2PTRA

Crystal structure of escherichia coli adenylosuccinate lyase mutant h171a with bound adenylosuccinate substrate
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
459
structure length
454
Chain Sequence
MELSSLTAVSPVDGRYGDKVSALRGIFSEYGLLKFRVQVEVRWLQKLAAHAAIKEVPAFAADAIGYLDAIVASFSEEDAARIKTIERTTNHDVKAVEYFLKEKVAEIPELHAVSEFIHFACTSEDINNLSHALMLKTARDEVILPYWRQLIDGLKDLAVQYRDIPLLSRTAGQPATPSTIGKEMANVAYRMERQYRQLNQVEILGKINGAVGNYNAHIAAYPEVDWHQFSEEFVTSLGIQWNPYTTQIEPHDYIAELFDCVARFNTILIDFDRDVWGYIALNHFKQKTIAGEIGSSTMPHKVNPIDFENSEGNLGLSNAVLQHLASKLPVSRWQRDLTDSTVLRNLGVGIGYALIAYQSTLKGVSKLEVNRDHLLDELDHNWEVLAEPIQTVMRRYGIEKPYEKLKELVDAEGMKQFIDGLALPEEEKARLKAMTPANYIGRAITMVDELKHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylosuccinate lyase
publication title Substrate and Product Complexes of Escherichia coli Adenylosuccinate Lyase Provide New Insights into the Enzymatic Mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 176
structure length 454
sequence length 459
chains with identical sequence B
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF08328 ASL_C Adenylosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 2ptrA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 2ptrA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 2ptrA02
3NO9A 2FUSA 4V2RA 1TJWA 3GTDA 5EYVA 2HVGA 4HGVA 1FURA 2E9FA 4NSLA 1K7WA 1TJ7A 3BHGA 4APBA 3OCFA 4CQ5A 3OCEA 1HY1A 2PFMA 1FUQA 3CZOA 4C6GA 5F92A 5D6BA 2NYNA 3R6QA 1U16A 4EEIA 1C3UA 1EB4A 3KDYA 3R6YA 1JSWA 5HW2A 4ADLA 1W27A 4BAAA 1T6JA 2O7EA 2NYFA 2QGAB 2PTRA 2O6YA 5F91A 3KDZA 1U15A 1GK3A 1Y2MA 2RJSA 1FUPA 1J3UA 1DOFA 4V2QA 4NLEA 2RJRA 3C8TA 2VD6A 1TJVA 2QVEA 1VDKA 3R6VA 3RRPA 2X75A 2OHYA 3UNVA 1GKMA 1XWOA 2J91A 4MX2A 3RD8A 2O7BA 2O7DA 4BABA 4APAA 3GZHA 1FUOA 1DCNA 1K62A 1Q5NA 1T6PA 5EYTA 1GKJA 4FLCA 3E04A 3NZ4A 3TV2A 2PTSA 4FFXA 1YISA 4EFCA 1C3CA 4C5UA 1YFEA 2YIIA 1RE5A 1GK2A 3QBPA 1TJUA 2PTQA 1YFMA 1I0AA 2O7FA 1HY0A 1AUWA 1B8FA 2O78A 1KQ7A 4C5RA 4ADMA 4C5SA
chains in the Genus database with same CATH superfamily
3NO9A 2FUSA 4V2RA 1Q92A 1TJWA 2D27A 3CRVA 3GTDA 4YIHA 5EYVA 2HVGA 4HGVA 1FURA 2E9FA 4NSLA 1K7WA 3CRW1 1TJ7A 5M0IA 3BHGA 4APBA 3F4RA 3OCFA 4CQ5A 3OCEA 2JAUA 3F4SA 1HY1A 2FELA 2PFMA 1FUQA 1U0LA 3CZOA 4C6GA 5F92A 5D6BA 2JAOA 2NYNA 1Q91A 1Z4KA 3R6QA 4L6CA 1U16A 4EEIA 1C3UA 1EB4A 1XL8A 2JAWA 3KDYA 3R6YA 1Z4IA 1IW7D 1JSWA 5HW2A 4ADLA 1W27A 1Z4QA 4BAAA 4L57A 1T6JA 2O7EA 2NYFA 1Z4MA 2QGAB 2PTRA 2O6YA 5F91A 4YIKA 1XL7A 3KDZA 1U15A 1GK3A 3F4TA 1Y2MA 2RJSA 1FUPA 1J3UA 4MWOA 1Z4LA 1DOFA 4V2QA 