J4LA 4DNFA 1XDDA 3HV2A 4R54A 1EFLA 1KMQA 1YOVB 3OA0A 3O8OB 2GS9A 3PXBA 4J7AA 3W5UA 1E3QA 4Y9RA 1N8NA 2IDJA 4TWZA 4HNSA 2YINC 3PX7A 1OV4A 3D4PA 3RU9A 1HRKA 1WAMA 4JP5A 3VX4A 2M32A 1RYNA 4JUBA 3HU5A 4ZRNA 5LVAA 2VK2A 1JEOA 4ZCSA 4V0QA 1S2NA 1IY8A 2BSXA 1M2GA 3ASVA 4K88A 5C5DA 1NN5A 1W59A 1Y7IA 5D3QA 1A71A 4NU6A 4KQGA 1CQJA 4BQRA 1CHDA 4NBNA 3D54D 3ZVNA 2WU0A 4TKZA 3NUGA 3ABOB 1QH0A 3VSBA 4JP8A 4XWTA 1HNNA 2YWFA 5JISA 3AJAA 2O8FA 3IKLA 1VLZA 4B3DA 4MVJA 1JG3A 4LUCA 3NBYC 4MB2A 1UADA 2ROQA 3JQAA 4BNKA 4DMFA 3UM9A 1XAHA 2M98A 3BMOA 2V7WA 4HTFA 2F1OA 3U39A 1LPNA 5EWLB 1BXRA 3UBMA 1TA0A 5EINA 1SELA 3BSSA 3MT0A 2YWCA 5LA6B 1CZKA 1ZJJA 2AVNA 2MINB 4XSHA 5J2UF 3QX3A 1BHJA 2VT7A 2FZKA 1Y33E 3GEGA 4G5GA 1FNMA 1VDZA 5F1KA 5IAGA 3FOFC 4CIWA 4IM7A 5J2TB 4NCNA 4RKEA 4F4FA 1AKWA 3RVDA 4M0LA 3NEAA 3DF9A 4GMGA 3RK0A 1Q3KA 4K0RA 3SKVA 1TB4A 5K4HA 2IHKA 1CUFA 1NVEA 1GUDA 1SCKA 2V1UA 5EMLA 5ENDA 4Q3KA 1AKYA 4X24A 3SC2A 5KS2A 1M74A 4XB1A 1PZGA 5E4TA 3TUZC 5DX0A 3LUCA 3T3IA 3IEPA 1TCBA 2QG9A 3A3OA 3LM8A 5K8VA 1A9YA 3HBMA 3CH5A 1XWOA 2SHKA 3WXBA 3HBFA 1SEPA 1TFUA 2HDOA 3C8HA 4R83A 4KDFA 5B1IA 1U8UA 2QQGA 2RGNC 1B93A 4L08A 3FR8A 1I3CA 1YS6A 5FWYA 2PMFA 3I8XA 4ZK6A 2G5CA 2VJMA 2YWJA 4KYUA 4ZMBA 4ZI7A 5EAIA 1U2DC 1FFXA 1OD6A 1A76A 2BE7A 1HDGO 5ES4B 1TUBA 4AYWA 4NXMB 3TQHA 4IDGA 1YA6A 1G0NA 4U0JA 2O1EA 2NTVA 3SQDA 1XXHA 3NVAA 3SX0A 1TYAE 3DB1A 4R7GA 4AK9A 4KUHA 5LMUB 3GUUA 4FS8A 2UZ0A 5DE3A 1VL6A 2D1QA 1ISFA 1PKXA 4ZIRB 3S2FA 3UUFA 3G9XA 4R1LA 4H1UA 1SC6A 1IATA 1P8JA 2JHAA 3GFTA 3JARB 2VDWA 4FCVA 4FYHA 3R6VA 4NMHA 4ZCRA 3BCUA 3HCNA 4E0BA 1T8PA 4HUQA 2AWOA 1P17A 3HBNA 3BILA 4OUKX 4PFSA 2ZIUB 1M2VA 1RQNA 1WP9A 1BE6A 2ZSUA 4X54A 5I7UA 1LQ2A 3L1KA 4NCIA 5LNK6 2TMKA 3A9SA 1G2IA 1SXGA 1YBFA 1ZK1A 2C96A 4KPFC 4EG1A 2ZJ5A 1HY0A 3BN3A 1NHWA 2V8BA 4QXPA 5BT9A 3G7UA 1F5SA 3RG8A 1Q0TA 1QPGA 3LUKA 4M98A 4QPDA 5KTOA 3F71A 1ZMBA 1RW4A 3ZGYA 3DS8A 1P29A 4J16A 4P53A 3V6MA 2X9LA 