2PTRA

Crystal structure of escherichia coli adenylosuccinate lyase mutant h171a with bound adenylosuccinate substrate
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
459
structure length
454
Chain Sequence
MELSSLTAVSPVDGRYGDKVSALRGIFSEYGLLKFRVQVEVRWLQKLAAHAAIKEVPAFAADAIGYLDAIVASFSEEDAARIKTIERTTNHDVKAVEYFLKEKVAEIPELHAVSEFIHFACTSEDINNLSHALMLKTARDEVILPYWRQLIDGLKDLAVQYRDIPLLSRTAGQPATPSTIGKEMANVAYRMERQYRQLNQVEILGKINGAVGNYNAHIAAYPEVDWHQFSEEFVTSLGIQWNPYTTQIEPHDYIAELFDCVARFNTILIDFDRDVWGYIALNHFKQKTIAGEIGSSTMPHKVNPIDFENSEGNLGLSNAVLQHLASKLPVSRWQRDLTDSTVLRNLGVGIGYALIAYQSTLKGVSKLEVNRDHLLDELDHNWEVLAEPIQTVMRRYGIEKPYEKLKELVDAEGMKQFIDGLALPEEEKARLKAMTPANYIGRAITMVDELKHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Adenylosuccinate lyase
publication title Substrate and Product Complexes of Escherichia coli Adenylosuccinate Lyase Provide New Insights into the Enzymatic Mechanism.
pubmed doi rcsb
source organism Escherichia coli
total genus 176
structure length 454
sequence length 459
chains with identical sequence B
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF08328 ASL_C Adenylosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 2ptrA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 2ptrA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 2ptrA02
2YIIA 1K7WA 3KDYA 4C6GA 3R6QA 5EYTA 4MX2A 1VDKA 4APAA 4C5SA 4V2QA 1DCNA 4ADMA 3NO9A 3RRPA 4CQ5A 4ADLA 4C5UA 3C8TA 2E9FA 1FUQA 2OHYA 2NYFA 1J3UA 3CZOA 2O6YA 1C3CA 1TJ7A 2PTSA 1W27A 1T6PA 1TJWA 4EFCA 1GKJA 1AUWA 1I0AA 2X75A 3OCFA 5HW2A 1XWOA 1YFEA 1T6JA 4BAAA 2NYNA 2FUSA 5F91A 4APBA 1U15A 1C3UA 1DOFA 2O7BA 3TV2A 2HVGA 1JSWA 2PTQA 4NSLA 1YFMA 3GZHA 1FUOA 1Q5NA 3R6YA 2PFMA 1YISA 2J91A 5D6BA 4BABA 1GK2A 5EYVA 1HY1A 4V2RA 4FFXA 1FURA 2RJSA 3GTDA 4C5RA 3R6VA 1FUPA 3NZ4A 3E04A 1RE5A 3BHGA 1GK3A 1GKMA 2O78A 1TJVA 4EEIA 2VD6A 1K62A 3UNVA 2QGAB 1U16A 3QBPA 5F92A 3OCEA 1KQ7A 2O7EA 2RJRA 1B8FA 1Y2MA 2QVEA 3KDZA 1TJUA 2O7DA 4FLCA 3RD8A 1EB4A 4HGVA 2O7FA 2PTRA 1HY0A 4NLEA
chains in the Genus database with same CATH superfamily
1Z4PX 3CRVA 5M0IA 4A15A 4L57A 3CI0K 2YIIA 1K7WA 3KDYA 4C6GA 3R6QA 5EYTA 3F4SA 4MX2A 1VDKA 5H8WA 4WNLA 4L6AA 4APAA 2FELA 4C5SA 2D28C 4V2QA 1DCNA 4ADMA 3NO9A 3RRPA 4CQ5A 4ADLA 4C5UA 3C8TA 2E9FA 1FUQA 2OHYA 2D27A 2NYFA 1J3UA 2JAUA 3CZOA 2O6YA 1C3CA 1TJ7A 2JAOA 2PTSA 1W27A 1T6PA 1TJWA 2I7DA 2JAWA 4YIKA 4EFCA 5M0JA 1GKJA 4MWOA 1AUWA 1MH9A 1Z4QA 1I0AA 2X75A 3F4RA 3OCFA 2VL7A 5HW2A 1XWOA 1XLYA 1XMDA 3BWVA 1YFEA 2FENA 1T6JA 1Z4KA 4BAAA 2NYNA 2FUSA 1U0LA 5F91A 4APBA 1U15A 1Z4IA 