1HY1A

Crystal structure of wild type duck delta 2 crystallin (eye lens protein)
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
448
structure length
448
Chain Sequence
TDPIMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLEKISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQLIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNPLDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFSTGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALTPEMLATDLALYLVRKGVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSISPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRELMKKQKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of duck delta 1 and delta 2 crystallin suggest conformational changes occur during catalysis.
pubmed doi rcsb
source organism Anas platyrhynchos
molecule tags Lyase
molecule keywords DELTA CRYSTALLIN II
total genus 181
structure length 448
sequence length 448
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.1: Argininosuccinate lyase.
pdb deposition date 2001-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF14698 ASL_C2 Argininosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 1hy1A03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 1hy1A01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 1hy1A02
2NYFA 2VD6A 4APAA 3RD8A 1HY1A 1TJVA 1VDKA 5F91A 5EYTA 3NO9A 4C5SA 2E9FA 3KDYA 3KDZA 4V2RA 1U16A 2O7FA 3R6QA 1J3UA 1FUPA 1B8FA 1YFEA 1AUWA 2O7EA 3R6YA 2QGAB 1YISA 1GK3A 1T6JA 3E04A 2RJRA 4EFCA 1RE5A 3UNVA 2PTQA 1FURA 4CQ5A 1DOFA 1U15A 1DCNA 1I0AA 1TJUA 4NLEA 1C3CA 1Y2MA 1GK2A 2PTSA 1T6PA 3RRPA 3TV2A 1K7WA 2O78A 2PFMA 3BHGA 3R6VA 2O7DA 3GZHA 1GKJA 1K62A 4V2QA 5EYVA 2YIIA 4HGVA 4MX2A 4FFXA 1FUOA 4C5RA 2RJSA 2X75A 4APBA 1EB4A 1TJWA 1C3UA 5D6BA 4EEIA 3C8TA 2O7BA 3GTDA 4C6GA 3OCEA 2J91A 3QBPA 2O6YA 1FUQA 2QVEA 2PTRA 5F92A 2FUSA 4BAAA 3CZOA 1HY0A 2NYNA 2HVGA 1Q5NA 4BABA 1JSWA 1XWOA 3OCFA 1KQ7A 1GKMA 3NZ4A 4ADMA 4ADLA 1YFMA 1TJ7A 2OHYA 5HW2A 4NSLA 4FLCA 1W27A 4C5UA
chains in the Genus database with same CATH superfamily
2NYFA 3F4SA 2VD6A 4APAA 3RD8A 5M0IA 1HY1A 2JAWA 1TJVA 3BWVA 1VDKA 5F91A 5EYTA 3NO9A 4YIHA 4C5SA 2E9FA 3KDYA 3KDZA 4V2RA 1IW7D 1U16A 3CRVA 2O7FA 3R6QA 1J3UA 1FUPA 1B8FA 1YFEA 2VL7A 1AUWA 2O7EA 3R6YA 2QGAB 4NFLA 4L57A 1YISA 1GK3A 3CRW1 2JAUA 1T6JA 3E04A 2RCNA 2RJRA 4EFCA 1RE5A 1XL8A 1XMCA 1Z4KA 3UNVA 1XMDA 1Z4JA 2PTQA 4MUMA 1FURA 1Z4IA 1DOFA 4CQ5A 1U15A 1DCNA 1MH9A 1I0AA 1TJUA 4NLEA 1C3CA 1Y2MA 1GK2A 1Z4QA 2JARA 2PTSA 3RRPA 3TV2A 1U0LA 1T6PA 1K7WA 2O78A 2PFMA 5M0JA 3BHGA 