4NLEA 2RJRA 3C8TA 2VD6A 1TJVA 2QVEA 4L6AA 1VDKA 3R6VA 3RRPA 3BWVA 2X75A 2OHYA 3UNVA 1Z4JA 1GKMA 4E88A 1XWOA 2J91A 4MX2A 3RD8A 2O7BA 2O7DA 2FENA 4BABA 4APAA 2D28C 5H8WA 3GZHA 1FUOA 1Z4PX 1DCNA 1K62A 1Q5NA 1T6PA 5EYTA 1GKJA 4MUMA 4FLCA 3E04A 2I7DA 4IQJM 3NZ4A 3TV2A 2PTSA 4FFXA 1YISA 4EFCA 1C3CA 4C5UA 2JARA 1YFEA 2YIIA 1RE5A 1MH9A 2RCNA 3QBPA 1GK2A 2VSFA 1TJUA 2PTQA 1XLYA 1YFMA 1I0AA 3U13A 1T9HA 1XMCA 2O7FA 1HY0A 5M0JA 1AUWA 3U19A 2VL7A 2YV5A 1B8FA 4WNLA 2O78A 1KQ7A 3CI0K 4C5RA 1XMDA 4ADMA 4C5SA 4NFLA 4A15A
chains in the Genus database with same CATH topology
3NO9A 2FUSA 4V2RA 1TJWA 3GTDA 5EYVA 2HVGA 4HGVA 1FURA 2E9FA 4NSLA 1K7WA 1TJ7A 3BHGA 4APBA 3OCFA 4CQ5A 3OCEA 1HY1A 2PFMA 1FUQA 3CZOA 4C6GA 5F92A 5D6BA 2NYNA 3R6QA 1U16A 4EEIA 1C3UA 1EB4A 3KDYA 3R6YA 1JSWA 5HW2A 4ADLA 1W27A 4BAAA 1T6JA 2O7EA 2NYFA 2QGAB 2PTRA 2O6YA 5F91A 3KDZA 1U15A 1GK3A 1Y2MA 2RJSA 1FUPA 1J3UA 1DOFA 4V2QA 4NLEA 2RJRA 3C8TA 2VD6A 1TJVA 2QVEA 1VDKA 3R6VA 3RRPA 2X75A 2OHYA 3UNVA 1GKMA 1XWOA 2J91A 4MX2A 3RD8A 2O7BA 2O7DA 4BABA 4APAA 3GZHA 1FUOA 1DCNA 1K62A 1Q5NA 1T6PA 5EYTA 1GKJA 4FLCA 3E04A 3NZ4A 3TV2A 2PTSA 4FFXA 1YISA 4EFCA 1C3CA 4C5UA 1YFEA 2YIIA 1RE5A 1GK2A 3QBPA 1TJUA 2PTQA 1YFMA 1I0AA 2O7FA 1HY0A 1AUWA 1B8FA 2O78A 1KQ7A 4C5RA 4ADMA 4C5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NO9 A;  2FUS A;  4V2R A;  1TJW A;  3GTD A;  5EYV A;  2HVG A;  4HGV A;  1FUR A;  2E9F A;  4NSL A;  1K7W A;  1TJ7 A;  3BHG A;  4APB A;  3OCF A;  4CQ5 A;  3OCE A;  1HY1 A;  2PFM A;  1FUQ A;  3CZO A;  4C6G A;  5F92 A;  5D6B A;  2NYN A;  3R6Q A;  1U16 A;  4EEI A;  1C3U A;  1EB4 A;  3KDY A;  3R6Y A;  1JSW A;  5HW2 A;  4ADL A;  1W27 A;  4BAA A;  1T6J A;  2O7E A;  2NYF A;  2QGA B;  2PTR A;  2O6Y A;  5F91 A;  3KDZ A;  1U15 A;  1GK3 A;  1Y2M A;  2RJS A;  1FUP A;  1J3U A;  1DOF A;  4V2Q A;  4NLE A;  2RJR A;  3C8T A;  2VD6 A;  1TJV A;  2QVE A;  1VDK A;  3R6V A;  3RRP A;  2X75 A;  2OHY A;  3UNV A;  1GKM A;  1XWO A;  2J91 A;  4MX2 A;  3RD8 A;  2O7B A;  2O7D A;  4BAB A;  4APA A;  3GZH A;  1FUO A;  1DCN A;  1K62 A;  1Q5N A;  1T6P A;  5EYT A;  1GKJ A;  4FLC A;  3E04 A;  3NZ4 A;  3TV2 A;  2PTS A;  4FFX A;  1YIS A;  4EFC A;  1C3C A;  4C5U A;  1YFE A;  2YII A;  1RE5 A;  1GK2 A;  3QBP A;  1TJU A;  2PTQ A;  1YFM A;  1I0A A;  2O7F A;  1HY0 A;  1AUW A;  1B8F A;  2O78 A;  1KQ7 A;  4C5R A;  4ADM A;  4C5S A; 
#chains in the Genus database with same CATH topology