3B8HA 3BMNB 5HJ7A 3FPBA 2QSYA 4PN3A 3HUFA 4PGHA 4Z53A 1XRRA 3QPWA 2A94A 3NW9A 4MIKA 1DJPA 1UK6A 5ULLA 3ZNQA 1YZGA 2EGHA 5BW5A 3DKKA 1FNBA 2VHTA 2C4UA 4C14A 2V0GA 1Y5LA 1MQAA 1K8QA 1SU4A 4ZO6A 3W6OA 4PSDA 4ROTA 1RXSA 3DZJA 3BE4A 1TIKA 1J0XO 1QAOA 3C24A 1G7TA 4F1KA 3LYHA 1YACA 1DSSG 3BK7A 3TMAA 4YMHA 3MN1A 4CMIA 3DBOB 1ZGZA 1OXSC 1E58A 1SU8A 4U0KA 1S02A 3GRYA 1WV0A 2NW6A 4MROA 1XQ1A 3VR6H 5BN3A 5AP9A 1NHGA 2WVHA 3X1YA 4ML3A 2QU8A 2VHEA 5LOVF 1UFOA 1TDJA 5KC9A 2DSTA 1R10A 1CZLA 1W36D 2NAPA 1XPOA 4DZRA 4OLJA 3PJFA 3AUUA 1VHTA 4PQRA 2YCLA 1HDOA 1YRYE 3IV7A 2KE5A 2HMYB 1XD9A 2JIDA 1UBFA 4OP3A 5HE9A 2NV0A 2R1VB 1YGYA 2VO1A 2B7LA 3FNRA 1W4RA 1YNSA 2WB4A 5JCJD 4DIDA 5HX7A 3X1JA 3T1VA 1JNXX 3BAZA 3GDFA 3KCQA 5IM5A 1YR7A 3TX6A 4F93B 1EI9A 4EW6A 4L5IA 4MXDA 2GK4A 2DVMA 4CDNA 3WLMA 4DDTA 4URXR 2VTBA 1K4MA 2GHQA 5F7XA 2VKQA 2GK7A 3CN7A 4DV0B 4YASA 4BB6A 3RGWS 2IUFA 1X7GA 2H5JA 1RFLA 2VP4A 2XIJA 2ZJBA 5DHSA 5KYKA 2F1RA 3EWAA 3GY0A 3OQJA 1Z3IX 2MSNA 3JU3A 5G4LA 3R3VA 1IHOA 3CRZA 1BFDA 3H7IA 3GFFA 4OK6A 3E04A 3IAXA 2IU0A 4ZDIA 3EX7C 3IMKA 3UCFA 2XAUA 3QBJA 4DT1A 4ZVKA 5D6OA 2PZMA 2XUPA 4ZK2A 1M1UA 1XK7A 3TIFA 4DSNA 2GXUA 1OGIA 3F9IA 5JY6A 2I4IA 2A1UB 4KIFA 4X3OA 4PSUA 4ECAA 4L7QA 3UW3A 1UR5A 1LXCA 5DJ5A 2R0QC 2XADA 1IHXA 1Z12A 3FH0A 1QMGA 1XD2A 4UCWA 3C8UA 3ORHA 2BFBB 5I7AA 3OIYA 4WLNA 2MHCA 3RH0A 3KSUA 3AINA 4KQIA 1C50A 1DTWB 1JSZA 2GN0A 3H5RA 1T1EA 3ANTA 3L6EA 3W5AA 4RENA 5HZGA 2RIPA 1ZCAA 2AEEA 3RIYA 2Q3CA 4P3PA 1V3TA 3SJ7A 4RUKA 3VZPA 4BYMA 2J6BA 4E5MA 4QA9A 2HKIA 1OXBB 1V3UA 1ULBA 5CEJA 2DF8A 5LN1A 3GBSA 3MJ4A 4K9SA 4OJNA 1M2WA 3UXHA 4XWYA 2N47A 2HJ9A 4AUMA 2H2FA 2WR8A 1FLAA 5ER6A 3WLRA 1I7SB 1KU6A 5HBGA 4A0GA 3LUJA 4IIJB 4IS3A 3AERA 4D8XA 2GYWA 4AMZA 4ZCTA 4XARA 1E98A 1KERA 2GPJA 1NSTA 2R6ZA 2CHVA 3Q0EA 2IF0A 3I6QA 3EGVA 3O3MB 3D2CA 3SM9A 2O6LA 3TRHA 3T35A 1NVVQ 3P19A 3KZ1E 2GBLC 2J33A 4G41A 1U2SA 5SZKB 1UXJA 3NFRA 4DIFA 3TW8B 3MUFA 2VA8A 1EA7A 