1HY1A

Crystal structure of wild type duck delta 2 crystallin (eye lens protein)
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
448
structure length
448
Chain Sequence
TDPIMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLEKISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQLIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNPLDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFSTGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALTPEMLATDLALYLVRKGVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSISPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRELMKKQKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DELTA CRYSTALLIN II
publication title Structural studies of duck delta 1 and delta 2 crystallin suggest conformational changes occur during catalysis.
pubmed doi rcsb
source organism Anas platyrhynchos
molecule tags Lyase
total genus 181
structure length 448
sequence length 448
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.1: Argininosuccinate lyase.
pdb deposition date 2001-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF14698 ASL_C2 Argininosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 1hy1A03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 1hy1A01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 1hy1A02
4C5UA 2J91A 1DOFA 1FUPA 1YFMA 3CZOA 3NZ4A 1JSWA 1T6PA 3UNVA 2VD6A 1DCNA 2PTSA 1U16A 4V2QA 3GZHA 3QBPA 5HW2A 1FUOA 1RE5A 4CQ5A 1Q5NA 1GKMA 3NO9A 2O7EA 2QVEA 1GK3A 1VDKA 4HGVA 3OCEA 2NYNA 1I0AA 3E04A 3C8TA 1GK2A 1YISA 2O7FA 1TJWA 4ADLA 2E9FA 1FURA 4BAAA 2YIIA 4NSLA 1KQ7A 2FUSA 3OCFA 1Y2MA 2X75A 2OHYA 5F92A 1W27A 4APBA 1K7WA 3KDYA 4C5RA 1TJ7A 3TV2A 3R6QA 1T6JA 4BABA 3RRPA 3KDZA 3BHGA 2O7BA 1HY1A 3GTDA 1U15A 2O78A 2PFMA 4C5SA 1GKJA 1FUQA 3R6YA 1B8FA 2RJRA 1AUWA 2HVGA 1C3CA 4FFXA 4FLCA 1HY0A 2O6YA 1YFEA 5EYVA 4NLEA 3RD8A 5EYTA 1XWOA 4C6GA 4MX2A 4APAA 1EB4A 4ADMA 5F91A 4EEIA 2QGAB 2NYFA 1C3UA 1TJUA 1J3UA 5D6BA 2O7DA 1TJVA 1K62A 4V2RA 2PTRA 2PTQA 3R6VA 4EFCA 2RJSA
chains in the Genus database with same CATH superfamily
3CI0K 4C5UA 1Q91A 3U19A 1DOFA 2J91A 1FUPA 2VL7A 1YFMA 3CZOA 1Z4QA 1JSWA 1T6PA 3NZ4A 2VD6A 1DCNA 2PTSA 3UNVA 2FELA 3F4SA 4WNLA 4A15A 1U16A 4V2QA 3GZHA 3QBPA 5HW2A 1FUOA 1RE5A 3U13A 4CQ5A 1Q5NA 4YIHA 1GKMA 3NO9A 2O7EA 4IQJM 1MH9A 4L6AA 5H8WA 2QVEA 1GK3A 4L57A 1VDKA 4HGVA 3OCEA 2NYNA 1I0AA 3E04A 3C8TA 1GK2A 5M0IA 1YISA 2O7FA 1TJWA 4ADLA 3BWVA 4L6CA 2E9FA 1FURA 4BAAA 2FENA 2YIIA 4NSLA 1KQ7A 2FUSA 3OCFA 1Z4PX 1Y2MA 2X75A 2OHYA 1Z4IA 5F92A 1W27A 4APBA 1K7WA 3KDYA 