4L6CA

Crystal structure of human mitochondrial deoxyribonucleotidase in complex with the inhibitor pib-t
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
201
structure length
201
Chain Sequence
SNAASGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformationally constrained nucleoside phosphonic acids - potent inhibitors of human mitochondrial and cytosolic 5'(3')-nucleotidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 5'(3')-deoxyribonucleotidase, mitochondrial
total genus 67
structure length 201
sequence length 201
ec nomenclature ec 3.1.3.-:
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4l6cA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4l6cA01
1Z4NA 4F71A 3SMVA 5AVYA 1Y8AA 4UAVA 2Q5EA 2IA5A 3ZW7A 1TA0A 3D6JA 1K1EA 1TJ5A 2D2VA 5AHXA 2ZG6A 1EK2A 2YMQA 3QX7A 1IWOA 2HDOA 3A1DA 4C4RA 2VKQA 3K1ZA 3ZU6A 3R9KA 4BEWA 5AW2A 4NAVA 1RQNA 2WFAA 5ALKA 5AVSA 1O08A 2YFYA 1YDFA 4MUMA 1S8OA 3ZVNA 1SWWA 5ALRA 3A1EA 4AS2A 3FGOA 2IOFA 3QU5A 4YCMA 2FPXA 4KNWA 3F9RA 4XOUA 1L7NA 5AK3A 4OFZA 2NYVA 1SU4A 4FYPA 4EZEA 1RQLA 4EELA 3L8GA 3L8FA 2FEAA 4OHFA 4E88A 5AI9A 1N8NA 2JAWA 4MWOA 3SHQA 5AI5A 3OCWA 3U7EB 5ALYA 4UMFA 4HGNA 3ZUPA 5AIBA 1ZD2P 4YIHA 4EEKA 5AM2A 1X42A 4JDPA 4UU1A 5AKIA 2GHQA 2BDEA 5AVXA 2AMYA 3NUQA 3EWIA 4J03A 2ODAA 2B1RA 4BYGA 4BEVA 1YS9A 4GXTA 4HGRA 3RF6A 4C4TA 5AM3A 4UU0A 1QH9A 1RMQA 4ZEXA 2AGVA 3FZQA 5ALUA 3AR6A 4FE3A 5ALOA 4CF5A 2QYHA 5AIAA 1WPGA 1U2TA 1JUDA 1T5SA 2C8LA 4G63A 4HGPA 5ALMA 4XQ0A 5AW3A 2I55A 2GO7A 2HOQA 3A1CA 5AKYA 1SWVA 5IS2A 4YCNA 1YNSA 2YY6A 1WR8A 2FUCA 1XPJA 1Z4LA 3OCVA 5AKXA 4C4SA 2HF7A 3AR2A 3PDWA 2YBDA 3QUQA 4Y2VA 1L7OA 2AUTA 4QJBA 4NV0A 5A3QA 1LTQA 1T9ZA 1J8DA 1O03A 3QUCA 2B30A 2NO4A 1U02A 3L1VA 4Y2RA 3QUTA 3ZVLA 3U7FB 4Y2QA 2I54A 2FPUA 4IG4A 3ZWDA 2AH5A 1Z5GA 4NABA 2CFRA 1RKUA 1ZD4A 5AKKA 5ALLA 1QYIA 2CFTA 4BX0A 4BBJA 5AVQA 1MH9A 2G1AA 2JGAA 2OA0A 3N1UA 3WKAA 2YJ4A 5AKJA 5AVVA 1S2OA 1EK1A 3U26A 5FP0A 2C88A 2YMPA 4KYTA 3U7HB 3UM9A 4UW9A 3L1UA 2RBKA 3ET4A 1ZRMA 5ALIA 1Z4MA 2RARA 5ALWA 2B8EA 3L5KA 3QYPA 1Z4KA 3UMCA 3HLTA 4BKMA 1Q92A 2DQSA 2OM6A 1Z5UA 5AKGA 1ZOLA 3WGVA 1RPZA 5AW1A 5AVRA 5ALQA 4ZEWA 1WZCA 5AI8A 1LVHA 2W4MA 3AR4A 3B9BA 1NNLA 1VFPA 4DFDA 5ALPA 3L0YA 3QU9A 5AESA 4I9GA 2RAVA 3CNHA 4YGYA 4JB3A 2Q4RA 4HGQA 4Y2JA 4UMVA 3NAMA 5ALVA 1U2SA 4NFLA 2FDRA 3J7TA 3E84A 2W11A 3E81A 4Y2XA 2CN1A 1L7MA 3I1YA 4CE6A 2JARA 2G08A 2X4DA 4PNHA 4Y2SA 5AICA 4L6CA 1ZRNA 3GYGA 2B0CA 2G09A 3ZI4A 3NIWA 3IB6A 2YJ3A 5AVZA 1ZJJA 4UASA 4Y2PA 4DW8A 4YH1A 3ONNA 5A3SA 2YJ6A 3QU2A 1TJ4A 1RMYA 4KX5A 5AM4A 1L8OA 4UMEA 1XP5A 2EARA 1VJ5A 3QUBA 3WKEA 3U7GA 2P27A 2FI1A 5ALXA 5ALNA 2WF7A 2WF5A 4J2TA 5AI0A 2BDUA 2GFHA 2CFSA 3I76A 2MU1A 3IRUA 4QQFA 4Y3UA 3FVVA 3WK4A 3N07A 1PW5A 4EENA 5AM5A 2JAUA 3WK8A 4RESA 4CNQA 3L8HA 4YCLA 1RDFA 5AI4A 3W5DA 3WGUA 1RLMA 2C4NA 5T41A 3KOOA 1Q91A 4DWOA 2ZXEA 3AR7A 3WK9A 2I6XA 2IYEA 4UM5A 1KYTA 1XVIA 2HSZA 2ZBFA 2R8ZA 3WKBA 5E0OA 3DNPA 2WHEA 5ALHA 2HEGA 3IJ5A 3NRJA 4O8CA 4I9FA 3BA6A 4UM7A 3WK6A 5A3RA 2HX1A 3N28A 2G80A 5AKZA 1ZD3A 5IT0A 1RLOA 2PR7A 1TJ3A 3KDPA 3KBBA 2B82A 3MMZA 3ZWKA 3OCZA 5ALFA 1RMTA 4DCCA 5AW7A 1ZD5A 2G0AA 2ZBEA 4IFTA 3DV9A 4BNDB 2FPWA 3OTQA 3EF1A 2ZBGA 1Z4OA 2EAUA 3N8GA 3SKYA 1RKQA 3ZX4A 1U7OA 1ZS9A 4Y2TA 3KZXA 3CZ4A 4GIBA 2OYCA 2FPSA 2P9JA 2WF9A 3NANA 1J97A 1Z4QA 3PGLA 4KX3A 4UAUA 3QNMA 5AVTA 3AR5A 4EX7A 3OCUA 1RC8A 3DAOA 3VAYA 3L0CA 5AI6A 3NASA 3R4CA 3E8MA 3SF0A 3A3YA 3NALA 3FM9A 2P11A 2HCFA 2WF6A 4L57A 3U19A 5AM0A 1T5TA 1VJRA 1FEZA 1QQ5A 3U13A 4YIKA 2IOFK 2YJ5A 4BX3A 3S6JA 4BNDA 3WK5A 5ALZA 5AK6A 3W5CA 4B6JA 4KNVA 5AW8A 1QQ6A 2FUEA 4OCZA 4UMDA 1CQZA 1RLTA 3UMGA 4G9BA 3W5BA 3B9RA 3RFUA 1WVIA 5AKLA 2FPRA 1AQ6A 2I7DA 3OPXA 2O9JA 5AKHA 3ET5A 5AK5A 2WM8A 2WF8A 2GHTA 4CF3A 3M9LA 4Y2YA 4AP9A 1RKVA 5AW0A 1YMQA 1Z4IA 2G07A 2ZBDA 3QU4A 3BWVA 3R09A 3UMBA 1CR6A 2G06A 3KC2A 2YMMA 1L6RA 3SKXA 2R8YA 4HAIA 2B8JA 5IT4A 3FPSA 2NO5A 2Q4TA 3ZVMA 2HI0A 1QQ7A 2PQ0A 3I28A 3SD7A 5AW4A 2IOHA 2HHLA 1TE2A 3OCYA 3MC1A 4KN8A 2R8XA 1Z4JA 5AM1A 1NF2A 3DDHA 2C8KA 3P96A 4Y2UA 4L6AA 3L7YA 2MSNA 5AW6A 4UARA 2BY4A 3EPRA 4HGOA 3QU7A 4AS3A 2P69A 5ALSA 4CF4A 5AVUA 2OBBA 5AW5A 2GMWA 2O2XA 5ALEA 3W5AA 5AK4A 5ALTA 3ZTYA 4NWIA 1N9KA 4OD0A 3M1YA 1Z88A 3KD3A 5ALDA 3AR3A 4EX6A 5ALGA 1U7PA 2HF2A 3AR9A 3MN1A 2R8EA 2RB5A 1YJ5A 3PCTA 3QGMA 5AW9A 3L8EA 2W43A 3ED5A 4FFDA 5ALJA 2I33A 2JAOA 1L7PA 4UATA 4ZEVA 3ESRA 2PKEA 3I6BA 3TLMA 1RRCA 3FPBA 2EATA 4XE5A 2B1QA 3OCXA 2YMLA 4RETA 2YN4A 5AKEA 2ZOSA 1F5SA 3QXGA 2HO4A 3MPOA 1NRWA 1YV9A 4HYTA 4H1WA 3ZTWA 3SLRA 5AVWA 3ESQA 3WK7A 3ZX5A 3L0BA 4XPZA 3WKCA 4BX2A 3B8EA 3HYCA 2C9MA 2I34A 3EF0A 3PGVA 2QLTA 3AR8A 1L8LA 3E58A 3N5KA 3QLEA 5JJBA 1Z4PX 3WKDA 4F72A
chains in the Genus database with same CATH superfamily
