4L6CA

Crystal structure of human mitochondrial deoxyribonucleotidase in complex with the inhibitor pib-t
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
201
structure length
201
Chain Sequence
SNAASGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase, mitochondrial
publication title Conformationally constrained nucleoside phosphonic acids - potent inhibitors of human mitochondrial and cytosolic 5'(3')-nucleotidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 67
structure length 201
sequence length 201
ec nomenclature ec 3.1.3.-:
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4l6cA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4l6cA01
2YJ4A 2GHQA 2R8XA 5JJBA 3WKEA 3E81A 1ZD2P 4BX0A 3I76A 3W5AA 2G0AA 4QJBA 2G09A 2IOHA 3M1YA 4OHFA 2QYHA 1VJ5A 4AP9A 2NO4A 5ALTA 5ALZA 5AVQA 5ALPA 3L8GA 2IYEA 4XOUA 4B6JA 2PQ0A 1N9KA 5ALVA 1L6RA 5AKLA 5IS2A 5FP0A 2FPXA 1ZOLA 2B0CA 4Y2UA 3E84A 2G08A 3QUCA 1LTQA 2GHTA 2WF6A 4Y2TA 1L7NA 4UMFA 2OBBA 1RMQA 2HDOA 2C9MA 5AKZA 4H1WA 3WGVA 1EK1A 1T5SA 3U7HB 4DWOA 1U7OA 4KNWA 3L5KA 2B30A 3SHQA 1RLMA 1LVHA 1K1EA 3N28A 3N07A 4KX3A 2RB5A 3L1UA 3QUTA 5AW1A 4JB3A 5AHXA 5ALDA 2I33A 2JAUA 3NANA 3ESQA 2FUCA 1XVIA 2GFHA 3NIWA 4IG4A 1Z4QA 5ALJA 3OCXA 2FPSA 1O08A 5ALXA 4BKMA 4CF5A 3I6BA 1Z4JA 1IWOA 2JAWA 5AKEA 2PR7A 1WZCA 1YJ5A 3WK4A 1VJRA 4AS3A 2WHEA 4BYGA 4UU1A 3ZW7A 3K1ZA 5ALFA 1U02A 3BWVA 1WR8A 2YMLA 2ZOSA 3B9RA 1TE2A 2FEAA 5ALMA 2RBKA 3L0CA 4UAVA 1EK2A 5AKXA 3QU5A 2B8EA 3SD7A 2FPRA 3QGMA 4FYPA 3VAYA 3DDHA 2AUTA 3U26A 3OCZA 3BA6A 3PGLA 5AI6A 4BEVA 3EPRA 3W5DA 3WKAA 3WKBA 3QU9A 3AR3A 3QU2A 2G07A 4UAUA 1QQ5A 4XE5A 2ZG6A 3EF1A 4L6CA 5AW3A 4OD0A 3R9KA 1NRWA 2WFAA 1X42A 3QYPA 1TJ3A 5ALHA 3EWIA 3A1CA 4Y2JA 2HOQA 3AR4A 1QQ6A 5AW6A 1FEZA 5AVUA 1U7PA 3NRJA 4UMVA 3ZU6A 5AVVA 1RMYA 2EARA 5AM3A 2RARA 4E88A 5AVTA 5AVSA 1RQNA 1RKVA 3OCUA 2I55A 3J7TA 4MUMA 2YY6A 1NNLA 2G1AA 4HGQA 5A3QA 2YMPA 3L8EA 1RLOA 3FPSA 3KDPA 3QU7A 3U7GA 1U2TA 1Z5GA 3ED5A 5AKIA 3W5CA 1ZS9A 1ZD4A 3ZX4A 3B9BA 4NFLA 4YIHA 4ZEVA 4EELA 2P11A 4Y2RA 4EX7A 1RKUA 1ZD3A 4KNVA 5AI5A 4NWIA 3NALA 4DFDA 2I34A 3IRUA 2MU1A 4Y2VA 1F5SA 5AIAA 3KC2A 3HYCA 1CR6A 2Q5EA 1YMQA 3OCWA 4UMEA 1Q92A 2YMQA 1Z88A 5ALOA 4XQ0A 1RLTA 2YJ3A 3NASA 1JUDA 4YIKA 4OFZA 2JARA 3PDWA 3ET5A 4O8CA 5AVZA 3SLRA 2W4MA 1MH9A 2C8KA 1J97A 1Z4KA 3L7YA 1WVIA 3U7EB 4FFDA 4AS2A 3L1VA 2HO4A 4YGYA 3CNHA 4FE3A 3WK6A 4KYTA 3ZWKA 1AQ6A 3WK8A 3S6JA 3L8HA 4BNDA 4Y2XA 4CF3A 1QYIA 3ET4A 5AKJA 3N5KA 4EZEA 1L8LA 2EAUA 4UW9A 1TJ4A 3MN1A 4BEWA 1CQZA 1N8NA 5AI9A 3SKXA 4GIBA 2YFYA 1SWVA 3A1DA 4I9GA 2AH5A 2NO5A 1YDFA 3A3YA 1RRCA 2RAVA 2OYCA 2I7DA 3DNPA 4HGPA 1J8DA 1L8OA 3E58A 5AVYA 1Z4PX 1ZD5A 2WF9A 3ESRA 3F9RA 3U7FB 4MWOA 4BBJA 4Y3UA 2B82A 2HCFA 5T41A 2R8ZA 3RF6A 2IA5A 2ZXEA 4YCLA 5AK6A 3CZ4A 1S8OA 1L7MA 5ALSA 3QXGA 3FGOA 5AI0A 2GO7A 5AW8A 3NUQA 4Y2QA 1QH9A 2I6XA 5AI8A 2C8LA 2O2XA 2WF5A 2VKQA 2P9JA 3AR2A 3L8FA 4L57A 2B1RA 4UASA 3SKYA 2AMYA 2EATA 3MC1A 4HGRA 1KYTA 5AM4A 2JGAA 1PW5A 3RFUA 4C4SA 2I54A 3D6JA 4EENA 1YNSA 1Z4MA 1SWWA 4OCZA 1TJ5A 3UMCA 2IOFK 1ZJJA 4C4TA 3L0BA 4L6AA 3P96A 2BY4A 5E0OA 3B8EA 2ODAA 5IT4A 3IB6A 2WF7A 2FPUA 4J2TA 4YCNA 3WGUA 2ZBDA 1QQ7A 4GXTA 4HGNA 2BDEA 3N8GA 2X4DA 3AR9A 3PGVA 3SF0A 3NAMA 2OM6A 1Z4NA 5AIBA 2C88A 4Y2YA 3FZQA 4JDPA 3OTQA 5ALEA 2HF2A 2P69A 4KN8A 3E8MA 3FM9A 1RPZA 2CFRA 3ZI4A 1U2SA 1SU4A 2FI1A 3FPBA 3ONNA 4EX6A 5AICA 5AVWA 2GMWA 5ALIA 2CN1A 5ALKA 1O03A 2AGVA 2W43A 3N1UA 3AR5A 1T5TA 1Q91A 3KZXA 4ZEWA 2R8YA 3ZVMA 2P27A 2PKEA 3ZX5A 1Z4LA 2B8JA 3ZWDA 3WK7A 4QQFA 2YBDA 2HHLA 3QU4A 4C4RA 3MPOA 5AW2A 1T9ZA 5ALRA 1RMTA 2QLTA 5ALUA 3QLEA 1WPGA 2C4NA 4F72A 1ZRMA 5AKGA 2FUEA 3DAOA 3GYGA 4UATA 3WK9A 1VFPA 5AKKA 1RKQA 2HEGA 3ZVLA 2Q4TA 2G06A 3OPXA 2CFTA 4Y2PA 5AW9A 4YH1A 4KX5A 5ALQA 4BX3A 1YS9A 4YCMA 2D2VA 5ALYA 2O9JA 3AR7A 4RESA 3ZUPA 4G63A 5AI4A 2YJ6A 5A3RA 3SMVA 1TA0A 1RC8A 1Y8AA 1YV9A 2HI0A 4G9BA 1S2OA 1XP5A 4HGOA 5AK3A 4HYTA 5ALGA 5AW0A 3UMBA 2R8EA 2FPWA 1Z4OA 3IJ5A 4CE6A 3ZTWA 2HF7A 3HLTA 1XPJA 2ZBFA 1RQLA 2YN4A 4XPZA 2HX1A 4J03A 5AW4A 3KD3A 4F71A 4DW8A 5AM1A 5AK5A 1L7OA 2MSNA 4EEKA 2OA0A 2HSZA 3TLMA 2BDUA 1Z5UA 3WKDA 4PNHA 3ZTYA 4Y2SA 5ALLA 2IOFA 4UM7A 5AK4A 3M9LA 2WM8A 3KBBA 3I1YA 4NAVA 4DCCA 1Z4IA 4NABA 5AVRA 2Q4RA 5ALNA 2YMMA 5AM0A 3WKCA 3MMZA 3QUBA 2ZBEA 3W5BA 5IT0A 3AR6A 2WF8A 2YJ5A 3AR8A 3QNMA 2DQSA 4ZEXA 2CFSA 4IFTA 3QX7A 4RETA 5AM5A 4HAIA 4NV0A 4CF4A 4UM5A 2G80A 3WK5A 3U19A 3PCTA 3L0YA 4BNDB 3R09A 3KOOA 4BX2A 1ZRNA 2FDRA 4CNQA 3ZVNA 5AVXA 3QUQA 5AKYA 2W11A 5AESA 3R4CA 1RDFA 5AM2A 3UM9A 3A1EA 2NYVA 3EF0A 5ALWA 2B1QA 3DV9A 2JAOA 5AKHA 3I28A 3FVVA 4I9FA 4UMDA 1NF2A 5AW7A 4UU0A 3U13A 5AW5A 2ZBGA 4UARA 1L7PA 3OCYA 3UMGA 3OCVA 5A3SA
chains in the Genus database with same CATH superfamily
