2PTRA

Crystal structure of escherichia coli adenylosuccinate lyase mutant h171a with bound adenylosuccinate substrate
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
459
structure length
454
Chain Sequence
b'MELSSLTAVSPVDGRYGDKVSALRGIFSEYGLLKFRVQVEVRWLQKLAAHAAIKEVPAFAADAIGYLDAIVASFSEEDAARIKTIERTTNHDVKAVEYFLKEKVAEIPELHAVSEFIHFACTSEDINNLSHALMLKTARDEVILPYWRQLIDGLKDLAVQYRDIPLLSRTAGQPATPSTIGKEMANVAYRMERQYRQLNQVEILGKINGAVGNYNAHIAAYPEVDWHQFSEEFVTSLGIQWNPYTTQIEPHDYIAELFDCVARFNTILIDFDRDVWGYIALNHFKQKTIAGEIGSSTMPHKVNPIDFENSEGNLGLSNAVLQHLASKLPVSRWQRDLTDSTVLRNLGVGIGYALIAYQSTLKGVSKLEVNRDHLLDELDHNWEVLAEPIQTVMRRYGIEKPYEKLKELVDAEGMKQFIDGLALPEEEKARLKAMTPANYIGRAITMVDELKHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylosuccinate lyase
publication title Substrate and Product Complexes of Escherichia coli Adenylosuccinate Lyase Provide New Insights into the Enzymatic Mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 176
structure length 454
sequence length 459
chains with identical sequence B
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF08328 ASL_C Adenylosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 2ptrA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 2ptrA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 2ptrA02
2O7BA 2YIIA 4FLCA 1FUPA 4C6GA 4HGVA 4V2QA 4BAAA 3RRPA 2PFMA 1Q5NA 4APAA 4EFCA 2X75A 1YFMA 2NYNA 3KDYA 2RJRA 3BHGA 4ADLA 2O7FA 4CQ5A 1XWOA 2HVGA 3C8TA 1K7WA 1GK3A 2NYFA 4V2RA 5HW2A 1B8FA 2E9FA 1KQ7A 4EEIA 1YISA 1T6PA 3OCFA 3KDZA 4BABA 5D6BA 4C5UA 1GKMA 3GZHA 4FFXA 3QBPA 1GK2A 3E04A 1I0AA 1TJVA 3NZ4A 1FURA 1HY0A 1TJ7A 2FUSA 1AUWA 4APBA 1C3CA 1DOFA 3UNVA 1JSWA 4ADMA 1RE5A 5EYTA 1J3UA 4C5SA 1U16A 1TJWA 5F92A 5EYVA 1FUOA 2O78A 1VDKA 2VD6A 2PTRA 2OHYA 2RJSA 3OCEA 1TJUA 3RD8A 2O6YA 2QVEA 1GKJA 4MX2A 1U15A 3TV2A 1EB4A 3NO9A 3R6YA 2J91A 3R6VA 2PTSA 3GTDA 1W27A 1HY1A 1K62A 1FUQA 1DCNA 4NSLA 3R6QA 3CZOA 2O7DA 4NLEA 1C3UA 5F91A 1Y2MA 1T6JA 2O7EA 4C5RA 1YFEA 2PTQA 2QGAB
chains in the Genus database with same CATH superfamily
2O7BA 2YIIA 4FLCA 1FUPA 4C6GA 4HGVA 4V2QA 1XLYA 2JAUA 4BAAA 2FELA 5M0JA 3RRPA 2PFMA 1Q5NA 4APAA 4EFCA 1XMCA 4NFLA 2X75A 1YFMA 3U19A 2NYNA 1T9HA 1Z4LA 3KDYA 2RJRA 2YV5A 3BHGA 1Z4QA 4IQJM 4ADLA 2O7FA 4CQ5A 1XWOA 2HVGA 3C8TA 1K7WA 1GK3A 2NYFA 4V2RA 2JARA 5HW2A 1B8FA 2E9FA 1XL8A 5H8WA 4L6AA 4YIHA 1U0LA 1KQ7A 4EEIA 1YISA 2VSFA 1T6PA 3OCFA 3F4SA 3KDZA 4BABA 5D6BA 4A15A 1Q92A 4C5UA 2VL7A 1GKMA 4L57A 2D27A 3F4RA 3GZHA 4FFXA 3QBPA 1GK2A 3CRVA 5M0IA 1Z4IA 3E04A 1I0AA 1TJVA 4YIKA 3NZ4A 1FURA 