3F4RA

Crystal structure of wolbachia pipientis alpha-dsba1
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
199
structure length
199
Chain Sequence
b'TSNELLLPLPNDKLLGDPKAPILMIEYASLTCYHCSLFHRNVFPKIKEKYIDTGKMLYIFRHFPLDYRGLKAAMLSHCYEKQEDYFNFNKAVFNSIDSWNYYNLSDLTLLQRIAALSNLKQDAFNQCINDKKIMDKIVNDKSLAINKLGITATPIFFIKLNDDKSYIEHNKVKHGGYKELKYFTNVIDKLYGKAIVKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structural and Functional Characterization of the Oxidoreductase alpha-DsbA1 from Wolbachia pipientis
pubmed doi rcsb
source organism Wolbachia pipientis
molecule tags Oxidoreductase
total genus 76
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2008-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.80 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Ribonucleotide Reductase Protein R1; domain 1 3f4rA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3f4rA01
1A8YA 3EU3A 4X0XA 5ECHB 2F3MA 1C72A 1U6TA 4L5LA 6GSXA 2AHEA 2V2GA 5ELGA 4OMVA 6GSWA 2EIRA 1QXHA 3DWVA 3MDKA 1OE7A 4MMMA 1ZCPA 4DVCA 5CRDA 22GSA 1MDKA 3RHCA 1SL2B 3DXBA 3L9UA 4LL1B 5G30A 4KDYA 3TGZA 1XW6A 4HZ2A 4K1FA 3IAS2 4CHSA 4RI6A 4FYCA 3A2VA 3GKXA 3TKPA 2OE0A 4BA7A 3U6VA 2LKUA 4TKYA 2B7JA 2I1UA 4IQ1A 2O8VB 4ZB8A 3TDGA 3LG6A 3U5RE 2H0GA 3IAM2 1TRVA 2WGRA 2H74A 2DJ1A 19GSA 2IMFA 2WS2A 4J56E 5EY6A 1AQVA 1DSBA 4IBPA 1DE1A 3FHKA 2C8UA 1QMVA 1ON4A 5IMDA 5DALA 2B3SA 2OACA 1BYEA 3TKSC 4FO5A 3APOA 1PL1A 4O32A 4BVYA 1PX7A 4PNFA 1A0RP 5J9CA 2ZNMA 1GNEA 3IA1A 3KH7A 3KD0A 4ZXGA 2J9HA 1T8EB 3IOSA 1DUGA 4GLTA 1B8XA 2L6CA 1JZWA 3KTBA 4XCSA 1HYUA 2NPBA 1E6BA 5DCGA 2R6KA 2LJAA 3G7IA 1JLWA 1V40A 4JBBA 2VM2A 2KP2A 3QAGA 2C1YA 1SJZA 3G7YA 5KN3A 1TXXA 3BBYA 2VAFA 4ML6A 1K0CA 1ZZYA 3J7Yb 5GZZB 1TU8A 2XBQA 1YKCA 2WJUA 2H1AA 3FRCA 3D21A 1S3CA 1PN9A 2O87A 1O81A 4MJEA 5B6MA 4OFTA 3C8EA 4WF5A 1Z5YE 5G1LA 2B5YA 1GSQA 1UA5A 3F4RA 3CRTA 1J08A 3PR8A 4DSRA 5AISA 1IYIA 1GLQA 4K7NA 5JCUA 3F8UA 3HHVA 4O92A 3F0IA 1G7EA 5JWOB 4ZL7A 3GX8A 2QC7A 2H6YA 1XPVA 4PUFC 2KLXA 1TW9A 1HD2A 1VF1A 3P7XA 5EL8A 1O73A 3QAVA 1SJ6A 3UAPA 1A23A 3UVTA 1TRWA 2DJ2A 2VOCA 2R5GA 2C0DA 3TKSE 5IO2A 4KSMA 1UVZA 2P0GA 4OFMA 5IO0A 5DALB 2CAIA 2QSIA 1O8XA 4L8EA 4NXIA 3EYTA 2YP6A 3FZ5A 4PGTA 3PINA 2GQLA 1URMA 4EDYA 4F0CA 4LLRA 5DDLA 1IYHA 3BD2A 1YF0A 2V6OA 3IK9A 3W8JA 2O89A 1DE2A 13GSA 2GSTA 1CQGA 1B4PA 1XWBA 2V1MA 2OE1A 3GV1A 3IV4A 3AY8A 1GUHA 4TR1A 4XS4A 3CBUA 3HCZA 4BWSA 2CQ9A 5IPGA 4DSQA 1Q4JA 4EDZA 2C0GA 4GQFA 4TRXA 4XRAA 2FHEA 2YV7A 5AN1A 1AQXA 1TK0B 3L9VA 1HNAA 4EF0A 4KCEA 5IIZA 3WGDA 2LRNA 1PX6A 1G0TA 1SU9A 1SD9A 2E2MA 2GLRA 3FR9A 1GTAA 4JR6A 1UN2A 3TJJA 1ZYQB 4DSSA 4ZB6A 1M9AA 4H86A 3DD3A 5GSTA 5G2ZA 3Q19A 1BG5A 1EWXA 3UIWA 1MEKA 1K0MA 1WWJA 1SK1A 5KEJA 1V58A 1XBSA 2H0IA 2DC5A 5ELAA 1F9MA 3WT1A 3HYPA 2IFQB 2MMAA 3P2AA 4WXTA 6GSSA 2X8HA 5COHA 2LRTA 3QFBC 3OR5A 4AGSA 2H75A 1SK0A 3TRPA 1M0UA 3HY2A 3GIXA 4K8MA 1T3BA 4NHWA 3LORA 3HKRA 4WR5A 4PUAA 3MAKA 3TJBA 3IXRA 4FIWA 1NHYA 4NV2A 5AIXA 4TW5A 1K0AA 1MTCA 4LA1A 1FW1A 2HRNA 4N11A 4RQXA 1PD21 4K7OA 3LEFA 2PBJA 3D4TA 1FO5A 4MJAA 4XHMA 4IN0A 4LMVA 3KTLA 5HR0A 1YEXA 1V98A 2LS5A 3ZMLA 1ST9A 2CZ3A 1XWAA 2PGTA 12GSA 3A5WA 5J41A 1JZDA 5GAPD 1JFUA 1KNGA 1WMJA 1AC1A 5L71A 4TR1B 2H70A 3GA4A 3HD5A 2L4CA 1TRSA 5F8BA 4PQHA 4HZ4A 3GURA 5DQSA 4QQ7A 1GNWA 3H1NA 3IE3A 1M2BA 3DRNA 4K0NA 3TRXA 3QCPA 4MP4A 1JZOA 3F4SA 2A4VA 1EP8A 1X5CA 2AB6A 2VCZA 1SK2A 2HZEB 1TK5B 2OBKA 3N5OA 1U3IA 4OD7A 2F9SA 4ZBAA 1XFLA 2MMZA 1WE0A 5A4WA 4AF2A 4DSSB 4WEYA 4N10A 2C3TA 4MF7A 3D0ZA 2K6VA 5DBQA 2R2JA 5H5QA 4JE1A 2EIOA 1T4ZA 4EVMA 2YANA 1FVJA 1EOHA 1T00A 3FYGA 2BTOT 4MDCA 3CRUA 3L0HA 3S9FA 1N8JA 4KDUA 1XVWA 1R5AA 3VI5A 3E0UA 3EVIA 3R2QA 3EURA 4GQCA 2A2SA 1GSFA 3BCIA 1WP0A 4G19A 1BJXA 3UJ1A 2HSHA 2WDUA 2JZTA 5F05A 4PQIA 4NAXA 1EV9A 2C3QA 2HZFA 4I97A 4MF5A 1YQ1A 4I5QA 3EE2A 4MH3A 2N5FA 2X99A 2N5AA 4JU5A 1KTEA 3C71A 1A0FA 2P5RA 3ZIVA 5ECKB 1USBA 3H4KA 2V6KA 2JU5A 3VURA 2LJKA 2CZ2A 2J23A 3WYWA 5AGYA 2M72A 2A2RA 1U3AA 2FWHA 1AUCA 5G1KA 5HFIA 1GSYA 4G9HA 4YH2A 3EWLA 2VM1A 2V41A 3E9JB 3PGTA 4EL1A 1AIUA 1QFNA 2B6MA 3IPZA 2GZZA 2JZRA 1WIKA 16GSA 3KJYA 1X0RA 4MA9A 4XS6A 2WCIA 2NVLA 2JSYA 2CAQA 3M9KA 2H1DA 2JZSA 2YV9A 1SD8A 5A5KA 1ERUA 2PVOC 2B1KA 1AAZA 2VCVA 1FB0A 4G2EA 1OKTA 1B9YC 3GN3A 4IP1A 3RPNA 3BOAA 3KMNA 2LV3A 5KN2A 4WBRD 