1OLSA 2NU7B 1GVNB 3VBEA 1J09A 2VSFA 4QVIA 3WJ1A 3WWCA 4QLOA 1KXZA 3GO4A 1NJ1A 3OFJA 5E9QA 4XIJA 3LU1A 1T2CA 2ARKA 1J5PA 1R0LA 1UKVY 2H4FA 2KBFA 3PUJA 1GKIA 8GPBA 3DP7A 5KYGA 1V7QA 2QTLA 2FN4A 1WE2A 1JHQA 2B61A 1FTQA 3PWSA 2ZT5A 5ALVA 4F4HA 5LDDC 3CHYA 3G0OA 2NACA 3D9QX 2XZDA 5EJ8A 4M87A 2QT1A 3EXG1 3HB1A 4KQ1A 5DHTA 1IOWA 4LBVA 2Z56A 1GCGA 2XZPA 3QPDA 2VJLA 1PFQA 3T7RA 1T6YA 4DIOA 4W7HA 4MQ6A 3PJDA 1BCRB 4WXRA 5CW1A 4CPDA 2PZFA 4ED9A 5IUJC 3ES9A 2DFLA 3OT1B 5HZKA 2YX1A 3CLRD 3KK0A 4PCAA 5THKA 3ZKAA 4A6PA 5E4YA 4NU0A 4ZFNA 2EHDA 3MHPA 4NTZA 3M8KA 2ENWA 4Z86A 1MX1A 3V9AA 1GADO 2FLWA 4Q9LA 1P7PA 2JGKA 1T5HX 3D3EA 2X9QA 4LOLA 1W5SA 3VR5H 4EMUA 3VHQA 4R5MA 5KNBD 2JGMA 1OD6A 2X9GA 3C3XA 3G89A 3KWJA 4JR0A 1SC4A 2VCEA 2ZE8A 1GPAA 3QUTA 1E7YA 1Q5PA 3OLZA 3ESZA 4GE3A 4TSFD 5C8VA 2IUUA 5JVDA 4JI7B 4JB3A 4N9WA 3G13A 1WHSA 4QGFA 4LECA 2CMFA 2EFEB 3S29A 2CWWA 4NOJA 2IDKA 2QN6A 1KA9H 1U2QA 5DVZA 1XWFA 1Z0JA 5K8LA 1EMDA 3C7AA 3ONDA 3K2EA 2FVYA 5TQ0B 2XUKA 2Q29A 1ZVMA 1JIKA 1JHXA 1UK6A 2B0JA 4RHYA 3H8SA 1SEVA 4EYQA 4AMYA 1XMVA 1B6SA 3CZ5A 4MV8A 4YJ2B 3W05A 5EKXA 1YCGA 2G5GX 3BTUA 3INNA 2AXQA 5ED0A 4IILA 3PD1A 4ZT5A 3S7TA 4KO8A 3BT7A 2BBTA 1TJNA 1G6Q1 2GPNA 2QLFA 5DI9A 1PL0A 1K0FA 1C30A 3K5PA 2PKXA 2C7GA 4H2DA 2P91A 3BWVA 3UAXA 1C3UA 2RGUA 1KMHB 2Z8XA 1X7ZA 4MIKA 4QNMA 2EZ4A 4CWAA 4JXJA 2HT6A 4R1LA 4F6CA 5BMVF 5IN4A 2XKAA 2XLBA 5EJ7A 4C01A 1ZM3A 2I0FA 2A0YA 2AJTA 2VXYA 3I8OA 4KK3A 5BR7A 2WTEA 3RS2A 2ZBVA 2ZPTX 2AC7A 3NR2A 2QD2A 4OBXA 1RYBA 2I80A 4MEBA 4FYPA 3SD7A 1QYRA 1VIYA 3VISA 2J0UA 1GD1O 2JLBA 3DF9A 4FGLA 2ZR8A 1X1SA 4FDLA 5BUCA 5LZ9A 3WZLA 3L0DA 1NXTA 3EZ2A 3ZU5A 3G9UA 1IZZA 1JI3A 3N9IA 4GMDA 4Q1VA 4WK4B 4HRYA 1GGFA 2R4TA 1E2EA 2VDPB 2ZQYA 4G67A 4QBIA 4TLBA 5C34B 5KOIA 3N8NA 3GGPA 4M7PA 1WKVA 4GQBA 1QPGA 3ZJYA 5EHNA 1VZ2A 1WY7A 2RHCA 3R6LA 2IUYA 2X19A 3HP4A 4Z4EA 1K63A 4DREA 3R9KA 1SVIA 5A5DA 4V0NA 2NVBA 2LNDA 3A1CA 3B2EA 3BK1A 1EUDB 4OB8A 2VK8A 3L4SO 4IICA 2Q5QA 4J9UE 4RQBA 2FJ0A 4XA8A 3W5HA 5A4IS 3IEUA 3H7IA 3WL7A 3WOVA 1B0UA 2NM0A 4JP2A 1QHGA 1X86B 4OBWA 1GCUA 2WZCA 1LI4A 1QJ4A 2V1XA 3I12A 1XLWA 1J5EB 3BFXA 1C8LA 4O4JA 3UANA 1PUXA 3A0UA 1SBNE 1WX1A 3UT0A 3FOFC 2IS4A 5ULLA 1F38A 1ZCJA 2WLTA 3DEHA 4PRKA 4DSAA 5KOJA 4B46A 1YVUA 1QIMA 4FR2A 4OJQA 4UEKA 1V41E 4H4CA 1R2QA 5F52A 3MWYW 4D26A 3WTBA 3G2NA 4FOPA 5A3QA 4Q9JA 2RHBA 2ZU0C 4I5FA 1Y98A 2VUSA 4KR0A 2O7VA 3B82A 1K86A 1BE8A 1A9TA 1PT7A 1TT5B 1U1CA 1GTG1 1ZD4A 3DXXA 3MWDB 3IUNA 3NM4A 4CG0A 1PK7A 2P9FA 4I9HA 4PLVA 3R4VA 2QXYA 3K96A 3F1KA 3BXGA 2FQXA 2P11A 1LF0A 4DMGA 5BVHB 4YDHB 4ZDWA 1WUJS 4DMKA 5F51A 3F47A 4LYGA 2PX3A 2DMRA 2LTAA 3TLKA 4DA0A 3D81A 4LVNA 4KIWA 2HQOA 5HF6A 3HY4A 4AFNA 1CR6A 2QP4A 1Q6YA 3EZ9A 3QWBA 2N3ZA 1PEYA 1FX1A 1N2CE 3PIDA 4MV9A 4ZP1A 1XZAA 4C0QC 1Q92A 1Y6GA 4X91A 4QGAA 1OYOA 2GXSA 3MB8A 4AUEA 2OP0A 4L3OA 5E6RA 2R1VB 3RJZA 3ICQB 2QL9A 2ZRLA 5JDCC 4ACBA 5A0TA 5AVZA 1L4MA 3P9IA 1FNMA 4D44A 4OI0A 3HUDA 1DS6A 2FCRA 3E5MA 5TPWB 4GXNA 1FUEA 3CO0S 2AA3A 3LW8A 3OIGA 3JALB 3OE4A 3OTGA 4YJ3F 3FMFA 2OGTA 2GWHA 3D59A 4Q7QA 2PA0A 4Q1AA 4HFRA 2FP4A 2AF3C 3VJRA 1U90A 4L0DA 2Q1XA 4MYCA 3ZGXA 4H35A 2D5IA 1TO6A 2DWOA 2HLPA 1QYIA 1NIPA 3NTUA 3WWDA 2R86A 1KDRA 1KNQA 3O4FA 3PDIA 5GOTA 4ZO6A 2EAUA 2VP0A 3G0GA 3DXYA 1DMRA 4RFVA 1XVAA 5HM6A 1IOLA 1T1RA 2NVOA 5IC5A 5D3KA 3SR3A 4UE6A 6YASA 2ZI7A 3NQ41 3UO8B 4KWEA 3ZHRA 1F2TA 3R7FA 1V6CA 3UUGA 4F9FA 1NBOA 3FPFA 1FBTA 5KQLA 3BB4A 2DQ4A 1CUYA 2AR0A 4S1VA 2R0QC 1NXXA 3MS7A 2SKCA 4G6ZA 3R8CA 1M1XB 2RIRA 3DLIA 4RKYA 4OY3A 1T36B 3B1YA 5CA1B 2X9LA 4KUEA 2PX0A 2ZB8A 2Q2VA 1EAMA 2JD1A 4MV3A 1DMSA 3VVCA 5C8DA 5JNTA 1ORRA 1CDEA 4C29A 4O4LF 4IQJM 3R9XB 3KT0A 5JWRA 2CVPA 1DRKA 2CDNA 3MTDA 1XQVA 4HNAB 4WXYB 4ARIA 2O5EA 1JLHA 4AIRA 2NUBA 2TRSB 4V0KA 1M2KA 1I4OA 4KXLA 4L3WA 3ZY5A 1HDXA 4QU9A 1XROA 5SY9A 2FR8C 1XDBA 3JAKA 3NCHA 1U9ZA 1F14A 1QRRA 3ABRB 221PA 5BWBA 1OAAA 5KX5A 3I39X 1SZDA 1X8LA 2HMVA 2AIRA 3AEKB 3QXGA 5DX1A 2G9ZA 2AX3A 2WHRA 1P3JA 3EC1A 2BMWA 2OZEA 1V26A 4CV0A 4A16A 3QFHA 3VDRA 3MILA 1UC9A 4LOHA 3N6VA 1M73E 1QV9A 1ZJ4A 2FFRA 4Y2QA 2RHDA 2I6XA 3BCSA 3DHYA 1DQPA 5BYJA 4EHAA 4GLBA 2PRJA 4IMJB 4RTQA 1ZGAA 4IXDA 1JEYA 2VKQA 2P9JA 3LVRE 1I94B 2VJAA 4G0UA 3RSZA 5I7RA 4YS6A 1EGQA 1GSHA 3GDFA 2E85A 3H8JA 4IJMA 2KX7A 2XMGA 3MC1A 4KGZA 1W36B 5DYYA 2C9YA 4Q4HB 3A3OA 4HCJA 4YUZA 4QJIA 4CV1A 5FOTA 5AM4A 4N0MA 4D46A 1TJ7A 2C2XA 5DGIA 4AJOA 5GIPE 2DB3A 4IUBS 2VYNA 2P2CA 1VLJA 2ONZA 3DMDA 1SO8A 4JN6B 1AY0A 5D1NA 1TJ5A 3FNHA 4QODA 1LDNA 1GGJA 3DYIA 1UQUA 1F7UA 2FZKA 2C8VA 3JRXA 2ADMA 3C3PA 2AK3A 4XDYA 1NVMB 1TRKA 3LX4A 4KDRA 1G21B 3G17A 4J2TA 5DLQC 2PCLA 4DJEC 4MWZA 4B32A 2P30A 3UHPA 2F64A 1H6CA 1RU3A 3N8GA 3IT2A 1G42A 4L16A 4LEIA 1GTJ1 3DA8A 3WLIA 2WVHA 3HRIA 2FN7A 1A4RA 2B99A 3D0KA 1T5BA 4HUTA 3OTQA 4L9SA 2P69A 1KMNA 4TKVA 3E35A 4KPEC 1CR2A 3EHEA 1JLMA 1Z07A 3QPCA 1RPZA 2R8OA 2IE0A 2QPOA 2RHTA 2ZPUA 4G56A 1EFPB 1WMEA 3T5DA 1EEHA 2X41A 2YJTD 4E13A 5IX8A 1I7LA 1JIXA 3UAYA 5JCOA 3AVWA 1C7QA 3LJKA 3GD5A 4XRGA 4P1ZA 2PKWA 1Q91A 3TD2A 4CEIA 3FSEA 4P08A 3HYNA 1U3GA 2FYTA 2PJZA 2WWXA 2DETA 3EZNA 1RHUA 2LUOA 1ZBDA 1C29B 1U2GC 5BR8B 3PICA 3GLIA 4CM9D 2HT1A 1N9ZA 1UOPA 2PBRA 3CNOA 4OHZA 1VJ1A 1KSFX 4PY2A 4DV6B 2QRVB 4D9EA 3GJ6A 3MWEB 5CD9A 1FMLA 3HADA 4RTMA 2GCPA 4ZVPA 3K4HA 1R0YA 1AO3A 2DUJA 2IPOA 3MWLA 4OHYA 3QEMA 4H3HB 5EUBA 5BN3A 2HEGA 5TT0A 2CFTA 4JX8A 3VR5D 1EWTA 2PQMA 1FDIA 