4FX2A 1QZTA 3U4QA 4JUCA 1NBMD 5E3IA 3FX2A 3BD7A 1M5RA 1IXZA 3WGJA 3LOUA 4I5FA 4RF3A 2FMFA 1E5DA 2QVZX 3K9CA 3Q40A 2QLTA 4TXHA 3CLSD 4J3NA 4QJ3A 5DNUA 2ZR0A 4PX5A 3C1AA 4H16A 1OXUA 2XRYA 3ZWMA 1E0JA 2GDZA 3WKDA 3KDAA 1X9GA 1XX6A 2CLIB 3HA5A 2VTVA 4AS1A 4V38A 3F0TA 3ENVA 4INAA 5KPDA 3FOCA 1RWVA 1H42A 1CQIA 3IEXA 1WKBA 1XZGA 5HFAA 4DTCA 3I9NA 3B2NA 4HMQA 3LZDA 5FPTA 3D4OA 4YRIA 5CXXA 5KTYA 1O8CA 1YA8A 3KXPA 1FRFS 1MB0A 1ZVMA 2DUWA 1C4XA 2H6EA 1VKHA 4PG6A 2I78A 5E1BA 2H5EA 2ZIEA 4UNRA 5I9LA 1N92A 3D4LA 1FYFA 2Z57A 3BFXA 4MAMA 1PYGA 4FGJA 4JVSB 4RVOA 1ATIA 1OWLA 3NXKA 3DTTA 4F4CA 1FS4A 1NQTA 3AUSA 3OLVA 1NR5A 3NAGA 1DXHA 1DJLA 2H1LA 4X45A 4EA7A 2EG5A 2FSUA 2EDAA 3PUIA 1K06A 3FSEA 2P0AA 1OFIA 1B6RA 1YQDA 3ISVA 3DUFA 3NCTA 3OSUA 3P2MA 1GYQA 4X92A 3S6JA 5IKPA 3VPDA 1XZAA 2YMLA 3ZWCA 5I48A 5IMSA 3DL0A 3OOYA 3HO6A 3QF4B 9ABPA 2BEUB 1BGVA 1KGSA 2HO5A 2G9ZA 3GLQA 2H63A 4UMEA 1UXIA 5FHQA 3IP6A 4D6YA 4JDPA 3TL2A 3U6KA 3GN2A 4YR9A 1NVMB 3DE2X 5TARA 4QQRA 2XQVA 3THRA 1QP4A 1JPNA 3FPAA 1U63A 2DB3A 1RQLA 1EVYA 1QVRA 2W2VA 2UYHA 1S4QA 1GPDG 1TK9A 4KXNA 5B55A 5LUAA 5AUNB 4YV0A 1U1IA 1XTZA 2RC6A 4YUYA 4IFTA 3R0VA 1U9ZA 1K92A 4L8GA 1G8PA 4MDYA 4J43A 4QVIA 5HP4A 2C2HA 4DQDA 3EXG2 1NI5A 5EJ9A 2WKWA 2AX4A 4LY6A 1N32B 2NQTA 3PHJA 4JEIA 1X8JA 2HK8A 3BH0A 4FE3A 5D3MA 4PW0A 4CM7A 3GLFE 4WBNB 1TXGA 2B4KA 3MGAA 5CVEA 4Q48A 4J1TC 2GKGA 3DOOA 3EYAA 1QHSA 4DLKA 4QRHA 4JI1B 2W2XA 5AM3A 3U9SA 3IP9A 4HXYA 1UOPA 3EVFA 3TGPA 1ZOLA 3NPAA 4H4CA 5G4KB 3ZV3A 2A1IA 4FN5A 5FEMA 5FUWA 5CVCA 3UJ9A 3WK8A 3ZWQA 3VJMA 4TYPA 1A9SA 3RLFA 3ZNOA 4EFMA 2GZAA 3A1VA 2CLSA 2GWHA 1J42A 3LWZA 2GILA 4FDMA 3MD0A 5BSRA 3V4OA 3W7VA 4CHTA 4PLYA 3G2JA 3TW6A 2CN1A 1BWPA 1PK8A 2HCJB 3D2LA 3NWEA 3P2OA 4IV0A 5DWQA 5EOVA 4R1QA 1SKYE 3R7AA 3OPQA 4IICA 2QUZA 4MQLA 2O23A 4NYMQ 3LF2A 1Y6RA 1DAEA 4R8VA 4S2EA 3W3AA 1FYEA 2VAVA 2FCRA 4B2YA 1N5JA 1LWNA 2D1TA 3WLIA 1SFRA 1W5FA 2GN8A 3AVQA 2DTXA 4MX8A 1MO3A 3WBJA 