4HS1A 2X64A 1GWCA 2FWFA 2LRCA 1U88A 4HDEA 6GSVA 2O7KA 1QK8A 4ZL8A 2NBSA 3ZREA 1K0BA 5HFGA 3UBKA 4LL4B 1M99A 1OKDA 2C3NA 2DIZA 1O7UA 2K18A 2Z9SA 3DMLA 2AAWA 1LU4A 1VF3A 4HI7A 3Q18A 1B4QA 4HQZA 3F3QA 2KUCA 1FOVA 2FGXA 4KNDA 4WF4A 2GZYA 2YJ7A 1Z9HA 3UBLA 4GSSA 1GTIA 2F8AA 2PMTA 4POBA 3F3RA 2RM5A 4JEDA 1PQNA 1YZXA 2VUPA 3FEUA 3HVSA 2XPDA 3HZ4A 3L9SA 2L5LA 4MF6A 3DVXA 1PMTA 2VCXA 2GZPA 2I3YA 3CTFA 3TJFA 2B1LA 4ZILA 4NV5A 2GT5A 2YZHA 3D5JA 2HLSA 3FK8A 4TXVA 3ZITA 3QPMA 2NDOA 2XBIA 5CREA 1THXA 9GSSA 4GWRA 3VWUA 4PX1A 1XOAA 4ILFA 5IMZA 1ZOFA 1A8LA 1NW2A 2HRFA 2C4JA 2FY6A 2DSAA 3GRXA 1GTUA 3MSZA 2DJ0A 1ABAA 3L78A 4ZL9A 1O85A 2H71A 3APSA 6GSYA 3GX0A 2AYTA 1ZL9A 3DEXA 1XXUA 2L57A 4ECIA 2VD1A 2VL2A 3L4NA 1F37A 2AUVA 2LUSA 5IMCA 3HZ8A 3ZYWA 4BVXA 3KEBA 4FYUA 1ML6A 3UVHA 1ACVA 1VF4A 3VPQA 1EGRA 4ZBDA 3K8NA 5JCGA 3ISOA 4ML1A 3VWWA 3F4TA 2IMIA 2H1BA 3QFAC 3FZ4A 4D73A 4PXOA 1H4OA 2ALBA 4XRDA 2X8CA 3ZL5A 1J9BA 3ZMKA 5HR3A 1PSQA 4OCFA 2KP1A 3I43A 1PKWA 5D8IA 2TIRA 3V1WA 1WOUA 2R3XA 2IPAA 1TI1A 3CSJA 3ZRDA 1S3DA 1UC7A 2K8SA 1MDIA 2L59A 2MBTA 4JR4A 3H79A 1ERWA 1XVQA 2ON7A 3O76A 1XOBA 4E8HA 3EINA 5F07A 4I2TA 1Z7PA 2FCHA 1DBYA 3M9JA 1A24A 1EEMA 1WRYA 5HFKA 2FUG2 4ECJA 3LYKA 3FY7A 1YDKA 2PVQA 3TB2A 3DYRA 2IMDA 3LWAA 2JACA 1SKRB 2PERA 2GVPA 2WULA 3W6GA 3FZ9A 2DJ3A 3HJOA 5CRHA 2VL2C 4OCEA 4JRRA 5ECLB 5H5RA 2OA7A 2GQMA 2LEGA 1Y25A 2LQQA 5ECIB 4GRFA 4OWYA 2IJYA 1J0FA 1JHBA 5IMFA 3A2XA 3UARA 2JL4A 1BEDA 1GL8A 3VLNA 1O6JA 3G9BA 2L5OA 4MPGA 2YN1A 3DKSA 1GSUA 4L0WA 1HNCA 4F0BA 2VLTA 1QQ2A 4Q5NA 2CA8A 1FHEA 3EU4A 1G7OA 2DMLA 1AQWA 2IMKA 2YPMA 3NIVA 3HJPA 2C80A 2L4QA 1ERVA 2RIIA 3ZFBA 2G2QA 1FAAA 4XS1A 1A2MA 1W4VA 2K9FA 3KM6A 2I9HA 3FR3A 4WETA 5J4UA 4ID0A 2GS3A 5EVOA 1SENA 3LXTA 4YAVA 3CSHA 4ECBA 5HR2A 4K7IA 3IHQA 5F06A 3QMXA 1SKWB 1EP7A 5EPFA 3HA9A 4EE0A 1A2LA 2GSSA 4LMWA 5CYYA 2PWJA 3IBHA 3JCML 2V32A 5J9BA 4YAPA 3F63A 2C0FA 3KP8A 3GL5A 3H93A 3MNGA 3GYKA 1FG4A 4J57E 1GSDA 1KBNA 4HJMA 4KCAA 1HNBA 1EZKA 3HDCA 5F0GA 2FA8A 2GSQA 3ZVJA 1R5PA 1JZRA 4ULXA 4IGJA 2EIQA 3GHAA 5ID2A 2YNXA 3IR4A 1SKSB 1TKDB 1TRUA 1GSSA 2VD0A 3F6DA 5ABRA 4IQAA 5ECPB 5G5FA 5J5NA 1SYRA 4FYBA 3EMXA 4TR0A 4POMA 4ZB9A 1WJKA 4MABA 4IELA 3ED3A 2B5XA 5B7CA 1W89A 1M9BA 4XS4B 3M1GA 2K8VA 1VRSD 5KN1A 2B5EA 1ERTA 3HVXA 5A4VA 3CSIA 3KCMA 2WB9A 4ISDA 2VL3A 3VI7A 1O8WA 2FWGA 1V2AA 4FH8A 4K6XA 5D93A 3E3EA 3Q74A 1LBKA 1RQMA 4AJ6A 2IN3A 4V2LA 5B8AA 2VCTA 1G6YA 3ME7A 2OKAA 2LQOA 3N9JA 5JWQB 11GSA 2CVDA 2FD3A 2CX3A 4GF0A 5B6NA 4AJ8A 1I9DA 3M0FA 1JLVA 2GGTA 4YQUA 1TDIA 4BWQA 3BJ5A 2JADA 2GT6A 3F6FA 1YF1A 3KP9A 1V57A 3Q6OA 3PH9A 1R4WA 1TOFA 4L0UA 2GDRA 1GUMA 2X8GA 4NWYA 4NPBA 3D4MA 1Z6MA 2FWEA 3TOTA 2H66A 4IP6A 3F9UA 3G7JA 2DJKA 2WRTA 3LQ7A 1ZYEA 5IPHA 1B48A 2AV4A 2I81A 2OE3A 18GSA 2D2ZA 1B9XC 3CXGA 5HR1A 4NMUA 4GSNA 4IVFA 4HU9A 2VIMA 5JWRB 2H19A 3IK7A 2YZUA 1N2AA 3SWLA 5IQYA 2RUEA 6GSTA 3FW2A 3D22A 3NZNA 1V9WA 1ZGNA 1HQOA 5A4UA 4KX4A 3ERWA 3DIEA 2JSZA 2BJXA 2HFDA 1THOA 1S3AA 1X5EA 4I8BA 1XW5A 4N30A 2MYGA 4KE3A 5CP1A 4N0VA 1OE8A 4QL9A 1K3YA 1NSWA 3UEMA 1SL1B 5CNWA 3ERGA 2N5BA 1M2DA 1RK4A 4X43A 4WKWA 3QDNA 1TK8B 4PNGA 5C00A 2ZUPA 4V2MA 1RW1A 2GQKA 3US3A 5LD0A 5DJMA 4Q5FA 3CTGA 3LJRA 3IRAA 5IOWA 2L6DA 3TOUA 3HVVA 2H1GA 4L5OA 4KB3A 3DVWA 4HQSA 1X9MB 3GFKA 4TVEA 4KUNA 1G6WA 2F51A 5G31A 3C7MA 4XIHA 3GSSA 2FA4A 5E59A 5CAXA 2H30A 3KGKA 1YY7A 4CW9A 2FNOA 1Z7RA 3C73A 1X9SB 2CVBA 1XW9A 2FLSA 4OO5A 2I4AA 1PGTA 5GAND 2PN8A 3TRQA 2H76A 5LNKe 4TR4A 3O6TA 3SBCA 4ACSA 4K2DA 2VCQA 3HJMA 2HE3A 1XWKA 5ECRB 3W8SA 1MDJA 3RBTA 4V1Ag 2ON5A 4GSTA 4BPYA 2H73A 1F2EA 3WD6A 1X5DA 3RPPA 1K0DA 2MMOA 1GSEA 4E8EA 4HEA2 2O85A 2DMMA 5D9XA 2YWMA 4ECCA 3ZVJD 5FWGA 1OC8A 3ZIJA 3IDVA 4TN8A 5FT3A 3D6IA 4MZBA 3M8NA 2YCDA 5D96A 2XPEA 1R26A 5KN0A 3CMIA 4TR3A 5DAKA 4TOPA 10GSA 3J7Yk 1VF2A 3A3TA 2P31A 3APQA 4WBJA 2YWNA 2DBCA 2DLXA 3I9V2 5DCHA 4GCIA 2R4VA 4I2UA 1OAZA 2OJLA 1AW9A 3H8QA 1EOGA 4RI7A 2F8FA 1K0OA 3UOMA 3QR6A 1GTBA 4PURA 3QOUA 4KDXA 1GULA 2M80A 2P5QA 2PUKC 5CRGA 4ZIJA 3TKQA 3GNJA 2CVKA 2HT9A 3LFLA 2DJJA 2LJRA 2VL9A 2XHFA 2KHPA 4O7HA 4MLYA 1TP9A 4GXZA 5CO3A 4YQMA 5ECQB 5J3RA 2LTKA 2E7PA 4N0ZA 5DQYA 4K0GA 3GTUA 5IOXA 5IMVA 2YWOA 3GMFA 4F82A 5JCWA 2IFQA 4IW9A 2HSYA 5B8BA 3A2WA 3VK9A 14GSA 3FR6A 2TRCP 2H6ZA 2RUFA 4HJ2A 1A2JA 2E0QA 1GH2A 3LYPA 1X9WB 4F9ZA 