3R6VA 2O7DA 3GZHA 1GKJA 1K62A 4V2QA 5EYVA 2D28C 2YIIA 4HGVA 4MX2A 2VSFA 4FFXA 1FUOA 1Q91A 4C5RA 2RJSA 4L6CA 4IQJM 1Z4LA 2X75A 4APBA 1EB4A 1TJWA 1C3UA 5D6BA 4EEIA 2FENA 3C8TA 2O7BA 4MWOA 3GTDA 4L6AA 1T9HA 3F4TA 2JAOA 1Z4PX 4C6GA 3OCEA 4E88A 2J91A 3QBPA 2O6YA 1FUQA 2QVEA 2PTRA 3F4RA 2FELA 5F92A 4WNLA 1XL7A 2FUSA 1Z4MA 2YV5A 4YIKA 4BAAA 3CZOA 1HY0A 2D27A 2NYNA 4A15A 2HVGA 3U19A 1Q5NA 4BABA 1JSWA 1XWOA 3OCFA 1Q92A 1KQ7A 2I7DA 1GKMA 3NZ4A 4ADMA 4ADLA 1YFMA 1TJ7A 2OHYA 1XLYA 5HW2A 4NSLA 4FLCA 3CI0K 3U13A 1W27A 5H8WA 4C5UA
chains in the Genus database with same CATH topology
2NYFA 2VD6A 4APAA 3RD8A 1HY1A 1TJVA 1VDKA 5F91A 5EYTA 3NO9A 4C5SA 2E9FA 3KDYA 3KDZA 4V2RA 1U16A 2O7FA 3R6QA 1J3UA 1FUPA 1B8FA 1YFEA 1AUWA 2O7EA 3R6YA 2QGAB 1YISA 1GK3A 1T6JA 3E04A 2RJRA 4EFCA 1RE5A 3UNVA 2PTQA 1FURA 4CQ5A 1DOFA 1U15A 1DCNA 1I0AA 1TJUA 4NLEA 1C3CA 1Y2MA 1GK2A 2PTSA 1T6PA 3RRPA 3TV2A 1K7WA 2O78A 2PFMA 3BHGA 3R6VA 2O7DA 3GZHA 1GKJA 1K62A 4V2QA 5EYVA 2YIIA 4HGVA 4MX2A 4FFXA 1FUOA 4C5RA 2RJSA 2X75A 4APBA 1EB4A 1TJWA 1C3UA 5D6BA 4EEIA 3C8TA 2O7BA 3GTDA 4C6GA 3OCEA 2J91A 3QBPA 2O6YA 1FUQA 2QVEA 2PTRA 5F92A 2FUSA 4BAAA 3CZOA 1HY0A 2NYNA 2HVGA 1Q5NA 4BABA 1JSWA 1XWOA 3OCFA 1KQ7A 1GKMA 3NZ4A 4ADMA 4ADLA 1YFMA 1TJ7A 2OHYA 5HW2A 4NSLA 4FLCA 1W27A 4C5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NYF A;  2VD6 A;  4APA A;  3RD8 A;  1HY1 A;  1TJV A;  1VDK A;  5F91 A;  5EYT A;  3NO9 A;  4C5S A;  2E9F A;  3KDY A;  3KDZ A;  4V2R A;  1U16 A;  2O7F A;  3R6Q A;  1J3U A;  1FUP A;  1B8F A;  1YFE A;  1AUW A;  2O7E A;  3R6Y A;  2QGA B;  1YIS A;  1GK3 A;  1T6J A;  3E04 A;  2RJR A;  4EFC A;  1RE5 A;  3UNV A;  2PTQ A;  1FUR A;  4CQ5 A;  1DOF A;  1U15 A;  1DCN A;  1I0A A;  1TJU A;  4NLE A;  1C3C A;  1Y2M A;  1GK2 A;  2PTS A;  1T6P A;  3RRP A;  3TV2 A;  1K7W A;  2O78 A;  2PFM A;  3BHG A;  3R6V A;  2O7D A;  3GZH A;  1GKJ A;  1K62 A;  4V2Q A;  5EYV A;  2YII A;  4HGV A;  4MX2 A;  4FFX A;  1FUO A;  4C5R A;  2RJS A;  2X75 A;  4APB A;  1EB4 A;  1TJW A;  1C3U A;  5D6B A;  4EEI A;  3C8T A;  2O7B A;  3GTD A;  4C6G A;  3OCE A;  2J91 A;  3QBP A;  2O6Y A;  1FUQ A;  2QVE A;  2PTR A;  5F92 A;  2FUS A;  4BAA A;  3CZO A;  1HY0 A;  2NYN A;  2HVG A;  1Q5N A;  4BAB A;  1JSW A;  1XWO A;  3OCF A;  1KQ7 A;  1GKM A;  3NZ4 A;  4ADM A;  4ADL A;  1YFM A;  1TJ7 A;  2OHY A;  5HW2 A;  4NSL A;  4FLC A;  1W27 A;  4C5U A; 
#chains in the Genus database with same CATH topology
