1HY1A

Crystal structure of wild type duck delta 2 crystallin (eye lens protein)
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
448
structure length
448
Chain Sequence
TDPIMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLEKISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQLIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNPLDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFSTGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALTPEMLATDLALYLVRKGVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSISPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRELMKKQKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of duck delta 1 and delta 2 crystallin suggest conformational changes occur during catalysis.
pubmed doi rcsb
source organism Anas platyrhynchos
molecule tags Lyase
molecule keywords DELTA CRYSTALLIN II
total genus 181
structure length 448
sequence length 448
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.1: Argininosuccinate lyase.
pdb deposition date 2001-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF14698 ASL_C2 Argininosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 1hy1A03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 1hy1A01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 1hy1A02
5F91A 1B8FA 1AUWA 1C3UA 3OCFA 1KQ7A 1T6JA 2X75A 1T6PA 1K62A 2HVGA 3KDYA 4NSLA 1YFMA 3R6VA 5EYVA 3E04A 2RJSA 1GKJA 2QVEA 1YFEA 2PFMA 3KDZA 4MX2A 4BABA 1GK3A 4CQ5A 2J91A 1Q5NA 1DCNA 4ADLA 1VDKA 1DOFA 4V2RA 1EB4A 1FUOA 1HY1A 3RD8A 4BAAA 1JSWA 5D6BA 1J3UA 1U15A 5HW2A 4EEIA 4APBA 1U16A 1I0AA 1TJUA 2PTRA 3R6YA 2PTSA 2VD6A 4HGVA 1FURA 4FLCA 4FFXA 3UNVA 4C6GA 2RJRA 2O7EA 2O7BA 2NYFA 4ADMA 4EFCA 2O6YA 4C5SA 3NO9A 1K7WA 3GZHA 2O7FA 5EYTA 1TJ7A 1XWOA 4C5UA 4V2QA 1FUQA 1TJWA 4C5RA 3C8TA 1GKMA 5F92A 1TJVA 3R6QA 1HY0A 3RRPA 2PTQA 3NZ4A 3TV2A 2OHYA 1YISA 4NLEA 2NYNA 2YIIA 4APAA 3QBPA 3OCEA 1W27A 1RE5A 2QGAB 2O7DA 3GTDA 2E9FA 1C3CA 2FUSA 3CZOA 1GK2A 1Y2MA 2O78A 3BHGA 1FUPA
chains in the Genus database with same CATH superfamily
2D27A 5F91A 2JARA 1AUWA 1B8FA 2I7DA 3BWVA 1XL8A 1C3UA 3OCFA 1KQ7A 1T6JA 3F4RA 2X75A 1T6PA 1Q92A 2JAOA 3U19A 1K62A 4E88A 2HVGA 3KDYA 4NSLA 1YFMA 3R6VA 5EYVA 5H8WA 3E04A 2RJSA 4MUMA 4L57A 1GKJA 2QVEA 1YFEA 2PFMA 3KDZA 4MX2A 4BABA 1GK3A 4CQ5A 2J91A 1Q5NA 1IW7D 1Z4LA 3CRVA 1DCNA 4ADLA 1VDKA 1DOFA 4V2RA 3CRW1 1EB4A 1XMDA 1FUOA 1HY1A 3RD8A 4BAAA 1JSWA 1Z4MA 5D6BA 1J3UA 1U15A 5HW2A 3U13A 4EEIA 1U16A 4APBA 1I0AA 1TJUA 1Z4IA 2PTRA 3R6YA 2PTSA 2VL7A 2VSFA 2VD6A 4HGVA 1Z4QA 1FURA 