1TU7A 3KZQA 4Q5RA 1M2AA 4IS0A 5LCZA 5IMAA 4RUVA 2VCWA 7GSSA 2H0HA 5ECOB 3WGEA 4J2FA 1FB6A 3GUSA 1OC9A 2BMXA 4Q5QA 3TCOA 3ZZXA 3VPTA 5G5EA 5INYA 1U87A 4KAEA 1XWCA 1F6MC 2HI7A 4KA0A 4NHZA 4MPFA 5C04A 4IKHA 1EV4A 1M7TA 3M3MA 4PQ1A 1I5GA 3P8WA 3EC3A 5ECNB 2REMA 1XIYA 1EGOA 2AJQB 5DAKB 4X1UA 3BCKA 2WFCA 2H01A 5HQPA 3TUEA 5D73A 3MWHA 1QUWA 4TXOA 3RDWA 2M46A 1OVNA 1WPIA 3KIJA 3GH9A 1OYJA 1GRXA 1GLPA 4HU7A 4MZCA 2MMNA 17GSA 1QGVA 3GKNA 2GSRA 1AXDA 1VGLA 3KXOA 3LGCA 4BL7A 3IC4A 1GUKA 6GSUA 2HZEA 1BAYA 4F2IA 4HOJA 3UMAA 1OC3A 2CT6A 1SYXA 3ZTLA 1F3AA 4D73B 1YJ6A 3LSZA 3LXZA 5AIVA 5D9WA 3GTUB 5D9VA 4AJ7A 2LSTA 2R37A 2MZCA 4EKZA 4MH2A 2ES7A 4WR4A 2MBSA 1MD3A 4HUAA 2CV4A 4P3YB 4OFNA 4F03A 3ME8A 4MJCA 1BX9A 4EXJA 1YEPA 4MCUA 2OADA 2PU9C 4MZWA 1EEJA 3TKRA 3C1RA 4ZBBA 8GSSA 5FHIA 3ZLPA 2TRXA 2YJHA 2YOIA 1ZMAA 3FKFA 3P90A 5DVBA 1XCCA 3ERFA 5GSSA 1E2YA 4KGIA 1Q98A 1OC9B 1PL2A 1FVKA 1ILOA 4POKA 1XZOA 3EMPA 1F3BA 2KOKA 3I6AA 1YKAA 4JZQA 1TTZA 1NM3A 2IL3A 1GP1A 4OO4A 4MJBA 2NTOA 2HYXA 2IMEA 4QL7A 3VWVA 1LJRA 2WZ9A 4V1Ap 1PKZA 4POLA 4EC0A 1NHOA 3O3TA 2CX4A 1PA3A 1Y6EA 4TXOB 2RM6A 3UL3A 1T7PB 2E2GA 3GSTA 4RQRA 1TJDA 2QKEA 1T1VA 2RLIA 3NOFA 3VFIA 3QD9A 4IJ3A 2LNSA 3KH9A 1K3LA 4KW6A 2QGVA 1MD4A 4EO3A 4KSOA 2HNLA 2IWTA 5ECMB 3QAWA 5IM9A 2VO4A 3ZFLA 4EUYA 1H75A 4GTUA 3WGXA 1BQ7A 2VLUA 5ECSA 3GKMA 5CRWA 3RAZA 3DGQA 1T4YA 5DJLA 2B7KA 2OBIA 2VLVA 4MK3A 1CQHA 5ENUA 1KEBA 4G10A 2HXKA 4KH7A 3VWXA 1PRXA 1K3OA 3FZAA 4IHUA 4DEJA 4K9ZA 2PPTA 2XC2A 3CYNA 2LNTA 3TJGA 4CDOA 3TJKA 1Z6NA 5ID2B 4YQVA 2DIYA 4I6XA 3GH6A 2G0FA 3C1SA 3KMOA 1TI3A 5D9TA 2H72A 3RHBA 4IJIA 2C0EA 1SL0B 2IIYA 2GTUA 3I69A 2H6XA 4Z7XA 1XWGA 1SJIA 4V2NA 5E4WA 2YWIA 3WT2A 2EC4A 1K0NA 4XTSA 1Z3EA 3TKSA 3HXSA 20GSA 2ZCTA 2H8LA 5H5SA 3GKKA 1R7HA 4O5RA 3GL3A
chains in the Genus database with same CATH superfamily
1A8YA 3EU3A 4X0XA 5ECHB 4L6AA 2F3MA 1C72A 1U6TA 4L5LA 6GSXA 2AHEA 2V2GA 2QGAB 4OMVA 5ELGA 2YV5A 6GSWA 2EIRA 1QXHA 3DWVA 3MDKA 1OE7A 4MMMA 1IW7D 1ZCPA 4DVCA 5CRDA 22GSA 1MDKA 3RHCA 1SL2B 3DXBA 3L9UA 4EIQA 4LL1B 5G30A 4KDYA 3TGZA 1XW6A 4HZ2A 4APAA 4K1FA 3IAS2 4CHSA 4RI6A 4FYCA 3R6QA 3A2VA 3GKXA 3TKPA 2OE0A 4BA7A 3U6VA 2LKUA 4TKYA 2B7JA 4Z2RA 2I1UA 4IQ1A 2O8VB 4ZB8A 3IC8A 3TDGA 3LG6A 3U5RE 2H0GA 3IAM2 1TRVA 2WGRA 2H74A 2DJ1A 19GSA 2IMFA 2WS2A 4J56E 5EY6A 1AQVA 1DSBA 4IBPA 1DE1A 3FHKA 2C8UA 1QMVA 1ON4A 5IMDA 5DALA 2B3SA 2OACA 4EFCA 1BYEA 3TKSC 4FO5A 3APOA 1PL1A 4O32A 4BVYA 1PX7A 4PNFA 1A0RP 5J9CA 2ZNMA 1GNEA 3IA1A 3KH7A 3BWVA 3KD0A 4ZXGA 4MUMA 2J9HA 4EIPA 1T8EB 3IOSA 1DUGA 4GLTA 1B8XA 2L6CA 1JZWA 3KTBA 4XCSA 1HYUA 2NPBA 1E6BA 5DCGA 2R6KA 2LJAA 3G7IA 1JLWA 1FURA 1V40A 1C3CA 4JBBA 2VM2A 2KP2A 3QAGA 2C1YA 1SJZA 3G7YA 5KN3A 1TXXA 3BBYA 2VAFA 4ML6A 1FUPA 1K0CA 1ZZYA 3J7Yb 5GZZB 1TU8A 2XBQA 1YKCA 2WJUA 2H1AA 3FRCA 3D21A 1S3CA 1PN9A 2O87A 1O81A 4MJEA 5B6MA 4OFTA 3C8EA 4WF5A 1TJUA 1Z5YE 5G1LA 2B5YA 1GSQA 1UA5A 3F4RA 3CRTA 1J08A 3PR8A 4DSRA 5AISA 1IYIA 1GLQA 4K7NA 5JCUA 3F8UA 3HHVA 4O92A 3F0IA 1G7EA 5JWOB 4ZL7A 3GX8A 2QC7A 2H6YA 1XPVA 4PUFC 2KLXA 1TW9A 4K2XA 1HD2A 1VF1A 3P7XA 2JAWA 5EL8A 1O73A 3QAVA 2X75A 1SJ6A 3UAPA 1A23A 3UVTA 1TRWA 2DJ2A 2VOCA 2R5GA 2C0DA 1MH9A 2JARA 3TKSE 5IO2A 4KSMA 1UVZA 2P0GA 4OFMA 5IO0A 3FMWA 5DALB 2CAIA 2QSIA 1O8XA 4L8EA 4NXIA 3EYTA 2YP6A 3FZ5A 4PGTA 3PINA 4BVYB 2GQLA 1URMA 4EDYA 4F0CA 4LLRA 5DDLA 1IYHA 3BD2A 4YIHA 1YF0A 2V6OA 3IK9A 3W8JA 5F92A 2O89A 1DE2A 13GSA 2GSTA 1CQGA 3LW9A 1B4PA 1XWBA 2V1MA 2OE1A 3GV1A 3IV4A 2R0GA 3AY8A 1GUHA 4TR1A 4XS4A 3CBUA 3HCZA 4FQUA 4BWSA 2CQ9A 5IPGA 4DSQA 1Q4JA 4EDZA 2C0GA 4GQFA 4TRXA 4XRAA 1M3JA 1FUOA 1AUWA 2FHEA 2YV7A 5AN1A 1AQXA 1TK0B 3L9VA 1HNAA 4EF0A 4KCEA 5KOWA 5IIZA 3WGDA 2LRNA 1PX6A 1G0TA 1SU9A 1T9HA 1SD9A 2E2MA 2GLRA 3FR9A 1GTAA 4JR6A 1UN2A 3TJJA 1ZYQB 4DSSA 4ZB6A 1M9AA 4H86A 3DD3A 5GSTA 5G2ZA 3Q19A 1BG5A 1EWXA 3UIWA 1MEKA 1K0MA 1WWJA 1SK1A 4YKFA 2DKHA 5KEJA 1V58A 1XBSA 2H0IA 2DC5A 5ELAA 1F9MA 3WT1A 3HYPA 2IFQB 2MMAA 1U0LA 3P2AA 4WXTA 6GSSA 2X8HA 5COHA 4MX2A 2LRTA 3QFBC 3OR5A 4AGSA 2H75A 1SK0A 3TRPA 1M0UA 3HY2A 3GIXA 4K8MA 1T3BA 4NHWA 3LORA 3HKRA 4WR5A 4PUAA 3MAKA 3TJBA 3IXRA 4FIWA 1NHYA 4NV2A 5AIXA 4TW5A 1K0AA 1MTCA 4LA1A 1FW1A 2HRNA 4N11A 4RQXA 1PD21 4K7OA 3LEFA 2PBJA 3D4TA 1FO5A 4MJAA 4XHMA 4IN0A 4LMVA 3KTLA 4APBA 5HR0A 2R0PA 1YEXA 1V98A 2LS5A 3ZMLA 