1VDKA

Crystal structure of fumarase from thermus thermophilus hb8
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
460
structure length
458
Chain Sequence
RIERDTMGEVRVPADKYWGAQTQRSLENFRIGTDRFRMPLEIIRAYGMLKKAAARANLELGELPEEIAKAIIQAAEEVVQGKWDDHFPLVVFQTGSGTQTNMNVNEVIANRASEILGKPLGSKYAHPNDHVNRGQSSNDTFPTAMYVAVALALHQRLYPAVEGLIRTFTAKAQAFDQIVKVGRTHLMDAVPITLGQEIGSWAAQLKTTLAAVKEMEKGLYNLAIGGTAVGTGLNAHPRFGELVAKYLAEETGLPFRVAENRFAALAAHDELVNVMGAIRTLAGALMKIGNDVRWLASGPYAGIGEITIPANEPGSSIMPGKVNPTQVEALTMVVVRVYGNDHTVAFAGSQGNFQLNVYKPVMAYSTLESINLLADAVASFDAHLAQGIEPNLERIEEYLQKNPMLATALNKAIGYDKAAEIVKKALKKTLKQAALELGYLTEEEFDRIVVPMRLAKPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Fumarate hydratase class II
publication title Crystal structure of fumarase from thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 173
structure length 458
sequence length 460
chains with identical sequence B
ec nomenclature ec 4.2.1.2: Fumarate hydratase.
pdb deposition date 2004-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF10415 FumaraseC_C Fumarase C C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 1vdkA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 1vdkA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 1vdkA02
2PTSA 3E04A 4APBA 1B8FA 4C5UA 1T6JA 2O7DA 3RRPA 1YFMA 1GK3A 2O78A 3R6YA 2NYFA 1GKJA 2QGAB 1HY1A 1YISA 4V2QA 4C5RA 3KDZA 1C3CA 1K7WA 2VD6A 4BAAA 1YFEA 3R6QA 4C5SA 4BABA 4FLCA 2E9FA 1AUWA 5EYTA 2YIIA 5F91A 2RJSA 3OCFA 4C6GA 4CQ5A 1DOFA 1TJWA 1RE5A 4APAA 2FUSA 2O7BA 4MX2A 1XWOA 1GKMA 1KQ7A 1FUQA 2PFMA 1JSWA 4EEIA 1Y2MA 2O7FA 3R6VA 2OHYA 3KDYA 2O7EA 4ADMA 2RJRA 4NSLA 1C3UA 3NO9A 2QVEA 1T6PA 4FFXA 2NYNA 5EYVA 1I0AA 3OCEA 1W27A 1TJ7A 1FURA 4ADLA 1U15A 1J3UA 1FUPA 3QBPA 1FUOA 3CZOA 1TJVA 2HVGA 1K62A 4EFCA 3NZ4A 2PTRA 1GK2A 3UNVA 1VDKA 1Q5NA 4NLEA 3TV2A 3RD8A 2J91A 5D6BA 3BHGA 5F92A 3GTDA 1TJUA 4V2RA 1EB4A 1U16A 5HW2A 2X75A 4HGVA 2PTQA 3C8TA 1DCNA 3GZHA 1HY0A 2O6YA
chains in the Genus database with same CATH superfamily
1MH9A 1IW7D 2PTSA 5M0JA 3E04A 4MUMA 4APBA 1XL7A 1B8FA 2JAUA 4C5UA 3CRVA 4L6CA 1T6JA 2O7DA 3RRPA 1YFMA 1Z4QA 1GK3A 2VL7A 5M0IA 1Z4JA 2O78A 3R6YA 2D27A 2NYFA 3U19A 1GKJA 2QGAB 1HY1A 1YISA 4V2QA 4C5RA 3KDZA 3CRW1 1C3CA 1K7WA 2FELA 2VD6A 4BAAA 1YFEA 3R6QA 3F4SA 3F4RA 4C5SA 4BABA 4MWOA 2FENA 2VSFA 4FLCA 2E9FA 1AUWA 5EYTA 2YIIA 5F91A 1Q91A 2RJSA 3OCFA 4C6GA 4CQ5A 1DOFA 1TJWA 1RE5A 4APAA 2FUSA 2O7BA 4MX2A 1XWOA 1GKMA 1KQ7A 1FUQA 2PFMA 1JSWA 4EEIA 1Y2MA 2O7FA 3R6VA 2OHYA 3KDYA 2O7EA 4YIHA 4ADMA 2RJRA 4NSLA 1C3UA 