 2NYF A;  3F4S A;  2VD6 A;  4APA A;  3RD8 A;  5M0I A;  1HY1 A;  2JAW A;  1TJV A;  3BWV A;  1VDK A;  5F91 A;  5EYT A;  3NO9 A;  4YIH A;  4C5S A;  2E9F A;  3KDY A;  3KDZ A;  4V2R A;  1IW7 D;  1U16 A;  3CRV A;  2O7F A;  3R6Q A;  1J3U A;  1FUP A;  1B8F A;  1YFE A;  2VL7 A;  1AUW A;  2O7E A;  3R6Y A;  2QGA B;  4NFL A;  4L57 A;  1YIS A;  1GK3 A;  3CRW 1;  2JAU A;  1T6J A;  3E04 A;  2RCN A;  2RJR A;  4EFC A;  1RE5 A;  1XL8 A;  1XMC A;  1Z4K A;  3UNV A;  1XMD A;  1Z4J A;  2PTQ A;  4MUM A;  1FUR A;  1Z4I A;  1DOF A;  4CQ5 A;  1U15 A;  1DCN A;  1MH9 A;  1I0A A;  1TJU A;  4NLE A;  1C3C A;  1Y2M A;  1GK2 A;  1Z4Q A;  2JAR A;  2PTS A;  3RRP A;  3TV2 A;  1U0L A;  1T6P A;  1K7W A;  2O78 A;  2PFM A;  5M0J A;  3BHG A;  3R6V A;  2O7D A;  3GZH A;  1GKJ A;  1K62 A;  4V2Q A;  5EYV A;  2D28 C;  2YII A;  4HGV A;  4MX2 A;  2VSF A;  4FFX A;  1FUO A;  1Q91 A;  4C5R A;  2RJS A;  4L6C A;  4IQJ M;  1Z4L A;  2X75 A;  4APB A;  1EB4 A;  1TJW A;  1C3U A;  5D6B A;  4EEI A;  2FEN A;  3C8T A;  2O7B A;  4MWO A;  3GTD A;  4L6A A;  1T9H A;  3F4T A;  2JAO A;  1Z4P X;  4C6G A;  3OCE A;  4E88 A;  2J91 A;  3QBP A;  2O6Y A;  1FUQ A;  2QVE A;  2PTR A;  3F4R A;  2FEL A;  5F92 A;  4WNL A;  1XL7 A;  2FUS A;  1Z4M A;  2YV5 A;  4YIK A;  4BAA A;  3CZO A;  1HY0 A;  2D27 A;  2NYN A;  4A15 A;  2HVG A;  3U19 A;  1Q5N A;  4BAB A;  1JSW A;  1XWO A;  3OCF A;  1Q92 A;  1KQ7 A;  2I7D A;  1GKM A;  3NZ4 A;  4ADM A;  4ADL A;  1YFM A;  1TJ7 A;  2OHY A;  1XLY A;  5HW2 A;  4NSL A;  4FLC A;  3CI0 K;  3U13 A;  1W27 A;  5H8W A;  4C5U A; 
#chains in the Genus database with same CATH homology
 2NYF A;  2VD6 A;  4APA A;  3RD8 A;  1HY1 A;  1TJV A;  1VDK A;  5F91 A;  5EYT A;  3NO9 A;  4C5S A;  2E9F A;  3KDY A;  3KDZ A;  4V2R A;  1U16 A;  2O7F A;  3R6Q A;  1J3U A;  1FUP A;  1B8F A;  1YFE A;  1AUW A;  2O7E A;  3R6Y A;  2QGA B;  1YIS A;  1GK3 A;  1T6J A;  3E04 A;  2RJR A;  4EFC A;  1RE5 A;  3UNV A;  2PTQ A;  1FUR A;  4CQ5 A;  1DOF A;  1U15 A;  1DCN A;  1I0A A;  1TJU A;  4NLE A;  1C3C A;  1Y2M A;  1GK2 A;  2PTS A;  1T6P A;  3RRP A;  3TV2 A;  1K7W A;  2O78 A;  2PFM A;  3BHG A;  3R6V A;  2O7D A;  3GZH A;  1GKJ A;  1K62 A;  4V2Q A;  5EYV A;  2YII A;  4HGV A;  4MX2 A;  4FFX A;  1FUO A;  4C5R A;  2RJS A;  2X75 A;  4APB A;  1EB4 A;  1TJW A;  1C3U A;  5D6B A;  4EEI A;  3C8T A;  2O7B A;  3GTD A;  4C6G A;  3OCE A;  2J91 A;  3QBP A;  2O6Y A;  1FUQ A;  2QVE A;  2PTR A;  5F92 A;  2FUS A;  4BAA A;  3CZO A;  1HY0 A;  2NYN A;  2HVG A;  1Q5N A;  4BAB A;  1JSW A;  1XWO A;  3OCF A;  1KQ7 A;  1GKM A;  3NZ4 A;  4ADM A;  4ADL A;  1YFM A;  1TJ7 A;  2OHY A;  5HW2 A;  4NSL A;  4FLC A;  1W27 A;  4C5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...