1ST9A 2CZ3A 1XWAA 2PGTA 12GSA 3A5WA 5J41A 1JZDA 5GAPD 1JFUA 1KNGA 1WMJA 1AC1A 4G0IA 5L71A 4TR1B 2H70A 1Z4MA 3GA4A 3HD5A 2L4CA 1TRSA 5F8BA 4PQHA 4HZ4A 3GURA 5DQSA 4QQ7A 1GNWA 3H1NA 3IE3A 1M2BA 3DRNA 4K0NA 3TRXA 3QCPA 4MP4A 1JZOA 3F4SA 2A4VA 1EP8A 1X5CA 2AB6A 2VCZA 1SK2A 2HZEB 1TK5B 4O5UA 2OBKA 3N5OA 1U3IA 4OD7A 2F9SA 4ZBAA 1XFLA 2MMZA 1WE0A 5A4WA 4AF2A 4DSSB 4WEYA 4N10A 2C3TA 4MF7A 3D0ZA 2K6VA 5DBQA 2R2JA 5H5QA 4JE1A 2A2PA 2EIOA 1T4ZA 4EVMA 2YANA 1FVJA 1EOHA 1T00A 3FYGA 2BTOT 4MDCA 3CRUA 3L0HA 3S9FA 1N8JA 4CY8A 4KDUA 1XVWA 1R5AA 3VI5A 3E0UA 3EVIA 3R2QA 3EURA 4GQCA 2A2SA 1GSFA 2FUSA 3BCIA 1WP0A 4G19A 1BJXA 3UJ1A 2HSHA 2WDUA 2JZTA 5F05A 4PQIA 4NAXA 1EV9A 3HVNA 2C3QA 2HZFA 4I97A 4MF5A 4O5QA 1YQ1A 4I5QA 3EE2A 4MH3A 2N5FA 2X99A 2N5AA 4JU5A 1KTEA 3C71A 1A0FA 2P5RA 3ZIVA 5ECKB 1USBA 3H4KA 3IHGA 2V6KA 2JU5A 3VURA 4ADMA 2LJKA 2CZ2A 2J23A 3WYWA 5AGYA 2M72A 2A2RA 4NSLA 1U3AA 2FWHA 1AUCA 5G1KA 5HFIA 1GSYA 4G9HA 4YH2A 3EWLA 2VM1A 2V41A 3E9JB 3PGTA 4EL1A 1AIUA 1QFNA 2B6MA 3IPZA 2GZZA 1TJWA 2JZRA 1WIKA 16GSA 3KJYA 1X0RA 4MA9A 4XS6A 2WCIA 2NVLA 2JSYA 2CAQA 3M9KA 2H1DA 2JZSA 2YV9A 1SD8A 5A5KA 1ERUA 2PVOC 2B1KA 1AAZA 2VCVA 1FB0A 4G2EA 1OKTA 1B9YC 3GN3A 4IP1A 3RPNA 3BOAA 3KMNA 2LV3A 5KN2A 4WBRD 1TJVA 4HS1A 2X64A 1GWCA 2FWFA 2LRCA 1U88A 4HDEA 6GSVA 2O7KA 1QK8A 4ZL8A 2NBSA 3ZREA 1K0BA 5HFGA 3UBKA 4LL4B 1M99A 1OKDA 2C3NA 2DIZA 1O7UA 2K18A 2Z9SA 3DMLA 2AAWA 1LU4A 1VF3A 4HI7A 3Q18A 1Z4JA 1B4QA 1K7WA 4HQZA 3F3QA 4E88A 2KUCA 1FOVA 2FGXA 4KNDA 4WF4A 1Q5NA 2GZYA 2YJ7A 1Z9HA 3UBLA 4GSSA 1GTIA 2F8AA 2PMTA 4POBA 3F3RA 2RM5A 4L57A 1PQNA 1YZXA 2VUPA 4JEDA 3FEUA 1U15A 3HVSA 2XPDA 3HZ4A 3L9SA 2L5LA 4MF6A 3DVXA 1PMTA 2VCXA 4IQJM 2GZPA 3CQFA 2I3YA 3CTFA 3TJFA 2B1LA 4ZILA 4NV5A 2GT5A 2YZHA 3D5JA 2HLSA 3FK8A 1YFEA 4TXVA 3ZITA 3QPMA 2NDOA 1XWOA 2XBIA 5CREA 1THXA 9GSSA 4GWRA 3VWUA 4PX1A 1XOAA 4ILFA 5IMZA 1ZOFA 1A8LA 1NW2A 2HRFA 2C4JA 2FY6A 2DSAA 3GRXA 5KOXA 1K62A 1GTUA 2HSMA 3MSZA 2DJ0A 1ABAA 3L78A 4ZL9A 1O85A 2H71A 1DOFA 3APSA 6GSYA 3GX0A 2AYTA 1ZL9A 3DEXA 1XXUA 2L57A 4ECIA 2VD1A 2VL2A 3L4NA 1F37A 2AUVA 2LUSA 5IMCA 3HZ8A 3ZYWA 4BVXA 3KEBA 3R6VA 4FYUA 3OCEA 1ML6A 3UVHA 1ACVA 1VF4A 3VPQA 1EGRA 4ZBDA 3K8NA 5JCGA 3ISOA 4PTSA 1ZYPA 4ML1A 3VWWA 3F4TA 2IMIA 2H1BA 3QFAC 3FZ4A 4D73A 4PXOA 1H4OA 2ALBA 4XRDA 2X8CA 3ZL5A 1J9BA 3ZMKA 5HR3A 1PSQA 4OCFA 2KP1A 3I43A 1PKWA 3R3EA 5D8IA 2TIRA 3V1WA 1WOUA 2R3XA 2IPAA 1HY1A 2PTSA 1TI1A 3CSJA 1S3DA 3ZRDA 1UC7A 2K8SA 1MDIA 2L59A 2MBTA 3NO9A 4JR4A 3H79A 1ERWA 1XVQA 2ON7A 3O76A 1XOBA 4E8HA 3EINA 5F07A 4I2TA 4MWOA 1Z7PA 2FCHA 1DBYA 3M9JA 1A24A 1EEMA 1WRYA 5HFKA 2FUG2 4ECJA 3LYKA 3FY7A 1YDKA 2PVQA 3TB2A 3DYRA 2IMDA 3LWAA 2JACA 1SKRB 2PERA 2GVPA 2HRAA 2WULA 3W6GA 3FZ9A 2DJ3A 3HJOA 5CRHA 2VL2C 4OCEA 2PTRA 4JRRA 5ECLB 5H5RA 2OA7A 2GQMA 2LEGA 1Y25A 2LQQA 1RE5A 5ECIB 5D6BA 4GRFA 4OWYA 2IJYA 1J0FA 1JHBA 5IMFA 3A2XA 3UARA 2JL4A 1BEDA 4ADLA 1GL8A 3VLNA 1O6JA 3G9BA 2L5OA 4MPGA 2YN1A 3DKSA 1GSUA 4L0WA 1HNCA 4F0BA 2VLTA 1QQ2A 4Q5NA 2CA8A 1FHEA 3EU4A 1G7OA 2DMLA 1AQWA 2QA1A 2IMKA 2YPMA 3NIVA 3HJPA 2C80A 2L4QA 1ERVA 5BRTA 1DCNA 2RIIA 3ZFBA 2G2QA 2E9FA 1FAAA 4XS1A 1A2MA 1W4VA 2K9FA 3KM6A 2I9HA 3FR3A 4WETA 5J4UA 1PN0A 4ID0A 2GS3A 5EVOA 1TJ7A 1SENA 3LXTA 4YAVA 3CSHA 3E04A 4ECBA 5HR2A 4K7IA 3IHQA 5F06A 3QMXA 1SKWB 1EP7A 5EPFA 3HA9A 4EE0A 1A2LA 2GSSA 4LMWA 5CYYA 2PWJA 3MIXA 3IBHA 3JCML 2V32A 5J9BA 4USSA 4YAPA 3F63A 2C0FA 3KP8A 3GL5A 3H93A 3MNGA 3GYKA 1FG4A 4J57E 1GSDA 1KBNA 4HJMA 1S3RA 4KCAA 1HNBA 1EZKA 3HDCA 3A5IA 5F0GA 2FA8A 2GSQA 3ZVJA 1R5PA 1JZRA 4ULXA 4IGJA 1U16A 2EIQA 3GHAA 5ID2A 2YNXA 3IR4A 1SKSB 1TKDB 1TRUA 1GSSA 2VD0A 3F6DA 5ABRA 4IQAA 5ECPB 5G5FA 5J5NA 1SYRA 4FYBA 4YKGA 3EMXA 4TR0A 4POMA 4ZB9A 1WJKA 4MABA 4IELA 3ED3A 2B5XA 5B7CA 1W89A 1M9BA 4XS4B 3M1GA 2K8VA 1VRSD 5KN1A 2B5EA 4ICYA 1ERTA 3HVXA 5A4VA 3CSIA 3KCMA 2WB9A 4ISDA 2VL3A 3VI7A 1O8WA 2D27A 2FWGA 2I7DA 4G0LA 1J3UA 1V2AA 4FH8A 4K6XA 5D93A 3E3EA 3Q74A 1LBKA 1Q91A 1RQMA 4AJ6A 2IN3A 4V2LA 5B8AA 2VCTA 1G6YA 3ME7A 2OKAA 2LQOA 3N9JA 5JWQB 11GSA 2CVDA 1Z4KA 2FD3A 2X4AA 2CX3A 4MNNA 4GF0A 5B6NA 4AJ8A 1I9DA 4HGVA 1JLVA 3M0FA 2GGTA 4YQUA 1TDIA 4BWQA 3RD8A 3BJ5A 3GZHA 2JADA 2GT6A 3F6FA 1YF1A 3KP9A 1V57A 3Q6OA 3PH9A 1R4WA 1TOFA 4L0UA 2GDRA 1GUMA 2X8GA 4NWYA 4NPBA 3D4MA 1Z6MA 2FWEA 1FUQA 3TOTA 2H66A 4IP6A 3F9UA 3G7JA 