1HY0A 1TJ7A 2FUSA 4MWOA 1AUWA 1IW7D 4APBA 1C3CA 1DOFA 4MUMA 3UNVA 1JSWA 4ADMA 3BWVA 1RE5A 5EYTA 1J3UA 4C5SA 1U16A 1TJWA 5F92A 5EYVA 1FUOA 4L6CA 1VDKA 1Z4JA 2PTRA 2O78A 2VD6A 2RCNA 2I7DA 3U13A 4E88A 2OHYA 1Z4KA 2RJSA 3OCEA 1TJUA 3RD8A 1XL7A 2JAWA 2O6YA 2QVEA 1GKJA 4MX2A 1U15A 3F4TA 3TV2A 3NO9A 1EB4A 1XMDA 2D28C 3R6YA 2J91A 3R6VA 2PTSA 3GTDA 1W27A 1HY1A 1K62A 1FUQA 1DCNA 1Z4PX 1MH9A 4NSLA 3R6QA 3CZOA 2O7DA 2JAOA 1Z4MA 4NLEA 3CI0K 3CRW1 1C3UA 5F91A 1Y2MA 1T6JA 1Q91A 2O7EA 4C5RA 2FENA 1YFEA 2PTQA 4WNLA 2QGAB
chains in the Genus database with same CATH topology
2O7BA 2YIIA 4FLCA 1FUPA 4C6GA 4HGVA 4V2QA 4BAAA 3RRPA 2PFMA 1Q5NA 4APAA 4EFCA 2X75A 1YFMA 2NYNA 3KDYA 2RJRA 3BHGA 4ADLA 2O7FA 4CQ5A 1XWOA 2HVGA 3C8TA 1K7WA 1GK3A 2NYFA 4V2RA 5HW2A 1B8FA 2E9FA 1KQ7A 4EEIA 1YISA 1T6PA 3OCFA 3KDZA 4BABA 5D6BA 4C5UA 1GKMA 3GZHA 4FFXA 3QBPA 1GK2A 3E04A 1I0AA 1TJVA 3NZ4A 1FURA 1HY0A 1TJ7A 2FUSA 1AUWA 4APBA 1C3CA 1DOFA 3UNVA 1JSWA 4ADMA 1RE5A 5EYTA 1J3UA 4C5SA 1U16A 1TJWA 5F92A 5EYVA 1FUOA 2O78A 1VDKA 2VD6A 2PTRA 2OHYA 2RJSA 3OCEA 1TJUA 3RD8A 2O6YA 2QVEA 1GKJA 4MX2A 1U15A 3TV2A 1EB4A 3NO9A 3R6YA 2J91A 3R6VA 2PTSA 3GTDA 1W27A 1HY1A 1K62A 1FUQA 1DCNA 4NSLA 3R6QA 3CZOA 2O7DA 4NLEA 1C3UA 5F91A 1Y2MA 1T6JA 2O7EA 4C5RA 1YFEA 2PTQA 2QGAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O7B A;  2YII A;  4FLC A;  1FUP A;  4C6G A;  4HGV A;  4V2Q A;  4BAA A;  3RRP A;  2PFM A;  1Q5N A;  4APA A;  4EFC A;  2X75 A;  1YFM A;  2NYN A;  3KDY A;  2RJR A;  3BHG A;  4ADL A;  2O7F A;  4CQ5 A;  1XWO A;  2HVG A;  3C8T A;  1K7W A;  1GK3 A;  2NYF A;  4V2R A;  5HW2 A;  1B8F A;  2E9F A;  1KQ7 A;  4EEI A;  1YIS A;  1T6P A;  3OCF A;  3KDZ A;  4BAB A;  5D6B A;  4C5U A;  1GKM A;  3GZH A;  4FFX A;  3QBP A;  1GK2 A;  3E04 A;  1I0A A;  1TJV A;  3NZ4 A;  1FUR A;  1HY0 A;  1TJ7 A;  2FUS A;  1AUW A;  4APB A;  1C3C A;  1DOF A;  3UNV A;  1JSW A;  4ADM A;  1RE5 A;  5EYT A;  1J3U A;  4C5S A;  1U16 A;  1TJW A;  5F92 A;  5EYV A;  1FUO A;  2O78 A;  1VDK A;  2VD6 A;  2PTR A;  2OHY A;  2RJS A;  3OCE A;  1TJU A;  3RD8 A;  2O6Y A;  2QVE A;  1GKJ A;  4MX2 A;  1U15 A;  3TV2 A;  1EB4 A;  3NO9 A;  3R6Y A;  2J91 A;  3R6V A;  2PTS A;  3GTD A;  1W27 A;  1HY1 A;  1K62 A;  1FUQ A;  1DCN A;  4NSL A;  3R6Q A;  3CZO A;  2O7D A;  4NLE A;  1C3U A;  5F91 A;  1Y2M A;  1T6J A;  2O7E A;  4C5R A;  1YFE A;  2PTQ A;  2QGA B; 
#chains in the Genus database with same CATH topology
