1HY1A

Crystal structure of wild type duck delta 2 crystallin (eye lens protein)
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
448
structure length
448
Chain Sequence
b'TDPIMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLEKISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQLIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNPLDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFSTGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALTPEMLATDLALYLVRKGVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSISPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRELMKKQKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DELTA CRYSTALLIN II
publication title Structural studies of duck delta 1 and delta 2 crystallin suggest conformational changes occur during catalysis.
pubmed doi rcsb
source organism Anas platyrhynchos
molecule tags Lyase
total genus 181
structure length 448
sequence length 448
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.1: Argininosuccinate lyase.
pdb deposition date 2001-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF14698 ASL_C2 Argininosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 1hy1A03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 1hy1A01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 1hy1A02
2NYFA 3KDZA 4APAA 4C5UA 4FFXA 3R6VA 4C5SA 3R6QA 1TJUA 1C3CA 4CQ5A 1TJVA 1HY1A 5F92A 2HVGA 1YFMA 1YFEA 1DOFA 1I0AA 1TJ7A 1TJWA 3CZOA 1U16A 2PTQA 3KDYA 1JSWA 4FLCA 2NYNA 4NSLA 2O7BA 4HGVA 2FUSA 2RJSA 3TV2A 2PFMA 4V2QA 2J91A 3NZ4A 2O7EA 2OHYA 1RE5A 2QVEA 1FURA 4ADMA 3RD8A 1EB4A 1VDKA 1T6PA 2O6YA 4EFCA 2RJRA 1GK3A 2X75A 2QGAB 3C8TA 1GKJA 4NLEA 4EEIA 3OCEA 4C5RA 4V2RA 1K62A 1B8FA 1Y2MA 3E04A 1T6JA 1XWOA 3OCFA 1FUQA 2PTRA 3GTDA 1K7WA 4BAAA 1HY0A 5HW2A 4ADLA 2PTSA 3RRPA 1YISA 2VD6A 2O7FA 3GZHA 1GK2A 1AUWA 4MX2A 1W27A 1U15A 1C3UA 2O78A 5EYVA 3BHGA 3R6YA 4APBA 1Q5NA 5F91A 2YIIA 1J3UA 3NO9A 5D6BA 3QBPA 5EYTA 4BABA 1KQ7A 2O7DA 1FUOA 4C6GA 2E9FA 1DCNA 1FUPA 3UNVA 1GKMA
chains in the Genus database with same CATH superfamily
2YV5A 2NYFA 2VL7A 3KDZA 2RCNA 4APAA 4C5UA 4FFXA 3R6VA 4C5SA 1Z4JA 3R6QA 1TJUA 4YIHA 1XLYA 1C3CA 4IQJM 4CQ5A 2I7DA 1XMDA 1TJVA 1Z4QA 2JAUA 1HY1A 5F92A 2HVGA 1YFMA 1YFEA 2JAWA 1DOFA 1I0AA 1TJ7A 2D27A 4L57A 1TJWA 4L6AA 3CZOA 1U16A 2PTQA 3KDYA 1JSWA 4FLCA 1Z4PX 1Z4MA 3F4SA 3F4TA 4NSLA 2NYNA 2O7BA 3U19A 2JAOA 2FUSA 4HGVA 3TV2A 2RJSA 1U0LA 2PFMA 4E88A 4V2QA 5M0IA 2J91A 4MWOA 3NZ4A 2O7EA 2OHYA 1RE5A 4NFLA 4YIKA 1IW7D 5M0JA 2QVEA 1FURA 2FENA 4ADMA 3RD8A 1EB4A 