2JGDA 3MJCA 1DCFA 2Y1XA 3EBLA 2JBAA 2A0WA 2YWDA 3FBWA 3JVDA 3QEOA 4U7JA 3SS7X 3ZK8A 4C6SA 2NSLA 1YT5A 2JRLA 3U7IA 2X5JO 4L0MA 3EVBA 5TY0A 4QRIA 3T95A 3R7BA 2PIAA 2DKOA 3LK7A 3AVQA 4D8UA 3ONVA 4HKTA 1M8GA 4IZIA 1FP2A 3SC6A 4HDNB 3WL3A 2RBEA 4EUNA 8ATCA 4NATA 3BUSA 1XK7A 3PVSA 5I7VA 3K1ZA 3EVFA 1A8IA 1IPEA 1YCFA 1L5VA 4AZ0A 2XIQA 1BXZA 3CS3A 3AF1A 3GZNA 3AKZA 4ZCMA 1ZA2A 3JPYA 4CEJB 2JKZA 1SIOA 1Z2AA 2VDRB 2YUTA 1X7WB 3MWEA 5EXEA 4GGPA 5ARCA 3ZVNA 3E6AA 2XLCA 3A1EA 1JEOA 1JIVA 1J00A 1JLLB 2QN2A 1G8PA 3HWX1 1D6MA 2TMKA 3R5JA 4IJ5A 4JL5A 5EWJA 2AF4C 2ZE8A 1YZLA 1ISGA 4XOUA 1JQ3A 4AKSA 1WMBA 4Z4FA 4XW2A 4QQ8A 3RD8A 4BLOA 1LFDB 3L84A 3QVMA 3DCYA 3L8GA 4M0LA 3UWDA 4F5EA 4O08A 4E88A 4U4AA 3U17A 2FFBA 1AS0A 3INGA 1N4DA 3KSDO 5C8XA 5LQJA 2Z2IA 2AZXA 3AQIA 3TLJA 4I1PA 4TLEA 3R0XA 3VPXA 5L40A 2OO5A 4WNIA 3VR6H 1T36B 4BWVA 1QTIA 5JSZA 4PGHA 3KALA 1E0SA 4OA8A 3SYMA 4HGYA 1MQ8B 3F3MA 3IAHA 3TRFA 2W2TA 4V02A 4ZOLB 3UJ8A 2X1HA 3GX1A 3GJQA 3U81A 3BJIC 1N9GA 2K5UA 5LQDA 4Z9BA 1AN0A 2JFPA 1X42A 3WX0A 5H7XA 3GRYA 4BLQA 1SK9A 2ATIA 2HY7A 2W2LA 1U1DA 2KJQA 2PD6A 3NT2A 2QXUA 3O2SB 3EVAA 4LOKA 4MR9A 1HI9A 4Q7KA 2H9YA 4NNJA 4OQEA 1BMTA 4IZ6A 1ABFA 5K6AC 5ER6A 2ZJ0A 1KVRA 3ZYCA 1FL9A 2B4QA 2R97A 3PJDA 2WZBA 2WTMA 4M46A 1UK7A 1KZ9A 1G42A 4CEIA 3DLTA 2MMCA 3CVXA 1TKRA 4G97A 4JXZA 3DM5A 2IY9A 4WWHA 1AA6A 1OPXA 2PUAA 2D4HA 4ENUA 3NVAA 4JBGA 1VPTA 4RQBA 2NSYA 1UEIA 3RBZA 3DONA 5A1TA 1XEWX 1Z18A 3U3KA 5JCZA 3FHJA 3PP8A 5C1PA 3PYLA 1FTSA 1HT3A 1OX6A 4OI4A 4R2HA 3S5UA 3BTUA 1XA0A 1I2AA 1W4LA 3AR2A 1GPWB 1HE3A 2OGTA 1QG4A 1KS2A 1HT0A 2H1VA 3QWBA 4G2TA 1R64A 2FFAA 1B6TA 2YXEA 5H4GA 2X8JA 2QA5A 1WEHA 2ECQA 3HGTA 4UU8A 4DMUB 2ZIVB 4IDDA 4DXAA 1Z22A 2HBYA 4WNAA 2B30A 4X1IA 3V4FA 2J45A 4B44A 1SXJC 1N0VC 1U2GA 2JFWA 3DR5A 2BEKA 4L4RA 2H29A 1NI4A 1J0EA 1U8UA 2CW5A 2W93A 4A15A 2WLSA 4QXMA 1B26A 2QF7A 4KW7A 4RMIA 1PU2A 4Y2QA 1TM3E 1M34A 1NTOA 2TSYB 2RGUA 4PNZA 4GF5A 5CDUA 1CJVC 4NABA 2J7PA 3K70C 2GO1A 5HEKA 1H05A 3F8WA 1Q7TA 4FUQA 3CZ5A 4L7VA 5K03A 1GDTA 2JHPA 3LIPA 3TSYA 3CZPA 1L5WA 3CUVA 4PPYA 2CLIB 4O4JB 3NCHA 1YS7A 5CVUA 2IPAB 5AJYA 3F6CA 3TLXA 1SH7A 3RU3A 1BDHA 2EIHA 2IEIA 3AJEA 4US0R 3JRXA 3VC3A 4GLBA 4Z0NA 3C5VA 1NC1A 4X3CA 3DQQA 4GHWA 3S2IA 3ZDDA 4TL9A 1IE3A 2CHEA 1LBTA 5BVGB 4EG7A 3BSSA 5CDGA 5IANA 1THMA 2GAIA 2NUBA 1CRQA 1Y1PA 3TRIA 1SOVA 1EFVB 1GILA 1QZ3A 2GBPA 1O57A 2LZ0A 2WP0A 3ANLA 3IGFA 1MIOA 1T9DA 2Z4TA 1T8SA 2DFTA 1XPUA 2D0DA 1NT4A 5CTJA 5D3KA 4XIYA 2II6A 2GEVA 4CKWA 5HK9A 1N8KA 1IVSA 3ZWYA 2ZRIA 3LVBA 4V1CB 3A32A 1TQ6A 1W4RA 2H3EA 2ZIXB 6ABPA 3IJPA 1F4VA 1LF5A 1WUTA 5LP6F 4B7UA 2DMRA 3TDMA 4WY2A 3AVYA 4NBVA 2C3UA 3IAEA 2ST1A 4Q9LA 2WA2A 3MERA 4DNXA 3KEOA 1NDHA 2ODTX 5A4KA 4BFCA 1F1JA 3O8QB 1T8RA 3R5SA 1YULA 2VAMA 5DTQA 5EE1A 4B3CA 4DWVA 1HKHA 4YUAA 3AP3A 1JA9A 2SKEA 4MVYA 2W2QA 4RXMA 1OTHA 1BVUA 3NUZA 4ML3A 1KSHA 3D0KA 4QYIB 4Y8VA 5DSTA 3SJAA 3T3PB 3WP0A 2G71A 1U98A 2VJMB 1OLOA 5FO1A 1UMCB 2IGBA 1RPTA 3FGNA 5AT1A 3KSAC 4DA6A 4B3FX 5AHOA 1OWLA 4H7IA 2Q3JA 1M2FA 1RPAA 1S3FA 1PJ4A 1SR8A 1LDYA 5CDFE 1C9JA 2GFQA 1IEWA 1M6VA 4R51A 2PUGA 2QQGA 3LTEA 5BYJA 3USES 4BQIA 1ZGBA 1Q16A 2UDPA 2Z2XA 4OGLA 5E3HA 5JOQA 2Q5JA 3MCZA 2W9XA 3SS9X 1G98A 1PT8A 1O95C 1REQA 4PNPA 4PQRA 3GYGA 1DCKA 4LC9A 4FGLA 4Q4JA 3DCNA 2J3IA 3LSYA 3PUWA 4X44A 4TYNA 3KPWA 1XNGA 3FR8A 3GEEA 2GJ9A 3CF6R 1CD5A 2FG6C 1GTMA 3I9JA 4UASA 3H87A 2IHVA 2DPHA 4YO7A 5A3SA 4BLWA 1QIDA 3AX6A 3F46A 3HBAA 3IO3A 3NNSA 4MWCA 5EYPB 5ITSA 3RNOA 4ZHQF 4KTVE 2Z56A 2FN4A 3L6UA 4H7FA 2DKNA 4YPOA 4A2QA 4WK2B 4AUMA 2RJOA 4MO9A 3TOVA 1CZLA 2PSJA 1JNYA 3U7GA 2BTOA 1AXGA 1R0ZA 1YQGA 1GA4A 2O7VA 4WN9A 4NBSA 5C80A 1HM5A 1JSXA 3EC1A 4FZ3A 1Q0TA 1NP3A 3BWYA 4NCNA 2PNJA 4NICA 3R5TA 1F6BA 2IYPA 3AETB 2WF5A 3EYWA 5LDHA 2HNKA 1JN0A 1VKHA 4LJ4A 5JYEA 3D8HA 1EYZA 1QQBA 4WCVA 1EWVA 3DOJA 3MWDA 3NBUA 1UJMA 4LXHA 4YJKA 3VPSA 1YQTA 1NXXA 4XWGA 1QYDA 4ZO8A 2BFDA 4P08A 3NYQA 3G2JA 3NZEA 3PXUA 4NECA 1MUUA 1Y4AE 3TI7A 2NU7A 3KYCA 4RCVA 1UODA 2ZI5A 3QEAZ 4I0WB 4FZJA 4JX8A 4AY4A 4K6OA 4LOIA 1V3UA 2ZSHA 2PBLA 3V8PA 1LBIA 2PXAA 1AE1A 1CIPA 2CEAA 4KQJA 4RVSA 4WINA 4LGMA 4BNWA 3TCNA 4UNIA 3BE6A 2JVKA 4WXYB 4RHTA 4GKAA 1GA6A 5EJMA 2R65A 1R4ZA 4I46A 4C0AC 3F6EX 3CLUC 5FTNA 5E9JA 3I45A 5HFNA 4EMBA 3M49A 3WK6A 1W4ZA 3OOWA 4MDFA 3D2LA 2A35A 4DR3B 4F4HA 2PL1A 2HX1A 3IVRA 4EY8A 4ESHA 4P92A 4QU9A 5EMLA 4R0NA 2YIJA 3OFVA 2G82A 1FFDA 2XUQA 1EAMA 3OZAA 1RLOA 3R6LA 4LDRA 2DQZA 1NQ5A 4U2FA 4DPLA 1KQPA 4MI3A 2Y2UA 1YFEA 1E7QA 3OE7D 1IUKA 5HFAA 2AJLI 4JVOA 3DTNA 2ORYA 5TB5A 2PMWB 2ZRPA 3I5XA 4I4CA 2L0XA 5JD6A 1CLEA 1JT9A 2FWPA 3MTBA 4K6HA 4WKGA 3PNBA 2IE8A 1HDOA 4C0KA 2UVQA 2A5YB 4KVZA 3VPHA 3FKSD 3K6SB 2ZBVA 4JQSA 1PFWA 2ZBGA 4RH1A 2DY0A 1VIYA 1Z8FA 3R8CA 1JDVA 2O7SA 1OH7A 2L17A 1AVTA 1D1PA 2QROA 1ZS9A 5J1SB 4JYMA 2WABA 4R3WA 5EHQA 1VBNA 1OB2A 3BTSA 2VHUA 2VUIB 4RDXA 4D6XA 1ATZA 1ZLYA 3EX7C 2I4LA 4X61A 4FNOA 2YRWA 2O52A 2ISSD 4AECA 4UU7A 3L6BA 1TM5E 1N34B 1LDMA 4R8MA 1I7PA 1SQ0A 1VBMA 2ZWVA 4DJTA 2ZBQA 3NEPX 2IITA 3NYWA 3LDUA 4N47A 3IDQA 4DTCA 5JAMA 4KR6A 1J99A 4MUYA 1GKKA 3U9SA 4OHWA 4IW3B 5KHLB 3KU1A 3NNNA 2IPNA 2LCIA 2MTBA 2C04A 3EIEA 5BT9A 3VMMA 1PJRA 2PVPA 4X60A 1U31A 3VDRA 4A2PA 5A9RA 1L7EA 2ATXA 1N3IA 1BRTA 3H1GA 4YUWA 2ZR0A 4CCYA 1W73A 3QVTA 2BJVA 2JGJA 5E6RA 4BZXA 2OP1A 3OP4A 1DAHA 3TOCA 4I8XA 1ZL0A 4UUMA 2PA0A 4XI9A 5F7JA 1B16A 5KX5B 1S7GA 2OECA 