2VDWA 1UBJS 1O9HA 1UKBA 3V6LA 2PZGA 4J1SA 4QYTA 3TPZA 4F4FA 2YUTA 6REQA 2XTJA 3W4IA 1G3QA 1A88A 3IKMB 3OA0A 1HDYA 4MWDA 1AZSC 2BFBA 3DXFA 4U2BA 2BONA 2JAPA 1TRHA 3G59A 5EXDA 4IZHA 2CEKA 5E7IA 4ZAZA 1U4OA 2AFIB 4RIGA 3F4RA 2IP1A 2V5AA 1NMYA 4FHFA 1G4HA 4G2NA 4RXUA 3W6ZA 4A8JC 3EVEA 1YV9A 1QE3A 2J41A 2C4WA 3NTVA 2QEQA 5FHRA 4JP1A 3EGVA 1KJJA 1MEOA 4Y6GB 1ZX1A 2W9XA 1FNBA 2M2IA 4LCBA 4MIEA 3ZDCA 4RUKA 1XXHB 4E3ZA 1XGKA 2B4RO 4RHUA 5JNVA 3SZMA 4WNAB 3LT1A 1ZK0A 4H60A 4FLMA 2HMYB 2O19A 1DAKA 1PLJA 1PV1A 3ZTWA 3R41A 4ZQBA 1XPJA 4O25A 3E9DA 4U3JA 2VP4A 3DBOB 4U1RA 2OYRA 3MT7A 4QSHA 1UT5A 1TM7E 2O7RA 5CM9C 2HH9A 3PG5A 1VL0A 3UH1A 1ISMA 2EP7A 2VPQA 3DPIA 2A4MA 5I9MA 1BFKA 5T8KA 1TB4A 1T13A 4O02B 4TTJA 4DW8A 2QYSA 4H15A 5LMUB 1X1QA 3LHDA 4QDKA 1JSLA 5DSTA 1FU4A 2ALJA 2EJUA 1K5DA 1EUCA 2Z2JA 2VP5A 3GX1A 1NI4A 1XBTA 3LM8A 3OFKA 4PONA 1HTBA 4QD3A 5CVJA 1BX3A 4A8HA 5GJCA 5LYJF 4JYZA 1QP7A 4DZTA 2RAPA 4M8KA 5BWLA 2HW8A 2NT4A 3D43A 5FT9A 4Y2SA 2NV6A 1H2BA 1V9SA 3LXXA 4NSLA 1T9KA 4Z7NB 1I80A 3ND8A 3V1UA 4EPWA 2OG1A 3KYDB 1G6HA 4N47A 1V5EA 3Q11A 1B8VA 1NP3A 1LEHA 1ZGBA 2Q9AA 3C16C 3FGPA 2YWJA 4HZUA 3RSLA 4DABA 5AWFC 5AVRA 3SM9A 2JF0A 1K8YB 2OD9A 1LUAA 3ENWA 4PFQA 1MO2A 3VTKA 3K8ZA 4PQEA 4O4HB 3U1BA 4R2MA 2WRZA 4O0MA 1NQUA 4LISA 5ALNA 2YHUA 3JQAD 2JFYA 3AO0B 3FH0A 5FX2A 4GI3A 3U7IA 3OIDA 4W8HA 4AT1A 2LW7A 4JBLA 3OMLA 5DLDA 1RYHA 1XJCA 1EG7A 4FEGA 5BW6B 1DRUA 3VU9B 3ZZ0A 3DYBA 4FWTA 3PFKA 3TV2A 3A1NA 3F3SA 4HPWA 4YHHB 3UMJA 2FB9A 4HKTA 4RF4A 3W9UA 2EEPA 4H1UA 1ONOA 2I6SA 2BZGA 3O4JA 2CLIB 4JVSB 1EPUA 5TGZA 4BWVA 1EUYA 1ZH4A 1JBQA 1Z0IA 2JJ2A 2R68A 1KK0A 1H3NA 3QQ5A 3O1JC 4IFTA 5CLGA 1E2MA 2WTUA 2UYCA 5EAIA 1G3MA 1CEYA 4Q9AA 2GQ0A 3SBDA 2ZRFA 4N8DA 2I62A 3H3JA 4UM5A 1UXJA 1ESEA 2HA4A 3C24A 4DKJA 2P41A 4QGGA 5T5QA 2PEZA 4PCUA 2GZ2A 2WJJA 4HH3C 1SCAA 4BNDB 3PNPA 4WEOA 3RU3A 4L8WB 1MJNA 2JGJA 2PUJA 3I5AA 3KUDA 1W2GA 4JNKA 1DC7A 4NPCA 5BT9A 3GLQA 3K0FB 3TE6A 2I2DA 3NTOA 1Q74A 3H9JA 3R4CA 5EHGA 5IM4F 4RZ3A 1XZEA 4QJ5A 4B0PA 2DUNA 5DFAA 2EQAA 3IP6A 2A9QA 3B6EA 5TV2A 2IYPA 1K3UB 1ZSYA 1HE4A 1BEEA 1UJ6A 3IESA 3MMPA 1HY0A 1ZEMA 3ED1A 2WJZB 1R0WA 2BEVA 3RVDA 4DUZB 2H2GA 2GETA 2YOHA 1YE5A 4PF1A 2XQGA 4M9QA 4UD2A 5COAA 4F4UA 3VR2D 2I6QA 5K09A 5GWXA 2CNNA 3R7DA 4TT8A 3B9QA 4U7FA 1VL6A 5BWCA 1LS1A 1G7CA 3D8BA 2AJLI 4JA0A 1VQ1A 3NM6B 3EGDA 1ENZA 3I76A 2BL4A 3STYA 2CL5A 4ZIRA 1L0BA 1NY5A 4NMMA 1JDJA 5H9VA 3G1TA 3V4FA 3EUEA 1J1IA 1SU7A 4J0CA 3JWHA 4CUZA 3OVMA 1SIBE 4NJMB 2F9MA 2UUOA 4RSRA 1L6RA 1Q1NA 2BSXA 1K3TA 1G4UR 1Z2CA 3H4VA 3I04M 3OZ7A 2GPJA 4H6VA 1ULSA 2J3MA 1KI2A 1ZN9A 3C70A 4X8MA 3ABZA 1L8AA 4EY5A 2X8LA 3DW3X 3EC7A 4LI3X 1VMDA 5EE5B 3JTEA 4OHXA 3RSCA 3FTEA 3IEPA 3EH2A 3U3MA 3UK7A 2GRAA 4I0WB 2QRNA 4M99A 3R3JA 5ELXA 3D8NA 4GE0A 2ZIWB 5EXPA 3DM5A 3LY9A 4ZT6A 2ZYAA 3P27A 4G81A 5M5BA 1V3UA 4WNCA 1U28A 1W35A 4C2TA 3GPLA 4W5HA 1SZCA 4Q18A 3JAMA 3V8MA 2B30A 4MX2A 3T5BA 4EAQA 1K1EA 1TK9A 2DH6A 2VPZA 5BSGA 4TTQA 5KHOC 1BD4A 2Y6VA 4OXKA 2YV3A 3PEVA 3O9VA 2RGWA 4JZYA 2EFJA 4DR2B 5ALDA 1O0SA 2I33A 3W5IA 1NT4A 1I1HA 4RM3A 4Z54A 4UQLA 5ES3A 1QDUA 1Y1SA 3NIWA 3DBIA 4RD1A 4QOIA 2PJDA 4YMWA 4Q7EA 2GJKA 2CZQA 1E58A 1E69A 2QYOA 5EE9A 5HA5A 5LUBA 5MN5A 4W5QA 2I3DA 2NIPA 1JDUA 3VR4A 5I45A 3T35A 1KO7A 3IT0A 3K9QO 2FUSA 2JAWA 3NAZA 3T6KA 2PR7A 4YV7A 4G0WA 3L0IB 5HUJA 4JCOA 3GUYA 1FMJA 4AZTA 1LI7A 3IP9A 4AS3A 3HFGA 5F78A 4RGQA 2W00A 4CIWA 1J20A 3GH1A 2XMRA 4IXNA 2R85A 3FGZA 2UZ4A 1B74A 4ZI7F 2JGFA 4U6QA 3THYB 3L7NA 2WJPA 2X14A 1SXJB 1Y8QB 1X39A 3VOSA 5LXTF 3TFWA 3ZHZA 3DKPA 1DOZA 4AJ1A 2QUAA 3ZWOA 4E1AA 1BMFD 1JB1A 1QXSA 1ZHHA 3OX4A 4W7IA 1QV7A 3B52X 1S2IA 4LZZA 3T15A 1JHUA 3DD5A 4UZFA 5SYNA 5CU7A 1Q21A 2PAFA 1KARA 1CR4A 2VVTA 1V25A 2RG7A 4UM8B 3EAFA 3TIFA 3TNJA 2HYIC 2P9ZA 3D6NB 2YR0A 1D7AA 2I03A 2Q6LA 3KYCA 2H52A 3QM1A 2ZSAA 1TYEB 4HP8A 1YZLA 4RZHA 5K45A 1E3QA 1Y5NA 2IXTA 2QTAA 4P9NA 1B1AA 1QNLA 1U99A 3IELA 4PC7A 1W0KA 3FXAA 4PLYA 3UWSA 1NVVR 5B6PA 3A1TA 2P4EA 3F5FA 3MK31 1GG5A 2W6JA 3A6GA 3MUEA 3BJRA 3PHJA 4L22A 5BNIA 1NRWA 1YIDA 5DI3B 5EJ5A 1OWLA 2J0VA 1BVRA 4WASA 2VP3A 3U3KA 1FEZA 4DXDA 4X6XA 5AVUA 4C7OB 1P3Y1 1Q14A 1XPOA 5EP2A 1S2GA 1NW3A 3ESBA 4BB6A 1GKLA 2JRCA 4M7WA 3BMNB 2OFOA 1SQSA 5FA5A 3W2TA 2CD9A 4I8DA 4P33A 2FPLA 3O2QB 5B1YA 1QFYA 3EDQA 1KAGA 1L5QA 2EARA 3V9PA 4C1BA 4HLDA 1A5ZA 1CY2A 2I99A 3C4QA 4TV8F 4WNYA 3AHEA 1M34B 3U0VA 4I4NA 1FDVA 2LDBA 1O9BA 1CUIA 3FYUA 4PYMA 5ELMA 3V1MA 4L73A 3OX3A 2Q1TA 3V97A 1AGRA 2WUVA 4CBVA 5JUWA 1VPDA 2KQUA 2YXEA 2ZREA 1TQ2A 3L46A 1I13A 4V3CA 2QGNA 3DHEA 4ZANA 4DUPA 2ZZMA 3PT5A 4FYXA 1A1SA 1O0CA 2BFFB 3RS0A 3R24A 2E5LB 1TNDA 2GBCA 3B3FA 4I50F 4US1R 2O8BB 4E15A 2H2FA 4JB0A 3ZHSA 3E1SA 2WYUA 2D7JA 3I04A 1Q22A 3O0DA 2AI2A 3CZPA 5E2IA 3E03A 4KPGA 4C7JA 4JYBA 5CFPA 1QKIA 3HXQA 3OE5A 4CQMA 5K3FB 5ITZA 3WL6A 3RYCA 2XUZA 1TTQB 1UMCA 3LV8A 3UXYA 3TTXA 4H7KA 4A26A 3JQ6A 1WMBA 4KVGA 1P1BA 3VH4A 1A8UA 1EIWA 1IPEA 5H8WA 2LRHA 2OBNA 4LC1A 2G9NA 4BWFB 3HB7A 4Q0MA 5KNBH 3RB8A 3QTBA 3GJSA 1N6HA 4L72A 3AW8A 5TPZD 1WMFA 4BAUA 4RTRA 1SCUA 3EZGA 4FYVA 2P6OA 2W6CX 3T34A 1UKEA 