4FLCA 4FFXA 3UNVA 4C6GA 2RJRA 4YIKA 2O7EA 2O7BA 2YV5A 2NYFA 4ADMA 1XLYA 2FELA 4EFCA 2O6YA 4C5SA 3NO9A 4NFLA 1K7WA 3GZHA 2O7FA 1T9HA 4YIHA 5EYTA 1TJ7A 1XWOA 4C5UA 4V2QA 1FUQA 1TJWA 4A15A 4L6CA 4C5RA 3C8TA 1GKMA 1Z4KA 5F92A 1TJVA 3R6QA 1HY0A 3RRPA 2FENA 5M0IA 4IQJM 1U0LA 2PTQA 1XL7A 1MH9A 3NZ4A 3TV2A 1Z4JA 1Z4PX 2OHYA 1YISA 2RCNA 4NLEA 2NYNA 3CI0K 2YIIA 4APAA 2JAWA 2JAUA 4L6AA 3QBPA 3OCEA 1Q91A 1W27A 2D28C 1RE5A 2QGAB 2O7DA 3GTDA 2E9FA 1C3CA 2FUSA 4MWOA 3CZOA 5M0JA 1GK2A 1Y2MA 4WNLA 2O78A 3F4SA 3F4TA 3BHGA 1FUPA 1XMCA
chains in the Genus database with same CATH topology
5F91A 1B8FA 1AUWA 1C3UA 3OCFA 1KQ7A 1T6JA 2X75A 1T6PA 1K62A 2HVGA 3KDYA 4NSLA 1YFMA 3R6VA 5EYVA 3E04A 2RJSA 1GKJA 2QVEA 1YFEA 2PFMA 3KDZA 4MX2A 4BABA 1GK3A 4CQ5A 2J91A 1Q5NA 1DCNA 4ADLA 1VDKA 1DOFA 4V2RA 1EB4A 1FUOA 1HY1A 3RD8A 4BAAA 1JSWA 5D6BA 1J3UA 1U15A 5HW2A 4EEIA 4APBA 1U16A 1I0AA 1TJUA 2PTRA 3R6YA 2PTSA 2VD6A 4HGVA 1FURA 4FLCA 4FFXA 3UNVA 4C6GA 2RJRA 2O7EA 2O7BA 2NYFA 4ADMA 4EFCA 2O6YA 4C5SA 3NO9A 1K7WA 3GZHA 2O7FA 5EYTA 1TJ7A 1XWOA 4C5UA 4V2QA 1FUQA 1TJWA 4C5RA 3C8TA 1GKMA 5F92A 1TJVA 3R6QA 1HY0A 3RRPA 2PTQA 3NZ4A 3TV2A 2OHYA 1YISA 4NLEA 2NYNA 2YIIA 4APAA 3QBPA 3OCEA 1W27A 1RE5A 2QGAB 2O7DA 3GTDA 2E9FA 1C3CA 2FUSA 3CZOA 1GK2A 1Y2MA 2O78A 3BHGA 1FUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F91 A;  1B8F A;  1AUW A;  1C3U A;  3OCF A;  1KQ7 A;  1T6J A;  2X75 A;  1T6P A;  1K62 A;  2HVG A;  3KDY A;  4NSL A;  1YFM A;  3R6V A;  5EYV A;  3E04 A;  2RJS A;  1GKJ A;  2QVE A;  1YFE A;  2PFM A;  3KDZ A;  4MX2 A;  4BAB A;  1GK3 A;  4CQ5 A;  2J91 A;  1Q5N A;  1DCN A;  4ADL A;  1VDK A;  1DOF A;  4V2R A;  1EB4 A;  1FUO A;  1HY1 A;  3RD8 A;  4BAA A;  1JSW A;  5D6B A;  1J3U A;  1U15 A;  5HW2 A;  4EEI A;  4APB A;  1U16 A;  1I0A A;  1TJU A;  2PTR A;  3R6Y A;  2PTS A;  2VD6 A;  4HGV A;  1FUR A;  4FLC A;  4FFX A;  3UNV A;  4C6G A;  2RJR A;  2O7E A;  2O7B A;  2NYF A;  4ADM A;  4EFC A;  2O6Y A;  4C5S A;  3NO9 A;  1K7W A;  3GZH A;  2O7F A;  5EYT A;  1TJ7 A;  1XWO A;  4C5U A;  4V2Q A;  1FUQ A;  1TJW A;  4C5R A;  3C8T A;  1GKM A;  5F92 A;  1TJV A;  3R6Q A;  1HY0 A;  3RRP A;  2PTQ A;  3NZ4 A;  3TV2 A;  2OHY A;  1YIS A;  4NLE A;  2NYN A;  2YII A;  4APA A;  3QBP A;  3OCE A;  1W27 A;  1RE5 A;  2QGA B;  2O7D A;  3GTD A;  2E9F A;  1C3C A;  2FUS A;  3CZO A;  1GK2 A;  1Y2M A;  2O78 A;  3BHG A;  1FUP A; 
#chains in the Genus database with same CATH topology