3NO9A 2QVEA 2JARA 1Z4MA 1T6PA 2JAWA 1XMDA 4FFXA 3CI0K 1Z4LA 2NYNA 1Q92A 4NFLA 5EYVA 1I0AA 3F4TA 3OCEA 4L6AA 1XMCA 4L57A 4WNLA 1W27A 1TJ7A 1FURA 4ADLA 1U15A 4YIKA 1J3UA 3U13A 4E88A 4IQJM 4A15A 1FUPA 3QBPA 1Z4PX 1FUOA 2D28C 3CZOA 1T9HA 1TJVA 2HVGA 1K62A 1U0LA 4EFCA 5H8WA 3NZ4A 2PTRA 1GK2A 3UNVA 1VDKA 2RCNA 1Q5NA 2JAOA 4NLEA 3TV2A 3BWVA 1XLYA 3RD8A 2J91A 2YV5A 5D6BA 3BHGA 5F92A 1Z4KA 3GTDA 1TJUA 2I7DA 4V2RA 1EB4A 1U16A 5HW2A 2X75A 4HGVA 1XL8A 2PTQA 3C8TA 1DCNA 1Z4IA 3GZHA 1HY0A 2O6YA
chains in the Genus database with same CATH topology
2PTSA 3E04A 4APBA 1B8FA 4C5UA 1T6JA 2O7DA 3RRPA 1YFMA 1GK3A 2O78A 3R6YA 2NYFA 1GKJA 2QGAB 1HY1A 1YISA 4V2QA 4C5RA 3KDZA 1C3CA 1K7WA 2VD6A 4BAAA 1YFEA 3R6QA 4C5SA 4BABA 4FLCA 2E9FA 1AUWA 5EYTA 2YIIA 5F91A 2RJSA 3OCFA 4C6GA 4CQ5A 1DOFA 1TJWA 1RE5A 4APAA 2FUSA 2O7BA 4MX2A 1XWOA 1GKMA 1KQ7A 1FUQA 2PFMA 1JSWA 4EEIA 1Y2MA 2O7FA 3R6VA 2OHYA 3KDYA 2O7EA 4ADMA 2RJRA 4NSLA 1C3UA 3NO9A 2QVEA 1T6PA 4FFXA 2NYNA 5EYVA 1I0AA 3OCEA 1W27A 1TJ7A 1FURA 4ADLA 1U15A 1J3UA 1FUPA 3QBPA 1FUOA 3CZOA 1TJVA 2HVGA 1K62A 4EFCA 3NZ4A 2PTRA 1GK2A 3UNVA 1VDKA 1Q5NA 4NLEA 3TV2A 3RD8A 2J91A 5D6BA 3BHGA 5F92A 3GTDA 1TJUA 4V2RA 1EB4A 1U16A 5HW2A 2X75A 4HGVA 2PTQA 3C8TA 1DCNA 3GZHA 1HY0A 2O6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PTS A;  3E04 A;  4APB A;  1B8F A;  4C5U A;  1T6J A;  2O7D A;  3RRP A;  1YFM A;  1GK3 A;  2O78 A;  3R6Y A;  2NYF A;  1GKJ A;  2QGA B;  1HY1 A;  1YIS A;  4V2Q A;  4C5R A;  3KDZ A;  1C3C A;  1K7W A;  2VD6 A;  4BAA A;  1YFE A;  3R6Q A;  4C5S A;  4BAB A;  4FLC A;  2E9F A;  1AUW A;  5EYT A;  2YII A;  5F91 A;  2RJS A;  3OCF A;  4C6G A;  4CQ5 A;  1DOF A;  1TJW A;  1RE5 A;  4APA A;  2FUS A;  2O7B A;  4MX2 A;  1XWO A;  1GKM A;  1KQ7 A;  1FUQ A;  2PFM A;  1JSW A;  4EEI A;  1Y2M A;  2O7F A;  3R6V A;  2OHY A;  3KDY A;  2O7E A;  4ADM A;  2RJR A;  4NSL A;  1C3U A;  3NO9 A;  2QVE A;  1T6P A;  4FFX A;  2NYN A;  5EYV A;  1I0A A;  3OCE A;  1W27 A;  1TJ7 A;  1FUR A;  4ADL A;  1U15 A;  1J3U A;  1FUP A;  3QBP A;  1FUO A;  3CZO A;  1TJV A;  2HVG A;  1K62 A;  4EFC A;  3NZ4 A;  2PTR A;  1GK2 A;  3UNV A;  1VDK A;  1Q5N A;  4NLE A;  3TV2 A;  3RD8 A;  2J91 A;  5D6B A;  3BHG A;  5F92 A;  3GTD A;  1TJU A;  4V2R A;  1EB4 A;  1U16 A;  5HW2 A;  2X75 A;  4HGV A;  2PTQ A;  3C8T A;  1DCN A;  3GZH A;  1HY0 A;  2O6Y A; 
#chains in the Genus database with same CATH topology