3UJ3X 2C07A 3OIYA 3ANXA 4KQMA 4M49A 1E6EA 4L74A 4UULA 1WVGA 3GT7A 4MKRA 3FF1A 1QORA 1GGMA 1XAIA 1ZWKA 5HCUA 3TRHA 4TMKA 1U9IC 2GKSA 2QR5A 4RIFA 2VA8A 2VZ0A 4BO4A 1U3DA 1XD2B 4PYRA 3ISTA 2VF8A 2DWPA 3RUFA 6NULA 5CDFE 2M6RA 3PDJA 3PE4A 4A5SA 3PEYA 1DE0A 1I5RA 4M6WA 2HPVA 3OCEA 2JZNA 4CCWA 3WSWA 4B74A 4RK5A 5K4GA 3WLTA 3HWSA 1TZ2A 3MN1A 5IT5A 5DM70 4Q34A 4BEWA 1HF3A 4RE5A 2JGRA 2JLAA 3TSWA 1NUTA 2JKVA 5IVDA 1KDYA 3UICA 4EI2A 1J8YF 2NU6A 3FGNA 2DM6A 3U09A 1MORA 1XTRA 3DAFA 3TXXA 3L1JA 2WJVA 1LK7A 4PNZA 3CEPB 4JYCA 3SHVA 4NOKA 5KJCA 1QIGA 1RQPA 2IXDA 1X14A 3U81A 4AIIA 3EMDA 4ZT3A 3GRCA 4XI9A 1BXRB 4ARBA 1YU9A 3M0EA 3U0BA 1L4KA 4GOKA 2VJOA 1IRXA 4QUDA 3EFOB 4UNSA 4XVQA 1Z4PX 1YS4A 3ZHQA 2DYKA 3H17A 2BUBA 3N0RA 4PHFA 5EZSA 4MWOA 1HSZA 1SVOA 2BFOA 1BNCA 1OXMA 2FMXA 2JFWA 3MJFA 4YP9A 2A94A 2ECOA 2IKQA 1YR2A 3AHCA 1LX6A 4X8HA 2F3SA 5E9AA 3FCCA 5CBPA 4FC7A 1MO4A 2YOGA 5CFRA 2J9FB 2J6CA 3AEQB 3MUNA 2G4LA 3HDGA 3T9BA 3H2BA 4B3JA 1YQWA 4BMCA 5JNSA 2RGRA 1VJCA 1KFEB 2V6BA 3CLUC 4G1BA 1XWOA 3IOBA 3M83A 1LSJA 2HLHA 5AR1A 1AS2A 3VC3A 3RSOA 3L7IA 1HR0B 2O0JA 4RZUA 1ARZA 1PEAA 4MPPA 2HJWA 3R74A 3CISA 3U48A 2QTGA 4XB1A 4DLYA 1G5QA 1SBZA 2ZWAA 3I9FA 1GRQA 2QVYX 3WV5A 4ER7A 4KHPB 4LQDA 4K2AA 4JENA 1U5AA 2BFCA 2Q50A 1QVAA 1U0TA 1HYGA 1PWEA 3L8FA 4Q3NA 4UNNA 3TECE 1ZSNA 4PG6A 5BNZA 4O2AB 1ETUA 4J4TA 4YT5A 1D04A 3SYMA 1Z56C 2BMFA 2O2EA 3EDMA 1F8UA 5AHKA 5C81A 3J7AC 2IU3A 4LZOA 4V0RA 4P92A 3GFQA 1YZKA 1ZA2A 2C2WA 5FUMA 2QMHA 2JK0A 5D5QA 3OEED 2OXTA 1J2JA 4FMPA 4DDVA 3KYBA 2B2XA 1XZQA 4N7BA 3M6MD 4LXTA 2CE2X 5C7OO 1KEEA 2IBTA 4EL5A 3R77A 5EYPB 1VIDA 5JARA 1YRQA 1G8JA 2SKDA 2W0SA 4Y1RA 2NXJA 2ZBDA 1ZVJA 3LIPA 4L8VA 1DQNA 2VDLB 2M6LA 5FEUA 2I22A 5FV4A 1JJFA 2XUFA 3OQIA 1KKLA 2BAGA 4TTRA 4XGRA 2BKVA 1G9SA 2C4TA 2IT1A 4GM4A 2O6LA 3V8NA 4D81A 3HJBA 4WOKA 1IN4A 4YRZA 1LDGA 5B58C 5LN1A 2D6FA 1DTSA 5SZKB 3UPUA 3Q41A 2CFRA 2EL7A 3IJPA 4PWZA 1M5TA 1IWBB 2B7LA 3SG0A 5AVWA 1ABFA 3NIDB 5ALIA 5HE9A 2HWXA 3ASUA 4M2LA 2HA2A 5DHUA 2ZETA 4A92A 1NW7A 1IRIA 1WQ1R 2DY1A 5MGNA 4PX2A 1E9FA 4UEQA 1KI4A 3T7SA 4DYHA 3SAJA 3EGXB 4LQCA 4WESB 3KTAA 1WRBA 5LWQA 2PUAA 3N2LA 2WSBA 3I2KA 3ZX5A 5KINB 2C1EA 4GR5A 3Q5DA 4M1SA 4DC9A 4OK6A 3TZLA 4QU5A 2J5RA 1SUDA 3O8NA 4FGSA 2WAAA 2I66A 4IUCS 4TPKA 5HZMA 1DAEA 1VYTA 3R0VA 4ZT2A 4NCAA 2EJTA 3GLFE 3VH2A 2E1PA 2G6TA 2GASA 4EPYA 1VI2A 1GSIA 2XH8A 4KTVE 3RC7A 1RTTA 4UATA 3WK9A 2DWUA 3VPDA 2ZT7A 3JWGA 2BTEA 2ISSD 4GMKA 2F1HA 4L9WA 4BNIA 4GX1A 3FOBA 3OEWA 4TWBA 3OG9A 4A2CA 1DHTA 1FNCA 3NMUF 3LVQE 1N2ZA 4RLQA 3IALA 3A6EA 2PS3A 4MMZB 2PNJA 2FAXA 2C3MA 1ACLA 3KTFA 1C9EA 1RZUA 3WLSA 1RBQA 1X94A 4EGJA 4OGWA 3JU3A 3KEFA 4L4UA 2QLNA 4NDZA 3PYLA 3IAM1 4PAOA 2G9UA 5IK2D 1FW6A 1TA0A 1RFLA 2HLNA 4IGKA 2X0NA 4R8KA 4S1PA 3LTEA 3VOBA 1O6CA 2DEUA 3HHEA 2QTRA 4BV3A 4AUMA 2APJA 3QVUA 4ITVA 5CP8A 3CNBA 2FLKA 2Z9DA 4HXYA 1F8XA 1KFBB 1PTJA 4OPMA 5D51S 4R0NA 4FPXA 1EP1B 1TVKB 3IDAA 2O1WA 3PA8A 3ROZA 3GEBA 4JT2A 4WY8A 4DG9A 1E5XA 1OZGA 2P78A 4DA6A 4DR5B 1RAIA 2MSLA 3C0KA 5JSQA 2HQBA 2MTBA 4X71A 4TYMA 4DE5A 3EGIA 1ULZA 4ARZB 3Q3VA 5AW4A 2QE7D 1L5GB 1O97C 3R3UA 1OTHA 1WDKA 3ND9A 4QPZA 4M1OA 1EX1A 1BIFA 1P80A 1MAUA 2J6IA 2G70A 3A32A 4H59A 3WBKA 4HQKA 1IK4A 4KV7A 4N8SA 3GUVA 5I3ZA 1FX0A 4XVHA 5AK5A 2HNBA 3N8DA 5JZOA 3EPKA 1AXRA 2B8NA 1MRNA 1ZMOA 1JAXA 4F1KA 3TG8A 4U0JA 5F92A 3EZLA 2J59A 4UNRA 2PLWA 5B7GA 3W5VA 4P22A 4DUGA 2PZBA 3PYMA 1KS9A 4P7BA 1EWKA 4PAGA 5ENZA 3A4YA 3OLXA 5KPJA 3EIEA 2PIAA 1KC1A 4OLAA 2V7UA 3OEHD 1L5OA 5E38A 5JXWA 3GGJA 2OHJA 2X0DA 4G9GA 2E48A 1VHDA 1ZI8A 3ZY4A 3OWHA 2FW7A 2GB4A 2GVNA 2H6EA 2Q5LA 1GQFA 2VYQA 2WYWA 3EVDA 1NW9B 2N1BA 1IJEA 3N2KA 2XVZA 1U3CA 3L9WA 2IYZA 4MVJG 2G04A 2W37A 2YMMA 4N8EA 2CNBA 5K0LA 1T4BA 2IZ6A 3NUGA 3PSAA 3RREA 2Q9BA 4BE7B 3FBWA 4OI4A 1K9VF 3GW8A 3ETJA 4UOEA 2HV8A 1YOVB 5U4XA 2GZ3A 1TA9A 2PWZA 2REOA 2YJ5A 3AGPA 2W71A 4ND3A 3F97A 3HBLA 4E2XA 1UXHA 3KAQA 4OVKA 2RK6A 3IRVA 3QX7A 4B2YA 4MS4B 3OSUA 1NE2A 3DE2X 3JPYA 1VIAA 4NEQA 4ZOQI 1XMOB 1P7ZA 3I53A 2G80A 3HDHA 4ZK2A 1XDUA 5CYPA 1JKIA 4QTYA 3L0YA 1V7ZA 4D4GA 3HV0A 1CP2A 3CW9A 3LGSA 4ZHQB 5M04A 3GYBA 1Y82A 3I8XA 4P4LA 4PQGA 1A2QA 3PITA 4ECEA 5DF1A 3R3ZA 4GFDA 1LDMA 2BD0A 4FHCA 3W0LB 4BFWA 1GT6A 4F56A 3HL0A 4E5PA 4KQXA 5KKAA 4ZOEA 4DM3A 5A4AA 5T4FA 1FU7A 2ZI9A 2QV0A 1RLJA 3UJDA 4UOZA 4E21A 3ELBA 4KO1S 1YTUA 4QUAA 3OKCA 4A10A 1UM9A 4GH5A 2F8SA 3DTYA 3AI3A 1WDTA 5AW7A 3UB3A 1KTVA 3ZJTA 3TCNA 5EGSA 3CNEA 4QBTA 4DAOA 1J5XA 1FSZA 1YQ9A 1AZWA 3EXG2 4HH0A 4KH1A 4L4RA 1GKUB 3KJXA 4NE7A 3GA5A 4NP6A 4Q3AA 5AJUA 2FFJA 1C3OB 5A3SA 3VKFA 4D42A 2X2EA 1W34A 3I37X 2OLJA 2O06A 2VTKA 1JW9B 3Q3HA 5L6MB 4AYXA 1A1VA 2W8BA 3FWZA 4M1ZA 3EPPA 4S1NA 2C83A 4GOOD 4I1RA 4J0QA 4L50A 1K6IA 2ATCA 4KLAA 4WY5A 3GNTA 1EK0A 4MRRA 5TXGA 3CLTC 1E1CB 3BHJA 4ZOLF 1N77A 3ILYA 2POCA 5ALPA 4MB6A 1YJXA 3CGGA 3HCPA 4XOUA 1ONNA 1NKTA 1KK3A 3EW7A 3BXZA 3ZS9A 4D0SA 5EIWA 4BWYA 2RGCA 3NTQA 3WNQA 2UZ1B 4FEEA 4JVNA 4N0DA 4NV3A 1CY1A 4QKQA 5LIPA 1OFUA 3C14C 3Q12A 1AGNA 3BGVA 4F3YA 3PU6A 3QUCA 4ILEA 4QVGA 1FBNA 4AY5A 4EP1A 2RGNC 3P5SA 2J31A 1FVFA 