4C5RA 2JAUA 4YIKA 1TJ7A 2D27A 3R6QA 3TV2A 1T6JA 1IW7D 4BABA 3RRPA 3KDZA 3BHGA 2O7BA 2JAWA 1HY1A 1XL8A 2JARA 3GTDA 1XLYA 1U15A 1U0LA 2O78A 2PFMA 4C5SA 1GKJA 1Z4KA 1FUQA 3R6YA 1Z4MA 1XL7A 3CRVA 1Z4JA 1B8FA 2RJRA 1AUWA 2HVGA 1C3CA 1XMDA 4MUMA 4NFLA 4FFXA 4FLCA 1HY0A 2O6YA 1YFEA 5EYVA 1Z4LA 4NLEA 3RD8A 5EYTA 2YV5A 1XWOA 4C6GA 5M0JA 4MX2A 2D28C 4APAA 1EB4A 3F4TA 4ADMA 5F91A 4EEIA 2QGAB 2I7DA 4MWOA 1C3UA 2NYFA 1TJUA 2RCNA 3CRW1 1J3UA 5D6BA 2VSFA 4E88A 2O7DA 1TJVA 1XMCA 1Q92A 1K62A 2JAOA 4V2RA 2PTRA 1T9HA 2PTQA 3F4RA 3R6VA 4EFCA 2RJSA
chains in the Genus database with same CATH topology
4C5UA 2J91A 1DOFA 1FUPA 1YFMA 3CZOA 3NZ4A 1JSWA 1T6PA 3UNVA 2VD6A 1DCNA 2PTSA 1U16A 4V2QA 3GZHA 3QBPA 5HW2A 1FUOA 1RE5A 4CQ5A 1Q5NA 1GKMA 3NO9A 2O7EA 2QVEA 1GK3A 1VDKA 4HGVA 3OCEA 2NYNA 1I0AA 3E04A 3C8TA 1GK2A 1YISA 2O7FA 1TJWA 4ADLA 2E9FA 1FURA 4BAAA 2YIIA 4NSLA 1KQ7A 2FUSA 3OCFA 1Y2MA 2X75A 2OHYA 5F92A 1W27A 4APBA 1K7WA 3KDYA 4C5RA 1TJ7A 3TV2A 3R6QA 1T6JA 4BABA 3RRPA 3KDZA 3BHGA 2O7BA 1HY1A 3GTDA 1U15A 2O78A 2PFMA 4C5SA 1GKJA 1FUQA 3R6YA 1B8FA 2RJRA 1AUWA 2HVGA 1C3CA 4FFXA 4FLCA 1HY0A 2O6YA 1YFEA 5EYVA 4NLEA 3RD8A 5EYTA 1XWOA 4C6GA 4MX2A 4APAA 1EB4A 4ADMA 5F91A 4EEIA 2QGAB 2NYFA 1C3UA 1TJUA 1J3UA 5D6BA 2O7DA 1TJVA 1K62A 4V2RA 2PTRA 2PTQA 3R6VA 4EFCA 2RJSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C5U A;  2J91 A;  1DOF A;  1FUP A;  1YFM A;  3CZO A;  3NZ4 A;  1JSW A;  1T6P A;  3UNV A;  2VD6 A;  1DCN A;  2PTS A;  1U16 A;  4V2Q A;  3GZH A;  3QBP A;  5HW2 A;  1FUO A;  1RE5 A;  4CQ5 A;  1Q5N A;  1GKM A;  3NO9 A;  2O7E A;  2QVE A;  1GK3 A;  1VDK A;  4HGV A;  3OCE A;  2NYN A;  1I0A A;  3E04 A;  3C8T A;  1GK2 A;  1YIS A;  2O7F A;  1TJW A;  4ADL A;  2E9F A;  1FUR A;  4BAA A;  2YII A;  4NSL A;  1KQ7 A;  2FUS A;  3OCF A;  1Y2M A;  2X75 A;  2OHY A;  5F92 A;  1W27 A;  4APB A;  1K7W A;  3KDY A;  4C5R A;  1TJ7 A;  3TV2 A;  3R6Q A;  1T6J A;  4BAB A;  3RRP A;  3KDZ A;  3BHG A;  2O7B A;  1HY1 A;  3GTD A;  1U15 A;  2O78 A;  2PFM A;  4C5S A;  1GKJ A;  1FUQ A;  3R6Y A;  1B8F A;  2RJR A;  1AUW A;  2HVG A;  1C3C A;  4FFX A;  4FLC A;  1HY0 A;  2O6Y A;  1YFE A;  5EYV A;  4NLE A;  3RD8 A;  5EYT A;  1XWO A;  4C6G A;  4MX2 A;  4APA A;  1EB4 A;  4ADM A;  5F91 A;  4EEI A;  2QGA B;  2NYF A;  1C3U A;  1TJU A;  1J3U A;  5D6B A;  2O7D A;  1TJV A;  1K62 A;  4V2R A;  2PTR A;  2PTQ A;  3R6V A;  4EFC A;  2RJS A; 
#chains in the Genus database with same CATH topology