2DJKA 2WRTA 1Q92A 3LQ7A 1ZYEA 5IPHA 1B48A 2AV4A 2UZ8A 2I81A 2OE3A 18GSA 2D2ZA 1B9XC 3CXGA 5HR1A 3U19A 4NMUA 4GSNA 4IVFA 4HU9A 1I0AA 2VIMA 4X4JA 5JWRB 2H19A 3IK7A 2YZUA 1N2AA 3SWLA 5IQYA 2RUEA 6GSTA 3FW2A 3D22A 3NZNA 1V9WA 1ZGNA 1HQOA 5A4UA 4KX4A 3ERWA 3DIEA 2JSZA 1JSWA 2BJXA 2HFDA 1THOA 3PPUA 1S3AA 1X5EA 4I8BA 1XW5A 4N30A 2MYGA 4KE3A 5CP1A 4N0VA 3C8TA 5HW2A 1OE8A 4QL9A 1K3YA 1PFOA 1NSWA 3UEMA 1SL1B 4NLEA 5CNWA 3ERGA 2N5BA 1M2DA 1RK4A 3EPTA 4X43A 4WKWA 3QDNA 1TK8B 4PNGA 5C00A 2ZUPA 4V2MA 1RW1A 2GQKA 3US3A 5LD0A 5DJMA 4Q5FA 3CTGA 3LJRA 3IRAA 5IOWA 2L6DA 3TOUA 3HVVA 2H1GA 4L5OA 4KB3A 3DVWA 4HQSA 1X9MB 3GFKA 4TVEA 4KUNA 1G6WA 2F51A 5G31A 3C7MA 4XIHA 3GSSA 2FA4A 5E59A 5CAXA 2H30A 1M3IA 3KGKA 1YY7A 4CW9A 2FNOA 1Z7RA 3C73A 1X9SB 2HRKA 2CVBA 1XW9A 2FLSA 4OO5A 2I4AA 1PGTA 5GAND 2PN8A 3TRQA 2H76A 5LNKe 4TR4A 3O6TA 2D28C 3RRPA 3SBCA 4G0KA 4ACSA 3CI0K 4K2DA 1ZYNA 2VCQA 3HJMA 2HE3A 4K5RA 1XWKA 5ECRB 3W8SA 1MDJA 3RBTA 4V1Ag 2ON5A 4GSTA 4BPYA 2H73A 1F2EA 3WD6A 1X5DA 3RPPA 1K0DA 1VDKA 2MMOA 1GSEA 4E8EA 4HEA2 2O85A 2DKIA 2DMMA 5D9XA 1KQ7A 2YWMA 4ECCA 3ZVJD 5FWGA 1OC8A 3ZIJA 3IDVA 4TN8A 5FT3A 3D6IA 4MZBA 3M8NA 2YCDA 5D96A 2XPEA 1R26A 5KN0A 3CMIA 4TR3A 5DAKA 4TOPA 10GSA 3J7Yk 1VF2A 3A3TA 2P31A 3APQA 4WBJA 2YWNA 2DBCA 2DLXA 3I9V2 5DCHA 4GCIA 2R4VA 4I2UA 1OAZA 2OJLA 1AW9A 3H8QA 1EOGA 1XG8A 4RI7A 2F8FA 1K0OA 3UOMA 3QR6A 1GTBA 4PURA 3QOUA 4KDXA 1GULA 2M80A 2P5QA 2PUKC 5CRGA 4ZIJA 3TKQA 3GNJA 2CVKA 2HT9A 2QA2A 3LFLA 2DJJA 2LJRA 2VL9A 4KF9A 2XHFA 2KHPA 1YFMA 4O7HA 4MLYA 1TP9A 4GXZA 5CO3A 4YQMA 5ECQB 5J3RA 2LTKA 2E7PA 4N0ZA 5DQYA 4K0GA 3GTUA 5IOXA 3QBPA 5IMVA 2YWOA 3GMFA 4BIKA 4F82A 5JCWA 5F91A 2IFQA 1Z4IA 4IW9A 2HVGA 2HSYA 5B8BA 4NFLA 3A2WA 3VK9A 14GSA 3FR6A 2TRCP 2H6ZA 2RUFA 4HJ2A 1A2JA 2E0QA 1GH2A 3LYPA 1X9WB 4F9ZA 1TU7A 3KZQA 2PFMA 4Q5RA 1M2AA 4IS0A 5LCZA 5IMAA 4RUVA 2VCWA 7GSSA 2H0HA 2A4HA 5ECOB 3WGEA 4J2FA 1FB6A 3GUSA 1OC9A 2BMXA 4Q5QA 3TCOA 3ZZXA 3VPTA 5G5EA 5INYA 1U87A 4KAEA 1XWCA 1F6MC 4EEIA 2HI7A 4KA0A 4NHZA 2JAUA 4MPFA 5C04A 4IKHA 1EV4A 4HSCX 1M7TA 3M3MA 4PQ1A 1I5GA 3P8WA 3EC3A 1FOHA 5ECNB 2REMA 1XIYA 1EGOA 2AJQB 5DAKB 4X1UA 3BCKA 2WFCA 2H01A 5BMUA 5HQPA 3TUEA 5D73A 3MWHA 1QUWA 4TXOA 3RDWA 2M46A 1OVNA 1WPIA 3KIJA 3GH9A 1OYJA 1GRXA 1GLPA 4HU7A 1HY0A 4MZCA 2MMNA 17GSA 4BVXB 1QGVA 3GKNA 2GSRA 1AXDA 1VGLA 3KXOA 3LGCA 4BL7A 3IC4A 1GUKA 6GSUA 2HZEA 1BAYA 4F2IA 4HOJA 3UMAA 1OC3A 2CT6A 1SYXA 3ZTLA 1F3AA 2R0CA 1YJ6A 4D73B 3LSZA 3LXZA 5AIVA 3MYDA 5D9WA 3GTUB 5D9VA 4AJ7A 2LSTA 2R37A 2MZCA 4EKZA 3BHGA 4MH2A 2ES7A 4WR4A 2MBSA 1MD3A 4HUAA 2CV4A 4P3YB 2JAOA 4OFNA 4F03A 3ME8A 4MJCA 1BX9A 4EXJA 1YEPA 4MCUA 2OADA 2PU9C 4Z2UA 4MZWA 1EEJA 3TKRA 3C1RA 4ZBBA 8GSSA 5FHIA 3ZLPA 2TRXA 2YJHA 2YOIA 1ZMAA 3FKFA 3P90A 5DVBA 1XCCA 3ERFA 5GSSA 1E2YA 4KGIA 1Q98A 3U13A 1OC9B 1PL2A 4Z2TA 1FVKA 1ILOA 4POKA 1XZOA 3EMPA 1F3BA 2KOKA 3I6AA 1YKAA 4JZQA 1TTZA 1NM3A 2IL3A 1GP1A 4OO4A 4MJBA 2NTOA 2HYXA 2IMEA 4QL7A 3VWVA 1LJRA 4L6CA 2WZ9A 4V1Ap 1PKZA 4POLA 4EC0A 1NHOA 3O3TA 2CX4A 1PA3A 1Y6EA 4TXOB 4K5SA 2RM6A 3UL3A 4A5PA 1T7PB 2E2GA 3GSTA 4RQRA 1TJDA 2QKEA 1T1VA 2RLIA 3NOFA 4BL7B 3VFIA 3QD9A 4IJ3A 2LNSA 3KH9A 1K3LA 4KW6A 4YIKA 2QGVA 4CY6A 1MD4A 4EO3A 4KSOA 2HNLA 2IWTA 5ECMB 3QAWA 5IM9A 2VO4A 3ZFLA 2PTQA 1C3UA 2RCNA 4EUYA 1H75A 4GTUA 3WGXA 1BQ7A 2VLUA 5ECSA 3GKMA 5CRWA 3RAZA 3DGQA 1T4YA 5DJLA 2B7KA 2OBIA 2X49A 2VLVA 3GTDA 4MK3A 1CQHA 5ENUA 1KEBA 4G10A 2HXKA 1Z4QA 4KH7A 3VWXA 1PRXA 1K3OA 3FZAA 4IHUA 4DEJA 4K9ZA 1Z4PX 2PPTA 2XC2A 3CYNA 2LNTA 3TJGA 4CDOA 3TJKA 1Z6NA 5ID2B 4YQVA 2DIYA 4I6XA 3GH6A 2G0FA 3C1SA 3KMOA 1TI3A 5D9TA 2H72A 3RHBA 4IJIA 2C0EA 1SL0B 2IIYA 2GTUA 3I69A 2H6XA 4Z7XA 1XWGA 1SJIA 4V2NA 5E4WA 2YWIA 3WT2A 2EC4A 1K0NA 4XTSA 1Z3EA 3TKSA 1Z4LA 3HXSA 20GSA 2ZCTA 2H8LA 3OCFA 5H5SA 3GKKA 1R7HA 4O5RA 3TV2A 3GL3A
chains in the Genus database with same CATH topology