1KO5A 4KACA 4CMEA 1A69A 3ZNNA 1U9IC 5IXSA 5BSEA 1KWKA 4IRMA 2ODAA 3P9PA 3SIRA 1EQAA 3KPVA 2Y76A 4C0KA 4QYIB 1QHFA 1VHQA 4YMVA 3PRYA 4G0YA 2GK6A 3KQMA 2R96A 4UFOA 3LUAA 3ZLTA 3CWCA 2FUG6 5FOQA 3FTFA 3V4VB 1H1TA 4LQLA 2XQJA 1ULTA 3M82A 5JRDS 4HY3A 4EDHA 3K32A 5KOHB 5FTLA 1QV7A 4R5MA 4LDNA 4OAOA 4HK4A 1UPBA 3TR5A 1RFGE 4MWDA 2QM8A 1H2RS 1MORA 2G9RA 1G66A 4R81A 3UXEA 2IEAA 4PAWA 4L0QA 2ZCUA 1U1CA 2QTRA 4HLUA 3E1SA 3QK7A 2YV3A 1N2GA 3QX8A 4QARA 2BH2A 3LC0A 2UYCA 1KGDA 3DO6A 4BZQA 5KNBA 2OFOA 3MWLA 3AJDA 1E3JA 3JQGA 4LRSB 3VYVA 1KQGA 3WZ2A 1UBNA 3RD8A 2J4CA 3N2IA 4N8EA 2C3OA 3M7IA 4LECA 2D5LA 4RA9B 1GQSA 1NXSA 2OGUA 1CY4A 4WACA 5I7OA 3TOXA 5BN4A 3ZE7A 1XDUA 4K9OA 5K99A 3QEMB 5AI0A 4S0ZA 2O6HA 1C7JA 1THZA 2J5QA 2YVKA 4RD1A 5FA6A 2FFAA 2YZGA 1GU7A 2CCKA 1RAHA 3F3SA 3N2LA 4MW2A 5L4SA 5HILA 1H1DA 2DFDA 3QSYA 1NVAA 1T36B 2NVUB 4GF5A 3CZMA 4HQ6A 1XDZA 4LYHA 1F0NA 3GJTA 1EXDA 1LCIA 4RF4A 2WU8A 3RUFA 1KZ7B 2HJSA 1ULAA 3DEKA 2HLHA 1E1RD 5BXQC 2WT9A 2JJQA 1UAAA 1K7SN 4MPRA 4ZREA 4RACA 9MHTA 1UJ5A 2ARKA 5BURA 2WMNB 3GI1A 4XD7A 4NENB 1ZLXA 4LF6B 2HA6A 4GG1A 5JD3A 1RQXA 3AB8A 1D4ZA 1UBJS 1G5FA 5BMVF 2PT6A 4HUTA 2VLIA 2IBMA 5GVRA 3RSLA 5SYAA 3O21A 5A7GA 4LX8A 1RKUA 4M0PA 4H7EA 5A9TA 3G88A 1A9XB 1G4HA 3HWWA 3BDVA 3JPYA 3OC6A 3TS1A 1Q84A 1XNQB 1VE3A 3QLTA 5K3FB 3WIDA 2ZVJA 3NIFB 4JBXA 2DBVO 1XA3A 5I7EA 3TL6A 4D9BA 5IBQA 5JU6A 2QIPA 1VDKA 1A4RA 4A82A 5ITZB 4WUTA 4QHSA 2WT8A 4MV0A 2BJWA 4B6EA 1U3DA 3I30X 2A78A 3AG6A 5CVVA 1Z0IA 2QR2A 3C85A 4H15A 2V9PA 4RTJA 2QTHA 4GM4A 5KYGA 2P9BA 4E32A 2LXNA 3N8GA 3P5BA 5CFQA 3KKMA 3QWAA 1AH2A 1SKBA 5EGSA 1IZZA 1ZL2A 2JFWA 3DDCA 2ZIXA 4YQEA 3EEFA 3TFWA 1YAJA 2J85A 2QT1A 1HGXA 1T9ZA 3M1YA 1N0WA 3V3KA 4P2GA 2IS1A 1C8BA 2BBWA 3D9QX 3EOAI 4BLQA 3CNNA 3ESAA 1SCJA 2G9VA 1RWKA 3IGFA 2HWUA 4DSAA 1K5HA 1EE2A 2IZ0A 4OAPA 1CDDA 1WF6A 2BBSA 2BT4A 2WJIA 4U3JB 3PR1A 2CMHA 1HT0A 3X2EA 2OTCA 2QYHA 2C1EA 4BS9A 4DQKA 7YASA 1NATA 2V7VA 3K6SA 