1VDKA 1Q92A 1T6PA 4WNLA 2O6YA 4EFCA 1Z4LA 2RJRA 1GK3A 2X75A 2QGAB 4L6CA 1XL7A 3C8TA 1GKJA 4NLEA 4EEIA 5H8WA 1Z4IA 3OCEA 4C5RA 3BWVA 2FELA 4V2RA 1K62A 2JARA 3U13A 1B8FA 1Y2MA 3E04A 1T6JA 1XWOA 1XMCA 1MH9A 3OCFA 1FUQA 2D28C 2PTRA 1K7WA 3GTDA 1HY0A 3F4RA 4BAAA 4MUMA 5HW2A 1Q91A 4ADLA 2PTSA 3RRPA 1YISA 2VSFA 2VD6A 2O7FA 3CI0K 1T9HA 3GZHA 1GK2A 1AUWA 3CRVA 4MX2A 1W27A 1XL8A 1U15A 1C3UA 2O78A 5EYVA 3BHGA 3R6YA 4APBA 4A15A 1Q5NA 5F91A 2YIIA 1J3UA 1Z4KA 3NO9A 3QBPA 5D6BA 5EYTA 4BABA 1KQ7A 2O7DA 1FUOA 4C6GA 2E9FA 1DCNA 1FUPA 3UNVA 3CRW1 1GKMA
chains in the Genus database with same CATH topology
2NYFA 3KDZA 4APAA 4C5UA 4FFXA 3R6VA 4C5SA 3R6QA 1TJUA 1C3CA 4CQ5A 1TJVA 1HY1A 5F92A 2HVGA 1YFMA 1YFEA 1DOFA 1I0AA 1TJ7A 1TJWA 3CZOA 1U16A 2PTQA 3KDYA 1JSWA 4FLCA 2NYNA 4NSLA 2O7BA 4HGVA 2FUSA 2RJSA 3TV2A 2PFMA 4V2QA 2J91A 3NZ4A 2O7EA 2OHYA 1RE5A 2QVEA 1FURA 4ADMA 3RD8A 1EB4A 1VDKA 1T6PA 2O6YA 4EFCA 2RJRA 1GK3A 2X75A 2QGAB 3C8TA 1GKJA 4NLEA 4EEIA 3OCEA 4C5RA 4V2RA 1K62A 1B8FA 1Y2MA 3E04A 1T6JA 1XWOA 3OCFA 1FUQA 2PTRA 3GTDA 1K7WA 4BAAA 1HY0A 5HW2A 4ADLA 2PTSA 3RRPA 1YISA 2VD6A 2O7FA 3GZHA 1GK2A 1AUWA 4MX2A 1W27A 1U15A 1C3UA 2O78A 5EYVA 3BHGA 3R6YA 4APBA 1Q5NA 5F91A 2YIIA 1J3UA 3NO9A 5D6BA 3QBPA 5EYTA 4BABA 1KQ7A 2O7DA 1FUOA 4C6GA 2E9FA 1DCNA 1FUPA 3UNVA 1GKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NYF A;  3KDZ A;  4APA A;  4C5U A;  4FFX A;  3R6V A;  4C5S A;  3R6Q A;  1TJU A;  1C3C A;  4CQ5 A;  1TJV A;  1HY1 A;  5F92 A;  2HVG A;  1YFM A;  1YFE A;  1DOF A;  1I0A A;  1TJ7 A;  1TJW A;  3CZO A;  1U16 A;  2PTQ A;  3KDY A;  1JSW A;  4FLC A;  2NYN A;  4NSL A;  2O7B A;  4HGV A;  2FUS A;  2RJS A;  3TV2 A;  2PFM A;  4V2Q A;  2J91 A;  3NZ4 A;  2O7E A;  2OHY A;  1RE5 A;  2QVE A;  1FUR A;  4ADM A;  3RD8 A;  1EB4 A;  1VDK A;  1T6P A;  2O6Y A;  4EFC A;  2RJR A;  1GK3 A;  2X75 A;  2QGA B;  3C8T A;  1GKJ A;  4NLE A;  4EEI A;  3OCE A;  4C5R A;  4V2R A;  1K62 A;  1B8F A;  1Y2M A;  3E04 A;  1T6J A;  1XWO A;  3OCF A;  1FUQ A;  2PTR A;  3GTD A;  1K7W A;  4BAA A;  1HY0 A;  5HW2 A;  4ADL A;  2PTS A;  3RRP A;  1YIS A;  2VD6 A;  2O7F A;  3GZH A;  1GK2 A;  1AUW A;  4MX2 A;  1W27 A;  1U15 A;  1C3U A;  2O78 A;  5EYV A;  3BHG A;  3R6Y A;  4APB A;  1Q5N A;  5F91 A;  2YII A;  1J3U A;  3NO9 A;  5D6B A;  3QBP A;  5EYT A;  4BAB A;  1KQ7 A;  2O7D A;  1FUO A;  4C6G A;  2E9F A;  1DCN A;  1FUP A;  3UNV A;  1GKM A; 
#chains in the Genus database with same CATH topology
