1VDKA

Crystal structure of fumarase from thermus thermophilus hb8
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
460
structure length
458
Chain Sequence
RIERDTMGEVRVPADKYWGAQTQRSLENFRIGTDRFRMPLEIIRAYGMLKKAAARANLELGELPEEIAKAIIQAAEEVVQGKWDDHFPLVVFQTGSGTQTNMNVNEVIANRASEILGKPLGSKYAHPNDHVNRGQSSNDTFPTAMYVAVALALHQRLYPAVEGLIRTFTAKAQAFDQIVKVGRTHLMDAVPITLGQEIGSWAAQLKTTLAAVKEMEKGLYNLAIGGTAVGTGLNAHPRFGELVAKYLAEETGLPFRVAENRFAALAAHDELVNVMGAIRTLAGALMKIGNDVRWLASGPYAGIGEITIPANEPGSSIMPGKVNPTQVEALTMVVVRVYGNDHTVAFAGSQGNFQLNVYKPVMAYSTLESINLLADAVASFDAHLAQGIEPNLERIEEYLQKNPMLATALNKAIGYDKAAEIVKKALKKTLKQAALELGYLTEEEFDRIVVPMRLAKPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fumarate hydratase class II
publication title Crystal structure of fumarase from thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Lyase
total genus 173
structure length 458
sequence length 460
chains with identical sequence B
ec nomenclature ec 4.2.1.2: Fumarate hydratase.
pdb deposition date 2004-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF10415 FumaraseC_C Fumarase C C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 1vdkA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 1vdkA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 1vdkA02
3R6QA 3E04A 2RJSA 1J3UA 2O7EA 5F92A 5EYTA 2RJRA 1W27A 1VDKA 2NYFA 4BABA 3GTDA 1EB4A 3OCEA 1Q5NA 3R6YA 5HW2A 1C3UA 1KQ7A 3QBPA 2PTSA 1Y2MA 4C5SA 3KDYA 3CZOA 1FUOA 3C8TA 4HGVA 1K62A 1FUQA 3KDZA 1TJUA 1XWOA 4NLEA 2O7DA 2E9FA 4C5UA 4CQ5A 3OCFA 1T6PA 3GZHA 4V2QA 5EYVA 3BHGA 2O78A 2QVEA 2VD6A 4V2RA 2J91A 2QGAB 1YFMA 3RRPA 4FFXA 4C5RA 1GKJA 2O7FA 1GKMA 3NO9A 2YIIA 2PFMA 4ADMA 1C3CA 2NYNA 4APBA 1YFEA 1TJVA 3NZ4A 1YISA 1HY1A 2O6YA 3TV2A 1U15A 4NSLA 1RE5A 2PTRA 2HVGA 1GK2A 2PTQA 2X75A 1I0AA 3R6VA 1HY0A 1U16A 1FURA 2OHYA 4C6GA 1FUPA 4EFCA 4ADLA 1B8FA 2O7BA 1DCNA 4APAA 2FUSA 1T6JA 1GK3A 3UNVA 1TJWA 4EEIA 1DOFA 5F91A 1AUWA 5D6BA 1TJ7A 3RD8A 4BAAA 4FLCA 4MX2A 1K7WA 1JSWA
chains in the Genus database with same CATH superfamily
4MUMA 3R6QA 3E04A 2RJSA 1J3UA 3BWVA 2O7EA 5F92A 5EYTA 2VSFA 2RJRA 4E88A 1W27A 1U0LA 1VDKA 1Z4JA 2D27A 2VL7A 2NYFA 4BABA 3GTDA 1EB4A 3OCEA 1Q5NA 1Z4QA 3R6YA 4L57A 5HW2A 1Z4LA 1C3UA 1KQ7A 3QBPA 2PTSA 1Y2MA 4C5SA 1XL8A 3KDYA 3CZOA 1FUOA 3C8TA 4HGVA 1IW7D 2JAWA 5H8WA 1K62A 3CRVA 1FUQA 3KDZA 1TJUA 1XWOA 4NLEA 2O7DA 2E9FA 4C5UA 4CQ5A 3OCFA 1T6PA 1Z4IA 1XL7A 3GZHA 4V2QA 5EYVA 4A15A 3BHGA 1XMDA 2O78A 2QVEA 4MWOA 1Q91A 2I7DA 2VD6A 4IQJM 4V2RA 1MH9A 2J91A 2QGAB 1YFMA 3RRPA 4FFXA 2FENA 4C5RA 1GKJA 2O7FA 