4YRKA 2C59A 4G4SO 1K7XB 1RYHA 2H00A 2J08A 4AVYA 1XCLA 1ZVQA 2G1KA 1LDGA 3ECCA 2BFNA 1TK2A 1HSOA 4JEUA 1Z0KA 4O6VA 4DUYB 1N1DA 1YT5A 4MKXA 4QBIA 3RSGA 4OP1A 5CFZA 5ALVA 3EGOA 3NIBA 5FUYA 4LNUB 2C07A 3G0CA 3KT8A 2KJQA 1L8AA 3KYIB 3FMOB 1BA2A 2AA3A 1HZZC 3L7AA 4UTZA 4B31A 4D3SA 1VPWA 4DBZA 3IOBA 4YRLA 1JPUA 2ADFA 3N2KA 4EMBA 1R64A 1PLJA 2YJGA 2AMVA 1KMMA 2UAGA 4INPA 3PLAE 3A26A 4EAQA 1VCHA 3RDPA 4EITA 1BCSB 2POCA 2W22A 1IJEA 2G1PA 5E6SB 5LA6F 4X65B 1B3BA 4JP1A 1KF0A 2VSQA 3IRVA 3JXEA 4PO9A 3JVEA 4Q1AA 4RSRA 2IUUA 4WADA 3VV3A 3A3YA 4F6RA 3R1IA 2ZKLA 2J41A 3AM5A 5J2TF 4Y18A 4I9NA 4TMFA 4IVQA 3BTUA 1FLVA 4N7MA 1CRLA 1P0MA 3VDNB 2EF1A 3F98A 4RX1A 2WA2A 5A3QA 3AVYA 2HB6A 4QE3A 1Q17A 2OLJA 1TMOA 3UT5B 2YY5A 1PEDA 1P5JA 4PFJA 3PFIA 1HE2A 3EMBA 2PSHA 4U5QA 1YR3A 4PLGA 5CFNA 4QXAA 4DV7B 3BXZA 1EE1A 2PL5A 4D0RA 2Q4RA 3ICQB 2VN8A 2B9VA 3HM2A 3S2YA 3V1YA 1BC5A 1OTHA 2B30A 1KDOA 1YR6A 3EIUA 4BRZA 1ADBA 1WD7A 4Q7QA 3CUSA 4CKEB 1KJJA 4FINA 2OC9A 1X3SA 2G7ZA 4HAXA 4KQHA 3CNLA 1W0JD 4MUMA 4C78A 4JLDA 4L5JA 2W5UA 1C7EA 4NP6A 1BS2A 4BZZA 3LDFA 3MYRA 4OHWA 4XQ0A 5KYNA 1FYXA 3EAGA 1C0EA 2JA2A 2DUNA 3G79A 4LXQA 2X4LA 3I9V1 3IUPA 3WGVA 2QW8A 4KOAA 3SOPA 2ONYA 1Q6ZA 1MB3A 1QKIA 4EI2A 4TVSA 3TK1A 2UVQA 3AR4A 4KSBA 1J39A 2QN2A 4IINA 1FK8A 4BVAA 5DP2A 2NUTA 3WWDA 2D27A 2IHYA 2H2WA 3KLBA 1L7XA 3AEQA 1MFZA 1Y9DA 1C9MA 4IDBA 1PRYA 1RLIA 2OV8A 2W2NA 4KQMA 4CM3A 2BZSA 3BC1A 3GQVA 3LNTA 3WMWA 3RT9A 1L2TA 4AMVA 3WDSA 5BNIA 3UV7A 1MIOB 3L5OA 4YWHA 3M9LA 1Q95A 4UASA 3GJ8A 3L1UA 4WESB 4KC0A 4U7TB 3G9UA 3VNBA 1XPRA 2P9HA 3L93A 2XPCA 3O90A 4PRZA 5IM4A 2O0MA 4WPGA 3ZHCA 5JAQA 1JHYA 4YR7A 4L4RA 1QWOA 3SS7X 3H42B 1ZN9A 2CEAA 1W8IA 2EX4A 2ZIGA 4F04A 1MP0A 3OFNA 3L4KA 3GYGA 3TIXB 4C5AA 4S2UA 5AI9A 2HK9A 1KL7A 3BXEA 5CYPA 5LB4A 5E3JA 1EWVA 2QI9F 3K6KA 1XE3A 1EGHA 2JFNA 4HNQA 4KAAA 1OU4A 3I0NA 1RTTA 3AVVA 2XDWA 2YQ4A 1E3DA 3I28A 4DG8A 1U0OC 4DREA 2YYYA 4KBFA 1DC6A 1V5IA 4PFKA 3D7LA 