5DJ5A 4KRGA 4YDSA 4ZALA 1EK1A 4GRAA 3Q15C 5H16A 3P9ZA 1AN9A 4MGZR 3DBLA 1G8KA 5DTIA 2CLFB 2I9KA 1QLHA 1ZUNB 4P4UA 3TQSA 2YRXA 4E07A 1IN8A 1R0CA 4DLVA 3VYUB 1LVHA 3IPCA 3QVKA 4R8SA 3HGQA 3NZEA 3X2EA 1OIVA 4PTYA 2YVUA 3NP9A 4P81A 1IJKA 1U2ZA 3BC1A 3N07A 4LW8A 9LDBA 3PV0A 1T3GA 4KFUA 5E4JA 2IV7A 1L4EA 2OGSA 1Z8HA 1IHUA 2ZBRA 1OCEA 4M38A 1XEXB 3BE5A 1MNQA 3HMKA 5MF6A 2A5FA 3U4CA 1CR0A 2PMWB 3D5EA 4Y6OA 4BGUA 2ZWMA 3DTVD 1Z4QA 3TIIA 3W1WA 1RE5A 1DEAA 5TEVA 4XB6B 1RWBA 3V33A 3B3AA 1MIHA 4Y1FA 4H3KB 1ZGGA 1FDWA 1WLSA 4DR3B 1T5DX 4Q9HA 1F6WA 1J56A 2BMDA 3SFVA 1VL8A 1K5HA 2ONYA 3WDMA 4QOEA 2WFLB 5IBPA 4EJSC 2O2JA 4PAQA 1YJ5A 5FBVB 2BV3A 3KL4A 4WK2B 1HE1C 1KP2A 4Q7JB 1WZ2A 4UU1A 4EEKA 4AG6A 5JSUA 1YZYA 1U02A 4D9KA 2FSIA 4G0XA 4MPTA 5JIBA 5CG1A 3RANA 4ENRA 4EKNB 2XUQA 3V2GA 2QN3A 1B26A 1XC7A 4KDEA 2QROA 2J4CA 4ETIA 1I7SB 1AA6A 3EZFA 3DVLA 5CBKA 2F6RA 1CRZA 1G2PA 3DTNA 4FX5A 2RJ3A 4GVPA 1P9LA 4YA6A 5L7TA 1CE8B 1SUFA 3H2JA 3E61A 2XOEA 3OIUA 3EASA 1O94A 4ON9A 1QYVA 4Q6WA 4RK6A 3AG6A 1ZJWA 3U44B 1ZGJA 3M33A 3BQ9A 1SURA 1L6IA 3PDHA 4RHEA 1QYXA 4IDCA 3TDNA 5KAPA 3CLHA 2ETXA 4LJSA 4WOCA 1V3QE 2BE7A 4OOEA 1H2ZA 3LP6A 4WJZA 4C30A 5LOVF 1USGA 3WWPA 2XLCA 1Y4DE 3I6YA 5F7JA 3E1GA 1PZGA 2G07A 2I3BA 3EGOA 1UKZA 4HFNA 5H1YA 3RG8A 2CMDA 3P97A 4L78A 5BOSB 2B2NA 1HDOA 2HK6A 4JVOA 2ZRIA 1OR8A 3D3QA 3KSBC 1ABEA 1T3LA 3KQPA 4JUIA 1SMKA 1VKRA 5GTDA 2J09A 1AHNA 3JVDA 3UV3A 2TSYB 5IJXA 1E4VA 4YP1A 5H9WA 2ZVDA 3IQDB 1YAJA 4MROA 1G3UA 4FP9A 5H83A 2XZOA 5KQPA 2G8NA 1W4LA 5D86A 3SC4A 1H23A 3H8VA 1W76A 4JC8A 1N2JA 2VOJA 3CX4A 4DBLE 4R9SA 5CIWA 3AP1A 3TJZA 4LSZA 4JXZA 3OTOB 3ECAA 3PE3A 1N6PA 2PSJA 4MQBA 5TT1A 3U3DA 5IH3A 3D2LA 2ZRGA 3ONVA 4EW6A 3OCUA 2A35A 3G7SA 1A9XA 1MTOA 1Z7WA 4Q9IA 2I6FA 5CNMA 3VFDA 1T25A 3RRXA 2IFTA 1RACA 4IGEA 1XV5A 3AT1A 3QA3E 5JLAA 3RV3A 2OECA 5ICGA 3KDPA 3NC0C 1KE2A 2XB4A 3HXTA 2M6KA 1NVGA 4P4NA 1FJ2A 3REQA 4BQNA 2XI4A 3WADA 1AGYA 1OTXA 1QVZA 2F1OA 3CFYA 4EB8A 4YUYA 3UA3A 2XYVA 4HS9A 1O6GA 5CB4A 1M8KA 4E1VA 1DX4A 4QYWA 3R20A 5TJ9A 3HXLA 4RVOA 4UTZA 3UHFA 5CDGA 3RHFA 3IRUA 1B8OA 1G7TA 2XZTA 4G23A 1VLQA 3ABQB 4X8LA 1UZMA 4JLUA 4H7FA 4UMEA 5ADWA 2H4YA 2ZYGA 5B3JA 2O3JA 3CR3C 3OCFA 5B4UA 3RD8A 1QV6A 1W88A 4M98A 3ESCA 5BWNA 1CY7A 4WJKB 1YFEA 1SBYA 1ZNYA 2RHRA 3DPUA 3WIOA 5IF9A 3NHSA 1RQXA 3PP8A 4H7PA 3DONA 1PEKE 3DZHA 4QO8A 2ESRA 3QMVA 1AKQA 3FKSA 2OBLA 1QDEA 3H18A 4L5CA 5CCDA 1VE5A 3S2ZA 3QEBZ 2QG4A 1QH8A 3V1LA 4B35A 4EJ0A 3BN3A 4WZ6A 5B4VA 2VJMA 3Q98A 1Y3AA 1QJCA 1HYHA 2VJCA 2VQDA 3VPGA 4TT3A 2MCFA 2PS9A 3EXEB 3WL4A 4LY9A 3O8DA 1M6VB 4MJXA 4E12A 1L8LA 1RM4A 1WV0A 4QM7A 2WQ6A 3C98A 2QZPA 3ZH2A 4NENA 3AM1A 2PUTA 1TAQA 2GYWA 3BRWA 1E8DA 1KR5A 4Y0VA 4BO7A 3UAOA 3TZ6A 4CT5A 4ZJUA 2ID8A 3O0TA 4G07A 5C35A 5MN4A 1Z39A 4J29A 2C2OA 3NT4A 1YR3A 1Q7EA 4IL5A 1WG8A 4TTPA 1ZUWA 1H3EA 3PHGA 1NJGA 1WF6A 4HGPA 1EX7A 5TY0A 3SSAA 4C0XA 3NP7A 5IULC 1E7MA 4YT8A 4NMHA 4X3OA 1LJ8A 2H0RA 3P0IA 1F1JA 1TGVA 4ZI5A 4IWXA 3IILA 4CDMA 4E51A 4F4IA 3AEYA 3ESRA 3NTRA 5EQDA 3U7QB 5E4TA 2EDAA 2R6ZA 4HNRA 3MFYA 5JCOC 5IZCA 1CX9B 1NUAA 4HH1A 3F3KA 1R6DA 4XJXA 5HS4A 4BO9A 3T3EA 4YFVA 4ARAA 3BMCA 5F1KA 2J30A 3NAGA 1VKZA 1R5OA 2IY8A 3KLOA 4MUNA 2ZJ3A 4XX0B 521PA 1U0NA 1YCDA 4A8PA 2JAQA 3I0NA 3CVWA 2R79A 3PXDA 3UKDA 1FSPA 1T6XA 1U8ZA 1SKYE 2ZYIA 4B3BA 1E2UA 4LF6B 1TYAE 1HFKA 2E9SA 3FGOA 3HKDA 3OU2A 1CUGA 2CLDX 1FDRA 3N86A 3SIWA 3D0QA 3NT5A 4BDTA 1RLUA 4YN3A 2HRRA 2C8LA 1KU6A 4Q9NA 3SQWA 2ACVA 2VS1A 5DE3A 4QATA 1FY2A 3USCS 2ZJ4A 2EKLA 3PR3A 1XMSA 1Z6TA 3AR2A 4UVIA 2I7VA 1VG1A 3IHWA 1P2DA 1VCOA 3DOCA 4QECA 4TTVA 2JS7A 1EK6A 4QC2A 1YRAA 5JVDB 2F3TA 4YP5A 3LQFA 5HGXA 4Q12A 1WMDA 1RAFA 1NV8A 1EX6A 3A1UA 3C8TA 4OGKA 1H2EA 2L18A 4N6NA 5CDYA 4C07A 2E21A 1XA0A 3MG9A 4NIMA 2CUNA 2I54A 2A88A 2RHLA 2A3RA 3C4VA 2NV2B 3LPAA 4QDTA 2BFNA 4MDHA 4ZDIA 2UUPA 1ST3A 4TZ6A 2BJVA 2WJWA 5BN5A 2XJ4A 5HGJA 3EHDA 1ZAYA 5AXBA 1DLIA 1KGDA 1MQ9A 3MELA 4HJRA 5E3IA 4C2BA 4D7AA 5FOQA 4B31A 1QYDA 3OP4A 5I4IA 4PGGA 1H9CA 1GNRA 5T7BA 1GO2A 1IXSB 2XWJI 5L95A 1GITA 2B7CA 1EI9A 2EGHA 1D09A 1S3SA 4ZN6A 4J1TA 1KFKB 2NWQA 4OMDA 5BVGA 1QK5A 4LOAA 2GN8A 3TAUA 3AU8A 4NSNA 5T8KC 2ZUEA 1YCFA 1E7SA 2NP6A 3MBOA 1PWYE 1A76A 2O3SA 2CSUA 2DTDA 3TM4A 2FN9A 1EVEA 1HFEL 2PGDA 4RDCA 1TJVA 7YASA 3KKKA 4ZCQA 4ZV9A 4I7EA 2JJYA 4ME6A 3HCBA 5JQWA 3N1UA 1SY7A 3VPCA 2GVDC 3GNLA 4YMUA 1GXSB 2ANCA 1P1HA 4WLFA 1DAIA 1K2VN 1LNQA 1HGXA 2CHEA 1BS9A 2PM8A 3TLGA 1T15A 3CV3A 1NRIA 2YFQA 1THMA 4J4HA 5JSKA 3SKVA 1P33A 1JLKA 1F3OA 5ALRA 5INTA 2ZPAA 2H1OA 1LRJA 3D4LA 4JU8A 1ODLA 3ZWYA 2WUFA 2X8JB 3WXMA 3H5NA 1R7RA 4RMHA 4KXFB 2IGBA 2QA5A 4HGZA 3FNGA 2O8FB 1NE7A 1RKQA 2WHYA 3CF0A 3ZD8A 2IF0A 1R18A 4Q21A 1PJRA 2FSUA 3DDOA 3AY6A 1OASA 1KF0A 4S2EA 1YS9A 4JJKA 4X93A 3L6UA 5TJHA 4ZYWA 5HPYB 2NZJA 1M1YE 1RRFA 3A10A 2A3NA 1QTNA 2GD0A 3KXIA 4TKUA 5DTRA 3TX6A 5IDXA 4KR3A 2OCPA 3L8MA 4WSOA 1CVIA 1W96A 2XGGA 1KVRA 4B4UA 4E7OA 4EPTA 1JJVA 5LSAA 1DIRA 4H18A 4OYRA 3IE1A 4CIAA 1R50A 2G5TA 5TMEA 2VT2A 2WD8A 4G9BA 4NZOA 2GBIA 1LCIA 2W6ZA 4RK0A 1D7OA 2FRDC 1ZA1A 2CCGA 3DDZX 1PJ4A 3V8QA 3RWMB 