1GKMA 3NO9A 4L6CA 2YIIA 1Z4PX 2PFMA 4ADMA 1C3CA 1Z4KA 2D28C 3F4RA 5M0JA 4NFLA 4APBA 2NYNA 1YFEA 2JAUA 1TJVA 3NZ4A 1YISA 1HY1A 2JARA 4YIKA 3TV2A 2O6YA 1U15A 5M0IA 4NSLA 1RE5A 1T9HA 2YV5A 2PTRA 2HVGA 1GK2A 2PTQA 4YIHA 2X75A 1I0AA 3R6VA 1HY0A 1U16A 1FURA 2OHYA 4C6GA 4WNLA 1FUPA 1XMCA 1Q92A 4EFCA 2FELA 4ADLA 1B8FA 2O7BA 1DCNA 3U13A 3F4SA 3F4TA 4APAA 2FUSA 2RCNA 1GK3A 1T6JA 3UNVA 2JAOA 4L6AA 1TJWA 4EEIA 3CRW1 1XLYA 1DOFA 5F91A 1AUWA 5D6BA 3U19A 1TJ7A 1Z4MA 3RD8A 4BAAA 4FLCA 4MX2A 1K7WA 1JSWA 3CI0K
chains in the Genus database with same CATH topology
3R6QA 3E04A 2RJSA 1J3UA 2O7EA 5F92A 5EYTA 2RJRA 1W27A 1VDKA 2NYFA 4BABA 3GTDA 1EB4A 3OCEA 1Q5NA 3R6YA 5HW2A 1C3UA 1KQ7A 3QBPA 2PTSA 1Y2MA 4C5SA 3KDYA 3CZOA 1FUOA 3C8TA 4HGVA 1K62A 1FUQA 3KDZA 1TJUA 1XWOA 4NLEA 2O7DA 2E9FA 4C5UA 4CQ5A 3OCFA 1T6PA 3GZHA 4V2QA 5EYVA 3BHGA 2O78A 2QVEA 2VD6A 4V2RA 2J91A 2QGAB 1YFMA 3RRPA 4FFXA 4C5RA 1GKJA 2O7FA 1GKMA 3NO9A 2YIIA 2PFMA 4ADMA 1C3CA 2NYNA 4APBA 1YFEA 1TJVA 3NZ4A 1YISA 1HY1A 2O6YA 3TV2A 1U15A 4NSLA 1RE5A 2PTRA 2HVGA 1GK2A 2PTQA 2X75A 1I0AA 3R6VA 1HY0A 1U16A 1FURA 2OHYA 4C6GA 1FUPA 4EFCA 4ADLA 1B8FA 2O7BA 1DCNA 4APAA 2FUSA 1T6JA 1GK3A 3UNVA 1TJWA 4EEIA 1DOFA 5F91A 1AUWA 5D6BA 1TJ7A 3RD8A 4BAAA 4FLCA 4MX2A 1K7WA 1JSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R6Q A;  3E04 A;  2RJS A;  1J3U A;  2O7E A;  5F92 A;  5EYT A;  2RJR A;  1W27 A;  1VDK A;  2NYF A;  4BAB A;  3GTD A;  1EB4 A;  3OCE A;  1Q5N A;  3R6Y A;  5HW2 A;  1C3U A;  1KQ7 A;  3QBP A;  2PTS A;  1Y2M A;  4C5S A;  3KDY A;  3CZO A;  1FUO A;  3C8T A;  4HGV A;  1K62 A;  1FUQ A;  3KDZ A;  1TJU A;  1XWO A;  4NLE A;  2O7D A;  2E9F A;  4C5U A;  4CQ5 A;  3OCF A;  1T6P A;  3GZH A;  4V2Q A;  5EYV A;  3BHG A;  2O78 A;  2QVE A;  2VD6 A;  4V2R A;  2J91 A;  2QGA B;  1YFM A;  3RRP A;  4FFX A;  4C5R A;  1GKJ A;  2O7F A;  1GKM A;  3NO9 A;  2YII A;  2PFM A;  4ADM A;  1C3C A;  2NYN A;  4APB A;  1YFE A;  1TJV A;  3NZ4 A;  1YIS A;  1HY1 A;  2O6Y A;  3TV2 A;  1U15 A;  4NSL A;  1RE5 A;  2PTR A;  2HVG A;  1GK2 A;  2PTQ A;  2X75 A;  1I0A A;  3R6V A;  1HY0 A;  1U16 A;  1FUR A;  2OHY A;  4C6G A;  1FUP A;  4EFC A;  4ADL A;  1B8F A;  2O7B A;  1DCN A;  4APA A;  2FUS A;  1T6J A;  1GK3 A;  3UNV A;  1TJW A;  4EEI A;  1DOF A;  5F91 A;  1AUW A;  5D6B A;  1TJ7 A;  3RD8 A;  4BAA A;  4FLC A;  4MX2 A;  1K7W A;  1JSW A; 
#chains in the Genus database with same CATH topology