4G5RA 3R5TA 3K5WA 2PTRA 2WE8A 3NOVA 3TTYA 2EJBA 4IVRA 5B6IA 1YU9A 1YNOA 1O7JA 1KPHA 1KBQA 1ML3A 3I4FA 3QOWA 4CZ2A 1UJMA 2DX7A 1U3WA 4LJLA 1JQLB 2AEJA 1P5FA 1S7GA 1SXHA 5J3JA 3WYFA 1N25A 2IIBA 2ZIWB 3THXA 1HORA 2IPXA 4FCCA 4P7BA 2G3YA 1J2YA 3DDZX 2VI5A 2AI3A 2W2LA 4I6EA 2NUAB 1U0LA 2N3ZA 1U0RA 1E7YA 4IMJB 5EMKA 4D92A 2FMUA 1YR8A 1M1XB 1RC1A 2GPNA 5PGMA 1ZNZA 4HC4A 4M7WA 3UJAA 1UT5A 5CNKA 4MKGA 3B36A 3W5SA 2PUWA 1ZN2A 3PNLA 4QPZA 3QBVA 4YMSA 1O77A 7REQB 5JDIA 3ZCQA 4Q1CA 5HOQA 3IT3A 3KEFA 1BEZA 2QD4A 1K6MA 3MK31 3I8SA 2DE0X 4CCWA 621PA 2Y27A 1WD5A 3HP4A 3X1KA 2SKCA 1X13A 4UVEA 4HDNA 2XJ4A 1O95C 1T6XA 4A6EA 3EWSA 1FDUA 1JE1A 1ZSVA 2PFKA 1BOOA 2WIBA 5DWVA 5CVDA 1B6SA 1Q19A 1FW8A 2F67A 3O74A 5KWSA 5H1YA 5LR6A 2D74A 1LDBA 1B0UA 3LLSA 5JCOA 3HS3A 4PIPA 3H3JA 3WWYA 1S2OA 3AUAA 4BWGA 2QM3A 2E82A 3OLYA 1J0EA 1Z4NA 5DNWA 5FORA 5JR3A 1SUIA 3GRKA 4JGBA 3DVQX 3CLKA 2K4MA 3GEIA 4G5SA 4B2PA 5LQDA 4MYUA 1BE8A 5K3CA 3PD7A 3TW0A 2QQ0A 3HJGA 3GR6A 3CBGA 2FSHA 2MMCA 3FZQA 3DXXA 2YZMA 3HV0A 5JXGA 4V0SA 2BJHA 4FFLA 1IM5A 4M8NE 3VPCA 1JPJA 2BAGA 3WS7A 5JNUA 4B47A 1I1HA 4GXNA 1VIVA 4JDUA 4C06A 4QGSA 1EFPB 3HDGA 4RBNA 1B2RA 3AG5A 2A3NA 2QEQA 1EFHA 1O87A 1UWVA 4MA0A 2PR7A 3R76A 4J0DA 4TYMA 3O1HB 1QO9A 3ETNA 4XVUA 2IBSA 2PD6A 1V5GA 3KVRA 3QVVA 3T1QA 2PD3A 3EAQA 4Q9AA 4OBXA 5LQMA 2OAGA 2B83A 3OIFA 1AT1A 5DCLA 5IVDA 5BNWA 1W52X 3CFYA 3ZV5A 2NP7A 3UAGA 4LVUA 3C5HA 1GL3A 1U8ZA 1EX7A 1WHSA 2GRJA 4IIJF 2O3QA 4BUCA 3STUA 3G6KA 4G07A 2K7FA 3JYHA 3ONNA 2WU4A 4M1EA 4TYQA 1C1XB 1J0DA 1U1FA 4RJIA 2IPOA 4P5PA 4UUOA 4L2IB 1MEOA 5JNSA 1ZSYA 1AZWA 2QAGC 3I64A 3JCZA 1GWNA 3HCCA 4CTOA 3UWSA 3FYCA 1Q1ZA 1TM3E 4ZVMA 1J8DA 4GPZA 3GLTA 2JIPA 1MJHA 2A2ZA 3HB7A 5ALEA 2FMKA 3LW8A 2Z2YA 2VHQA 4B7CA 4PR0A 1JXQA 2H9AA 2HMSA 1EWQA 2RE8A 4CKBB 1A82A 1TAGA 1YO6A 5I8PA 4EEIA 3GW8A 2G08A 3AHEA 1JR2A 4H17A 2PPVA 4HDRB 5CNJA 4I3HA 3ZI0A 4ZMSA 5MN5A 5KSPA 3IAM1 4UD2A 1OWNA 1Q3TA 5F64A 3B13B 2YHIA 