2MMGA 1TQ4A 4PO8A 3O3MB 1YDEA 3UMBA 2E1RA 1NHGA 2DQZA 4ISCA 3HJFA 1WCYA 5BR4A 5C1PA 1K2WA 1NM5C 1T5OA 4EEIA 4TLCA 3ZLTA 3GEHA 3QXHA 2HX1A 4DOMA 4F5DA 5IXJA 1JU4A 2CVZA 2DHEA 5CW2A 4N5DA 4Q3CA 2P6RA 1EFRA 4DG5A 1BD3A 5JSZB 1JLRA 1K6MA 3QE0A 4M0FA 4EY7A 1UXKA 2PCJA 3KLMX 3Q1LA 5EVCA 1PYDA 3SHOA 2QZ4A 1RJ9A 4MH0R 3RFTA 3VPAA 1EXWA 2XITA 2P75A 3D7NA 2FRXA 1TYDE 1KDTA 1MOZA 4F3RA 1FS6A 4AKEA 2Q1YA 1IUKA 4MIYA 1Y80A 1QVVA 4DQXA 3ZTYA 5DM4A 5B37A 3NKFA 4DT1B 1EQAA 4RPGA 4RHTA 2Y27A 4JA2A 1ML4A 1VL5A 1MABB 2Z58A 3HDYA 2GESA 3LBYA 4MDFA 1NSYA 1YC5A 4MI6A 4ICIA 1JHMA 1CERA 2AN1A 4AF7A 2BP7A 1Y5LA 3H1PA 3I6ZA 2H2HA 4G0MA 1XN4A 4JBGA 3RBAA 3ZYZA 2RCYA 4JQCA 3V46A 4YQFA 5KMGB 1YIOA 2OBMA 1GPUA 1S9DA 4JY7A 4PN7A 2ZRCA 1VLHA 4EW3A 1Y4AE 3C4JA 4FWIB 5D5HA 5DO9A 3IVXA 3ZIAA 3CEAA 3UPTA 1I2BA 5CVVA 3RUCA 4RTLA 1DEOA 2VWPA 3BSFA 1L1RA 3IVMA 1FP6A 1Z6AA 3I83A 4N3CA 4HYQA 4M36A 3QG1A 1JDZA 1EVQA 1XQ9A 2W70A 3AR6A 7ADHA 2VDQB 3UW3A 2BGJA 1PIWA 4KR6A 3TOCA 3RIGA 3AL0C 3C3MA 121PA 3GJ0A 1HX7A 3Q7TA 4TSKA 5JS8A 1PL8A 3QNMA 4ZGGA 1ESNA 1CUEA 1UKAA 3JYOA 2I6TA 4LXXA 2ZDQA 3VHLB 5K01A 3ZDRA 1CZUA 2ZATA 1L7RA 5TQ0A 2OFFA 3WA7A 2NTEA 1E1LA 2C5EA 5LB2A 3RHSA 1YR7A 2O5CA 5C1OA 1C1HA 5FADA 5GV8A 3ZV3A 5CTJA 1SAYA 1A5TA 3CRMA 3UNXA 1PT9A 4EI8A 4N5MA 4ES6A 2QS9A 2AI1A 2D59A 4DCTA 4YJ2A 1RW4A 2CLCX 3N0WA 3UUWA 3L8ZA 3S5UA 2XX3A 4EI9A 4HOYA 2NP7A 1Y8ZA 4Q9KA 1UP6A 5AKYA 2V3CC 4EM6A 3NEYA 1IZYA 1S1MA 2P90A 3MCVA 4G1VA 4WGFA 1RRVA 4JGGA 1ZOSA 5E1MA 4DMMA 4M9ZA 4H0NA 4D9JA 2P9YA 4TS9A 1L7DA 2PD6A 3ANTA 2JAOA 1WSAA 3UV7A 4WX2B 2QENA 3GDOA 3JWJA 2NGRA 3LT2A 3SXUA 1U6JA 1EA7A 1U0JA 5HCIA 1QQTA 4IMRA 1JHAA 2H16A 2WJGA 3SIRA 1PZFA 2ZBGA 4B0OA 1K5PA 3ZHTA 4NCJA 1JPNA 3BQNB 4RABA 4BAGA 2X2OA 2R8BA 4FGJA 3ANSA 1PJLA 1QX4A 3SEZA 3UOWA 1COWA 5FDFA 1Z68A 2P9CA 4I1UA 1KQ7A 5D87A 2GSDA 2QX9A 1VL2A 1ZVKA 2ZAYA 3G0IA 2G0AA 4RBNA 2VK2A 1CEEA 4AI6A 3O8OA 1ZJZA 4HC4A 4HZGA 4BZXA 2OKCA 1G18A 1XEFA 4R7TA 4BP8A 1Z83A 1BXKA 5AVQA 5ALZA 3OWXA 5F5XA 2VHWA 5HF9A 1WPRA 4PZUA 1HSOA 2GJ4A 3P9XA 5COQA 1X1CA 2JLZA 3QMMA 1I0LA 4Y2UA 4RVSA 2R6DA 5CFZA 5CLHA 3LCMA 1J8VA 4BNVA 1LTQA 5EIHA 2V8OA 2GCOB 2VEDA 3Q7EA 5AXCA 1K98A 1XEWY 2J8ZA 2V7GA 3L0ZA 2WTXA 3DVSX 3WYFA 4BP1A 4M4SA 1SK9A 2ZTVA 3GBPA 1E0JA 2IU6A 1ICEA 4YBZA 4P58A 1Z7BA 2AOTA 3KS9A 1J8FA 4U4AA 5DYWA 1VE6A 1QLWA 3E27A 3W3ZB 5B1DA 5JFGA 4B3TB 1B0PA 2WIFA 4KNWA 2GCGA 3JTMA 3TIVA 1FUOA 4BLUA 3DAHA 1IZ9A 1DAHA 1BW9B 3CH4B 2A59A 5HSGA 4OKNA 3HDJA 2P3OA 3S3TA 4IAOA 4RK4A 1ODJA 3A2KA 4B34A 4C4PA 4E22A 4L3VA 2BZSA 5HFNA 2RK3A 2QLMA 4EG0A 1ORTA 3IEVA 5DW0A 3NANA 3TBHA 2OR3A 2VR1A 3UW1A 3HCOA 4NKRA 4NZPA 3FYUC 4IG4A 4OGFA 1MIOB 1UQRA 1Y6JA 2ZYRA 2A67A 3IUBA 3EGWA 3OCXA 5BVHA 3GJRA 2O3RA 3LL4A 2L82A 4RV5A 2Y9MB 3DO8A 1KVSA 3BXPA 5CX4A 2V98A 3P7MA 3KV1A 4XYMA 5EIOA 2UVQA 4WHMA 4J3NA 4LF5B 4HQOA 4ZXFA 5I9SA 5GGYA 2NAFA 2FX5A 4ADMA 3WK4A 2V4ZA 2FJPA 4AS1A 3AJ8A 4S2UA 1QQAA 1AKVA 1ODSA 3OZCA 4R4JA 3RTBA 1RZRA 4R8VA 5ALFA 1FB5A 1BMTA 1NNEA 2B4KA 4ZAYA 3GFGA 2AOWA 3IYLW 3IBTA 4IJKA 4YJHB 1UK8A 2EERA 5DLYA 3U9LA 5KNCA 3NHJA 1SQGA 5TPWA 2JJ1A 1RNLA 4DY6A 5JALA 3BCUA 2EKQA 2GZDA 3AUAA 3QFSA 1E6UA 1NVAA 4EGFA 1CS4C 1KFJB 1CCWA 3EARA 4ZARA 3DVAA 2IODA 2ORWA 3ML1A 4P3YA 2XDWA 3PWKA 3BA6A 4QNRA 2XCLA 3K1AB 1GPBA 4RSMA 4X6UA 3FSGD 5D7BA 3VR6D 2DF8A 4BZPA 2EBFX 1LVUA 3P9CA 1R5JA 1BE0A 1X80B 5L51A 4G89A 3HBNA 3LDHA 2NU9B 1OC2A 1E2QA 1Q44A 1PR1A 3H6GA 3N2NA 3TW8B 1WNFA 1M2HA 1W85B 2DOKA 2J5BA 2QTWB 3MGCA 2YJGA 1UAGA 3B1ZA 5TC4A 2UAGA 3W2GA 3IIJA 4DN6A 4US2R 1XLUA 3HB9A 3RGGA 3RC1A 1JA0A 3F8TA 2AG5A 3VSAA 2OXEA 1LZLA 2BM0A 3EPJA 2CB0A 2C9ZA 3JY6A 4JKOA 7REQB 1GZ7A 1U3FA 3QWHA 2WV9A 4CI9A 2J3DA 3GB9A 4J9VA 1IY2A 1YUBA 1PR3A 3GH3A 1X0XA 4YRJA 2FG7C 3DFUA 1IZ7A 1H8EA 2XCIA 5CA1A 4XYEA 3OIFA 1XA3A 4Y0AA 3LC2O 4MOWA 3ZGOA 2BGUA 4RF3A 1RMYA 4K6KA 3QEOA 4JC0A 1HRDA 1PG5A 1YS6A 2D1QA 1J9ZA 1CZKA 3QXJA 4GU5A 5IJ9A 3NC1C 1XVTA 1YMUA 3A27A 1D1QA 4HNAA 3A70A 1ODTC 1VHTA 1C0PA 4DQKA 4HGQA 1Y1QA 5EFZA 2Q7DA 2V7QA 4EYEA 1UC5B 2WVAA 3LNCA 1ZO8A 4XJVA 4RE6A 1Z5GA 3ZGNA 5JANA 2R8RA 4F2HA 1AZLA 1CW2B 3IR5A 5AKIA 2PS1A 4ZYVA 3AEKA 4FWBA 5FULA 2IL1A 5J3JA 3IQHX 2AJCA 2CY0A 5A4DA 4JV5B 1GL3A 3R3VA 3MUOA 1V43A 2CW5A 2G4VA 4HAOA 5FBHA 2WSYB 4KG7A 2G72A 2PLAA 4UEWA 5BSFA 4X95A 1RKUA 5AI5A 1Q1BA 2HB6A 5JI3E 3HS3A 1HLFA 3NBXX 2P3QA 4NMXB 1F9AA 1P73A 3ESDA 2HHJA 2ICAA 2PTRA 1Z82A 5DWQA 4DA8A 4HB2A 1EGAA 1GFWA 2YH2A 4I9NA 1MF7A 3VVMA 3CVYA 3PKIA 5HX7A 3K16A 1H3FA 2XMDA 2XVXA 2ZUSA 3L1HA 4JBNA 4KXVA 4Q4HA 3OUTA 1OC4A 3NXSA 1QHHB 2FOLA 4LYHA 4ZCTA 1NW5A 4EO4A 3Q2IA 2J7KA 3U16A 3QHQA 3NBMA 1Q0RA 3A6JA 5BV2P 1EM6A 4UEJA 1JF8A 4RWEA 5CURA 4NQRA 1NC3A 1WVIA 1QLJA 4G85A 1ZCZA 1ZIYA 4KVAA 3SF8B 5KSZA 3PC3A 3MCAA 4HNSA 4OUKX 1E79A 3HI6A 2GPSA 1GZ6A 1M2OA 5IUNC 4WRRA 4ZAXA 3T61A 4RIIA 4DMLA 5LUAA 4U2KA 3TB6A 1I4TD 4CM1A 5A04A 1OFGA 4CF3A 4IHJB 5KTSA 4I4TB 4NDAA 3F9IA 5FBLB 3THWA 1ENPA 2ZTMA 2QMOA 2FGKA 3LCVB 5MGBA 4B09A 1KERA 4DJFC 3HN2A 1KWGA 3RABA 5HKOA 3H5AA 3K6SB 5DK4A 3HUUA 4KGXA 4ZQEA 4E94A 1X19A 4EJ6A 3KQOA 1BWQA 