 2D27 A;  5F91 A;  2JAR A;  1AUW A;  1B8F A;  2I7D A;  3BWV A;  1XL8 A;  1C3U A;  3OCF A;  1KQ7 A;  1T6J A;  3F4R A;  2X75 A;  1T6P A;  1Q92 A;  2JAO A;  3U19 A;  1K62 A;  4E88 A;  2HVG A;  3KDY A;  4NSL A;  1YFM A;  3R6V A;  5EYV A;  5H8W A;  3E04 A;  2RJS A;  4MUM A;  4L57 A;  1GKJ A;  2QVE A;  1YFE A;  2PFM A;  3KDZ A;  4MX2 A;  4BAB A;  1GK3 A;  4CQ5 A;  2J91 A;  1Q5N A;  1IW7 D;  1Z4L A;  3CRV A;  1DCN A;  4ADL A;  1VDK A;  1DOF A;  4V2R A;  3CRW 1;  1EB4 A;  1XMD A;  1FUO A;  1HY1 A;  3RD8 A;  4BAA A;  1JSW A;  1Z4M A;  5D6B A;  1J3U A;  1U15 A;  5HW2 A;  3U13 A;  4EEI A;  1U16 A;  4APB A;  1I0A A;  1TJU A;  1Z4I A;  2PTR A;  3R6Y A;  2PTS A;  2VL7 A;  2VSF A;  2VD6 A;  4HGV A;  1Z4Q A;  1FUR A;  4FLC A;  4FFX A;  3UNV A;  4C6G A;  2RJR A;  4YIK A;  2O7E A;  2O7B A;  2YV5 A;  2NYF A;  4ADM A;  1XLY A;  2FEL A;  4EFC A;  2O6Y A;  4C5S A;  3NO9 A;  4NFL A;  1K7W A;  3GZH A;  2O7F A;  1T9H A;  4YIH A;  5EYT A;  1TJ7 A;  1XWO A;  4C5U A;  4V2Q A;  1FUQ A;  1TJW A;  4A15 A;  4L6C A;  4C5R A;  3C8T A;  1GKM A;  1Z4K A;  5F92 A;  1TJV A;  3R6Q A;  1HY0 A;  3RRP A;  2FEN A;  5M0I A;  4IQJ M;  1U0L A;  2PTQ A;  1XL7 A;  1MH9 A;  3NZ4 A;  3TV2 A;  1Z4J A;  1Z4P X;  2OHY A;  1YIS A;  2RCN A;  4NLE A;  2NYN A;  3CI0 K;  2YII A;  4APA A;  2JAW A;  2JAU A;  4L6A A;  3QBP A;  3OCE A;  1Q91 A;  1W27 A;  2D28 C;  1RE5 A;  2QGA B;  2O7D A;  3GTD A;  2E9F A;  1C3C A;  2FUS A;  4MWO A;  3CZO A;  5M0J A;  1GK2 A;  1Y2M A;  4WNL A;  2O78 A;  3F4S A;  3F4T A;  3BHG A;  1FUP A;  1XMC A; 
#chains in the Genus database with same CATH homology
 5F91 A;  1B8F A;  1AUW A;  1C3U A;  3OCF A;  1KQ7 A;  1T6J A;  2X75 A;  1T6P A;  1K62 A;  2HVG A;  3KDY A;  4NSL A;  1YFM A;  3R6V A;  5EYV A;  3E04 A;  2RJS A;  1GKJ A;  2QVE A;  1YFE A;  2PFM A;  3KDZ A;  4MX2 A;  4BAB A;  1GK3 A;  4CQ5 A;  2J91 A;  1Q5N A;  1DCN A;  4ADL A;  1VDK A;  1DOF A;  4V2R A;  1EB4 A;  1FUO A;  1HY1 A;  3RD8 A;  4BAA A;  1JSW A;  5D6B A;  1J3U A;  1U15 A;  5HW2 A;  4EEI A;  4APB A;  1U16 A;  1I0A A;  1TJU A;  2PTR A;  3R6Y A;  2PTS A;  2VD6 A;  4HGV A;  1FUR A;  4FLC A;  4FFX A;  3UNV A;  4C6G A;  2RJR A;  2O7E A;  2O7B A;  2NYF A;  4ADM A;  4EFC A;  2O6Y A;  4C5S A;  3NO9 A;  1K7W A;  3GZH A;  2O7F A;  5EYT A;  1TJ7 A;  1XWO A;  4C5U A;  4V2Q A;  1FUQ A;  1TJW A;  4C5R A;  3C8T A;  1GKM A;  5F92 A;  1TJV A;  3R6Q A;  1HY0 A;  3RRP A;  2PTQ A;  3NZ4 A;  3TV2 A;  2OHY A;  1YIS A;  4NLE A;  2NYN A;  2YII A;  4APA A;  3QBP A;  3OCE A;  1W27 A;  1RE5 A;  2QGA B;  2O7D A;  3GTD A;  2E9F A;  1C3C A;  2FUS A;  3CZO A;  1GK2 A;  1Y2M A;  2O78 A;  3BHG A;  1FUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...