1FUKA 1SVKA 2OXTA 3TNFA 4AWAA 6LDHA 2B8EA 1QH8A 4V3CA 4BE9A 2ZR7A 2BFCB 2CVQA 4NONA 3B20A 4B8WA 4F1WA 5KWEA 4EEZA 2P2DA 2PKQO 2BHNA 1TADA 1JH9A 1KOFA 1NXOA 1XJQA 2F43A 1GU0A 1Z5ZA 4KKVA 4MR8A 1Q2XA 1NXQA 1XL1A 1QZ3A 5IAKA 1SHUX 2P6MA 4U9IS 3LHSA 4QPCA 4XVHA 5EIOA 3L4EA 4BV8A 1YB7A 1Z0DA 3EY9A 3Q41A 4Z1OA 1X80A 2FPPB 3HPRA 4PYKA 1BO6A 1U5BA 2XMSA 1ES9A 2BKVA 4CKXA 1WDMA 2JI6A 3Q9SA 5K20A 1B1AA 1FC0A 4UDOA 3ESRA 1RAGA 3J81k 3OVMA 3ULKA 3BICA 4FI3C 3WP0A 1RRKA 2A6PA 2BR5A 2ZS8A 4K5QA 1TRKA 2XEXA 4EGJA 2YJ6A 5TT0A 5C3MA 3D1VA 4JASB 2HPZA 5CIQA 1Z34A 2J87A 3FVVA 3LXXA 4DHWA 2X5OA 2DHDA 2QRJA 4ETNA 5JYDA 2XITA 3WLHA 2E5LB 2PGOA 5K7SA 4HUJA 1E0SA 3G5LA 2Z1MA 1D03A 3FE2A 3KT0A 3KKKA 3NHUA 1PZXA 3ET4A 4CQMB 4ZHQA 1Z28A 1FJ2A 1Q92A 4OMFG 1EVEA 1SHLA 1OT3A 1ZEMA 4PRYA 2QUHA 4K1XA 3IAEA 3V1MA 4ND6A 3R8FA 4E1VA 2O3JA 5B4TA 2DECA 1G3QA 1XMVA 4TVKA 1K97A 1QM5A 3A4VA 4UMFA 3RPEA 3MMZA 3DULA 4UCFA 5MFPA 5FLKA 4WBNF 4WAUA 4WGFA 1CY2A 3V9AA 4UEQA 1N3IA 2A57A 2P75A 3HG7A 4GZMA 1JWAB 3QG1A 5FOTA 5BW4A 2NU9A 5C5EA 1PWXA 3GJ3A 3FPEA 5TMDA 4ZQGA 4ZVSA 2EU8A 2ILTA 1IZ0A 1DAGA 3NIWA 1RHJA 3MJSA 4OXRA 3U3KA 2JJ8A 1HURA 4G1MB 1R0ZA 2FP3A 5L3QA 2XNDA 1LLFA 3BHNA 2BFWA 3NDJA 3LYLA 4YONB 5IDXA 4RPHA 3ZU5A 3G8CA 4A5OA 1OHHD 1U7WA 4G85A 2R6GA 1SCAA 4OGKA 1KPGA 1C4WA 1QCZA 4G89A 3UB4A 2WC1A 4IOKA 1ECFA 4I1UA 1QFJA 2W43A 4XYMA 1JQJC 3UF0A 4HVAA 4F3NA 4ARIA 3DGEC 2L42A 1T4MA 4LBWA 3RS3A 3OZCA 2A86A 1NE2A 1L8XA 2GZDA 1RDFA 3OQVA 3VU8A 1KKMA 3OO1A 4B40A 4GM1A 3JR7A 4DRXB 2PZGA 5FOXA 4Y2VA 3TNYA 2LTAA 3OZGA 2KQUA 2HHHB 1SK9A 3O95A 4BLPA 1I3LA 3DC2A 4C0HA 5GTDA 1VDMA 4CL3A 3NPMA 3ZJVA 1GQYA 4HEA6 3L1JA 3JYNA 1R8SA 5LDDC 1RPZA 1LBHA 1NQ5A 2V4UA 3VI3B 3M49A 3EMKA 3M33A 4OQ4A 4PYRA 1GSOA 4MKRA 1G59A 2P67A 2C94A 4G0MA 3C7AA 3FRIA 5F77A 3G2QA 3C39A 1IQUA 2HSGA 1IFXA 2GFHA 1WQ3A 5H4GA 3NEJA 5IC4A 3NETA 3D0OA 3STHA 4IYRA 1XZBA 4ANFA 2QN6A 4ILKA 1ZINA 1O9BA 4P3OA 4YUVA 2CWDA 4FFDA 