1C3UA 1DOFA 2O7BA 3TV2A 2HVGA 1JSWA 4E88A 2PTQA 3U19A 4NSLA 1Q92A 1YFMA 3GZHA 1FUOA 1Q5NA 3R6YA 2PFMA 1YISA 2J91A 5D6BA 4BABA 1GK2A 1XL7A 5EYVA 1HY1A 1Q91A 4IQJM 4V2RA 4FFXA 1XL8A 4YIHA 1FURA 2RJSA 3GTDA 4C5RA 3R6VA 1Z4MA 1FUPA 3NZ4A 3E04A 1RE5A 1XMCA 2RCNA 3BHGA 1GK3A 1GKMA 1T9HA 1IW7D 3U13A 2O78A 1TJVA 4EEIA 2VSFA 2VD6A 1K62A 3UNVA 1Z4JA 2QGAB 3F4TA 1U16A 3QBPA 4NFLA 5F92A 3OCEA 1KQ7A 2O7EA 2RJRA 1B8FA 1Y2MA 4MUMA 1Z4LA 2QVEA 3KDZA 1TJUA 2O7DA 4FLCA 3RD8A 4L6CA 1EB4A 2YV5A 4HGVA 2O7FA 3CRW1 2JARA 2PTRA 1HY0A 4NLEA
chains in the Genus database with same CATH topology
2YIIA 1K7WA 3KDYA 4C6GA 3R6QA 5EYTA 4MX2A 1VDKA 4APAA 4C5SA 4V2QA 1DCNA 4ADMA 3NO9A 3RRPA 4CQ5A 4ADLA 4C5UA 3C8TA 2E9FA 1FUQA 2OHYA 2NYFA 1J3UA 3CZOA 2O6YA 1C3CA 1TJ7A 2PTSA 1W27A 1T6PA 1TJWA 4EFCA 1GKJA 1AUWA 1I0AA 2X75A 3OCFA 5HW2A 1XWOA 1YFEA 1T6JA 4BAAA 2NYNA 2FUSA 5F91A 4APBA 1U15A 1C3UA 1DOFA 2O7BA 3TV2A 2HVGA 1JSWA 2PTQA 4NSLA 1YFMA 3GZHA 1FUOA 1Q5NA 3R6YA 2PFMA 1YISA 2J91A 5D6BA 4BABA 1GK2A 5EYVA 1HY1A 4V2RA 4FFXA 1FURA 2RJSA 3GTDA 4C5RA 3R6VA 1FUPA 3NZ4A 3E04A 1RE5A 3BHGA 1GK3A 1GKMA 2O78A 1TJVA 4EEIA 2VD6A 1K62A 3UNVA 2QGAB 1U16A 3QBPA 5F92A 3OCEA 1KQ7A 2O7EA 2RJRA 1B8FA 1Y2MA 2QVEA 3KDZA 1TJUA 2O7DA 4FLCA 3RD8A 1EB4A 4HGVA 2O7FA 2PTRA 1HY0A 4NLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YII A;  1K7W A;  3KDY A;  4C6G A;  3R6Q A;  5EYT A;  4MX2 A;  1VDK A;  4APA A;  4C5S A;  4V2Q A;  1DCN A;  4ADM A;  3NO9 A;  3RRP A;  4CQ5 A;  4ADL A;  4C5U A;  3C8T A;  2E9F A;  1FUQ A;  2OHY A;  2NYF A;  1J3U A;  3CZO A;  2O6Y A;  1C3C A;  1TJ7 A;  2PTS A;  1W27 A;  1T6P A;  1TJW A;  4EFC A;  1GKJ A;  1AUW A;  1I0A A;  2X75 A;  3OCF A;  5HW2 A;  1XWO A;  1YFE A;  1T6J A;  4BAA A;  2NYN A;  2FUS A;  5F91 A;  4APB A;  1U15 A;  1C3U A;  1DOF A;  2O7B A;  3TV2 A;  2HVG A;  1JSW A;  2PTQ A;  4NSL A;  1YFM A;  3GZH A;  1FUO A;  1Q5N A;  3R6Y A;  2PFM A;  1YIS A;  2J91 A;  5D6B A;  4BAB A;  1GK2 A;  5EYV A;  1HY1 A;  4V2R A;  4FFX A;  1FUR A;  2RJS A;  3GTD A;  4C5R A;  3R6V A;  1FUP A;  3NZ4 A;  3E04 A;  1RE5 A;  3BHG A;  1GK3 A;  1GKM A;  2O78 A;  1TJV A;  4EEI A;  2VD6 A;  1K62 A;  3UNV A;  2QGA B;  1U16 A;  3QBP A;  5F92 A;  3OCE A;  1KQ7 A;  2O7E A;  2RJR A;  1B8F A;  1Y2M A;  2QVE A;  3KDZ A;  1TJU A;  2O7D A;  4FLC A;  3RD8 A;  1EB4 A;  4HGV A;  2O7F A;  2PTR A;  1HY0 A;  4NLE A; 
#chains in the Genus database with same CATH topology