 3NO9 A;  2FUS A;  4V2R A;  1Q92 A;  1TJW A;  2D27 A;  3CRV A;  3GTD A;  4YIH A;  5EYV A;  2HVG A;  4HGV A;  1FUR A;  2E9F A;  4NSL A;  1K7W A;  3CRW 1;  1TJ7 A;  5M0I A;  3BHG A;  4APB A;  3F4R A;  3OCF A;  4CQ5 A;  3OCE A;  2JAU A;  3F4S A;  1HY1 A;  2FEL A;  2PFM A;  1FUQ A;  1U0L A;  3CZO A;  4C6G A;  5F92 A;  5D6B A;  2JAO A;  2NYN A;  1Q91 A;  1Z4K A;  3R6Q A;  4L6C A;  1U16 A;  4EEI A;  1C3U A;  1EB4 A;  1XL8 A;  2JAW A;  3KDY A;  3R6Y A;  1Z4I A;  1IW7 D;  1JSW A;  5HW2 A;  4ADL A;  1W27 A;  1Z4Q A;  4BAA A;  4L57 A;  1T6J A;  2O7E A;  2NYF A;  1Z4M A;  2QGA B;  2PTR A;  2O6Y A;  5F91 A;  4YIK A;  1XL7 A;  3KDZ A;  1U15 A;  1GK3 A;  3F4T A;  1Y2M A;  2RJS A;  1FUP A;  1J3U A;  4MWO A;  1Z4L A;  1DOF A;  4V2Q A;  4NLE A;  2RJR A;  3C8T A;  2VD6 A;  1TJV A;  2QVE A;  4L6A A;  1VDK A;  3R6V A;  3RRP A;  3BWV A;  2X75 A;  2OHY A;  3UNV A;  1Z4J A;  1GKM A;  4E88 A;  1XWO A;  2J91 A;  4MX2 A;  3RD8 A;  2O7B A;  2O7D A;  2FEN A;  4BAB A;  4APA A;  2D28 C;  5H8W A;  3GZH A;  1FUO A;  1Z4P X;  1DCN A;  1K62 A;  1Q5N A;  1T6P A;  5EYT A;  1GKJ A;  4MUM A;  4FLC A;  3E04 A;  2I7D A;  4IQJ M;  3NZ4 A;  3TV2 A;  2PTS A;  4FFX A;  1YIS A;  4EFC A;  1C3C A;  4C5U A;  2JAR A;  1YFE A;  2YII A;  1RE5 A;  1MH9 A;  2RCN A;  3QBP A;  1GK2 A;  2VSF A;  1TJU A;  2PTQ A;  1XLY A;  1YFM A;  1I0A A;  3U13 A;  1T9H A;  1XMC A;  2O7F A;  1HY0 A;  5M0J A;  1AUW A;  3U19 A;  2VL7 A;  2YV5 A;  1B8F A;  4WNL A;  2O78 A;  1KQ7 A;  3CI0 K;  4C5R A;  1XMD A;  4ADM A;  4C5S A;  4NFL A;  4A15 A; 
#chains in the Genus database with same CATH homology
 3NO9 A;  2FUS A;  4V2R A;  1TJW A;  3GTD A;  5EYV A;  2HVG A;  4HGV A;  1FUR A;  2E9F A;  4NSL A;  1K7W A;  1TJ7 A;  3BHG A;  4APB A;  3OCF A;  4CQ5 A;  3OCE A;  1HY1 A;  2PFM A;  1FUQ A;  3CZO A;  4C6G A;  5F92 A;  5D6B A;  2NYN A;  3R6Q A;  1U16 A;  4EEI A;  1C3U A;  1EB4 A;  3KDY A;  3R6Y A;  1JSW A;  5HW2 A;  4ADL A;  1W27 A;  4BAA A;  1T6J A;  2O7E A;  2NYF A;  2QGA B;  2PTR A;  2O6Y A;  5F91 A;  3KDZ A;  1U15 A;  1GK3 A;  1Y2M A;  2RJS A;  1FUP A;  1J3U A;  1DOF A;  4V2Q A;  4NLE A;  2RJR A;  3C8T A;  2VD6 A;  1TJV A;  2QVE A;  1VDK A;  3R6V A;  3RRP A;  2X75 A;  2OHY A;  3UNV A;  1GKM A;  1XWO A;  2J91 A;  4MX2 A;  3RD8 A;  2O7B A;  2O7D A;  4BAB A;  4APA A;  3GZH A;  1FUO A;  1DCN A;  1K62 A;  1Q5N A;  1T6P A;  5EYT A;  1GKJ A;  4FLC A;  3E04 A;  3NZ4 A;  3TV2 A;  2PTS A;  4FFX A;  1YIS A;  4EFC A;  1C3C A;  4C5U A;  1YFE A;  2YII A;  1RE5 A;  1GK2 A;  3QBP A;  1TJU A;  2PTQ A;  1YFM A;  1I0A A;  2O7F A;  1HY0 A;  1AUW A;  1B8F A;  2O78 A;  1KQ7 A;  4C5R A;  4ADM A;  4C5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...