3INYA 5CP8A 3WK5A 1GFIA 1JTEA 4Q4CA 2A1UB 5C81A 2YYZA 4MB6A 4HYYA 1M1YE 4CEJA 3WLIA 3RBXA 1C1XB 2WM9B 5K8UA 1M5RA 3I9KA 2V96A 4EOGA 1V4NA 4WZAA 3J81A 3MTGA 1QH1B 1YOVA 1ZVMA 2XXAB 4KRFA 3IHKA 1LLCA 2GESA 3IBYA 1ORDA 2BEWB 2G04A 1V1MA 1A4IA 3ABOB 5K4AA 4ER3A 2C5SA 2R7KA 1CS0A 4PICA 5AOBA 2VKTA 3MVEA 4B87A 3VU9B 4HDQB 3SNHA 4P9NA 4CKZA 3M3DA 1HT1E 2GK7A 3FUUA 1UT5A 4ZZIA 1XKXA 1C1XA 1QGDA 3CCCA 4HYQA 4QUBA 1RLIA 3WWDA 4GS5A 2C92A 4XWOA 1XRLA 4DM4A 5BWLA 4FNAA 2YOGA 3EHEA 1B8NA 4EBFA 3H7AA 1AKQA 8GPBA 2JA1A 3IV6A 4JQCA 4DYHA 3U3RA 4QM6A 5K5EA 4NL4H 5AW0A 3UCFA 3ZLUA 5FWXB 1OSNA 1V6CA 2ILVA 3MRXA 4KPEC 1K3TA 4NZYA 1C8BA 5FBQB 3L8DA 4B0PA 1NVWQ 4QEDA 3TZEA 4YJGB 2O7NA 5CVDA 4TTRA 1OYWA 2UYGA 3ANSA 3LBHA 5DX0A 4X64B 1YRAA 4K6KA 1PL7A 2QTVA 2R8YA 3N59A 4LVOA 5CFOA 5EFOA 3M4YA 1WIWA 3EA4A 4Y7DA 4BL5A 1A9OA 1QB8A 3HUTA 1MZVA 3BULA 3BSWA 3FTQA 3GMDA 3RS9A 3MT0A 2EKPA 4Q5IA 4BFSA 1WCIB 3DDNA 3RC2A 4DMRA 3K72B 2UVPB 2Q3LA 3M1LA 4MAMA 3QVGB 1NHGA 1TPYA 2C03A 1WXDA 1KEUA 3BPSA 3C7AA 4AFNA 1NNEA 2JFFA 1K2VN 1TK2A 1DHRA 1GLNA 4B84A 3AKDA 2R84A 1FDIA 4YUZA 4DNPA 2DM6A 2A9FA 3QWIA 3B6MA 3GLGB 1EB9A 1XZKA 3DZFA 3ETJA 3M5CA 2MSDB 3AHJA 4J4TA 3QPAA 4NE9A 4BO9A 3VZDA 1SMKA 3F4RA 1ZA1A 3OPYI 1M2OA 1EP2B 2MYNA 4JZKA 1MB4A 4M22A 1TU3A 4J1TC 1A7JA 3MJDA 2IIVA 1VYTA 2QB5A 5FX2A 4CM7A 1WEKA 4PRLA 3AHEA 4AYTA 5C1DA 1IUNA 5AK4A 1CRLA 5CLLA 3LZCA 3HY6A 3R44A 4PFKA 5T8KC 4DILA 4LE2A 5A9SB 2IZ0A 5IF3A 5CNKA 7REQB 2O8CA 2QVGA 2Y9MB 4I1VA 3ZEIA 3TEFA 1RE5A 2P41A 3OIGA 4OFWA 5FBHA 1K66A 3NHLA 2AHOA 2ERXA 2HJHA 3IHTA 5PGMA 1N0WA 1NN3A 3T52A 3BRSA 1QV9A 4XIIA 4MV7A 2VZEA 1NVTA 3EZNA 2J5KA 3L8EA 4YRNA 2HJWA 3AG5A 2KLHA 1RYMA 1WXIA 4U7FA 4CLEA 4DR7B 1UBJS 2ZS8A 1BX0A 1XDSA 3PTAA 2R6DA 1OD6A 5BN5A 1XZDA 1LF0A 1T8PA 2VYNA 1C30B 3HDVA 2OSBA 3CLKA 4AX8A 1JXAA 1EMDA 3B1XA 3F74A 4IY1A 2BCEA 3LUHA 2QT9A 4BFTA 3G2LA 4NDAA 4C7KA 3F5QA 3Q8WA 4IUDS 4O4JA 2H63A 4G23A 1I01A 4BZPA 2Y1EA 1O9GA 2ETVA 4IDPA 3LDAA 4Q3AA 4J0JA 3RJTA 1N6NA 2RB4A 4NBWA 3FNBA 4BO1A 2BZ1A 3C1UA 4J0KA 3KOMA 1JG4A 4HS9A 1YIDA 3RK1A 5AXAA 5NULA 2OHJA 1E59A 4NZOA 3UMSA 3CURA 3OWHA 3BXOA 4LZLA 1D1TA 4ARUA 2Y77A 3PGVA 3RYHA 4M53A 3I2KA 2RKOA 3K2EA 2V7PA 4XSGA 4NARA 5DBEX 4K9NA 2QJFA 2FXIA 2IW3A 1GN9A 4DLYA 2UZAA 4RKWA 1Q7EA 1XMPA 4FHZA 3PX2A 1GCOA 3I5MA 2O8DA 3VNVA 2PLWA 1B1CA 1KI3A 2ZYAA 5D84A 5EP2A 4PYJA 4G1CA 4INOA 4G8CA 3W05A 2PWZA 5AJXA 2AZ4A 2IA5A 3RTDA 4C1BA 1WV0A 3IQDB 2V6FA 1MQ9A 1SB9A 1U3GA 3GK3A 1SVUA 4XGKA 2HF8A 4W1SA 5ETJA 4D4IA 4F9EA 3UMYA 4IDHA 2W6PA 5LKAA 1S1MA 4G3XA 5EWLB 3LQ4A 4HN2A 4FYWA 1EK2A 3G9ZA 4X85A 1NVXQ 3FMPB 4NMHA 1N7IA 2REXB 1DKNA 3SQOA 4ND8A 1W5BA 2K2WA 2D1TA 1FUKA 5F3WB 1KI2A 2QRGA 3Q8MA 1JZTA 4MV1A 4P86A 3ETDA 1FK8A 1FXUA 1XZCA 2JLCA 3EGWA 2DFLA 1ZY2A 4DR6B 4IINA 3QU5A 3TKYA 5TE9A 3RYCA 3Q40A 1P6XA 2ZTMA 2OKGA 3MUFA 4PIVA 5ULLA 2FMHA 3V1MA 4FYPA 1RKBA 3E3MA 5EXTA 1JLHA 2YNMD 4BAUA 3ZWXA 4ZPJA 4E6EA 1A9RA 2ODNA 3OZIA 3R8FA 5EN4A 4IF6A 4B8ZA 1EKXA 2H7VA 3GNLA 3FBGA 5AI5A 1C80A 2VJQA 3OCWA 4H6WA 4J7UA 5KWVA 3JVEA 5CG1A 4Z53A 3K3PA 1ZJ6A 1XA4A 4DSOA 2VC2B 4CETA 2IHNA 5B4UA 5JWHA 4TMXA 3MTJA 1GRVA 3GJTA 4PG6A 3OQJA 1PWYE 3FR7A 4LHVA 5DBIA 5E7QA 3ZKWB 4KUHA 5AKIA 5IM5A 4WI1A 1GY8A 2GHRA 4AT1A 5BMVF 2WA1A 4W5QA 2ZYDA 1DC3A 2BDEA 5AVXA 3FOZA 2XVXA 4DEYA 1I6LA 3JYOA 5GP1A 1EGHA 3PI7A 4IKEA 1O0SA 1UC4B 2OBYA 4GI7A 4LDJA 4PC7A 3MHPA 1U2QA 2XGOA 3RYIB 3A6EA 1C7RA 2CL5A 2EU8A 5G4KB 3T1OA 3U48A 1QH9A 1AO0A 4EI7A 3Q5DA 2B3TA 2D7JA 3WLEA 1IN4A 2PX2A 2H1IA 2X2EA 2YWJA 1JG6A 1NOKA 4NZPA 5ALOA 1W8DA 1XTZA 3HMKA 2BPOA 5B1HA 5JANA 2HW8A 3QW4B 2C77A 4RV5A 1JEYB 2ZIAA 6GPBA 4CRWB 3SY8A 1L4YA 1PTKA 1YSCA 3L7IA 1V7ZA 2I55A 2J3JA 4FI3F 4UEQA 2QE7D 1II8A 3RAPR 4F21A 3I2IA 2EQBA 3A1CA 1C4OA 3BMCB 1RLJA 1CLUA 3GWZA 4FGWA 1C3OB 4XASA 4RVOA 1J22A 5F77A 4AURA 2AJDA 2PRZA 1EDEA 2YY6A 3BCHA 2YWEA 4BDTA 1JBEA 4NFHA 1YL6A 1ZOPA 3LQQA 1I7DA 4LF8B 2YBDA 2ZJBA 3P27A 4KGVA 1NXOA 4GWGA 5D2CA 1JPJA 4NV0A 5CXXA 2KPOA 2PRIA 2IL1A 1LTQA 3HA7A 3L49A 2G83A 5CFPA 4ESEA 1E1QA 1K98A 5A6VA 3BIOA 4Q1CA 1R6DA 1ENYA 5DM4A 1KOJA 4O2AF 3NP7A 2OBFA 5JXIA 5CPFA 1SG9A 2J5QA 3VV2A 1AURA 1LDEA 3VFDA 2BE9A 2H2DA 4EBBA 3K6SA 4JYBA 3GLIE 3PIRA 5E8RA 2XECA 1FUOA 1ZBDA 1OWNA 4U8GA 3PNQA 3L4JA 4ZZ0A 3NP9A 4M1WA 3UFXA 3H9UA 2FEMA 1VHDA 4QTUB 2AFIA 4LZAA 2Y1LA 3CNOA 3SSAA 1YB5A 1RNLA 1OBCA 3ETNA 1WPQA 4CIBA 2G1KA 2VT2A 4W8OA 2Q1XA 4AY3A 1XQXA 1JS1X 1QIIA 1U6IA 3ITDA 3K1TA 4OBXA 5M3BA 3UM9A 3IP3A 1E1KA 1IM5A 5GONF 3ET4A 2HA3A 2R6HA 1HFEL 3CX6A 4U2BA 3THYA 1EX1A 1AN9A 1L7BA 1SZDA 2AKYA 2BGNA 2I3BA 2IELA 5EESA 2JLAA 1Y4UA 3B38A 5CXUA 4K6CA 5M2QA 1KSFX 3FYUB 5AUOB 4YCAA 1A7KA 1LSSA 2JCYA 2XMPA 4PC1A 3WGVA 1Y1RA 1Z5VA 2QN9A 4JCOA 3UF0A 5HW0A 1UP7A 3L9XA 1K8ZB 3T1QA 1S3SA 1CRZA 1QGOA 3DMYA 1MC4A 1UPAA 3B6EA 3PEVA 5HRCA 1YRBA 1V2HE 1CE8B 3B9BA 1VKRA 4O4IF 1LPSA 1VFPA 1UKAA 3Q0IA 4G5HA 5EG5A 5FYQA 2XYVA 3MQ2A 4UNPA 3O5AA 4A0QA 2IH4A 1GG2A 3V7UA 4RHFA 3D4BA 1QHFA 2QJOA 2I6QA 1Q20A 2VTDA 1CUZA 5HJ2A 5C31A 2D1YA 2P9QA 2D1QA 4DLWA 3O0DA 1CB0A 2B7LA 3FLAA 3UT5B 1U5AA 1RE1A 1RP1A 