1HY1A

Crystal structure of wild type duck delta 2 crystallin (eye lens protein)
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
448
structure length
448
Chain Sequence
TDPIMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLEKISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQLIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNPLDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFSTGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALTPEMLATDLALYLVRKGVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSISPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRELMKKQKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords DELTA CRYSTALLIN II
publication title Structural studies of duck delta 1 and delta 2 crystallin suggest conformational changes occur during catalysis.
pubmed doi rcsb
source organism Anas platyrhynchos
total genus 181
structure length 448
sequence length 448
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.1: Argininosuccinate lyase.
pdb deposition date 2001-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF14698 ASL_C2 Argininosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 1hy1A03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 1hy1A01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 1hy1A02
4CQ5A 3NZ4A 2HVGA 1YFEA 3GZHA 5EYVA 2YIIA 4V2RA 2FUSA 2O6YA 1KQ7A 3OCEA 4NLEA 1HY0A 5F91A 3NO9A 2OHYA 3OCFA 2QVEA 3QBPA 4MX2A 5D6BA 3R6VA 2O7BA 1FUQA 1Y2MA 3RD8A 1RE5A 3KDZA 5HW2A 4V2QA 2PFMA 1K7WA 1J3UA 3E04A 1VDKA 4NSLA 2J91A 3KDYA 1TJUA 4BAAA 1B8FA 4ADLA 3CZOA 4BABA 1DOFA 4HGVA 1FUPA 2RJRA 1YFMA 3TV2A 1DCNA 1T6JA 3R6QA 1T6PA 1K62A 4EEIA 2O78A 2PTSA 1XWOA 2RJSA 1Q5NA 4FLCA 1TJWA 1C3CA 2PTRA 4APBA 2NYNA 1C3UA 1U15A 4ADMA 5F92A 1AUWA 4C5SA 2NYFA 2O7EA 1U16A 3RRPA 2X75A 4C5RA 2VD6A 1FUOA 3C8TA 2QGAB 1JSWA 3UNVA 1TJ7A 2PTQA 2O7DA 5EYTA 1TJVA 1FURA 1GKMA 1GK2A 3BHGA 1GKJA 1GK3A 4EFCA 2O7FA 3R6YA 1EB4A 4FFXA 1YISA 1I0AA 2E9FA 4C5UA 4APAA 1W27A 1HY1A 4C6GA 3GTDA
chains in the Genus database with same CATH superfamily
4MWOA 2JAOA 4CQ5A 3NZ4A 2HVGA 1YFEA 4NFLA 3GZHA 5EYVA 2YIIA 3U13A 4V2RA 2FUSA 2O6YA 1KQ7A 3OCEA 5H8WA 1Z4IA 1XLYA 4NLEA 1HY0A 5F91A 4YIKA 3NO9A 2OHYA 4L6CA 3OCFA 2QVEA 2D27A 3QBPA 4MX2A 5D6BA 3R6VA 2O7BA 1FUQA 1Y2MA 3RD8A 1RE5A 3U19A 3KDZA 1T9HA 4YIHA 2JAUA 4E88A 5HW2A 4V2QA 1IW7D 1Q92A 2PFMA 1K7WA 1J3UA 3E04A 1XMDA 1VDKA 2YV5A 4NSLA 3CRVA 2J91A 3KDYA 1TJUA 4L6AA 4BAAA 1B8FA 4ADLA 3CZOA 4BABA 1DOFA 3F4TA 4HGVA 5M0IA 1FUPA 2RJRA 3CI0K 1Z4KA 1U0LA 4MUMA 1YFMA 2I7DA 