 2YV5 A;  2NYF A;  2VL7 A;  3KDZ A;  2RCN A;  4APA A;  4C5U A;  4FFX A;  3R6V A;  4C5S A;  1Z4J A;  3R6Q A;  1TJU A;  4YIH A;  1XLY A;  1C3C A;  4IQJ M;  4CQ5 A;  2I7D A;  1XMD A;  1TJV A;  1Z4Q A;  2JAU A;  1HY1 A;  5F92 A;  2HVG A;  1YFM A;  1YFE A;  2JAW A;  1DOF A;  1I0A A;  1TJ7 A;  2D27 A;  4L57 A;  1TJW A;  4L6A A;  3CZO A;  1U16 A;  2PTQ A;  3KDY A;  1JSW A;  4FLC A;  1Z4P X;  1Z4M A;  3F4S A;  3F4T A;  4NSL A;  2NYN A;  2O7B A;  3U19 A;  2JAO A;  2FUS A;  4HGV A;  3TV2 A;  2RJS A;  1U0L A;  2PFM A;  4E88 A;  4V2Q A;  5M0I A;  2J91 A;  4MWO A;  3NZ4 A;  2O7E A;  2OHY A;  1RE5 A;  4NFL A;  4YIK A;  1IW7 D;  5M0J A;  2QVE A;  1FUR A;  2FEN A;  4ADM A;  3RD8 A;  1EB4 A;  1VDK A;  1Q92 A;  1T6P A;  4WNL A;  2O6Y A;  4EFC A;  1Z4L A;  2RJR A;  1GK3 A;  2X75 A;  2QGA B;  4L6C A;  1XL7 A;  3C8T A;  1GKJ A;  4NLE A;  4EEI A;  5H8W A;  1Z4I A;  3OCE A;  4C5R A;  3BWV A;  2FEL A;  4V2R A;  1K62 A;  2JAR A;  3U13 A;  1B8F A;  1Y2M A;  3E04 A;  1T6J A;  1XWO A;  1XMC A;  1MH9 A;  3OCF A;  1FUQ A;  2D28 C;  2PTR A;  1K7W A;  3GTD A;  1HY0 A;  3F4R A;  4BAA A;  4MUM A;  5HW2 A;  1Q91 A;  4ADL A;  2PTS A;  3RRP A;  1YIS A;  2VSF A;  2VD6 A;  2O7F A;  3CI0 K;  1T9H A;  3GZH A;  1GK2 A;  1AUW A;  3CRV A;  4MX2 A;  1W27 A;  1XL8 A;  1U15 A;  1C3U A;  2O78 A;  5EYV A;  3BHG A;  3R6Y A;  4APB A;  4A15 A;  1Q5N A;  5F91 A;  2YII A;  1J3U A;  1Z4K A;  3NO9 A;  3QBP A;  5D6B A;  5EYT A;  4BAB A;  1KQ7 A;  2O7D A;  1FUO A;  4C6G A;  2E9F A;  1DCN A;  1FUP A;  3UNV A;  3CRW 1;  1GKM A; 
#chains in the Genus database with same CATH homology
 2NYF A;  3KDZ A;  4APA A;  4C5U A;  4FFX A;  3R6V A;  4C5S A;  3R6Q A;  1TJU A;  1C3C A;  4CQ5 A;  1TJV A;  1HY1 A;  5F92 A;  2HVG A;  1YFM A;  1YFE A;  1DOF A;  1I0A A;  1TJ7 A;  1TJW A;  3CZO A;  1U16 A;  2PTQ A;  3KDY A;  1JSW A;  4FLC A;  2NYN A;  4NSL A;  2O7B A;  4HGV A;  2FUS A;  2RJS A;  3TV2 A;  2PFM A;  4V2Q A;  2J91 A;  3NZ4 A;  2O7E A;  2OHY A;  1RE5 A;  2QVE A;  1FUR A;  4ADM A;  3RD8 A;  1EB4 A;  1VDK A;  1T6P A;  2O6Y A;  4EFC A;  2RJR A;  1GK3 A;  2X75 A;  2QGA B;  3C8T A;  1GKJ A;  4NLE A;  4EEI A;  3OCE A;  4C5R A;  4V2R A;  1K62 A;  1B8F A;  1Y2M A;  3E04 A;  1T6J A;  1XWO A;  3OCF A;  1FUQ A;  2PTR A;  3GTD A;  1K7W A;  4BAA A;  1HY0 A;  5HW2 A;  4ADL A;  2PTS A;  3RRP A;  1YIS A;  2VD6 A;  2O7F A;  3GZH A;  1GK2 A;  1AUW A;  4MX2 A;  1W27 A;  1U15 A;  1C3U A;  2O78 A;  5EYV A;  3BHG A;  3R6Y A;  4APB A;  1Q5N A;  5F91 A;  2YII A;  1J3U A;  3NO9 A;  5D6B A;  3QBP A;  5EYT A;  4BAB A;  1KQ7 A;  2O7D A;  1FUO A;  4C6G A;  2E9F A;  1DCN A;  1FUP A;  3UNV A;  1GKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...