4BNJA 4L3WA 1TQ2A 5DM60 4EL5A 5FUQA 1U8AA 3ORQA 3IVCA 3T7AA 1VL1A 4Z9XA 3ZY5A 5CNJA 5D7BA 3J7TA 1A4XA 3SF8B 3E84A 2E9FA 4M4SA 3ONDA 2VNJA 4E5SA 3OZEA 1R6TA 1U94A 4WLEA 2O54A 4D9EA 1BX3A 3O8LA 4OX9B 1G19A 3AH8A 1G8MA 1T9BA 1NM5C 3HR7A 2QX6A 3T4XA 1E7WA 3IH5A 4Y2SA 5I45A 3H9QA 5JE8A 1UBOS 1Q7GA 3Q88A 2G09A 3GIWA 4GR5A 5DBOA 3R7FA 4BGEA 1QFJA 3MWJA 2V4UA 2OC4A 2JA2A 1RWQA 3GBPA 3MJTA 3N0VA 4OHZA 3M5DA 3T15A 3W2TA 5AVZA 2I29A 3UB4A 2OCKA 2VO1A 3O26A 9ATCA 2AR7A 2XQVA 3K9HA 4I36A 3WXBA 4UHCA 3QVGA 1UKZA 2VP4A 1MPTA 1GV1A 2QVXX 4HDOB 4BZZA 1E5LA 3V2GA 2JI6A 4QXPA 4UFOA 5LLDA 2OB2A 1CR1A 2X5XA 3OJXA 2OCIA 2XEXA 1G7CA 4L0QA 3KOWA 1T35A 1QIJA 4HAUA 3BVPA 4J76A 1D6SA 3D0OA 3MJFA 3N05A 3IERA 5I4IA 2BM1A 4WZBA 2E1RA 4F9TA 1KK0A 3WV5A 2C5HA 4J2TA 6YASA 4YPVA 1RI2A 5I9SA 4HVAA 1CFZA 4KI7A 2RJ3A 4Q24A 4NYJQ 2DUNA 2AC2A 4LUCA 1HYQA 1VDZA 4MYTA 3RV3A 1OROA 4YCLA 1P4AA 2BFCB 3MG9A 1D2MA 5JFOA 1KFKB 2O0LA 2ZIWB 3G6KA 5H9VA 1B7GO 1S3GA 1NUQA 1TQDA 1RJFA 1TK3A 1ZMBA 4UVDA 4YALA 1AHHA 3PFIA 3UMMA 2A92A 1AO3A 4I08A 4KSCA 2HSZA 2HTFA 4ZV7A 3ZN2A 4YHHB 4PRYA 4LF7B 2JGLA 4KNYA 1EXDA 4V0QA 2WHEA 1JG7A 4KLRA 3RDPA 4BWGA 2GEBA 2XWSA 1VPEA 3OF2A 1PW7A 4GOXA 2OAQ1 2VQSA 2HDWA 1DAIA 1ESMA 1VMKA 3HADA 2ZDGA 4K28A 2REBA 1M2EA 3GMIA 3OAAD 4M1ZA 5ENDA 3VPBA 2C2GA 1F8UA 3HCAA 1YBAA 5EKSA 2IDZA 3AUTA 3L41A 1LPAB 2R1VB 2MWMA 2XUKA 2G3YA 1J5XA 4FFNA 4JIMA 3KBBA 5DTMA 2B82A 1D6JA 5C8YF 2MSLA 2CV1A 4DVGA 2OXIA 3RO7A 4HUQB 1T0HB 1XKLA 2FP4A 1NKSA 1YOBA 1E61A 3AHDA 4H4EA 4C88A 5FWNA 3B7GA 4FB5A 1HX7A 3BF8A 2E6UX 4B45A 3W4IA 5KSYA 4CF6A 3E4CA 5JNVA 3G2MA 3I9LA 3RSGA 1H9AA 3UCXA 1C50A 3KXDA 3NTVA 4K6MA 4ZAGA 3SXPA 2IXEA 1DQNA 2P5UA 3UYKA 1H0KA 1S4MA 1AUXA 1IIRA 3CZ4A 3G1UA 2C99A 3LOUA 3N86A 1EINA 4MIKA 2EG9A 4N82A 4TTPA 5CDYA 3MUNA 2CXQA 3M3HA 1Q44A 5CVVA 1INLA 5CJJA 4P83A 1DRVA 2JFXA 2P62A 1J7KA 4LWPA 1H0SA 3ORFA 3ZG6A 2WBLC 1AZLA 4I9HA 4LFBB 3B2EA 4B83A 4YJ2B 4BS9A 4J4BA 5M7EA 4CLOB 2B99A 4RU1A 4KIUA 1P73A 3L0CA 3REQA 3ZHYA 2W0SA 1PLKA 3SF0A 5JPCA 1NJ6A 2Q0SA 3A4NA 2P11A 4NLLA 4EATA 5BPFA 4DXDA 4NFYA 2YN2A 2NZUG 3VOTA 1I6MA 5JCPA 5IDQA 3K0SA 1QQ5A 2WUEA 4DMGA 1F7VA 1HZZC 4AI6A 1J07A 5FNZA 3AEZA 1X15A 2H2HA 3DFMA 4DUPA 4OB6A 1LH0A 3EUWA 3VYUB 4OHPA 2FOIA 4NTZA 3RREA 4DC1A 2BCJQ 4DF3A 2B7CA 1Y42X 4B8YA 3V8NA 3IT3A 2QX9A 1DEOA 2HGSA 2ZYHA 4ZQCB 2ZJ2A 2HXYA 2WJWA 5F4BA 3WQSB 2IPLA 4DLLA 4N5NA 1SXQA 4B6JA 1S8FA 2VCYA 1F2UA 2OCDA 3E70C 2P9GA 4KNVA 5KTOA 5CH8A 1KWKA 2GRUA 3GZHA 4A8JC 1PFYA 3L0SA 1TD9A 2NYAA 4G1MB 2EJWA 2XQJA 3O1HB 2VK8A 1W96A 2BGTA 1DG1G 3CB4A 4H15A 4QOSA 1ZUD1 4LCJA 1LWNA 2AEFA 4TV9F 2W8BB 2H07A 3B6KA 2VHCA 3PJFA 2R0QC 5DXAA 4FMPA 2QZZA 4C7VA 4XPIA 3H0KA 3A9UA 2G9QA 2NU7B 2Z83A 4E1VA 4EUEA 3ET5A 2P6PA 4ZKDA 3ZHVA 4PGGA 4BYMA 4LXGA 4FINA 1Z2NX 5D5QA 4BNMA 4WOBA 5BR1A 5KYTA 3G2KA 1FQWA 1PLJA 2IYQA 1ETUA 4KE9A 1B6RA 5G0SA 2QD1A 4QBTA 1E2FA 1G21A 1MNAA 2Q0XA 4B75A 4EG3A 3VVMA 1QP7A 4ZICA 3KTAB 2VPYA 4LV8B 3CM0A 4WBNA 2IK8A 2FG5A 1PLLA 1U1CA 4W63A 3NM4A 1K5DA 1RHUA 1Y37A 1A9PA 2QTNA 3IUQA 2F9LA 2F3RA 2PZFA 2Q4TA 2RGXA 3LU1A 5B7GA 4EG5A 1JPNA 5EXSA 2DQYA 3O94A 4NR0A 3RWBA 3ZH9B 3RGGA 3I28A 2QL9A 3GELA 4Q48A 4UDOA 3SD7A 3AHIA 4GZMA 5AW4A 1OB5A 1TE2A 3BMCA 3UZUA 1RZ3A 4KN8A 1A76A 4HEJA 5SZKB 1MVNA 3NHAA 3S68A 1E1RA 3JXEA 1ISMA 1T2UA 5U1PA 3VU9A 3I30X 1GCAA 4KZPA 2V1UA 4YY3B 3EIXA 1K27A 1H85A 3U09A 5B1EA 2VHZA 2PWAA 2VDNB 4J0CA 3DE6X 4OSEA 4PYMA 2AX4A 1SOWA 1Y9ZA 3N70A 1MVLA 1QORA 3IP8A 5ALSA 2D1FA 4P3XA 3O4HA 3T3DA 2ZRGA 3LCMA 3MGAA 3QEBZ 5HGJA 4NBLA 3E7WA 1S2MA 2J87A 2GMWA 3QOFA 5JDCC 2P8JA 2NW6A 1FUIA 1MU0A 4B0OA 1ZNZA 4PG7A 3O0TA 4QWWA 5THQA 4E07A 3SXUA 3O3NB 4W5WA 1GTVA 3GP3A 1TTHA 3F6BX 4ZHQA 1F1BA 2V45A 4B6GA 4MCJA 1ODTC 1Z88A 3C5WP 2HCJB 1UBLS 2OQIA 1ZN2A 3JW8A 3KT8A 4BB6A 4DV3B 1R5NA 3L4BA 4EKDA 1HNZB 1U7PA 4FSDA 2HFJA 1FC0A 4I8IA 3Q7SA 1KS9A 3RC9A 1O94A 4OHXA 1V35A 1XDWA 2JBAB 2SNIE 3FOAA 1G55A 3FPHA 2B7BA 4Y18A 5IVDA 4GOND 5F2NA 3S40A 4O4HB 4PYOA 4K3UA 3WMFA 4ZOQI 1SG6A 2QTAA 3RC8A 2VFAA 3IMGA 4XQCA 3I6BA 2FR8A 4KLNA 2QPLA 4BJ6A 1BTOA 1EZ1A 4H6PA 2MSKA 2FF7A 3KO8A 2EATA 4HN4B 4QU0A 4TGLA 1XE3A 2OB1A 3IA7A 1DDGA 4V03A 2BMJA 1QIGA 5KNDA 1JR6A 1E3DA 3KAQA 2FEXA 2O2HA 2V98A 4FFOA 3IBFA 3ZLJA 3PQ6A 1R3DA 2Q49A 3DV0A 3N39C 3QQ5A 2CBXA 3AERB 1PJCA 3W5IA 3EH1A 4DY4A 4KVGA 4D0GA 1V95A 2J9FB 3GGOA 4MJLA 4BRUA 3UJNA 1ZGJA 3ESQA 1GTJ1 4KO4S 3C3EA 5E4JA 1I5EA 2O1WA 1OZAA 4FNGA 5FH9A 4IQGA 2I2BA 4ETWA 1MHTA 1EFCA 4CKCB 1Z7GA 4B3BA 3VKUA 3CWCA 1H9CA 5FBWB 4OOEA 3L2OB 1RAIA 2IUTA 1RABA 4YC7A 1AZWA 4HQ6A 1KJ9A 1OIXA 3OJEA 1U8FO 5HTOA 3SX2A 3NV7A 4PZAA 4I4NA 3GVCA 3WWCA 2BZSA 4Z3KA 3NH6A 1Z5OA 4LS3A 1WDTA 4K81B 4QLAA 3ROKA 4GOOD 4CZ2A 4D7AA 3GJYA 3GP5A 4TV9A 2ECPA 3E03A 1PJSA 1NGSA 1RAAA 5L8VA 1IQRA 2WAXA 4MRNA 1P0FA 1DQYA 1IPFA 3QPBA 3A7EA 1UBHS 2ZT7A 3C7TA 1I13A 4BBAA 4S3MA 4OXRA 3AFIA 3LPAA 4BEWA 4H77A 4EI2A 4DCMA 3IELA 1QQAA 2LWIA 2C3MA 1XTUA 1TLTA 4TV9B 1PJBA 5C3UA 2HU8A 2XZTA 4HNSA 1PNOA 3AJRA 4P3YA 2WTNA 1JQBA 4M54A 3W8DA 1P2VA 2J33A 4LDNA 4MWTA 3RIHA 4BDSA 3O8OB 4B2IA 4KFTA 3R7DA 