 2O7B A;  2YII A;  4FLC A;  1FUP A;  4C6G A;  4HGV A;  4V2Q A;  1XLY A;  2JAU A;  4BAA A;  2FEL A;  5M0J A;  3RRP A;  2PFM A;  1Q5N A;  4APA A;  4EFC A;  1XMC A;  4NFL A;  2X75 A;  1YFM A;  3U19 A;  2NYN A;  1T9H A;  1Z4L A;  3KDY A;  2RJR A;  2YV5 A;  3BHG A;  1Z4Q A;  4IQJ M;  4ADL A;  2O7F A;  4CQ5 A;  1XWO A;  2HVG A;  3C8T A;  1K7W A;  1GK3 A;  2NYF A;  4V2R A;  2JAR A;  5HW2 A;  1B8F A;  2E9F A;  1XL8 A;  5H8W A;  4L6A A;  4YIH A;  1U0L A;  1KQ7 A;  4EEI A;  1YIS A;  2VSF A;  1T6P A;  3OCF A;  3F4S A;  3KDZ A;  4BAB A;  5D6B A;  4A15 A;  1Q92 A;  4C5U A;  2VL7 A;  1GKM A;  4L57 A;  2D27 A;  3F4R A;  3GZH A;  4FFX A;  3QBP A;  1GK2 A;  3CRV A;  5M0I A;  1Z4I A;  3E04 A;  1I0A A;  1TJV A;  4YIK A;  3NZ4 A;  1FUR A;  1HY0 A;  1TJ7 A;  2FUS A;  4MWO A;  1AUW A;  1IW7 D;  4APB A;  1C3C A;  1DOF A;  4MUM A;  3UNV A;  1JSW A;  4ADM A;  3BWV A;  1RE5 A;  5EYT A;  1J3U A;  4C5S A;  1U16 A;  1TJW A;  5F92 A;  5EYV A;  1FUO A;  4L6C A;  1VDK A;  1Z4J A;  2PTR A;  2O78 A;  2VD6 A;  2RCN A;  2I7D A;  3U13 A;  4E88 A;  2OHY A;  1Z4K A;  2RJS A;  3OCE A;  1TJU A;  3RD8 A;  1XL7 A;  2JAW A;  2O6Y A;  2QVE A;  1GKJ A;  4MX2 A;  1U15 A;  3F4T A;  3TV2 A;  3NO9 A;  1EB4 A;  1XMD A;  2D28 C;  3R6Y A;  2J91 A;  3R6V A;  2PTS A;  3GTD A;  1W27 A;  1HY1 A;  1K62 A;  1FUQ A;  1DCN A;  1Z4P X;  1MH9 A;  4NSL A;  3R6Q A;  3CZO A;  2O7D A;  2JAO A;  1Z4M A;  4NLE A;  3CI0 K;  3CRW 1;  1C3U A;  5F91 A;  1Y2M A;  1T6J A;  1Q91 A;  2O7E A;  4C5R A;  2FEN A;  1YFE A;  2PTQ A;  4WNL A;  2QGA B; 
#chains in the Genus database with same CATH homology
 2O7B A;  2YII A;  4FLC A;  1FUP A;  4C6G A;  4HGV A;  4V2Q A;  4BAA A;  3RRP A;  2PFM A;  1Q5N A;  4APA A;  4EFC A;  2X75 A;  1YFM A;  2NYN A;  3KDY A;  2RJR A;  3BHG A;  4ADL A;  2O7F A;  4CQ5 A;  1XWO A;  2HVG A;  3C8T A;  1K7W A;  1GK3 A;  2NYF A;  4V2R A;  5HW2 A;  1B8F A;  2E9F A;  1KQ7 A;  4EEI A;  1YIS A;  1T6P A;  3OCF A;  3KDZ A;  4BAB A;  5D6B A;  4C5U A;  1GKM A;  3GZH A;  4FFX A;  3QBP A;  1GK2 A;  3E04 A;  1I0A A;  1TJV A;  3NZ4 A;  1FUR A;  1HY0 A;  1TJ7 A;  2FUS A;  1AUW A;  4APB A;  1C3C A;  1DOF A;  3UNV A;  1JSW A;  4ADM A;  1RE5 A;  5EYT A;  1J3U A;  4C5S A;  1U16 A;  1TJW A;  5F92 A;  5EYV A;  1FUO A;  2O78 A;  1VDK A;  2VD6 A;  2PTR A;  2OHY A;  2RJS A;  3OCE A;  1TJU A;  3RD8 A;  2O6Y A;  2QVE A;  1GKJ A;  4MX2 A;  1U15 A;  3TV2 A;  1EB4 A;  3NO9 A;  3R6Y A;  2J91 A;  3R6V A;  2PTS A;  3GTD A;  1W27 A;  1HY1 A;  1K62 A;  1FUQ A;  1DCN A;  4NSL A;  3R6Q A;  3CZO A;  2O7D A;  4NLE A;  1C3U A;  5F91 A;  1Y2M A;  1T6J A;  2O7E A;  4C5R A;  1YFE A;  2PTQ A;  2QGA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...