1A8YA 3EU3A 4X0XA 5ECHB 2F3MA 1C72A 1U6TA 4L5LA 6GSXA 2AHEA 2V2GA 5ELGA 4OMVA 6GSWA 2EIRA 1QXHA 3DWVA 3MDKA 1OE7A 4MMMA 1IW7D 1ZCPA 4DVCA 5CRDA 22GSA 1MDKA 3RHCA 1SL2B 3DXBA 3L9UA 4EIQA 4LL1B 5G30A 4KDYA 3TGZA 1XW6A 4HZ2A 4K1FA 3IAS2 4CHSA 4RI6A 4FYCA 3A2VA 3GKXA 3TKPA 2OE0A 4BA7A 3U6VA 2LKUA 4TKYA 2B7JA 4Z2RA 2I1UA 4IQ1A 2O8VB 4ZB8A 3IC8A 3TDGA 3LG6A 3U5RE 2H0GA 3IAM2 1TRVA 2WGRA 2H74A 2DJ1A 19GSA 2IMFA 2WS2A 4J56E 5EY6A 1AQVA 1DSBA 4IBPA 1DE1A 3FHKA 2C8UA 1QMVA 1ON4A 5IMDA 5DALA 2B3SA 2OACA 1BYEA 3TKSC 4FO5A 3APOA 1PL1A 4O32A 4BVYA 1PX7A 4PNFA 1A0RP 5J9CA 2ZNMA 1GNEA 3IA1A 3KH7A 3KD0A 4ZXGA 2J9HA 4EIPA 1T8EB 3IOSA 1DUGA 4GLTA 1B8XA 2L6CA 1JZWA 3KTBA 4XCSA 1HYUA 2NPBA 1E6BA 5DCGA 2R6KA 2LJAA 3G7IA 1JLWA 1V40A 4JBBA 2VM2A 2KP2A 3QAGA 2C1YA 1SJZA 3G7YA 5KN3A 1TXXA 3BBYA 2VAFA 4ML6A 1K0CA 1ZZYA 3J7Yb 5GZZB 1TU8A 2XBQA 1YKCA 2WJUA 2H1AA 3FRCA 3D21A 1S3CA 1PN9A 2O87A 1O81A 4MJEA 5B6MA 4OFTA 3C8EA 4WF5A 1Z5YE 5G1LA 2B5YA 1GSQA 1UA5A 3F4RA 3CRTA 1J08A 3PR8A 4DSRA 5AISA 1IYIA 1GLQA 4K7NA 5JCUA 3F8UA 3HHVA 4O92A 3F0IA 1G7EA 5JWOB 4ZL7A 3GX8A 2QC7A 2H6YA 1XPVA 4PUFC 2KLXA 1TW9A 4K2XA 1HD2A 1VF1A 3P7XA 5EL8A 1O73A 3QAVA 1SJ6A 3UAPA 1A23A 3UVTA 1TRWA 2DJ2A 2VOCA 2R5GA 2C0DA 3TKSE 5IO2A 4KSMA 1UVZA 2P0GA 4OFMA 5IO0A 3FMWA 5DALB 2CAIA 2QSIA 1O8XA 4L8EA 4NXIA 3EYTA 2YP6A 3FZ5A 4PGTA 3PINA 4BVYB 2GQLA 1URMA 4EDYA 4F0CA 4LLRA 5DDLA 1IYHA 3BD2A 1YF0A 2V6OA 3IK9A 3W8JA 2O89A 1DE2A 13GSA 2GSTA 1CQGA 3LW9A 1B4PA 1XWBA 2V1MA 2OE1A 3GV1A 3IV4A 2R0GA 3AY8A 1GUHA 4TR1A 4XS4A 3CBUA 3HCZA 4FQUA 4BWSA 2CQ9A 5IPGA 4DSQA 1Q4JA 4EDZA 2C0GA 4GQFA 4TRXA 4XRAA 2FHEA 2YV7A 5AN1A 1AQXA 1TK0B 3L9VA 1HNAA 4EF0A 4KCEA 5KOWA 5IIZA 3WGDA 2LRNA 1PX6A 1G0TA 1SU9A 1SD9A 2E2MA 2GLRA 3FR9A 1GTAA 4JR6A 1UN2A 3TJJA 1ZYQB 4DSSA 4ZB6A 1M9AA 4H86A 3DD3A 5GSTA 5G2ZA 3Q19A 1BG5A 1EWXA 3UIWA 1MEKA 1K0MA 1WWJA 1SK1A 4YKFA 2DKHA 5KEJA 1V58A 1XBSA 2H0IA 2DC5A 5ELAA 1F9MA 3WT1A 3HYPA 2IFQB 2MMAA 3P2AA 4WXTA 6GSSA 2X8HA 5COHA 2LRTA 3QFBC 3OR5A 4AGSA 2H75A 1SK0A 3TRPA 1M0UA 3HY2A 3GIXA 4K8MA 1T3BA 4NHWA 3LORA 3HKRA 4WR5A 4PUAA 3MAKA 3TJBA 3IXRA 4FIWA 1NHYA 4NV2A 5AIXA 4TW5A 1K0AA 1MTCA 4LA1A 1FW1A 2HRNA 4N11A 4RQXA 1PD21 4K7OA 3LEFA 2PBJA 3D4TA 1FO5A 4MJAA 4XHMA 4IN0A 4LMVA 3KTLA 5HR0A 2R0PA 1YEXA 1V98A 2LS5A 3ZMLA 1ST9A 2CZ3A 1XWAA 2PGTA 12GSA 3A5WA 5J41A 1JZDA 5GAPD 1JFUA 1KNGA 1WMJA 1AC1A 4G0IA 5L71A 4TR1B 2H70A 3GA4A 3HD5A 2L4CA 1TRSA 5F8BA 4PQHA 4HZ4A 3GURA 5DQSA 4QQ7A 1GNWA 3H1NA 3IE3A 1M2BA 3DRNA 4K0NA 3TRXA 3QCPA 4MP4A 1JZOA 3F4SA 2A4VA 1EP8A 1X5CA 2AB6A 2VCZA 1SK2A 2HZEB 1TK5B 4O5UA 2OBKA 3N5OA 1U3IA 4OD7A 2F9SA 4ZBAA 1XFLA 2MMZA 1WE0A 5A4WA 4AF2A 4DSSB 4WEYA 4N10A 2C3TA 4MF7A 3D0ZA 2K6VA 5DBQA 2R2JA 5H5QA 4JE1A 2A2PA 2EIOA 1T4ZA 4EVMA 2YANA 1FVJA 1EOHA 1T00A 3FYGA 2BTOT 4MDCA 3CRUA 3L0HA 3S9FA 1N8JA 4CY8A 4KDUA 1XVWA 1R5AA 3VI5A 3E0UA 3EVIA 3R2QA 3EURA 4GQCA 2A2SA 1GSFA 3BCIA 1WP0A 4G19A 1BJXA 3UJ1A 2HSHA 2WDUA 2JZTA 5F05A 4PQIA 4NAXA 1EV9A 2C3QA 2HZFA 4I97A 4MF5A 4O5QA 1YQ1A 4I5QA 3EE2A 4MH3A 2N5FA 2X99A 2N5AA 4JU5A 1KTEA 3C71A 1A0FA 2P5RA 3ZIVA 5ECKB 1USBA 3H4KA 3IHGA 2V6KA 2JU5A 3VURA 2LJKA 2CZ2A 2J23A 3WYWA 5AGYA 2M72A 2A2RA 1U3AA 2FWHA 1AUCA 5G1KA 5HFIA 1GSYA 4G9HA 4YH2A 3EWLA 2VM1A 2V41A 3E9JB 3PGTA 4EL1A 1AIUA 1QFNA 2B6MA 3IPZA 2GZZA 2JZRA 1WIKA 16GSA 3KJYA 1X0RA 4MA9A 4XS6A 2WCIA 2NVLA 2JSYA 2CAQA 3M9KA 2H1DA 2JZSA 2YV9A 1SD8A 5A5KA 1ERUA 2PVOC 2B1KA 1AAZA 2VCVA 1FB0A 4G2EA 1OKTA 1B9YC 3GN3A 4IP1A 3RPNA 3BOAA 3KMNA 2LV3A 5KN2A 4WBRD 4HS1A 2X64A 1GWCA 2FWFA 2LRCA 1U88A 4HDEA 6GSVA 2O7KA 1QK8A 4ZL8A 2NBSA 3ZREA 1K0BA 5HFGA 3UBKA 4LL4B 1M99A 1OKDA 2C3NA 2DIZA 1O7UA 2K18A 2Z9SA 3DMLA 2AAWA 1LU4A 1VF3A 4HI7A 3Q18A 1B4QA 4HQZA 3F3QA 2KUCA 1FOVA 2FGXA 4KNDA 4WF4A 2GZYA 2YJ7A 1Z9HA 3UBLA 4GSSA 1GTIA 2F8AA 2PMTA 4POBA 3F3RA 2RM5A 4JEDA 1PQNA 1YZXA 2VUPA 3FEUA 3HVSA 2XPDA 3HZ4A 3L9SA 2L5LA 4MF6A 3DVXA 1PMTA 2VCXA 4IQJM 2GZPA 2I3YA 3CTFA 3TJFA 2B1LA 4ZILA 4NV5A 2GT5A 2YZHA 3D5JA 2HLSA 3FK8A 4TXVA 3ZITA 3QPMA 2NDOA 2XBIA 5CREA 1THXA 9GSSA 4GWRA 3VWUA 4PX1A 1XOAA 4ILFA 5IMZA 1ZOFA 1A8LA 1NW2A 2HRFA 2C4JA 2FY6A 2DSAA 3GRXA 5KOXA 1GTUA 2HSMA 3MSZA 2DJ0A 1ABAA 3L78A 4ZL9A 1O85A 2H71A 3APSA 6GSYA 3GX0A 2AYTA 1ZL9A 3DEXA 1XXUA 2L57A 4ECIA 2VD1A 2VL2A 3L4NA 1F37A 2AUVA 2LUSA 5IMCA 3HZ8A 3ZYWA 4BVXA 3KEBA 4FYUA 1ML6A 3UVHA 1ACVA 1VF4A 3VPQA 1EGRA 4ZBDA 3K8NA 5JCGA 3ISOA 4PTSA 1ZYPA 4ML1A 3VWWA 3F4TA 2IMIA 2H1BA 3QFAC 3FZ4A 4D73A 4PXOA 1H4OA 2ALBA 4XRDA 2X8CA 3ZL5A 1J9BA 3ZMKA 5HR3A 1PSQA 4OCFA 2KP1A 3I43A 1PKWA 3R3EA 5D8IA 2TIRA 3V1WA 1WOUA 2R3XA 2IPAA 1TI1A 3CSJA 3ZRDA 1S3DA 1UC7A 2K8SA 1MDIA 2L59A 2MBTA 4JR4A 3H79A 1ERWA 1XVQA 2ON7A 3O76A 1XOBA 4E8HA 3EINA 5F07A 4I2TA 1Z7PA 2FCHA 1DBYA 3M9JA 1A24A 1EEMA 1WRYA 5HFKA 