1U9YA 3SC4A 1H8HD 3JWEA 4QNNA 3SPXA 3P9RA 2V6MA 3JQCA 3NNDA 4RV9A 4BJ3A 1PR5A 4J29A 5G1NA 2FP3A 1NNUA 2CCKA 3X1JA 2P65A 5AI9A 5DWVA 1N8NA 1OTXA 4LAFA 3UAOA 2YVQA 1HEYA 2J3HA 2QSJA 3SVLA 3IPAA 1XXHA 3JAMA 1W1UA 2ECOA 4D98A 3EW7A 4BY9E 2L18A 3DZDA 3UWSA 1VL8A 4CTJA 1RP7A 1AKYA 1ICIA 4HGNA 3LL4A 3Q0EA 3VO9A 4TMZA 1QBGA 2EEZA 1YQXA 4RFSB 3THSA 4DLTA 4JJ7A 4US1R 4F6CA 1KEVA 1Z0SA 4RZSA 1LSUA 3OKAA 2GT1A 1X3LA 1PFGA 1WXXA 1YJXA 1YRYE 3EFOA 4JDPA 2OCAA 4MW0A 1WVMA 3AXSA 1WMEA 1AKRA 1PFVA 2ADFA 3Q6IA 5K7SA 2EFCB 4NXNB 4D74A 1JHAA 1OX5A 4RA6A 2AN1A 2EHDA 2DHEA 4BEVA 1VM6A 3EQ7A 3Q7TA 5CITA 1JXMA 5KTPA 3BIXA 2Q2VA 5CGQB 5HUQA 3O3OB 2O8EB 1T9CA 1N1GA 1A2OA 3KTDA 1M2OB 4N3NA 4TWJA 5DE3A 3MNFA 3UY4A 3NRCA 3ZGZA 3E5RA 3RS0A 3CRMA 4YDQA 2WD9A 3QELB 5AIAA 4LY3A 5E6UA 4BXOB 2A7QA 4GI3A 2ZAYA 2UXCB 3G59A 3CTMA 4XQ0A 2YC4C 4HH0A 3A7DA 1EVKA 1UM9B 4NJOA 1UWKA 4TV8B 3SZ3A 4AO8A 1Z6AA 2D06A 2ZR9A 1JBKA 1QHIA 5LP6C 4A8PA 1L5HB 1NBMA 3A06A 1QIEA 1P60A 2JAHA 3CRW1 2QTHA 3ZU2A 4C2TA 1H1TA 1SC3A 4LOHA 3UIEA 1Y4SA 3JARB 1QVZA 1P39A 1TLLA 1CUXA 3ROTA 5BOSA 4X1YA 4QBIA 3GARA 4EJ6A 3A3NA 4XM0A 2FB9A 2XGGA 3GU3A 1ZQ1A 4TLMB 4X54A 4ZVUA 2ZIXA 3CW2A 2XYPA 4N6OA 3BILA 1GWNA 2ZWIA 3HEMA 1Z6GA 4Z9YA 3RU7A 10MHA 1VSVA 4LI0A 4EO7A 5TXGA 3VZSA 1V3VA 4QECA 3HE3A 1U0RA 3LWBA 3W0LB 1OBHA 4P5DA 3VTKA 1U0LA 1EM8A 3WRVA 4C3OB 1Y1LA 2KHZA 3FVTA 2JJ2D 2XCIA 4MMYB 4Q0MA 3A9CA 2GK4A 5LOVF 3BD7A 4YLYA 1CNEA 5IUJC 3U61B 3ZWOA 4CLRA 4IV8A 3VSCA 1VMDA 6AT1A 4U9HS 2OA0A 1JKXA 5J3JA 4P0TA 4LHYA 1ZC3A 3OX1A 3ZHZA 5TJHA 2IE0A 3UMRA 3BIWA 3ZGNA 2ZWAA 1J6UA 4DV0B 3ZWPA 4D4HA 2C5LA 2JL1A 2AEEA 2ZP1A 1YBFA 1W2HA 1LFAA 1QGAA 1YJ8A 5KJ1A 2G4LA 4LG1A 2GTPA 3JZDA 3T0FA 2RARA 1RRFA 1X94A 4RVUA 3PLAE 2FMUA 3L5KA 5GOZA 1TFRA 2XMGA 1GEGA 1SCAA 3KQPA 5K3OA 2HWKA 4KUEA 3E1KA 4IOLA 2YW9A 5AKGA 4N7BA 2AW5A 3AB8A 4CEHB 2OFWA 3IVGA 4MWZA 4MKHA 5DLQC 1EDBA 1N6KA 1NUSA 1UC5B 1Y7PA 3CBGA 5JAQA 1JJBA 3I0MA 1NWHA 2OZEA 2Y4OA 1RFGE 1NYQA 5ALPA 3I5UA 1SO8A 5DGTA 4GSLA 1WW2A 4I9GA 4TUYA 3GO4A 2IH2A 4XLLA 2AS0A 5DTRA 3WB9A 3GNQA 2EG5A 3I0NA 2I22A 3C6MA 5JU6A 1TCUA 4QD3A 3RCBA 4HRVA 4F84A 1N0HA 4JWKA 1LEHA 3INTA 1FNBA 1QO9A 1DAKA 5BRNA 5ALVA 3KVNA 2DJ5A 1F8GA 2G9NA 3P9PA 4NFLA 3V1KA 1JFSA 1RXSA 1X13A 2VDOB 1IWPB 1YDWA 2I6SA 2Z6QA 1T0BA 721PA 1N78A 3F4TA 2FX5A 1JG3A 2CHUA 1XCJA 2X58A 4E6PA 1FW8A 2GXSA 4IIFA 1N1EA 4RTPA 4UTNA 1OKKD 3CI0K 5MFPA 1ODSA 1WF6A 4O4LA 4R1UA 1FOEB 4WVFA 3C3WA 4AXBA 5KOJB 2PH7A 2P6NA 1X80B 5BMVA 2DHRA 5SZIA 3MWDB 5AOCA 4JKYA 2C7QA 2NUTB 1DHTA 1TYBE 1AKVA 2P1DA 3DLAA 4MYUA 4MGYR 4RY2A 3PYXA 4Y9RA 2X0FA 4Q4DA 5PNTA 3THRA 1ONNA 3B2QA 4KC0A 4JJZA 1A8UA 2WHQA 4M9XA 4RNCA 4UHEA 3NUGA 4BFZA 4QELA 3H8WA 2BCGY 3QMWA 3T7TA 2WKSA 3H1FA 1M1YB 4DDVA 4LN1A 3KLNA 1EVQA 3KTFA 2PS1A 1CR0A 1ZLXA 3UENA 1BRMA 2BFFB 3AM4A 3CV3A 2XMDA 3H5OA 1L8QA 3VU8A 1V41E 1HWYA 2XB4A 1FU8A 1MABB 1Y8QB 4YRFA 3ZXUB 5A3VA 1PEKE 3ECSA 3TSWA 4JJ4A 3CH5A 4BMNA 4DV4B 2WVAA 4AUEA 3U7JA 3V42A 4DQ0A 3QVLA 1WRBA 2TS1A 3PUKA 4KCGA 2DY1A 2QN6A 1E2HA 2XDYA 3M6WA 4PYKA 2VTEA 3EMKA 3OQ6A 3OQ1A 1KPIA 3QPDA 4DQUA 4EY7A 1B8UA 4Y1FA 1QC5A 3SHVA 2GAFA 5KAPA 3WYAA 2Q4BA 3EZGA 5KYUA 4Z7NB 4U5QA 2QRUA 3VR3D 1ZO8A 3DNPA 5J5VA 1VRWA 1X8XA 4BQNA 3JQAB 4KHPB 3BZBA 2IY8A 2O8BB 1UMDA 1T1RA 1DTSA 1NAIA 2O50A 1CNFA 3BA6A 4ZI7F 1O97C 4XX0A 4PZ0A 4FGSA 2XZPA 4URYR 2I3GA 4Y30A 4ZAWA 4DZZA 1YXMA 2X1VA 1MRNA 3KVRA 3K4QA 4ZO7A 2WVGA 1SUAA 2CD7A 5F9HA 1YL7A 3H2IA 1O54A 2EKQA 5ILGA 3OCFA 3UC5A 4MV0A 5BR7A 1RWBA 4KAXA 4D9BA 3GT3A 3OH8A 3RASA 4IMRA 5CAEB 3CRVA 3GQBB 1K89A 4XCQA 2IHKA 1OYVA 4IS2A 1EXNA 2XD9A 4LQLA 1VB5A 4OU5A 3QE9Y 4NMMA 5JALA 3Q0TA 2G0AA 1NX6A 2V7QD 2VDWA 2ZB3A 4ETNA 4TKUB 2YNMA 2VRBA 4X24A 2VXOA 3DV9A 4HAVA 2FPWA 4JUFA 5FBLB 2POCA 4MV6A 2JIZD 2Z3WA 4IUYA 4MICA 5C2JB 4CIAA 3ZX4A 2WIJA 1MW8X 2CDNA 3FTDA 4XJSA 2D2XA 2R8OA 3CKLA 3HB0A 2K7ZA 3IKMB 2ZS7A 1K9VF 2EFEB 4L76A 3U3JA 2NVWA 2VF2A 3LT2A 3HQ4O 3LX5A 5EMJA 2BKUA 4GYYA 4BC0A 4DVJA 5FA5A 2OYSA 1L8XA 3CH4B 2GZRA 2O23A 2RHTA 3U60B 4GWLA 4JBHA 4BO4A 4UAUA 2WKWA 2Y68A 1G8FA 2YUIA 3AKCA 3LJKA 2EEPA 4LDPA 5JSZB 1CQXA 2FCRA 4EX7A 4JP3A 4TRJA 1YS1X 1RC8A 1GUZA 4PC3A 5JJCA 3NG1A 4IM7A 5LB4A 1BO6A 3L7NA 1U2DC 1KC1A 2I7XA 4OHBA 1XCLA 2WPDD 1KYVA 3HNPA 4FDTA 4ZCRA 1BJRE 2HCFA 3PC3A 4P2GA 1Z0FA 3KKOA 1T4BA 3JR7A 4LZNA 5BWMA 3DQPA 4K7JA 1A5AB 1ZFNA 1GLVA 1UKCA 3ZDEA 1Z5WA 2FUG6 1U9JA 5IK2D 3IPLA 1ZK4A 1SD1A 4WXPA 3BGWA 3P8ZA 1KRXA 3H3JA 1L4LA 3JD3A 3TW8A 4PONA 4XARA 4N49A 5BWOA 1PQ4A 4X5OA 4ALJA 5F2EA 1ABBA 1I7LA 2CCGA 4UE6A 3NIBA 2PSEA 4GXNA 2CL6X 3RAFC 1C2YA 4NSNA 2CJPA 1NE7A 2FN9A 4QHTA 1G17A 1B2LA 3F4LA 1UPFA 1LJLA 4AICA 5HZKA 3OBBA 4XZ3A 5FQOA 3RS5A 1H1LB 1QE5A 4G4SO 2V7TA 4JFRA 3O8OA 3LBFA 3HFJA 3UMGA 5C51B 1E69A 3C8MA 4YLGA 5E6SB 4KO2S 2OCXA 1V5IA 4CM6A 2FSIA 5EE3A 2YYSA 4IZOA 1CWUA 4F4IA 5I8PA 1RAHA 2QQ5A 4AAYA 5LYJF 3U7HB 4R98A 3QEMA 4YN3A 5K9ZA 2GVNA 4TVOA 2UYQA 3OTOB 4BO5A 2C2YA 2NVUB 2ONKA 1T8TA 3F9IA 2BJWA 3K9BA 5DF1A 3JY6A 1WE2A 2G07A 2CWWA 4FYIA 1YUBA 3SG0A 2OKCA 2CHFA 3NBMA 4KXFB 4YP9A 3CLTC 3W6OA 5KOYA 1AGXA 3RI3A 