3TV2A 2VSFA 1DCNA 1T6JA 2FELA 3R6QA 1XMCA 3BWVA 1Z4QA 1T6PA 1K62A 4EEIA 4A15A 2O78A 4L57A 2PTSA 1Z4JA 3F4SA 1XL7A 1XWOA 2FENA 2RJSA 1Q5NA 4FLCA 1TJWA 1C3CA 2PTRA 2VL7A 4APBA 2D28C 2NYNA 1C3UA 1U15A 4ADMA 5F92A 1AUWA 4C5SA 4WNLA 2NYFA 2O7EA 1U16A 5M0JA 3RRPA 2X75A 4C5RA 2VD6A 1FUOA 3C8TA 2QGAB 1JSWA 3CRW1 3UNVA 1TJ7A 2PTQA 1MH9A 2O7DA 2RCNA 5EYTA 1TJVA 1FURA 1GKMA 1GK2A 3BHGA 3F4RA 1GKJA 1Z4PX 1GK3A 4EFCA 2O7FA 2JAWA 4IQJM 3R6YA 1Q91A 1EB4A 1XL8A 4FFXA 1Z4MA 1YISA 1I0AA 2E9FA 2JARA 1Z4LA 4C5UA 4APAA 1W27A 1HY1A 4C6GA 3GTDA
chains in the Genus database with same CATH topology
4CQ5A 3NZ4A 2HVGA 1YFEA 3GZHA 5EYVA 2YIIA 4V2RA 2FUSA 2O6YA 1KQ7A 3OCEA 4NLEA 1HY0A 5F91A 3NO9A 2OHYA 3OCFA 2QVEA 3QBPA 4MX2A 5D6BA 3R6VA 2O7BA 1FUQA 1Y2MA 3RD8A 1RE5A 3KDZA 5HW2A 4V2QA 2PFMA 1K7WA 1J3UA 3E04A 1VDKA 4NSLA 2J91A 3KDYA 1TJUA 4BAAA 1B8FA 4ADLA 3CZOA 4BABA 1DOFA 4HGVA 1FUPA 2RJRA 1YFMA 3TV2A 1DCNA 1T6JA 3R6QA 1T6PA 1K62A 4EEIA 2O78A 2PTSA 1XWOA 2RJSA 1Q5NA 4FLCA 1TJWA 1C3CA 2PTRA 4APBA 2NYNA 1C3UA 1U15A 4ADMA 5F92A 1AUWA 4C5SA 2NYFA 2O7EA 1U16A 3RRPA 2X75A 4C5RA 2VD6A 1FUOA 3C8TA 2QGAB 1JSWA 3UNVA 1TJ7A 2PTQA 2O7DA 5EYTA 1TJVA 1FURA 1GKMA 1GK2A 3BHGA 1GKJA 1GK3A 4EFCA 2O7FA 3R6YA 1EB4A 4FFXA 1YISA 1I0AA 2E9FA 4C5UA 4APAA 1W27A 1HY1A 4C6GA 3GTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CQ5 A;  3NZ4 A;  2HVG A;  1YFE A;  3GZH A;  5EYV A;  2YII A;  4V2R A;  2FUS A;  2O6Y A;  1KQ7 A;  3OCE A;  4NLE A;  1HY0 A;  5F91 A;  3NO9 A;  2OHY A;  3OCF A;  2QVE A;  3QBP A;  4MX2 A;  5D6B A;  3R6V A;  2O7B A;  1FUQ A;  1Y2M A;  3RD8 A;  1RE5 A;  3KDZ A;  5HW2 A;  4V2Q A;  2PFM A;  1K7W A;  1J3U A;  3E04 A;  1VDK A;  4NSL A;  2J91 A;  3KDY A;  1TJU A;  4BAA A;  1B8F A;  4ADL A;  3CZO A;  4BAB A;  1DOF A;  4HGV A;  1FUP A;  2RJR A;  1YFM A;  3TV2 A;  1DCN A;  1T6J A;  3R6Q A;  1T6P A;  1K62 A;  4EEI A;  2O78 A;  2PTS A;  1XWO A;  2RJS A;  1Q5N A;  4FLC A;  1TJW A;  1C3C A;  2PTR A;  4APB A;  2NYN A;  1C3U A;  1U15 A;  4ADM A;  5F92 A;  1AUW A;  4C5S A;  2NYF A;  2O7E A;  1U16 A;  3RRP A;  2X75 A;  4C5R A;  2VD6 A;  1FUO A;  3C8T A;  2QGA B;  1JSW A;  3UNV A;  1TJ7 A;  2PTQ A;  2O7D A;  5EYT A;  1TJV A;  1FUR A;  1GKM A;  1GK2 A;  3BHG A;  1GKJ A;  1GK3 A;  4EFC A;  2O7F A;  3R6Y A;  1EB4 A;  4FFX A;  1YIS A;  1I0A A;  2E9F A;  4C5U A;  4APA A;  1W27 A;  1HY1 A;  4C6G A;  3GTD A; 
#chains in the Genus database with same CATH topology