2FUG2 4ECJA 3LYKA 3FY7A 1YDKA 2PVQA 3TB2A 3DYRA 2IMDA 3LWAA 2JACA 1SKRB 2PERA 2GVPA 2HRAA 2WULA 3W6GA 3FZ9A 2DJ3A 3HJOA 5CRHA 2VL2C 4OCEA 4JRRA 5ECLB 5H5RA 2OA7A 2GQMA 2LEGA 1Y25A 2LQQA 5ECIB 4GRFA 4OWYA 2IJYA 1J0FA 1JHBA 5IMFA 3A2XA 3UARA 2JL4A 1BEDA 1GL8A 3VLNA 1O6JA 3G9BA 2L5OA 4MPGA 2YN1A 3DKSA 1GSUA 4L0WA 1HNCA 4F0BA 2VLTA 1QQ2A 4Q5NA 2CA8A 1FHEA 3EU4A 1G7OA 2DMLA 1AQWA 2QA1A 2IMKA 2YPMA 3NIVA 3HJPA 2C80A 2L4QA 1ERVA 5BRTA 2RIIA 3ZFBA 2G2QA 1FAAA 4XS1A 1A2MA 1W4VA 2K9FA 3KM6A 2I9HA 3FR3A 4WETA 5J4UA 1PN0A 4ID0A 2GS3A 5EVOA 1SENA 3LXTA 4YAVA 3CSHA 4ECBA 5HR2A 4K7IA 3IHQA 5F06A 3QMXA 1SKWB 1EP7A 5EPFA 3HA9A 4EE0A 1A2LA 2GSSA 4LMWA 5CYYA 2PWJA 3MIXA 3IBHA 3JCML 2V32A 5J9BA 4USSA 4YAPA 3F63A 2C0FA 3KP8A 3GL5A 3H93A 3MNGA 3GYKA 1FG4A 4J57E 1GSDA 1KBNA 4HJMA 4KCAA 1HNBA 1EZKA 3HDCA 3A5IA 5F0GA 2FA8A 2GSQA 3ZVJA 1R5PA 1JZRA 4ULXA 4IGJA 2EIQA 3GHAA 5ID2A 2YNXA 3IR4A 1SKSB 1TKDB 1TRUA 1GSSA 2VD0A 3F6DA 5ABRA 4IQAA 5ECPB 5G5FA 5J5NA 1SYRA 4FYBA 4YKGA 3EMXA 4TR0A 4POMA 4ZB9A 1WJKA 4MABA 4IELA 3ED3A 2B5XA 5B7CA 1W89A 1M9BA 4XS4B 3M1GA 2K8VA 1VRSD 5KN1A 2B5EA 4ICYA 1ERTA 3HVXA 5A4VA 3CSIA 3KCMA 2WB9A 4ISDA 2VL3A 3VI7A 1O8WA 2D27A 2FWGA 4G0LA 1V2AA 4FH8A 4K6XA 5D93A 3E3EA 3Q74A 1LBKA 1RQMA 4AJ6A 2IN3A 4V2LA 5B8AA 2VCTA 1G6YA 3ME7A 2OKAA 2LQOA 3N9JA 5JWQB 11GSA 2CVDA 2FD3A 2X4AA 2CX3A 4MNNA 4GF0A 5B6NA 4AJ8A 1I9DA 3M0FA 1JLVA 2GGTA 4YQUA 1TDIA 4BWQA 3BJ5A 2JADA 2GT6A 3F6FA 1YF1A 3KP9A 1V57A 3Q6OA 3PH9A 1R4WA 1TOFA 4L0UA 2GDRA 1GUMA 2X8GA 4NWYA 4NPBA 3D4MA 1Z6MA 2FWEA 3TOTA 2H66A 4IP6A 3F9UA 3G7JA 2DJKA 2WRTA 3LQ7A 1ZYEA 5IPHA 1B48A 2AV4A 2UZ8A 2I81A 2OE3A 18GSA 2D2ZA 1B9XC 3CXGA 5HR1A 4NMUA 4GSNA 4IVFA 4HU9A 2VIMA 4X4JA 5JWRB 2H19A 3IK7A 2YZUA 1N2AA 3SWLA 5IQYA 2RUEA 6GSTA 3FW2A 3D22A 3NZNA 1V9WA 1ZGNA 1HQOA 5A4UA 4KX4A 3ERWA 3DIEA 2JSZA 2BJXA 2HFDA 1THOA 3PPUA 1S3AA 1X5EA 4I8BA 1XW5A 4N30A 2MYGA 4KE3A 5CP1A 4N0VA 1OE8A 4QL9A 1K3YA 1NSWA 3UEMA 1SL1B 5CNWA 3ERGA 2N5BA 1M2DA 1RK4A 3EPTA 4X43A 4WKWA 3QDNA 1TK8B 4PNGA 5C00A 2ZUPA 4V2MA 1RW1A 2GQKA 3US3A 5LD0A 5DJMA 4Q5FA 3CTGA 3LJRA 3IRAA 5IOWA 2L6DA 3TOUA 3HVVA 2H1GA 4L5OA 4KB3A 3DVWA 4HQSA 1X9MB 3GFKA 4TVEA 4KUNA 1G6WA 2F51A 5G31A 3C7MA 4XIHA 3GSSA 2FA4A 5E59A 5CAXA 2H30A 3KGKA 1YY7A 4CW9A 2FNOA 1Z7RA 3C73A 1X9SB 2HRKA 2CVBA 1XW9A 2FLSA 4OO5A 2I4AA 1PGTA 5GAND 2PN8A 3TRQA 2H76A 5LNKe 4TR4A 3O6TA 2D28C 3SBCA 4G0KA 4ACSA 4K2DA 1ZYNA 2VCQA 3HJMA 2HE3A 4K5RA 1XWKA 5ECRB 3W8SA 1MDJA 3RBTA 4V1Ag 2ON5A 4GSTA 4BPYA 2H73A 1F2EA 3WD6A 1X5DA 3RPPA 1K0DA 2MMOA 1GSEA 4E8EA 4HEA2 2O85A 2DKIA 2DMMA 5D9XA 2YWMA 4ECCA 3ZVJD 5FWGA 1OC8A 3ZIJA 3IDVA 4TN8A 5FT3A 3D6IA 4MZBA 3M8NA 2YCDA 5D96A 2XPEA 1R26A 5KN0A 3CMIA 4TR3A 5DAKA 4TOPA 10GSA 3J7Yk 1VF2A 3A3TA 2P31A 3APQA 4WBJA 2YWNA 2DBCA 2DLXA 3I9V2 5DCHA 4GCIA 2R4VA 4I2UA 1OAZA 2OJLA 1AW9A 3H8QA 1EOGA 4RI7A 2F8FA 1K0OA 3UOMA 3QR6A 1GTBA 4PURA 3QOUA 4KDXA 1GULA 2M80A 2P5QA 2PUKC 5CRGA 4ZIJA 3TKQA 3GNJA 2CVKA 2HT9A 2QA2A 3LFLA 2DJJA 2LJRA 2VL9A 4KF9A 2XHFA 2KHPA 4O7HA 4MLYA 1TP9A 4GXZA 5CO3A 4YQMA 5ECQB 5J3RA 2LTKA 2E7PA 4N0ZA 5DQYA 4K0GA 3GTUA 5IOXA 5IMVA 2YWOA 3GMFA 4F82A 5JCWA 2IFQA 4IW9A 2HSYA 5B8BA 3A2WA 3VK9A 14GSA 3FR6A 2TRCP 2H6ZA 2RUFA 4HJ2A 1A2JA 2E0QA 1GH2A 3LYPA 1X9WB 4F9ZA 1TU7A 3KZQA 4Q5RA 1M2AA 4IS0A 5LCZA 5IMAA 4RUVA 2VCWA 7GSSA 2H0HA 2A4HA 5ECOB 3WGEA 4J2FA 1FB6A 3GUSA 1OC9A 2BMXA 4Q5QA 3TCOA 3ZZXA 3VPTA 5G5EA 5INYA 1U87A 4KAEA 1XWCA 1F6MC 2HI7A 4KA0A 4NHZA 4MPFA 5C04A 4IKHA 1EV4A 1M7TA 3M3MA 4PQ1A 1I5GA 3P8WA 3EC3A 1FOHA 5ECNB 2REMA 1XIYA 1EGOA 2AJQB 5DAKB 4X1UA 3BCKA 2WFCA 2H01A 5BMUA 5HQPA 3TUEA 5D73A 3MWHA 1QUWA 4TXOA 3RDWA 2M46A 1OVNA 1WPIA 3KIJA 3GH9A 1OYJA 1GRXA 1GLPA 4HU7A 4MZCA 2MMNA 17GSA 4BVXB 1QGVA 3GKNA 2GSRA 1AXDA 1VGLA 3KXOA 3LGCA 4BL7A 3IC4A 1GUKA 6GSUA 2HZEA 1BAYA 4F2IA 4HOJA 3UMAA 1OC3A 2CT6A 1SYXA 3ZTLA 1F3AA 2R0CA 1YJ6A 4D73B 3LSZA 3LXZA 5AIVA 3MYDA 5D9WA 3GTUB 5D9VA 4AJ7A 2LSTA 2R37A 2MZCA 4EKZA 4MH2A 2ES7A 4WR4A 2MBSA 1MD3A 4HUAA 2CV4A 4P3YB 4OFNA 4F03A 3ME8A 4MJCA 1BX9A 4EXJA 1YEPA 4MCUA 2OADA 2PU9C 4Z2UA 4MZWA 1EEJA 3TKRA 3C1RA 4ZBBA 8GSSA 5FHIA 3ZLPA 2TRXA 2YJHA 2YOIA 1ZMAA 3FKFA 3P90A 5DVBA 1XCCA 3ERFA 5GSSA 1E2YA 4KGIA 1Q98A 1OC9B 1PL2A 4Z2TA 1FVKA 1ILOA 4POKA 1XZOA 3EMPA 1F3BA 2KOKA 3I6AA 1YKAA 4JZQA 1TTZA 1NM3A 2IL3A 1GP1A 