5C4IA 3VSBA 4HRXA 3PX3A 3ECSA 4YAGA 4RA6A 1WL8A 1CF2O 1AE1A 2HSDA 3GT0A 4Y67A 3S8MA 1IJFA 4W6ZA 3A3YA 3KZVA 4R6WA 1NNSA 3VNRA 2NXEA 4QG7A 2VN8A 3HYLA 3A0RB 3QH4A 2OYCA 3DMGA 4LV8B 3FMOB 4JASB 4NCHA 4YAOA 4BGIA 1A4IA 1ZC3A 3OD1A 5C46F 5CB8A 4Z7JA 1HETA 4MYTA 3Q8KA 8LDHA 1NG1A 1R6BX 4LJ7A 3WRVA 2HA0A 5AVYA 1UPTA 2DUWA 1TK3A 1CS0B 1IWPB 3JQ7B 1EHIA 4YYZA 1ZPDA 3O73A 3T9AA 4QICA 4EBBA 1H2AS 1LQTA 1SPBS 1GN9A 2RONA 5F77A 4I3GA 1EFLA 5F9FA 2VBGA 3IQIX 4QAJA 4Q01A 1PYGA 4L85A 3TJRA 1VB3A 2W48A 1TLFA 3CNNA 5KX5F 4G41A 1ZW6A 1A9QA 2ZIAA 4JQSA 2ZXEA 3DL0A 4YXWA 4IF4A 4BO0A 5KNDA 4NZ9A 2DSNA 1RYDA 1YE3A 5FBRB 1T2UA 3DMHA 1E1MA 1XFDA 4J3JA 4WXMA 3VSCA 5I7WA 1EVIA 2GA8A 2QL5A 5DHSA 2Q0HA 4OAOA 4YJKA 3WNBA 3EDRA 1E2HA 4U7WA 5B57C 3FHOA 1RLIA 1YFKA 2GZ1A 4ESHA 4WKCA 2AFIA 2JD2A 4OLFA 1KJZA 4H7IA 3RIHA 2YZGA 2XW6A 5SV2A 5FBWB 3WIDA 1JGTA 1A7AA 3JRWA 2VP6A 1FFBA 3C5HA 4QHTA 4WLUA 5EL0A 1EDBA 5J5AA 2ZIVB 1DJPA 1HL7A 1VLVA 1XXHA 2QR3A 4GSKA 4R3UC 4UASA 4U02A 1DQSA 5T64A 4YV2A 1DFIA 2Q3CA 4CU5A 4R5HA 4MTCA 1ANKA 4WNAA 1CUJA 5IWAB 3SJZA 4Z3OA 2AK2A 4LZAA 5EGNA 1JKJB 4RIEA 2YV2A 2ID7A 4R7ZA 1U2DA 4IV0A 6PFKA 3CNLA 2JFOA 1G5TA 3GZNA 1S2DA 1UP7A 2HPAA 2WZDA 2CNWA 3E18A 3WY9A 1CRPA 4C78A 1ODCA 2GTIA 2JHPA 4MA4A 3W2HA 3V2HA 3UAWA 3VKGA 3RVMA 4X61A 4BJHB 5F2NA 3E04A 3O3CA 2BY4A 1QG2A 1R4NA 2G5PA 3BVPA 3OMWA 2WWRA 3PPYA 3X1MA 3N7AA 4ASUD 1TQHA 5IT4A 1NXPA 4YROA 3N7UA 3ZH9B 4HAVA 1RHRA 4Q19A 4ZCMA 4JLDA 2ATEA 4P3NA 4GNRA 3AR9A 4DPMA 2H65A 4B3IA 2EX1A 2F2TA 3SQNA 4BZQA 5TEWA 3IOCA 2HBZA 3EPLA 3GBVA 4JUBA 4NYIR 2VRBA 4JDPA 3KVRA 4RO0A 2HK7A 1ORIA 5KHLB 2X9NA 3P4XA 1N57A 4MXDA 3D6MA 1SU4A 4FCWA 3EYWA 1TD1A 5JOQA 1CB0A 4JYPA 4EA6A 5FIUA 2IOYA 3WLAA 3ZU2A 2CN1A 3DCIA 1ZJ5A 4M37A 2PVPA 3HV2A 5IT9A 1EFHA 3H19A 2AGVA 2WVGA 2WDZA 1KOGA 1ZQ9A 4NI5A 2V1UA 3ROEA 4NS1A 4ZEWA 1CUVA 3GLHB 4FINA 4ZVUA 5TMBA 2QOEA 3LT5A 4GM1A 3V4VB 3U49A 4BO2A 4DRXB 5JO0A 1IBMB 4ZPJA 3N8HA 1WXXA 2HR1A 3I30X 1XVVA 4COOA 3I9V1 3CW8X 4BFUA 1GGNA 4ZRDA 2C2YA 4AG3A 2CT8A 3FUWA 5LA6B 1ZH0A 3Q3GE 5FBKA 5EMMA 1ZRMA 1O5IA 4CHTA 5ER6A 4EA9A 5BMVB 2YNMA 3TLBA 2Q8PA 4DLWA 1HDRA 2ODNA 3E5HA 4I1PA 1A71A 4X92A 4DCGA 2O3TA 2JVJA 4GRDA 4AX4A 5JYBA 3AI2A 4IF6A 3TX2A 1YR8A 2MR6A 2O2HA 3FJYA 4KXUA 3JQPA 3QEAZ 3AR7A 3BCRA 2NQ8A 4LYDA 3COSA 2WMNB 3CMMA 3ZUPA 1KOJA 1TD9A 2BFDA 4W5OA 2COEA 3HPRA 5IKPA 3QFCA 1GG8A 3W78A 1IOZA 4QE3A 4B7XA 4V38A 2Y2UA 4K6MA 5HVNA 1HQYE 1PQPA 3RS9A 1KJ9A 1VDKA 4M21A 1XEWX 1L3IA 1KOLA 5A02A 3TBKA 2HI0A 4RLHA 1H05A 3C8DA 2OMEA 5EQJB 3NEAA 2WPDA 4ZYUA 1YR9A 4B84A 4K6HA 2AOUA 1LQ2A 2DBZA 2XTNA 4XJTA 3G6WA 5TS3A 4GOMD 1NVDA 2G17A 2R8EA 1NBAA 5F7ZA 3PNMA 2GDJA 5A5FA 2IRWA 3JQFA 3A3NA 4Z4QA 1W73A 1G8AA 4NMLA 4G4SO 2IPLA 4UUQA 1VGRA 4IDPA 2FY8A 4X9XA 4EG3A 3Q0EA 1IHYA 2PIDA 1DPGA 3OC0A 3J80A 1E94E 3W77A 5LWHA 2YHBA 2PR2A 3SPXA 1INLA 3TRKA 1TCCA 5DGTA 4EYSA 4LXQA 2W4IA 3TOSA 1J25A 1ZI9A 4MW1A 4YUWA 3VGJA 1MQSA 2RGXA 1H5QA 2QL6A 3ORSA 5AMXA 4JLVA 2AEEA 1DXYA 4HDMA 2HSZA 2CFIA 3F7MA 1F2UA 1VSQA 4K86A 3U9SA 5B7QA 2HU2A 1G64A 4UBJA 2ZDGA 4LBZA 1ZZGA 4O63O 3K6RA 3U80A 3VO1A 3UBTA 3CWZA 4D25A 4P86A 2X0EA 1IHDA 4WCVA 5KSYA 3ZK7A 1NJ6A 3KSRA 1GEEA 3EXAA 4WKOA 1UJCA 5JH7F 3OLYA 2WU3A 1EFDN 5DNDA 1LLCA 2SNIE 5JNLA 3B53X 2VWHA 5EVJA 3F98A 4ZVSA 5IF3A 3U5TA 4FUTA 1ZKMA 2RC5A 4F96A 2BM9A 4RY9A 1R6XA 2FE1A 3C3JA 4W6QA 5CAEB 4DCPA 5JPDA 4HDSA 4LOKA 1O8CA 4QDUA 2PKYX 4D9NA 1R4MB 4RZQA 5EMNA 3K70B 3SNKA 5AM0A 4YT2A 4LRXA 1QZXA 3TQFA 4DBZA 1J2UA 3I2FA 3LDGA 4IJ5A 4GUAA 3EEFA 3DR5A 1RWNA 3ZKWA 4BQQA 1UBTS 2XUDA 1G20B 4BVHA 2FZEA 2CNDA 3HB0A 5K99A 2XB9A 2ZRKA 3H42B 2P9GA 1Z37A 1RC1A 3CLUD 4JFRA 3HG7A 5I7SA 1QKKA 2CD7A 4M54A 3DT8A 2DQSA 4KQCA 5FJJA 5K3CA 1D4AA 1NI5A 2F43B 3GROA 5SYAA 3QOYA 2W6QA 3AI7A 3DPSA 4G26A 3T9DA 2V7WA 4EHKA 1NNUA 2XY4A 3OJOA 2D62A 2Q6TA 2OBYA 1ZSVA 4P35A 4WBXC 4MICA 4FQ8A 5U4QA 2ZSJA 2D54A 4KIFA 1V8PA 5HZGA 1FZQA 1KI6B 2HL6A 1DX6A 5C31A 2Q5OA 2QTNA 2DBYA 2XE8A 4WCFC 1JDNA 1QF7A 1BJKA 1YJ8A 2C29D 1IHPA 3T5PA 2OMKA 5AM2A 1E77A 1ZXLA 4ZVKA 4TRNA 5EIEA 3THYA 1GYQA 2Y2VA 1Y8QA 2ODWA 5A0VA 3CRRA 2XVAA 5EE0A 1C1XB 2CJPA 4J0IA 3OZBA 3A4NA 3GLVA 4UU0A 5CNJA 5IVIA 4BV8A 3OT5A 5G0TA 1A9PA 4XPIB 1QC5B 3RTGA 1QHSA 1GV0A 4XOIA 4ZEMA 1VSVA 4PG4A 4CEHA 3SIXA 5A6SA 1L5RA 5IAKA 4H4DA 4JJ4A 3PIRA 1U8XX 3F8SA 4FW8A 4G4GA 3PC2A 2HRZA 2R7AA 3PFCA 1Z6XA 1PWXA 1OLUB 4UNPA 4V0SA 4JYAB 1L4YA 3O26A 3H2KA 3V8PA 3WKEA 4PC3A 3LPDA 2EU8A 3R3HA 4QDOA 3E9NA 1KETA 1AMUA 1FUIA 1M2JA 2DAPA 2OD2A 2DT8A 3BSSA 1JEJA 1O95C 3HFRA 3L8GA 4G09A 3SXPA 1JKFA 3T7AA 1J2RA 1WCIB 4P82A 2A4KA 5DI3A 3R3YA 2J32A 3G0DA 5IS2A 3I2YX 1JAYA 3KETA 2O8DA 4N4AA 1Z6ZA 4B71A 2J9RA 1EINA 2VJYA 2VNAA 3GLGA 5L8VA 2Y4OA 2ZZKA 1KR2A 4D02A 3BMNA 4Y2TA 3OX2A 3EIQA 4FI3F 4QHYA 4AECA 3ADBA 1RMQA 1DG9A 1DUVG 1F0YA 3OSZA 2JI7A 1QIEA 5A1TA 1RWQA 2ONKA 2C3YA 2LR0A 2WTNA 3DFZA 5GINE 1JH9A 1FXWF 2C1XA 2GAAA 2NYUA 2YY5A 3ZLVA 1DBSA 3BD6A 4RX1A 3AW9A 1GRNA 4YJ3A 3STTA 3AYXB 4MDEA 3BM5A 1X2EA 1RE0A 4ZAFA 1G60A 3JYQA 4RPKA 3G7NA 4NBWA 4ZMRA 3O8CA 1WTCA 2BFFA 4YAFA 3EOBI 3QLVC 3JQGA 3GP3A 