 4MWO A;  2JAO A;  4CQ5 A;  3NZ4 A;  2HVG A;  1YFE A;  4NFL A;  3GZH A;  5EYV A;  2YII A;  3U13 A;  4V2R A;  2FUS A;  2O6Y A;  1KQ7 A;  3OCE A;  5H8W A;  1Z4I A;  1XLY A;  4NLE A;  1HY0 A;  5F91 A;  4YIK A;  3NO9 A;  2OHY A;  4L6C A;  3OCF A;  2QVE A;  2D27 A;  3QBP A;  4MX2 A;  5D6B A;  3R6V A;  2O7B A;  1FUQ A;  1Y2M A;  3RD8 A;  1RE5 A;  3U19 A;  3KDZ A;  1T9H A;  4YIH A;  2JAU A;  4E88 A;  5HW2 A;  4V2Q A;  1IW7 D;  1Q92 A;  2PFM A;  1K7W A;  1J3U A;  3E04 A;  1XMD A;  1VDK A;  2YV5 A;  4NSL A;  3CRV A;  2J91 A;  3KDY A;  1TJU A;  4L6A A;  4BAA A;  1B8F A;  4ADL A;  3CZO A;  4BAB A;  1DOF A;  3F4T A;  4HGV A;  5M0I A;  1FUP A;  2RJR A;  3CI0 K;  1Z4K A;  1U0L A;  4MUM A;  1YFM A;  2I7D A;  3TV2 A;  2VSF A;  1DCN A;  1T6J A;  2FEL A;  3R6Q A;  1XMC A;  3BWV A;  1Z4Q A;  1T6P A;  1K62 A;  4EEI A;  4A15 A;  2O78 A;  4L57 A;  2PTS A;  1Z4J A;  3F4S A;  1XL7 A;  1XWO A;  2FEN A;  2RJS A;  1Q5N A;  4FLC A;  1TJW A;  1C3C A;  2PTR A;  2VL7 A;  4APB A;  2D28 C;  2NYN A;  1C3U A;  1U15 A;  4ADM A;  5F92 A;  1AUW A;  4C5S A;  4WNL A;  2NYF A;  2O7E A;  1U16 A;  5M0J A;  3RRP A;  2X75 A;  4C5R A;  2VD6 A;  1FUO A;  3C8T A;  2QGA B;  1JSW A;  3CRW 1;  3UNV A;  1TJ7 A;  2PTQ A;  1MH9 A;  2O7D A;  2RCN A;  5EYT A;  1TJV A;  1FUR A;  1GKM A;  1GK2 A;  3BHG A;  3F4R A;  1GKJ A;  1Z4P X;  1GK3 A;  4EFC A;  2O7F A;  2JAW A;  4IQJ M;  3R6Y A;  1Q91 A;  1EB4 A;  1XL8 A;  4FFX A;  1Z4M A;  1YIS A;  1I0A A;  2E9F A;  2JAR A;  1Z4L A;  4C5U A;  4APA A;  1W27 A;  1HY1 A;  4C6G A;  3GTD A; 
#chains in the Genus database with same CATH homology
 4CQ5 A;  3NZ4 A;  2HVG A;  1YFE A;  3GZH A;  5EYV A;  2YII A;  4V2R A;  2FUS A;  2O6Y A;  1KQ7 A;  3OCE A;  4NLE A;  1HY0 A;  5F91 A;  3NO9 A;  2OHY A;  3OCF A;  2QVE A;  3QBP A;  4MX2 A;  5D6B A;  3R6V A;  2O7B A;  1FUQ A;  1Y2M A;  3RD8 A;  1RE5 A;  3KDZ A;  5HW2 A;  4V2Q A;  2PFM A;  1K7W A;  1J3U A;  3E04 A;  1VDK A;  4NSL A;  2J91 A;  3KDY A;  1TJU A;  4BAA A;  1B8F A;  4ADL A;  3CZO A;  4BAB A;  1DOF A;  4HGV A;  1FUP A;  2RJR A;  1YFM A;  3TV2 A;  1DCN A;  1T6J A;  3R6Q A;  1T6P A;  1K62 A;  4EEI A;  2O78 A;  2PTS A;  1XWO A;  2RJS A;  1Q5N A;  4FLC A;  1TJW A;  1C3C A;  2PTR A;  4APB A;  2NYN A;  1C3U A;  1U15 A;  4ADM A;  5F92 A;  1AUW A;  4C5S A;  2NYF A;  2O7E A;  1U16 A;  3RRP A;  2X75 A;  4C5R A;  2VD6 A;  1FUO A;  3C8T A;  2QGA B;  1JSW A;  3UNV A;  1TJ7 A;  2PTQ A;  2O7D A;  5EYT A;  1TJV A;  1FUR A;  1GKM A;  1GK2 A;  3BHG A;  1GKJ A;  1GK3 A;  4EFC A;  2O7F A;  3R6Y A;  1EB4 A;  4FFX A;  1YIS A;  1I0A A;  2E9F A;  4C5U A;  4APA A;  1W27 A;  1HY1 A;  4C6G A;  3GTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...