 1Z4P X;  3CRV A;  5M0I A;  4A15 A;  4L57 A;  3CI0 K;  2YII A;  1K7W A;  3KDY A;  4C6G A;  3R6Q A;  5EYT A;  3F4S A;  4MX2 A;  1VDK A;  5H8W A;  4WNL A;  4L6A A;  4APA A;  2FEL A;  4C5S A;  2D28 C;  4V2Q A;  1DCN A;  4ADM A;  3NO9 A;  3RRP A;  4CQ5 A;  4ADL A;  4C5U A;  3C8T A;  2E9F A;  1FUQ A;  2OHY A;  2D27 A;  2NYF A;  1J3U A;  2JAU A;  3CZO A;  2O6Y A;  1C3C A;  1TJ7 A;  2JAO A;  2PTS A;  1W27 A;  1T6P A;  1TJW A;  2I7D A;  2JAW A;  4YIK A;  4EFC A;  5M0J A;  1GKJ A;  4MWO A;  1AUW A;  1MH9 A;  1Z4Q A;  1I0A A;  2X75 A;  3F4R A;  3OCF A;  2VL7 A;  5HW2 A;  1XWO A;  1XLY A;  1XMD A;  3BWV A;  1YFE A;  2FEN A;  1T6J A;  1Z4K A;  4BAA A;  2NYN A;  2FUS A;  1U0L A;  5F91 A;  4APB A;  1U15 A;  1Z4I A;  1C3U A;  1DOF A;  2O7B A;  3TV2 A;  2HVG A;  1JSW A;  4E88 A;  2PTQ A;  3U19 A;  4NSL A;  1Q92 A;  1YFM A;  3GZH A;  1FUO A;  1Q5N A;  3R6Y A;  2PFM A;  1YIS A;  2J91 A;  5D6B A;  4BAB A;  1GK2 A;  1XL7 A;  5EYV A;  1HY1 A;  1Q91 A;  4IQJ M;  4V2R A;  4FFX A;  1XL8 A;  4YIH A;  1FUR A;  2RJS A;  3GTD A;  4C5R A;  3R6V A;  1Z4M A;  1FUP A;  3NZ4 A;  3E04 A;  1RE5 A;  1XMC A;  2RCN A;  3BHG A;  1GK3 A;  1GKM A;  1T9H A;  1IW7 D;  3U13 A;  2O78 A;  1TJV A;  4EEI A;  2VSF A;  2VD6 A;  1K62 A;  3UNV A;  1Z4J A;  2QGA B;  3F4T A;  1U16 A;  3QBP A;  4NFL A;  5F92 A;  3OCE A;  1KQ7 A;  2O7E A;  2RJR A;  1B8F A;  1Y2M A;  4MUM A;  1Z4L A;  2QVE A;  3KDZ A;  1TJU A;  2O7D A;  4FLC A;  3RD8 A;  4L6C A;  1EB4 A;  2YV5 A;  4HGV A;  2O7F A;  3CRW 1;  2JAR A;  2PTR A;  1HY0 A;  4NLE A; 
#chains in the Genus database with same CATH homology
 2YII A;  1K7W A;  3KDY A;  4C6G A;  3R6Q A;  5EYT A;  4MX2 A;  1VDK A;  4APA A;  4C5S A;  4V2Q A;  1DCN A;  4ADM A;  3NO9 A;  3RRP A;  4CQ5 A;  4ADL A;  4C5U A;  3C8T A;  2E9F A;  1FUQ A;  2OHY A;  2NYF A;  1J3U A;  3CZO A;  2O6Y A;  1C3C A;  1TJ7 A;  2PTS A;  1W27 A;  1T6P A;  1TJW A;  4EFC A;  1GKJ A;  1AUW A;  1I0A A;  2X75 A;  3OCF A;  5HW2 A;  1XWO A;  1YFE A;  1T6J A;  4BAA A;  2NYN A;  2FUS A;  5F91 A;  4APB A;  1U15 A;  1C3U A;  1DOF A;  2O7B A;  3TV2 A;  2HVG A;  1JSW A;  2PTQ A;  4NSL A;  1YFM A;  3GZH A;  1FUO A;  1Q5N A;  3R6Y A;  2PFM A;  1YIS A;  2J91 A;  5D6B A;  4BAB A;  1GK2 A;  5EYV A;  1HY1 A;  4V2R A;  4FFX A;  1FUR A;  2RJS A;  3GTD A;  4C5R A;  3R6V A;  1FUP A;  3NZ4 A;  3E04 A;  1RE5 A;  3BHG A;  1GK3 A;  1GKM A;  2O78 A;  1TJV A;  4EEI A;  2VD6 A;  1K62 A;  3UNV A;  2QGA B;  1U16 A;  3QBP A;  5F92 A;  3OCE A;  1KQ7 A;  2O7E A;  2RJR A;  1B8F A;  1Y2M A;  2QVE A;  3KDZ A;  1TJU A;  2O7D A;  4FLC A;  3RD8 A;  1EB4 A;  4HGV A;  2O7F A;  2PTR A;  1HY0 A;  4NLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...