3ER6A 5IAOA 5JSQA 2ZJYA 2Z43A 1SURA 2QAGB 3OEWA 1GUZA 5EHGA 4ZV9A 4FMCF 1X87A 2WPDA 4EJSC 3BGOS 1AMUA 3HFRA 1Z7YA 5I5EA 5ICEA 2J5BA 2LP4Y 1H4VB 1M1YE 2ZJFA 1MN6A 2L0XA 3QU4A 1MVLA 2CD9A 3OT5A 2EHDA 3BD6A 1Q0QA 1D2EA 2YXNA 2HT6A 2Z3ZA 4NEHB 4AQDA 5F2NA 5K0BA 1YI8A 4KO2S 5HMLA 5IFKA 2O06A 1YRAA 5AVJA 4YPFA 1F3OA 1CFJA 1Z15A 2IP1A 1HDCA 4IW3B 1E7WA 4LAFA 3S1SA 2O8DA 1EEXB 4GYJA 3NT5A 1KFKB 4PIVA 4KN6A 4YJHB 4TL8A 1TJPB 3LK7A 3PSAA 4LRTB 1RI4A 4MGHA 3MSCA 3G5TA 4BNXA 2F4VB 3LVQE 3K0HA 4XKJA 1JQEA 3EN0A 3TSAA 2RH9B 2VDPB 2RSLA 2NO7A 2Q0HA 1RSZA 4YIKA 1GPJA 1RWOA 2WHRA 2BZ0A 4IQ8A 3P9KA 3R5XA 4G81A 1AQLA 3NGLA 4MDFA 4U7DA 5E6RA 4LI0A 3GJQA 1TJ7A 5E1MA 5LQSA 2XBMA 5CU7A 5KVAA 2C7VA 2CMDA 2NUPB 4F85A 3UH1A 2Q50A 3U7QB 3ZE9A 4ARZB 2NZWA 4EMTA 3DYBA 3TLZA 2RHBA 4ZAXA 1NQXA 2UYOA 2IXGA 4XJXA 1Z6ZA 10MHA 4PC3A 2VHUA 5EJ7A 4IJ5A 2YKGA 2IPNA 1KTVA 3FKSA 4TXLA 1HI9A 1JR3E 5U4XA 4Z9BA 1IN1A 1F8YA 3KJGA 3B8EA 3IR6A 4Y2RA 1RP1A 1T25A 3N8HA 2G71A 1GTZA 3QX7A 1DQZA 1Q1GA 1U8CB 2IIPA 3QXHA 1T1IA 3U7GA 4GM0A 3D6NB 3WYEA 3IESA 1RPNA 1E3TA 2NXNA 2VYNA 4JB2A 1QS0B 3E5RA 3D3QA 3ND8A 4OQDA 4RZ2A 5FWAA 5HCUA 5JWHA 3VH4A 3WKEA 4ZODA 3HFGA 1FU8A 3BJZA 4K8OA 4H2DA 4K40A 4PHCA 4K0KB 1TQ4A 4PHGA 1M1NA 4RVFA 5EI5A 1EKXA 3RG2A 4AI6A 2CZQA 1SBNE 3FOWA 3INYA 3VHQA 4NQZA 5JCPA 3CA8A 1EFKA 1BX1A 3NUZA 1L5RA 3EGIA 1EVKA 3PFGA 4N3NA 2R8OA 4WOBA 1SK8A 3EBLA 2IHUA 4H9GA 1C29B 4B3JA 1SKUA 2V5VA 2X3UA 2G72A 3O92A 2YJ5A 4K9KA 5MDHA 3S44A 3UV6A 3OTOB 1XBTA 3DHVA 4QDZA 5DBGA 3GEHA 4TKUB 5IPFA 1DL5A 2WTUA 3K0CC 2P2ZA 3GLUA 1RYEA 1QKJA 4FP9A 4XM1A 3TM4A 1JBKA 1S4MA 4X6UA 1AURA 1I3MA 2X5JO 4J49A 3E7DA 4FJ1A 1OI3A 2W58A 3DZBA 2ADMA 3GZNB 5LKRA 5KTNA 3UGJA 4PSAA 4R2XA 3WK6A 3TBHA 4R98A 5ECWA 5ILGA 1FSSA 2VWHA 4LI3X 3N2NA 4OLFA 4GUAA 4BRWA 3P97A 1I1NA 3GPIA 4KQKA 1XTKA 5AW5A 4WXHA 1WPQA 2YNMC 4X5OA 4IWNA 4MUKA 3SQWA 1TM1E 1OX4A 4Y0AA 1Q7GA 4LFCB 2QL6A 4IQFA 2H1FA 4PPNA 1I4OA 4GZLA 4HXG<