1Y8ZA 3AQ4A 3EXFA 2AZTA 4BP9A 4EARA 2HPVA 5K3CA 4YRSA 1H22A 2AFHA 2NO5A 2WU3A 5T4FA 3CCBA 3K16A 4H60A 4PV7A 3ZS9A 4BO0A 1F2UB 2HI0A 3FPFA 3RQIA 1PJ3A 4FN5A 1KMQA 2Y3IA 5KKNB 3W9SA 4EB6A 4CM9A 1L1RA 1N2IA 3I39X 1PR6A 3P9ZA 3LKBA 4CMKA 1Y6FA 3Q9NA 3JAWA 1IN1A 3GRZA 1ODFA 3KTOA 4A9AA 1B8PA 4Q82A 4C7XA 1S9HA 3IEIA 1J2EA 2NXJA 1E89A 2W8BA 2CEKA 3PHLA 4HQLA 1VXRA 4OL0A 4RIIA 4TSFD 1S02A 3BMQA 1BS9A 1B74A 1CYDA 2BHRA 4JAVC 3C8HA 2ZIZA 4F4UA 5C4IA 1KMHA 1ESDA 3P0FA 5EWMB 5FD8A 6Q21A 3QPWA 1L4NA 1X1AA 2Z0MA 5ISMA 4HGOA 3ETGA 3EW9A 3KUDA 1IQ0A 1EDOA 1EAYA 3BH0A 4H0NA 4MB0A 1PK9A 1R4NA 4Q6BA 4S0ZA 4Q21A 2JCGA 2H16A 2SECE 2YINC 1NQOA 2XE7A 4QTXA 3GWGA 1V7QA 1N9KA 3T9AA 3QHPA 4NCXA 4RDIA 3TLGB 1FMLA 4HFRA 3WYNA 1P1FA 4HT3B 4KOAA 1Y33E 1U99A 1EEXB 2C7PA 1WBBA 1PUJA 2FN3A 1XYYA 2HHCA 1MNQA 1N2CB 1LU9A 3AJDA 3EDCA 4OJMX 3WDSA 4DMFA 5KIAA 4A36A 1QIMA 2E85A 3DAPA 1UWLA 2XF8A 1CIVA 4ZT4A 3ND5A 3LA8A 2MYUA 4AKHA 2JGKA 3TRKA 3HBFA 1M1UA 3S5JA 1NVGA 1R16A 4JB0A 2Q5FA 1UQTA 1ORVA 3FOCA 4QXRA 3NT5A 5EMNA 4A82A 1ZK0A 2QMYA 4ZYYA 1K92A 4ZCIA 4DQXA 3ZNOA 1B76A 4LHSA 3D8UA 5DYNA 4KDEA 4ZT6A 1O87A 1SBCA 3P97A 1C7FA 1DO0A 4X95A 5AJUA 4QPPA 4XE5A 3I04A 2DOKA 3W3AD 4UUBA 2HDNB 2I2CA 1FA9A 3H0EA 1MHPA 4YQEA 5ICFA 2J3KA 3Q8KA 1COZA 1BJTA 2Q7XA 3TEJA 2F4NA 2VXBA 2WUGA 1MT3A 4EVQA 1Z45A 4JELA 1GG8A 1QBKC 1K5HA 4HYTA 5TMBA 1QRDA 2FSUA 4BFUA 3Q41A 2VAWA 4C2BA 1YIOA 4R41A 3U3OA 4K88A 2PTQA 3AHFA 2WM3A 3L0PA 4CYMA 4AQYB 3MOSA 1UPBA 1QRUA 1D1SA 1GNQA 2N47A 2WIKA 1SUDA 3P4XA 3KJIA 4HLQB 3WVNA 3Q3CA 1Z2EA 3KOZA 3LKDA 4MUEA 1DUSA 2X0JA 1X7XB 1NW9B 1YKFA 3PQFA 3HBNA 1NVUQ 5JSKA 3E8SA 1Y8AA 2P2ZA 1VQ1A 4IGFA 4C3UA 1C2TA 3I92A 4Z8XA 1ICEA 2Q5EA 1K62A 3A6LA 3WIUA 2QLBA 1WCWA 3NDRA 3PFHA 1MAVA 1Z7YA 1KAHA 1P9WA 4X8LA 2CBGA 2GRJA 4S2UA 1K1EA 3K5IA 3EDQA 1QRRA 1JDTA 1UPUA 1DWUA 2OENG 4Q9AA 3SQLA 2RCYA 3T12A 2I80A 3D1VA 2H18A 4RENA 5ICCA 2X8AA 3OUUA 6NULA 3ZKWA 5DEOA 4UUAA 3NO4A 3TQOA 2DU8A 3FN4A 3LLMA 1AB6A 4YV1A 5DV9A 4QT0A 3CPHA 3IJEB 4ECEA 1N5JA 2NACA 4QWMA 3RT9A 2QP9X 3OTGA 3OCCA 4BKRA 4G6ZA 1LVUA 5G3YA 3D2BA 2RKBA 1R18A 1G6Q1 5A4FS 1KEWA 4ARIA 1NBAA 5HKOA 1RKXA 1AKNA 2CDAA 2GPBA 2VF4X 1C3XA 1CQJB 3DMDA 3CUWA 1JJAA 3PFKA 1Q95A 2EJTA 1D7AA 1NT2A 2K6GA 2P2NA 1ISSA 4OFZA 1GPUA 3AT1A 3WZMA 1MEJA 1E58A 2WHXA 1GYQA 2XYRA 3VHLB 2FEAA 2ATEA 2A9KA 3WWZA 4C03A 3DJYA 1NVVQ 1L8AA 4XVQA 2AEMA 5G4KA 3Q5GA 1ML3A 3ZJ5A 2B4AA 1TAQA 3UYLA 1Z07A 3U7EB 3B70A 1VI2A 4FJ1A 1FYEA 3ZU5A 3ZWNA 1ULSA 1OASA 5EIOA 3DYBA 3TW4A 5IAEA 4NE7A 1LLFA 2O8FA 1TCVA 2ZKLA 3SIPA 3CRNA 5H3CA 3SZOA 4I55F 4OGFA 2GKSA 3G2NA 4MWDA 4OHKA 1BCSB 2D0PB 4Q3EA 5DCUA 1OAKA 5AM2A 5FNVA 3I9V1 5FTLA 4CHTA 4I50A 1M2VB 4FZRA 3KUCA 1EVLA 3IMFA 4YLEA 5KJFA 1AV6A 1UXHA 2Q3CA 3DJFA 3EWIA 2NYUA 1QHHA 1ZM7A 1SUPA 3CZAA 1IJFA 3KZCA 4MO2A 4MVJM 3UQZA 1CUGA 2AD1A 5ANRB 1LD3A 1Z7BA 3CVOA 3SHWA 3TINA 4O2BA 4F92B 3NTRA 5KYYA 2HRCA 1QKJA 1AS3A 2OG2A 4KQMA 3TUZC 3BXGA 4CIVA 4B3SB 1BCSA 1B43A 1QUFA 2Y1OA 1NRIA 2FSSA 4PAQA 1YFMA 1G6HA 1JJVA 4UBOA 1KH2A 5CR9A 2ZI3A 3AO0B 3LBYA 4R2MA 3UUGA 5FPHA 4A03A 3VYTB 1IJEA 1KDRA 4QOHA 4TS3A 4WERA 3AZPA 4XFDA 1OAOC 2IDJA 2P3OA 2C8LA 1UBSB 1C29B 1MO2A 1DXYA 3K8OE 3AUXA 2DE0X 3NB0A 3BAFA 1WETA 1MB2A 3OPNA 5LPNA 5JS8A 3SGLA 2PZMA 1M8KA 2V9PA 3AI7A 3M0EA 4OX9Y 1XXHE 5LQNA 4EKNB 2B78A 2I6GA 3GPCA 4QVGA 3HWRA 2FRDA 3I6YA 3IT0A 3JYNA 4MKZA 4TSRA 2F3QA 2Q8PA 3HB1A 4MW1A 4NFSA 2XI4A 4EFLA 2WU1A 3C8ZA 4CL2A 3PDWA 4J1NA 4YCSA 1KK1A 5BRAA 1BWRA 1QOZA 1Y8RB 4FJ2A 4O2RA 1VJCA 1DWOA 4KE6A 5LB2A 1T9ZA 4S05A 4D0SA 1WUKS 1V3QE 2M98A 4HQNA 2C2WA 3AESB 3L1VA 5EPEA 4O3FA 2X8BA 5CLGA 1XX6A 1PR2A 1W36D 4MWBA 2XIJA 1XRQA 4JEHA 1AKWA 4B35A 1CUWA 1E2GA 3ETCA 1ZEJA 5DLPA 1CVIA 5CCXA 2HADA 3IILA 1ZHFA 3AF4A 5AVQA 3U4IA 3FTEA 1CT9A 4FCWA 1X39A 3UXYA 1VC2A 3GRVA 4I6GA 4Q4LA 2LVBA 1U1GA 3R0VA 1F0KA 4QUKA 1S2OA 2X9VA 1J06A 1DBIA 1E2UA 2VJNA 4JL6A 4IDAA 4KYTA 5IH3A 3VVCA 3ZCSA 2R60A 5EJ9A 1MJ5A 7MDHA 1K4YA 1ID1A 4ZJPA 1T43A 2FZEA 3LNCA 4YJ2F 2PEYA 4JU8A 4BVFA 4U6SA 5CX4A 4F91B 1Z4MA 5FUBA 3HM2A 3VR5A 4PLWA 1TZKA 4LJ9A 4DIMA 1Q3TA 4MVJF 2D5IA 3A1SA 5CEJA 2W6ZA 2ZKIA 4D9HA 3C48A 1ND6A 1F8YA 3UJ3X 4FYXA 3E9MA 3K9GA 3CEPB 1IN7A 1G0NA 3P26A 4GPTA 4LE0A 4NV3A 5DULA 5HMMA 2W70A 3WLRA 4E15A 5JCOC 4OREX 3UK1A 2QP4A 2F55A 3IOBA 3O82A 1V9CA 3ICOA 2PBRA 3KLOA 4UNQA 1FNCA 5K3SA 2PSHA 2VUTA 3UK6A 4BVBA 3AG6A 4C4AA 4ISCA 3W1VA 3DDWA 1JMKC 3DMNA 1TTQB 4NU5A 4U39A 2OHFA 2I4NA 2DPLA 1YZYA 1BE1A 1XU7A 5HKBA 1OLUB 2PMBA 2VJMA 4HFJA 4HLCA 4KO3S 4CWAA 2FDRA 5C4GB 3BFJA 2WHPB 3Q11A 4CMGA 3U7RA 1TF7A 4OM7A 2P90A 3E9NA 4A1OA 3BK7A 1KFCB 2LV8A 4XAQA 4O59O 4ARZA 4LY0A 1UDAA 3DDSA 4INZA 2PGXA 2Q6TA 2W22A 2X4IA 4IGAA 3FYCA 4XYBA 1UOEA 3VR4D 1MJGM 2I8AA 4ZV9A 3VR2D 1Z6QA 3S0JA 4GDMA 5DT9A 4C6TA 2IZZA 1U3DA 2QPTA 3RU2A 1DAEA 4BP8A 1Z34A 2HO5A 5KWIA 2X6TA 3C5HA 1NF9A 4FMCB 3FDZB 3O83A 3KLBA 4H7JA 1KMNA 1NAHA 4ZV4A 3IT2A 3AETA 2E4VA 2GNPA 3JTEA 3ZDQA 4EECA 1GIAA 1AOXA 1MENA 1SKQA 3C43A 3C2QA 4J0FA 2W0MA 4MAAA 4WESA 3JTMA 5JMWA 3RHFA 3N2GB 3M82A 2CK3A 3GUYA 1P0CA 2UZ0A 4DNFA 1CJMA 2BHTA 4E14A 