 1MH9 A;  1IW7 D;  2PTS A;  5M0J A;  3E04 A;  4MUM A;  4APB A;  1XL7 A;  1B8F A;  2JAU A;  4C5U A;  3CRV A;  4L6C A;  1T6J A;  2O7D A;  3RRP A;  1YFM A;  1Z4Q A;  1GK3 A;  2VL7 A;  5M0I A;  1Z4J A;  2O78 A;  3R6Y A;  2D27 A;  2NYF A;  3U19 A;  1GKJ A;  2QGA B;  1HY1 A;  1YIS A;  4V2Q A;  4C5R A;  3KDZ A;  3CRW 1;  1C3C A;  1K7W A;  2FEL A;  2VD6 A;  4BAA A;  1YFE A;  3R6Q A;  3F4S A;  3F4R A;  4C5S A;  4BAB A;  4MWO A;  2FEN A;  2VSF A;  4FLC A;  2E9F A;  1AUW A;  5EYT A;  2YII A;  5F91 A;  1Q91 A;  2RJS A;  3OCF A;  4C6G A;  4CQ5 A;  1DOF A;  1TJW A;  1RE5 A;  4APA A;  2FUS A;  2O7B A;  4MX2 A;  1XWO A;  1GKM A;  1KQ7 A;  1FUQ A;  2PFM A;  1JSW A;  4EEI A;  1Y2M A;  2O7F A;  3R6V A;  2OHY A;  3KDY A;  2O7E A;  4YIH A;  4ADM A;  2RJR A;  4NSL A;  1C3U A;  3NO9 A;  2QVE A;  2JAR A;  1Z4M A;  1T6P A;  2JAW A;  1XMD A;  4FFX A;  3CI0 K;  1Z4L A;  2NYN A;  1Q92 A;  4NFL A;  5EYV A;  1I0A A;  3F4T A;  3OCE A;  4L6A A;  1XMC A;  4L57 A;  4WNL A;  1W27 A;  1TJ7 A;  1FUR A;  4ADL A;  1U15 A;  4YIK A;  1J3U A;  3U13 A;  4E88 A;  4IQJ M;  4A15 A;  1FUP A;  3QBP A;  1Z4P X;  1FUO A;  2D28 C;  3CZO A;  1T9H A;  1TJV A;  2HVG A;  1K62 A;  1U0L A;  4EFC A;  5H8W A;  3NZ4 A;  2PTR A;  1GK2 A;  3UNV A;  1VDK A;  2RCN A;  1Q5N A;  2JAO A;  4NLE A;  3TV2 A;  3BWV A;  1XLY A;  3RD8 A;  2J91 A;  2YV5 A;  5D6B A;  3BHG A;  5F92 A;  1Z4K A;  3GTD A;  1TJU A;  2I7D A;  4V2R A;  1EB4 A;  1U16 A;  5HW2 A;  2X75 A;  4HGV A;  1XL8 A;  2PTQ A;  3C8T A;  1DCN A;  1Z4I A;  3GZH A;  1HY0 A;  2O6Y A; 
#chains in the Genus database with same CATH homology
 2PTS A;  3E04 A;  4APB A;  1B8F A;  4C5U A;  1T6J A;  2O7D A;  3RRP A;  1YFM A;  1GK3 A;  2O78 A;  3R6Y A;  2NYF A;  1GKJ A;  2QGA B;  1HY1 A;  1YIS A;  4V2Q A;  4C5R A;  3KDZ A;  1C3C A;  1K7W A;  2VD6 A;  4BAA A;  1YFE A;  3R6Q A;  4C5S A;  4BAB A;  4FLC A;  2E9F A;  1AUW A;  5EYT A;  2YII A;  5F91 A;  2RJS A;  3OCF A;  4C6G A;  4CQ5 A;  1DOF A;  1TJW A;  1RE5 A;  4APA A;  2FUS A;  2O7B A;  4MX2 A;  1XWO A;  1GKM A;  1KQ7 A;  1FUQ A;  2PFM A;  1JSW A;  4EEI A;  1Y2M A;  2O7F A;  3R6V A;  2OHY A;  3KDY A;  2O7E A;  4ADM A;  2RJR A;  4NSL A;  1C3U A;  3NO9 A;  2QVE A;  1T6P A;  4FFX A;  2NYN A;  5EYV A;  1I0A A;  3OCE A;  1W27 A;  1TJ7 A;  1FUR A;  4ADL A;  1U15 A;  1J3U A;  1FUP A;  3QBP A;  1FUO A;  3CZO A;  1TJV A;  2HVG A;  1K62 A;  4EFC A;  3NZ4 A;  2PTR A;  1GK2 A;  3UNV A;  1VDK A;  1Q5N A;  4NLE A;  3TV2 A;  3RD8 A;  2J91 A;  5D6B A;  3BHG A;  5F92 A;  3GTD A;  1TJU A;  4V2R A;  1EB4 A;  1U16 A;  5HW2 A;  2X75 A;  4HGV A;  2PTQ A;  3C8T A;  1DCN A;  3GZH A;  1HY0 A;  2O6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...