4RGVA 2O8BA 1V8ZA 3GGCA 1CQWA 3IQZA 3ER6A 2YOFA 1IM8A 1C3EA 1J6UA 2H3HA 4BUZA 4EHLA 4KFCA 4G25A 4HBZA 5ALJA 5K3FA 2WQ7A 4BATA 2FPSA 2WZBA 3L9XA 1U94A 1XMPA 1PT5A 4CTNA 3W1VA 4DCSA 4YMVA 1OSNA 3B6IA 4KN9S 2ZUWA 4URWR 4V2UA 4ALIA 3ADOA 1GVHA 2FKAA 1B7GO 1NJFA 2IV3A 3WDLA 1YB2A 3MT8A 4G4JA 3ZZNA 2DERA 4JEMA 3N6RA 3M6VA 4DF3A 4QLBA 1R0BA 2XE4A 3FCOA 3G79A 3QPAA 1IDN1 4G65A 4MJLA 4PSVA 3PGXA 1YQGA 3MGBA 1QP8A 3DLTA 3PPXA 4G5OA 4D43A 2Z4SA 4EBFA 3DAYA 5KTNA 4RTKA 1G1AA 1T2VA 1UKYA 1XNQB 3BH0A 1PTKA 2J9ZB 3AVTA 2C9DA 1F4VA 4EYGA 1SD1A 2CF5A 2FEAA 1KEUA 4DLAA 2Y1WA 4R8MA 1X7GA 1EK2A 4MVJD 4OQDA 2UUAB 2VJNA 2DBRA 4OB7A 1NMZA 2OB2A 3DC7A 4BIMA 4W8OA 3ZNNA 4Z0PA 3UWOA 1XK7A 2FW6A 5B3JC 1KOFA 4EFLA 4BGDA 3INYA 3PUIA 3KUUA 3GVHA 4Y9SA 2R6HA 2ZWOA 1WW2A 3VMFA 4FW9A 3E9CA 4JIMA 4I2NA 3WGQA 3MLEA 3THRA 1E7WA 3CY6A 3DKVA 2C4HA 3C6YA 3DCJA 5IASA 1K7CA 4OREX 2ZE6A 1DCTA 3ICCA 1NW8A 1ORHA 2ZUCA 4CFZA 3ROTA 4DDUA 5E1OA 1QZZA 5EMLA 3W7BA 1KIAA 2VDNB 4DJ5X 4UZSA 5FO1A 4GYYA 2XDQB 4V0OA 4PYQA 3SZOA 4CIDA 2GNPA 1M1ZA 1W5TA 3F6YA 2ZULA 3BJZA 1SKQA 2UVPB 3QYPA 4JK3A 4RD0A 1NBIA 2R7MA 4AROA 1CF4A 4JJ6A 1XZBA 4TS3A 3LDFA 4K9MA 2BGTA 5LP6B 1RHQA 1BXRA 1EFAA 1KZ7B 1J4AA 3HPQA 3EFOA 3TQOA 4KUHA 3KFXA 1DAFA 1K8ZB 3E7FA 3ZU6A 4MV4A 2O6HA 4YDRA 4ZTBA 3TR0A 2DRIA 3VZQA 2O7QA 4BLRA 1I3OA 2HN9A 1PNQA 4NCNA 1A95A 3B6JA 3AM5A 2JGDA 3J7TA 4MUMA 5COBA 3BFJA 3D7RA 4CQJA 5FLYA 1B16A 1CZNA 2J9FA 2PT7A 2V4UA 3GCZA 3L8EA 1RLOA 4K9NA 3QYJA 1JTVA 2WWIA 3UTCA 2C78A 3GPBA 3KOUA 3WMFA 1QAOA 5BQXA 3PQ8A 1PT8A 2WV7A 1QS0B 4FYJA 4CIBA 2I7XA 3COYA 4ZYLA 2ZIZA 4EJFA 2D0IA 2D13A 5IZCC 3HO1A 1VRCA 2VT7A 2XNDA 5FOVA 4XZ3A 4DJTA 4I4CA 3JWEA 1QHEA 3K0BA 4HNTA 3OJLA 4JUCA 4ZQGA 2IVZA 3UCFA 3OOWA 4R3NA 5DSXA 2JCYA 1QIIA 5ITWA 2AXEA 3TAXA 2D7CA 2JIOA 5EJFA 3NOQA 1V2HE 4S12A 3SGLA 4TTAA 3LY5A 2MHCA 3QY9A 4O2AA 4V0LA 2NU8A 1SUPA 2CBGA 1ZIOA 1MVLA 2C5SA 4MYDA 2NT3A 2QNBA 2KE5A 1XG5A 1N5KA 2E4XA 3BZBA 3FAZA 4KEAA 2HXYA 4LVCA 2R60A 1K4KA 1L5NA 1MH9A 3CUTA 3H5VA 4R71A 4CW7A 3ND6A 4L75A 1V9CA 3L6CA 3ZD7A 1Z0SA 2AJDA 2XUIA 1Z29A 2Y76A 4ZAWA 3WHKA 2QUJA 1IUNA 2GRUA 4GR9A 1TMKA 1W2HA 3U3JA 2P67A 3CLTD 1J0EA 1UP4A 1UOQA 2V6JA 3CLKA 3CNHA 1N9GA 1T29A 3AF3A 3OZEA 3DLPX 4H1TA 4MB2A 4P2BA 5FWDA 4PSCA 4RVUA 3KD2A 5JISA 3LQ2A 4OHVA 4QEDA 5AKJA 1J23A 1J70A 1CBUA 1ZMBA 3GMTA 1DRVA 3ONEA 5FNZA 4LGVA 1QFMA 3WGHA 4G0YA 1CHDA 4PX3A 5JW6A 3S40A 4J8PA 4Y9RA 1W44A 1SVNA 3X1XA 3HB4X 1O54A 1RQGA 1SWVA 1IY9A 1CY8A 4OQ4A 2W2VA 1CFZA 3P2OA 1AQLA 1YD7A 1YKSA 3LLSA 4EVRA 4ND5A 1Q1AA 4J1TC 1JPVA 4OHMA 1SRRA 1NDQA 5LMNB 1YBFA 3L82B 2VNHA 3FCYA 3UEOA 4AY6A 3JVUA 3T1NA 3C3CA 4KQWA 1ESCA 3VR6H 3X1ZA 4PTLA 4TYWA 4C4ZA 3CUSA 1VMIA 1VPVA 2JCVA 3FYTA 3PK0A 3UV6A 5KCZA 2BEKA 3PHIA 1H4SA 1WY5A 3ZBPA 2RAUA 3DB2A 3FSRA 3PLRA 4O3FA 5KQMA 1AMNA 3DV0B 2CXHA 1PUIA 1GZHB 3R6GA 2VPPA 1MX5A 2BGIA 2Y67A 4F92B 4MW2A 2JGEA 1JTEA 4HWGA 1I1QB 1KQ3A 1YK0A 1P7VA 1A3CA 1PDOA 2HCFA 1I9GA 4LDPA 4B87A 1TM2A 2PL3A 2C9CA 1R8JA 4YMTA 2IELA 3I5XA 1EBUA 2AFHE 5IFKA 4WWHA 3RAEC 4R9UC 2HIHA 4JQOA 1N7HA 2FHPA 4G9EA 2HQ1A 4D3FA 2CFOA 1SCDA 1L7MA 4EY6A 2ABWA 3CUEF 2FOXA 2QZJA 4L5AA 4L8FA 2ZE7A 4G1MB 1ACMA 2RGGA 3QYFA 3HB5X 4YVFA 2G7MC 2DFTA 4QDJA 4HJXA 1S3GA 2FQ1A 1ULAA 1VKOA 1KKUA 2HC9A 2YN2A 3DUWA 5G3YA 2BH2A 3DEJA 3IAS1 2ZYDA 1OA0A 4JAVC 1UL1X 2VZ8A 3V4RA 3N2GB 3GG9A 1E0DA 1PQUA 1FFAA 2DCMA 4I2VA 4RCVA 1HYQA 3EJWA 4UVDA 3KSMA 7GPBA 3PE6A 4NC9A 3FPEA 4TWZA 4KBGA 2P6PA 3LXUX 1QRDA 1WUKS 2Q46A 3K72B 5IDQA 3OBIA 1NZFA 3IP3A 3HEBA 2OESA 4U7GA 4LPSA 1T1GA 1PW5A 2PHZA 4FFMA 3S2IA 1DTEA 3L7KA 3D4OA 4EQ6A 2UXBB 1PDVA 3A9CA 1JEEA 3NWEA 1NN3A 2OQIA 1Z4MA 3HWX1 2JLQA 2Q2NA 4JD5A 3WHPA 1JN0A 5B5SA 5JAIA 1Z63A 4E08A 4HPXB 1OVGA 4KB5A 5K5EA 3I5YA 4FB4A 3AH8A 2ZYHA 3JYNA 2EJBA 4NZNA 2AVDA 1G8SA 3CT4A 1NVFA 4JI5B 3CVXA 2IPAB 3ON5A 1SHTX 5AUNB 1Q1ZA 1Q83A 4LGMA 1NUQA 4WLNA 4Z4HA 5TMDA 3E3MA 1GL7A 5FWXA 1VRVA 3KU4A 3TLCA 4ZMSA 2NUTB 5CHEA 3JD4A 4FMDB 2CJWB 3Q2OA 3UFBA 4GMHA 1KAEA 3MW8A 4TTIA 4ZKEA 1NRJB 2HF2A 4L5BA 1Z0KA 4PGFA 4V1CA 3KV3O 4WV3A 4EZIA 2RI0A 2R1UA 1TM1E 4L51A 4LC0A 3PXXA 5GP1A 3AL3A 1MZVA 1R4ZA 2WTMA 1ZRHA 3QV2A 4UJ3A 4JBXA 2VF5X 3UK6A 1IVSA 1UT8A 1OA1A 1QAQA 3I5MA 4LYAA 3TQQA 2W43A 3M6AA 1M2GA 2H1CA 2XGMA 3INRA 2PWAA 4RD2A 1C14A 5E6UB 1PRYA 2DGDA 4MQFB 4PHHA 2QT9A 5TE9A 1PN3A 2VHQA 3A06A 4M83A 5TNXA 2SICE 1NYRA 1OREA 1G3RA 2NV0A 3EC2A 1YOVA 4EUNA 4YWHA 3AJRA 3BRQA 2P4HX 1WPGA 2H1RA 2ZJ0A 5EJAA 1JR3A 3SVZA 1L5MA 2Y77A 3K0AB 1JR6A 2Y05A 1GPDG 2P0YA 4XR4A 1H1LB 3WDSA 3ZVLA 3OPXA 4A36A 1B6TA 2OO5A 3KIPA 4QREA 1ZYUA 4P7GA 4BX3A 3H9UA 3ASYA 4FDUA 4TZTA 1GGVA 5TF0A 1YQUA 4V02A 3CB4A 2QKYA 5E7JA 3WVNA 1M0EA 2FWMX 1CUAA 2X7JA 3P0EA 4MLCA 2BSQA 2VL7A 3VHXB 1OKKA 1SZJG 3BXXA 4XWWA 2J3EA 3FFXA 3CCBA 4S35A 5A3RA 3M5CA 1QP0A 3VPHA 3P0FA 4YRPA 4KVZA 4L2IA 1VA5A 2R00A 4WL0A 4NK4A 7MHTA 4DPKA 3OEYA 3F71A 5I4KA 2GJ8A 3OQOA 1OI4A 4C0HA 3NJ8A 2O4UX 3Q7PA 3TRJA 4BPRA 4ENUA 1E1DA 4KKXB 5HG0A 2FMIA 2OHVA 2J7PA 2O20A 3IMCA 2UYYA 1IEQA 1H0RA 4Q48A 1HDEA 4LJKA 3IJ5A 1GPWB 5LZ8A 4A73A 1SBHA 5F7XA 2FZGA