4YMUA 1R0LA 3HY3A 1V43A 2PJDA 1R8XA 3IB3A 4WLUA 2X0DA 1RWMA 3WKEA 3NPMA 4DM7A 1ZKMA 5BNIA 4Q12A 1EJ0A 4D9CA 4H27A 3GRPA 1N2OA 4UM8B 2DXIA 3KTAA 5B64A 4D9KA 4K8RB 5A4DA 3MGGA 1XEAA 2HL6A 2X0IA 2A86A 2EKZA 1PSWA 3FMFA 3KXPA 3N0XA 3N87A 1LQUA 4IWYA 4WPGA 4F12A 3QKRA 1AZTA 4BHTA 4F56A 2EFDB 4EPXA 5JAUA 4NG5A 1F7UA 1PW5A 2H1SA 1EJ6A 3CEMA 1CKEA 5DI9A 3L8HA 4E3WA 1DOHA 1P5ZB 2P0AA 1ZU4A 4AG5A 1IZZA 3HKCA 5BQ3A 2NXWA 2XE8A 3MB8A 1WA5A 1HXHA 5J2UF 3PKIA 1E99A 4YCJA 3GC6A 5JECA 4YRDA 3KR0A 4LIPD 5CT8A 2UUBB 3I8XA 3KWJA 4JJ8A 2XUFA 1L5HA 5FWYB 1P4GA 4Z4EA 1HE5A 2O3UA 2OHVA 3HRHA 3UQYS 4EF5A 4NJEB 5E0OA 3IP5A 3KSMA 3W6UA 5IHXA 5K4HA 3KSZO 2B8TA 4FWBA 2HEGA 3NHRA 2VSOA 3O74A 5AUQA 5JDIA 2ZUBA 1FS6A 4CKWB 3CUYA 4QQNA 5HQJA 2QEQA 2C95A 1PT7A 3TBFA 2XUGA 1KI9A 1V1JA 1LK0A 2NV6A 2WSSD 8LDHA 3K0HA 3RYFB 3RFFA 4E5UA 3IKVA 3NI2A 4B09A 4AWBA 4IWNA 1PQYA 2BGIA 5F5NA 5IT0A 1J9ZA 1PFKA 1QGYA 3ZDFA 3RUDA 2JFOA 1Q77A 1WDKA 2IPMA 2GPWA 5HXAA 3CUUA 5CJ2A 4YDRA 4HZUB 3C16C 2IZ1A 3LLVA 1W47A 3AV3A 4DIBA 5I6DA 5E95A 4RMGA 4GI2A 1P19A 1C7EA 3PITA 4BTLA 1GHTA 4FMDB 4D9IA 5LM3A 1QB7A 2XCLA 1AQYA 3ITEA 2KM1A 1U63A 3A4VA 1RD4A 2XB9A 2EBWA 4R16A 2EAUA 2JASA 4FGJA 1H0RA 1OYYA 2PKYX 3COWA 2G1UA 4FX2A 4ISBA 1B14A 1X7XA 4RVDA 5HPYB 5M04A 3E35A 1X7ZB 3I83A 5KHAA 3DL2A 1TUIA 4ZOLF 1QHXA 2EIXA 3AOEC 1RBMA 3Q7RA 2PRYA 4YJHB 3B8HA 3GF4A 3DXXA 3M5PA 1L1EA 3KQHA 3ZE8A 1UMDB 2V5AA 2GBCA 2N46A 2ZBRA 5K4GA 5E1DA 1OLSB 3W9YA 4O1HA 2HK6A 4AIIA 3QUSA 3EZ9A 4PAWA 1W44A 2WWVD 3V2HA 3PICA 3E8MA 1E1CA 5F7ZA 4AROA 1XD8A 4PLFA 4QEKA 2QBYB 2C5FA 1TC1A 2HPHA 2R4UA 4KEAA 5JQGB 3U19A 1MBZA 2HKIA 3KDSE 4U0KA 4M1QA 2COKA 1P7CA 3CJQA 2C8JA 1TO1E 3GQBA 1YCHA 3JALA 3KKLA 3UJAA 4AZ3A 3NKVA 4YMVA 4R31A 4XUGB 1J8QA 5TPZA 3PPIA 2WJAA 4Y9UA 2WWFA 4YRBA 2OMEA 1N2XA 2F2TA 5CX1B 2HA4A 2O06A 4HEA1 4AY5A 4N48A 4M76B 5JQGA 2RIRA 2HMAA 1I1QB 4EH1A 3PL5A 1DQSA 1NMXA 2GUWA 4BIMA 1M1YA 4J1SA 1PZGA 2REOA 2WTBA 3DMGA 4H17A 1ND5A 2O19A 1MDFA 1TVEA 4PYRA 4V3CA 2JH9A 3ITKA 4FC7A 2B4YA 4EFKA 5KTSA 2JLQA 1JF8A 5FO0A 4FW9A 1RLTA 4X1KB 4UBIA 3W4JA 1WF3A 1XIVA 4Y1EA 1PZHA 4EB0A 5F91A 4GYKA 1LV8A 1Q6YA 2V6BA 3B9RA 1OJ7A 3OJFA 2VH1A 2JIQA 2PUCA 3ZW9A 1E20A 3QP9A 4LGYA 2O4UX 1UEJA 1K7FB 4K9MA 4II3A 3DMTA 3WHLA 2ONYA 2WF8A 2GSWA 2E4ZA 1IQUA 3U4MA 2RI0A 1NUTA 2NIPA 2IP2A 4NG4A 1Z4IA 2XRMA 4H2DA 5IYZF 2OAGA 2QUHA 1RBZA 2PZ8A 1PI3A 3ST7A 2SCUA 3GEHA 1YF3A 4KXMA 2B20A 2BFWA 5BSEA 2GYUA 3C0KA 3ENQA 1CW2B 3RC3A 5EAIA 1D4FA 1T3TA 3R7WA 3T54A 5H8WA 3LC7O 4EGCB 3CLSD 5EMHA 3VO2A 4HB4A 3T8YA 4RA9B 2BFPA 1CXZA 2IEZA 1JG1A 2GBFA 3AIOA 1JFRA 2QLNA 3NYRA 1A9ZA 3PVZA 3GXOA 5IJAA 2FWRA 2G8LA 5CVJA 5ILQA 3DW1X 3EJ6A 3DO6A 2V97A 4TM7A 2Z2YA 2X6RA 4LZWA 3OCYA 1OW3B 1XKQA 4DCOA 2JKYA 4GR4A 1GAEO 4DAEA 3COJA 1NQVA 3GHHA 4YYZA 2F8SA 1CEEA 3PLRA 3VZCA 3FCUB 3SAJA 1ODLA 3A6HA 3THYB 2NTJA 4Z7JA 4LZPA 3T3MB 4G0NA 3WLPA 5I51A 3T9EA 1YE3A 3GFBA 4UARA 5LCXA 3TBHA 4DRZA 4AS3A 2FMKA 1FXSA 1LC3A 2V5UA 2VA8A 3KSUA 2H31A 2QM3A 2Q50A 4Q47A 2WV9A 1NASA 1DCMA 1MO5A 2ODBA 3BXXA 3EEFA 4X93A 4XX0B 1Z9BA 2X0KA 2XV1A 5CM2Z 3G8YA 1CQPA 2O2XA 1T0UA 4II7A 4G56A 1CUSA 4ZMRA 3TF5A 2ZVJA 4QIHA 2VVTA 5IBPA 2BFCA 1HNXB 3OEWA 3QTBA 3WYEA 4I66A 4C3VA 3EWAA 2CMFA 4GLLA 3ZGLA 2AC4A 4B3XA 1RQGA 1W1IA 3OVMA 3OZVA 4Z51A 2QRNA 3KD3A 3P32A 4HEQA 1Z56C 3SYKA 4ZCSA 3WBKA 2VH5R 1K8XB 2VTBA 1Z2DA 3F4BA 1Z33A 1KZHA 2IYWA 3F3SA 1NA5A 1KVTA 1NN1A 2R8EA 2RB5A 2V59A 3FWPA 3AY0A 4HPXB 4LQ4A 3UH0A 4TKVA 3LSTA 2CZGA 5I7WA 3H11B 1JP7A 2R96A 2YV4A 3OLYA 1ECFA 4EW1A 2B8NA 1XHEA 4HFMA 4RTMA 1RYYA 1TCCA 1NNSA 1XQYA 5MN4A 4RH3A 1UBEA 1T1JA 3DLIA 3VDMA 3ZK9A 4XB2A 1BHJA 4EKYA 3H16A 1RRCA 4JNCA 3LT4A 2XWJI 1IVNA 1YJBA 4AJHA 4L74A 3SXJA 2RGAA 1DKPA 1VIAA 1K6XA 3K5WA 4MROA 2ZRNA 4GOMD 2G1PA 2PKXA 4JZYA 4YGXB 3RLIA 4A5OA 3QXGA 3KZNA 1EBUA 1XQ1A 5BSFA 1F8XA 4GVLA 2H9AA 4QDOA 1Z74A 3MPOA 2RAFA 4LWQA 4D9JA 4MQ5A 3VYSB 1DFGA 1K4KA 4A6PA 4F7DA 2R8RA 1XVLA 4KKVA 1VLVA 2EGHA 2JIOA 3D3WB 1T5OA 3H2JA 3L6EA 3WK7A 4IAOA 2QAIA 2QNIA 2VWGA 2YZ7A 4G5OA 4A7PA 3CGGA 3EN0A 4Z9FA 2XGMA 4DIEA 3GJ7A 1NKVA 2AOTA 4JLSA 1F20A 2W00A 3M6FA 1V4BA 4IIDA 4URUR 5FOTA 4GU5A 2IV7A 3ZV3A 3QOYA 5TPZD 3UO8B 3ZDCA 4Y6GB 1Z6XA 3I72A 3HCEA 1WU8A 1UJ4A 1PZNA 2GXUA 3SMVA 1L7XA 3EGIA 5EGNA 2FWMX 3QFHA 2HIGA 1JDPA 2XNHA 3HCRA 1EP3B 4EGQA 2CCJA 3OZWA 2AOXA 5BYKA 2FSGA 3LHKA 4TUYF 1PJQA 3R6VA 1TFUA 5HQ3A 4J3NA 2E6KA 3LK6A 1TJ5A 1Z62A 2I4RA 3TPCA 5KREA 2HEIA 3IP9A 4QYIA 1FS5A 4B3TB 4WBXC 1J0CA 4IQJM 2R3SA 1G21E 4P3PA 5IUNC 1NL3A 3CJTA 4XB6B 3C4QA 4CTNA 3OETA 5I7AA 2CNWD 4IH9A 2AK3A 2J4DA 4GMHA 3A1NA 3QY0A 3GRCA 2GARA 1J9EA 3B3AA 3D5EA 4UTXA 5DX8A 1T8YA 5KWJA 1L9XA 2FPPA 1JRLA 1D1QA 1I0IA 1OAAA 1T4MA 2FX3A 3B13B 2CY0A 3FYTA 4GGMX 4NNPA 4ON9A 4EELA 5BRJA 2PUDA 2DBRA 1DT5A 4UBKA 3VC1A 2VK4A 3HFRA 3QKSB 4JI3B 2G9RA 2PGNA 4IEFB 1CZNA 1JALA 4D1YA 3BCSA 4N0QA 1AG9A 1YASA 2J3LA 2ZFUA 4MWOA 3SCZA 3L0ZA 3SHQA 3ZZNA 3K70D 3WL7A 2ZDHA 3FUTA 3X1MA 2ZB4A 4CIWA 3OF3A 4L8WB 3VZRA 2UUCB 1RHMA 1XD9A 4G25A 1I1HA 1JU3A 1X2BA 2INGX 2OXEA 2WJ3A 5H0IA 2WT9A 5C7OO 3D7LA 4CG1A 3EOAI 