 4MUM A;  3R6Q A;  3E04 A;  2RJS A;  1J3U A;  3BWV A;  2O7E A;  5F92 A;  5EYT A;  2VSF A;  2RJR A;  4E88 A;  1W27 A;  1U0L A;  1VDK A;  1Z4J A;  2D27 A;  2VL7 A;  2NYF A;  4BAB A;  3GTD A;  1EB4 A;  3OCE A;  1Q5N A;  1Z4Q A;  3R6Y A;  4L57 A;  5HW2 A;  1Z4L A;  1C3U A;  1KQ7 A;  3QBP A;  2PTS A;  1Y2M A;  4C5S A;  1XL8 A;  3KDY A;  3CZO A;  1FUO A;  3C8T A;  4HGV A;  1IW7 D;  2JAW A;  5H8W A;  1K62 A;  3CRV A;  1FUQ A;  3KDZ A;  1TJU A;  1XWO A;  4NLE A;  2O7D A;  2E9F A;  4C5U A;  4CQ5 A;  3OCF A;  1T6P A;  1Z4I A;  1XL7 A;  3GZH A;  4V2Q A;  5EYV A;  4A15 A;  3BHG A;  1XMD A;  2O78 A;  2QVE A;  4MWO A;  1Q91 A;  2I7D A;  2VD6 A;  4IQJ M;  4V2R A;  1MH9 A;  2J91 A;  2QGA B;  1YFM A;  3RRP A;  4FFX A;  2FEN A;  4C5R A;  1GKJ A;  2O7F A;  1GKM A;  3NO9 A;  4L6C A;  2YII A;  1Z4P X;  2PFM A;  4ADM A;  1C3C A;  1Z4K A;  2D28 C;  3F4R A;  5M0J A;  4NFL A;  4APB A;  2NYN A;  1YFE A;  2JAU A;  1TJV A;  3NZ4 A;  1YIS A;  1HY1 A;  2JAR A;  4YIK A;  3TV2 A;  2O6Y A;  1U15 A;  5M0I A;  4NSL A;  1RE5 A;  1T9H A;  2YV5 A;  2PTR A;  2HVG A;  1GK2 A;  2PTQ A;  4YIH A;  2X75 A;  1I0A A;  3R6V A;  1HY0 A;  1U16 A;  1FUR A;  2OHY A;  4C6G A;  4WNL A;  1FUP A;  1XMC A;  1Q92 A;  4EFC A;  2FEL A;  4ADL A;  1B8F A;  2O7B A;  1DCN A;  3U13 A;  3F4S A;  3F4T A;  4APA A;  2FUS A;  2RCN A;  1GK3 A;  1T6J A;  3UNV A;  2JAO A;  4L6A A;  1TJW A;  4EEI A;  3CRW 1;  1XLY A;  1DOF A;  5F91 A;  1AUW A;  5D6B A;  3U19 A;  1TJ7 A;  1Z4M A;  3RD8 A;  4BAA A;  4FLC A;  4MX2 A;  1K7W A;  1JSW A;  3CI0 K; 
#chains in the Genus database with same CATH homology
 3R6Q A;  3E04 A;  2RJS A;  1J3U A;  2O7E A;  5F92 A;  5EYT A;  2RJR A;  1W27 A;  1VDK A;  2NYF A;  4BAB A;  3GTD A;  1EB4 A;  3OCE A;  1Q5N A;  3R6Y A;  5HW2 A;  1C3U A;  1KQ7 A;  3QBP A;  2PTS A;  1Y2M A;  4C5S A;  3KDY A;  3CZO A;  1FUO A;  3C8T A;  4HGV A;  1K62 A;  1FUQ A;  3KDZ A;  1TJU A;  1XWO A;  4NLE A;  2O7D A;  2E9F A;  4C5U A;  4CQ5 A;  3OCF A;  1T6P A;  3GZH A;  4V2Q A;  5EYV A;  3BHG A;  2O78 A;  2QVE A;  2VD6 A;  4V2R A;  2J91 A;  2QGA B;  1YFM A;  3RRP A;  4FFX A;  4C5R A;  1GKJ A;  2O7F A;  1GKM A;  3NO9 A;  2YII A;  2PFM A;  4ADM A;  1C3C A;  2NYN A;  4APB A;  1YFE A;  1TJV A;  3NZ4 A;  1YIS A;  1HY1 A;  2O6Y A;  3TV2 A;  1U15 A;  4NSL A;  1RE5 A;  2PTR A;  2HVG A;  1GK2 A;  2PTQ A;  2X75 A;  1I0A A;  3R6V A;  1HY0 A;  1U16 A;  1FUR A;  2OHY A;  4C6G A;  1FUP A;  4EFC A;  4ADL A;  1B8F A;  2O7B A;  1DCN A;  4APA A;  2FUS A;  1T6J A;  1GK3 A;  3UNV A;  1TJW A;  4EEI A;  1DOF A;  5F91 A;  1AUW A;  5D6B A;  1TJ7 A;  3RD8 A;  4BAA A;  4FLC A;  4MX2 A;  1K7W A;  1JSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...