 3CI0 K;  4C5U A;  1Q91 A;  3U19 A;  1DOF A;  2J91 A;  1FUP A;  2VL7 A;  1YFM A;  3CZO A;  1Z4Q A;  1JSW A;  1T6P A;  3NZ4 A;  2VD6 A;  1DCN A;  2PTS A;  3UNV A;  2FEL A;  3F4S A;  4WNL A;  4A15 A;  1U16 A;  4V2Q A;  3GZH A;  3QBP A;  5HW2 A;  1FUO A;  1RE5 A;  3U13 A;  4CQ5 A;  1Q5N A;  4YIH A;  1GKM A;  3NO9 A;  2O7E A;  4IQJ M;  1MH9 A;  4L6A A;  5H8W A;  2QVE A;  1GK3 A;  4L57 A;  1VDK A;  4HGV A;  3OCE A;  2NYN A;  1I0A A;  3E04 A;  3C8T A;  1GK2 A;  5M0I A;  1YIS A;  2O7F A;  1TJW A;  4ADL A;  3BWV A;  4L6C A;  2E9F A;  1FUR A;  4BAA A;  2FEN A;  2YII A;  4NSL A;  1KQ7 A;  2FUS A;  3OCF A;  1Z4P X;  1Y2M A;  2X75 A;  2OHY A;  1Z4I A;  5F92 A;  1W27 A;  4APB A;  1K7W A;  3KDY A;  4C5R A;  2JAU A;  4YIK A;  1TJ7 A;  2D27 A;  3R6Q A;  3TV2 A;  1T6J A;  1IW7 D;  4BAB A;  3RRP A;  3KDZ A;  3BHG A;  2O7B A;  2JAW A;  1HY1 A;  1XL8 A;  2JAR A;  3GTD A;  1XLY A;  1U15 A;  1U0L A;  2O78 A;  2PFM A;  4C5S A;  1GKJ A;  1Z4K A;  1FUQ A;  3R6Y A;  1Z4M A;  1XL7 A;  3CRV A;  1Z4J A;  1B8F A;  2RJR A;  1AUW A;  2HVG A;  1C3C A;  1XMD A;  4MUM A;  4NFL A;  4FFX A;  4FLC A;  1HY0 A;  2O6Y A;  1YFE A;  5EYV A;  1Z4L A;  4NLE A;  3RD8 A;  5EYT A;  2YV5 A;  1XWO A;  4C6G A;  5M0J A;  4MX2 A;  2D28 C;  4APA A;  1EB4 A;  3F4T A;  4ADM A;  5F91 A;  4EEI A;  2QGA B;  2I7D A;  4MWO A;  1C3U A;  2NYF A;  1TJU A;  2RCN A;  3CRW 1;  1J3U A;  5D6B A;  2VSF A;  4E88 A;  2O7D A;  1TJV A;  1XMC A;  1Q92 A;  1K62 A;  2JAO A;  4V2R A;  2PTR A;  1T9H A;  2PTQ A;  3F4R A;  3R6V A;  4EFC A;  2RJS A; 
#chains in the Genus database with same CATH homology
 4C5U A;  2J91 A;  1DOF A;  1FUP A;  1YFM A;  3CZO A;  3NZ4 A;  1JSW A;  1T6P A;  3UNV A;  2VD6 A;  1DCN A;  2PTS A;  1U16 A;  4V2Q A;  3GZH A;  3QBP A;  5HW2 A;  1FUO A;  1RE5 A;  4CQ5 A;  1Q5N A;  1GKM A;  3NO9 A;  2O7E A;  2QVE A;  1GK3 A;  1VDK A;  4HGV A;  3OCE A;  2NYN A;  1I0A A;  3E04 A;  3C8T A;  1GK2 A;  1YIS A;  2O7F A;  1TJW A;  4ADL A;  2E9F A;  1FUR A;  4BAA A;  2YII A;  4NSL A;  1KQ7 A;  2FUS A;  3OCF A;  1Y2M A;  2X75 A;  2OHY A;  5F92 A;  1W27 A;  4APB A;  1K7W A;  3KDY A;  4C5R A;  1TJ7 A;  3TV2 A;  3R6Q A;  1T6J A;  4BAB A;  3RRP A;  3KDZ A;  3BHG A;  2O7B A;  1HY1 A;  3GTD A;  1U15 A;  2O78 A;  2PFM A;  4C5S A;  1GKJ A;  1FUQ A;  3R6Y A;  1B8F A;  2RJR A;  1AUW A;  2HVG A;  1C3C A;  4FFX A;  4FLC A;  1HY0 A;  2O6Y A;  1YFE A;  5EYV A;  4NLE A;  3RD8 A;  5EYT A;  1XWO A;  4C6G A;  4MX2 A;  4APA A;  1EB4 A;  4ADM A;  5F91 A;  4EEI A;  2QGA B;  2NYF A;  1C3U A;  1TJU A;  1J3U A;  5D6B A;  2O7D A;  1TJV A;  1K62 A;  4V2R A;  2PTR A;  2PTQ A;  3R6V A;  4EFC A;  2RJS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...