3NHUA 1QCYA 1IAVA 1IXKA 2O14A 2QRVA 2NU6B 1FLDA 3LC1O 3B6IA 1FP7A 4PYNA 4TX1A 4N8DA 4R1LA 3C70A 4R7GA 4HRAA 1W59A 5KYXB 4R8LA 2P4UA 3EAQA 3DLCA 3LOQA 4UKDA 1E5VA 5DFAA 5HJ5A 3FLEA 4AP5A 1ZGCA 2C07A 1R6AA 1XK6A 2IU6A 3DMRA 1WJGA 2E2WA 4XIGS 1JKJB 4JBIA 4PX3A 4ZC8A 4LRSB 3TFOA 4FYKA 2AGVA 4ZC1A 3UUFA 4EJMA 1K7SN 2P0EA 1I30A 3HNRA 5HSGA 5HF9A 3IKTA 1TOAA 5DNWA 1E6CA 2HLPA 4LNUA 3R0IA 1C14A 1G5HA 1OWMA 4E33A 1Z7WA 4RVFA 2C2KA 3A4IA 3WG9A 1E1MA 5B37A 1CUAA 3FNGA 1J2TA 3I6QA 1COWD 1FBNA 1RJ9A 1JG2A 1VFNA 2VWPA 4N9WA 4IG9A 1B15A 1GITA 4Z6KA 4HAXA 2OEPA 2LXNA 2W90A 4NENA 1OZ0A 5F3DA 5L53A 3NQ41 4OY3A 4CQMD 1SWVA 3AJ8A 4O6VA 2PHZA 1X6VA 2WAOA 1QMPA 1VMEA 1NQAO 2A3NA 4M9SA 2QD2A 2QLLA 3K8QA 3NEJA 3DOHA 4MKXA 3S55A 3VR5D 4FR5A 3U4QB 4BV2A 1IMJA 2O8BA 1AKEA 4B74A 1RJ9B 4ITVA 4FB4A 2GBLA 1L7OA 3RPEA 3Q72A 4RGYA 1WXWA 1YB6A 5A3QA 1FTQA 2BSAA 2MDTA 4BUCA 3AUJB 2EYQA 3O3MB 4KBGA 1ULBA 4EABA 1OXKB 1P7YA 3PU6A 3LQRA 1JFLA 4L4SA 4NONA 1N2ZA 1OREA 4U63A 2CHQA 4CVNA 2NUAB 1N7HA 4CHGA 4O2BB 1NVMB 3FD8A 4ZQGA 3V4OA 2FPUA 5FI0B 4AU1A 1V6SA 1G8KA 1I0ZA 1LA2A 1VLZA 3OX3A 4Q1EA 5LUBA 4E51A 1RKUA 1PSZA 4PS0A 3VR3A 5C5DA 4DUYB 2WWXA 3WAKA 4TLLB 4G2NA 4CEHA 4OXQA 5LBUA 4CR8A 3C4JA 5KQRA 3IOMA 2XUJA 4Z4CA 1ZSYA 2XUPA 3ML1A 4FN4A 4BE9A 3U4CA 2AI3A 2UYOA 4BE4A 5AVVA 2BSQA 2YJZA 4M1KA 4PLZA 3IBGA 2Q45A 5CLFA 5LFAA 2P79A 2BBOA 2RGWA 2I7CA 2OZLB 5G40A 3OWXA 3PC6A 5K8LA 4ID9A 2XCSB 4UW9A 2BM0A 3PIIA 1T9GR 3OPMA 1MOSA 1ZRMA 4J7AA 3RU9A 2YDYA 3LUPA 3V3TA 1PE0A 1HNNA 4CL8A 1TLFA 4GNRA 5EHXA 4KGXA 4JLMA 3DXYA 2W2XA 4BJ5A 4UE3S 3DXFA 4PSCA 3IQFA 4HZIA 4MPDA 4JH0A 1BROA 4N40A 3UUEA 4DT1A 1EFUA 2JGMA 2BGKA 3ON5A 4C2UA 1Q84A 1WZCA 1BZYA 3TAHA 4CKEB 4M0EA 3AR4A 5GIOE 2XDQA 1W88A 3T9DA 3C5CA 1Y3DE 3NTOA 1L5MA 3QEJA 4OGWA 3ACDA 3OZCA 4MGKR 4DFDA 5CBKA 3D81A 4TLBA 3WO1A 2R11A 2WLTA 4LE1A 3L0YA 2WIAA 3QU9A 4TQUS 4E2XA 1KO5A 2UV8A 1Z8HA 1XTPA 3JQGB 3WE7A 1FNDA 3SJUA 3TLKA 4BVHA 5LNK1 4FCVA 3PWTA 4KI0A 5BR4A 1NI3A 3RSOA 1H23A 1P7ZA 3QF4B 1H3NA 2BKVA 4F96A 1RVV1 3D7MA 4GC9A 2IYYA 5THXA 4AN1A 4UHDA 4RIFA 3SJZA 3LXRA 4KXQA 5E1BA 3SOZA 4B4KA 2CN1A 2RAPA 1DMSA 4TLDA 2HK9A 3C3DA 3P5BA 4MQLA 4QUJA 1ZSVA 3ER9A 4X71A 1WKCA 3F5MA 4IP0A 2G08A 1RC1A 2JW5A 4ITRC 2L82A 4WKBA 3TEMA 5BXYA 5AMXA 3D0QA 3ISVA 2B0CA 1U90A 1PT6A 2QGFA 4YTEA 3IPXA 4NBTA 3U16A 4RUKA 5KQMA 1O58A 1C7IA 3BQNB 5DOVA 2MJLA 2K2QB 4WCFC 4RTKA 3ONNA 3ZHUA 2BI4A 4NS4A 2WDZA 1TJ4A 1MQAA 1SKAA 3C3JA 4Q3CA 1VE6A 5DM0A 3HYTA 3W4KA 5I7OA 5K8VA 3KZKA 1JZQA 5AM4A 1Z73A 3MS4A 1L5QA 3W90A 3WMXA 1UIMA 1XB2A 1HEUA 3ORYA 3L6RA 5B1IA 2EARA 2NVUA 4AWAA 5HBGA 5DKFA 5LU9A 4X7PA 1YR8A 1MX9A 1OXBB 2Z4RA 1KY2A 1EGMB 5F7XA 1XEXA 2ASVA 2QE6A 3IEPA 1QFXA 5KMGA 4LWZA 1HYEA 3LE8A 4HUTA 1KFBB 3B1VA 1YBVA 2ZWPA 4NCJA 4L07A 5FL7D 3IDSA 3B82A 3F2VA 4P22A 5DNAA 3WGZA 4CQMA 2AG0A 3CPEA 3HDHA 5IEJA 5CAEA 1FB5A 3FIJA 2A8YA 1O9HA 1OFTA 2QW0X 4ZVQA 3K5HA 3GRUA 1XMSA 2GFIA 3MHTA 1KBQA 2Q2QA 1H69A 2ZPAA 4Q9IA 4RTLA 1KIAA 4GKVA 3QIVA 1DEKA 4Q3KA 4UXJA 1IHYA 4Y0VA 2E82A 2D8MA 3P2IA 2IUFA 1E0JA 3O8BA 3M8KA 2YWHA 2CVQA 2HK8A 3PZRA 4L0DA 5GM2A 4MPJA 1P9LA 2D1RA 2UAGA 2NNLD 3AW8A 5EE0A 2VR1A 1IJKA 2AVNA 2I8LA 3TXAA 2JI8A 3WGIA 5BQOA 2OV4A 2FU5C 1U16A 3DZGA 4C9BA 2YYYA 4U02A 1RPNA 4UFPA 2RGYA 3T5CA 2HQRA 1DKRA 3PS9A 3L01A 4UM9D 1BHQ1 2D5CA 4OIMA 1VKOA 4Q4AA 4W5TA 3B85A 1EQUA 2EKDA 4DCPA 3S1LA 4QUGA 4QTYA 1QFYA 2WZQA 3CYFA 1WWKA 2WUWE 1K6IA 1GZUA 4NF2A 2R62A 4RK5A 3V00A 1NIPA 1WP9A 5BN3A 1QNFA 1ZVKA 4UCXA 1YDGA 1VDKA 5IYZA 2AX3A 4ZVTA 3K4PA 4FDMA 3R41A 2BONA 1HOXA 4IRMA 3B1JA 3L18A 1YGPA 2HBZA 4ZCLA 1GGMA 1WXGA 4MVXA 5HDBB 3L0DA 3S1SA 3G0HA 3DEJA 2QM7A 4RW0A 4OKSA 4ADLA 1GYPA 4E5YA 1CF9A 1UBUS 2FH5B 3OX2A 2R6AA 2A1TR 1VA4A 2VP2A 5IASA 3ICPA 3K09C 1D4ZA 2E55A 5EP3A 1FX0B 2P9JA 3KQMA 4IO1A 1GGEA 2FE4A 2JZCA 3AGQA 4DLVA 1G2QA 1EHYA 4JB8A 5KO2A 3KJXA 4I3FA 2CF6A 4IHKA 4QKQA 1SKYB 4YFVA 5B4VA 1PL6A 2QL7A 3EZ6A 1O8BA 2OCGA 1NURA 4X63A 1V5GA 3TM4A 1ORIA 4F60A 3RRJA 5KSOA 1AUQA 1QR6A 2AZMA 1ZZGA 1CFJA 3ZU4A 3KX2A 3NWBA 4QOJA 4MNTA 1AQIA 2RHGB 3G0CA 4RKRA 2F3PA 4B34A 4IOJA 4TTVA 2VT6A 4YMHA 2VQ3A 3IAM6 3R9XA 1ORHA 3BICA 3S6JA 3JQFC 1XLWA 3O1LA 5EWLA 1QG0A 2HQOA 3EE6A 2FETA 4D8WA 3WL6A 2HUPA 1RADA 2JAPA 1IBRA 3DE4X 4N6GA 4TMVA 2BVNA 1V5FA 1HMPA 2JIMA 3AY3A 3RVPA 821PA 3A70A 2ZU6A 1QV7A 3TLAA 1IATA 3IX7A 4EG8A 2AJTA 3G3EA 3U39A 3O4RA 3FWNA 3OHMA 2JFQA 4KGDA 1TO6A 1OQAA 1TZJA 3EOBI 3DE5X 3LDHA 3VR4H 1YHYA 1SOMA 3W2IA 3Q7QA 1N2EA 4AMZA 3NWJA 3WGNA 2I91A 5BN5B 1M33A 5I47A 2C7OA 4W5JA 5EKTA 3K7EA 8ADHA 2RC6A 1QHGA 1G21B 1WZUA 4TUYB 2EBFX 3BRQA 1KQNA 3KKNA 4K9SA 3HU5A 1LB1B 4S24A 4YAGA 3OPXA 2IC5A 3OBIA 1OV4A 2VCHA 2OQRA 4MGZR 2DBZA 2NPFA 3GW8A 1FX1A 2B1IA 3C6XA 2VIIA 1NMSA 1VTKA 1XMIA 2VJLA 1JTFA 1S2NA 1XDDA 2H1CA 2J9RA 3L8MA 3LYAA 4AP9A 4ASUA 4D41A 2HUNA 2YFHA 3FB1A 4D82A 3SVZA 1YMQA 4NJEA 2XD4A 4PCUA 1EK0A 4DCUA 1K7YA 2H7YA 1VJTA 3AVXA 4YJ3A 4MQBA 2FGKA 4N1AA 1GPKA 5TIIA 2A9QA 1N57A 2ZAGA 3IXLA 3NDJA 4L2IB 2AG1A 2UYCA 4ZPXA 1JH9A 4H1TA 4RK4A 3P2EA 2X6QA 3K96A 5A4IS 3AONB 3IP7A 4PZYA 4Z3DA 5B58C 3B3FA