4OO4A 4MJBA 2NTOA 2HYXA 2IMEA 4QL7A 3VWVA 1LJRA 2WZ9A 4V1Ap 1PKZA 4POLA 4EC0A 1NHOA 3O3TA 2CX4A 1PA3A 1Y6EA 4TXOB 4K5SA 2RM6A 3UL3A 4A5PA 1T7PB 2E2GA 3GSTA 4RQRA 1TJDA 2QKEA 1T1VA 2RLIA 3NOFA 4BL7B 3VFIA 3QD9A 4IJ3A 2LNSA 3KH9A 1K3LA 4KW6A 2QGVA 4CY6A 1MD4A 4EO3A 4KSOA 2HNLA 2IWTA 5ECMB 3QAWA 5IM9A 2VO4A 3ZFLA 4EUYA 1H75A 4GTUA 3WGXA 1BQ7A 2VLUA 5ECSA 3GKMA 5CRWA 3RAZA 3DGQA 1T4YA 5DJLA 2B7KA 2OBIA 2X49A 2VLVA 4MK3A 1CQHA 5ENUA 1KEBA 4G10A 2HXKA 4KH7A 3VWXA 1PRXA 1K3OA 3FZAA 4IHUA 4DEJA 4K9ZA 2PPTA 2XC2A 3CYNA 2LNTA 3TJGA 4CDOA 3TJKA 1Z6NA 5ID2B 4YQVA 2DIYA 4I6XA 3GH6A 2G0FA 3C1SA 3KMOA 1TI3A 5D9TA 2H72A 3RHBA 4IJIA 2C0EA 1SL0B 2IIYA 2GTUA 3I69A 2H6XA 4Z7XA 1XWGA 1SJIA 4V2NA 5E4WA 2YWIA 3WT2A 2EC4A 1K0NA 4XTSA 1Z3EA 3TKSA 3HXSA 20GSA 2ZCTA 2H8LA 5H5SA 3GKKA 1R7HA 4O5RA 3GL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A8Y A;  3EU3 A;  4X0X A;  5ECH B;  2F3M A;  1C72 A;  1U6T A;  4L5L A;  6GSX A;  2AHE A;  2V2G A;  5ELG A;  4OMV A;  6GSW A;  2EIR A;  1QXH A;  3DWV A;  3MDK A;  1OE7 A;  4MMM A;  1ZCP A;  4DVC A;  5CRD A;  22GS A;  1MDK A;  3RHC A;  1SL2 B;  3DXB A;  3L9U A;  4LL1 B;  5G30 A;  4KDY A;  3TGZ A;  1XW6 A;  4HZ2 A;  4K1F A;  3IAS 2;  4CHS A;  4RI6 A;  4FYC A;  3A2V A;  3GKX A;  3TKP A;  2OE0 A;  4BA7 A;  3U6V A;  2LKU A;  4TKY A;  2B7J A;  2I1U A;  4IQ1 A;  2O8V B;  4ZB8 A;  3TDG A;  3LG6 A;  3U5R E;  2H0G A;  3IAM 2;  1TRV A;  2WGR A;  2H74 A;  2DJ1 A;  19GS A;  2IMF A;  2WS2 A;  4J56 E;  5EY6 A;  1AQV A;  1DSB A;  4IBP A;  1DE1 A;  3FHK A;  2C8U A;  1QMV A;  1ON4 A;  5IMD A;  5DAL A;  2B3S A;  2OAC A;  1BYE A;  3TKS C;  4FO5 A;  3APO A;  1PL1 A;  4O32 A;  4BVY A;  1PX7 A;  4PNF A;  1A0R P;  5J9C A;  2ZNM A;  1GNE A;  3IA1 A;  3KH7 A;  3KD0 A;  4ZXG A;  2J9H A;  1T8E B;  3IOS A;  1DUG A;  4GLT A;  1B8X A;  2L6C A;  1JZW A;  3KTB A;  4XCS A;  1HYU A;  2NPB A;  1E6B A;  5DCG A;  2R6K A;  2LJA A;  3G7I A;  1JLW A;  1V40 A;  4JBB A;  2VM2 A;  2KP2 A;  3QAG A;  2C1Y A;  1SJZ A;  3G7Y A;  5KN3 A;  1TXX A;  3BBY A;  2VAF A;  4ML6 A;  1K0C A;  1ZZY A;  3J7Y b;  5GZZ B;  1TU8 A;  2XBQ A;  1YKC A;  2WJU A;  2H1A A;  3FRC A;  3D21 A;  1S3C A;  1PN9 A;  2O87 A;  1O81 A;  4MJE A;  5B6M A;  4OFT A;  3C8E A;  4WF5 A;  1Z5Y E;  5G1L A;  2B5Y A;  1GSQ A;  1UA5 A;  3F4R A;  3CRT A;  1J08 A;  3PR8 A;  4DSR A;  5AIS A;  1IYI A;  1GLQ A;  4K7N A;  5JCU A;  3F8U A;  3HHV A;  4O92 A;  3F0I A;  1G7E A;  5JWO B;  4ZL7 A;  3GX8 A;  2QC7 A;  2H6Y A;  1XPV A;  4PUF C;  2KLX A;  1TW9 A;  1HD2 A;  1VF1 A;  3P7X A;  5EL8 A;  1O73 A;  3QAV A;  1SJ6 A;  3UAP A;  1A23 A;  3UVT A;  1TRW A;  2DJ2 A;  2VOC A;  2R5G A;  2C0D A;  3TKS E;  5IO2 A;  4KSM A;  1UVZ A;  2P0G A;  4OFM A;  5IO0 A;  5DAL B;  2CAI A;  2QSI A;  1O8X A;  4L8E A;  4NXI A;  3EYT A;  2YP6 A;  3FZ5 A;  4PGT A;  3PIN A;  2GQL A;  1URM A;  4EDY A;  4F0C A;  4LLR A;  5DDL A;  1IYH A;  3BD2 A;  1YF0 A;  2V6O A;  3IK9 A;  3W8J A;  2O89 A;  1DE2 A;  13GS A;  2GST A;  1CQG A;  1B4P A;  1XWB A;  2V1M A;  2OE1 A;  3GV1 A;  3IV4 A;  3AY8 A;  1GUH A;  4TR1 A;  4XS4 A;  3CBU A;  3HCZ A;  4BWS A;  2CQ9 A;  5IPG A;  4DSQ A;  1Q4J A;  4EDZ A;  2C0G A;  4GQF A;  4TRX A;  4XRA A;  2FHE A;  2YV7 A;  5AN1 A;  1AQX A;  1TK0 B;  3L9V A;  1HNA A;  4EF0 A;  4KCE A;  5IIZ A;  3WGD A;  2LRN A;  1PX6 A;  1G0T A;  1SU9 A;  1SD9 A;  2E2M A;  2GLR A;  3FR9 A;  1GTA A;  4JR6 A;  1UN2 A;  3TJJ A;  1ZYQ B;  4DSS A;  4ZB6 A;  1M9A A;  4H86 A;  3DD3 A;  5GST A;  5G2Z A;  3Q19 A;  1BG5 A;  1EWX A;  3UIW A;  1MEK A;  1K0M A;  1WWJ A;  1SK1 A;  5KEJ A;  1V58 A;  1XBS A;  2H0I A;  2DC5 A;  5ELA A;  1F9M A;  3WT1 A;  3HYP A;  2IFQ B;  2MMA A;  3P2A A;  4WXT A;  6GSS A;  2X8H A;  5COH A;  2LRT A;  3QFB C;  3OR5 A;  4AGS A;  2H75 A;  1SK0 A;  3TRP A;  1M0U A;  3HY2 A;  3GIX A;  4K8M A;  1T3B A;  4NHW A;  3LOR A;  3HKR A;  4WR5 A;  4PUA A;  3MAK A;  3TJB A;  3IXR A;  4FIW A;  1NHY A;  4NV2 A;  5AIX A;  4TW5 A;  1K0A A;  1MTC A;  4LA1 A;  1FW1 A;  2HRN A;  4N11 A;  4RQX A;  1PD2 1;  4K7O A;  3LEF A;  2PBJ A;  3D4T A;  1FO5 A;  4MJA A;  4XHM A;  4IN0 A;  4LMV A;  3KTL A;  5HR0 A;  1YEX A;  1V98 A;  2LS5 A;  3ZML A;  1ST9 A;  2CZ3 A;  1XWA A;  2PGT A;  12GS A;  3A5W A;  5J41 A;  1JZD A;  5GAP D;  1JFU A;  1KNG A;  1WMJ A;  1AC1 A;  5L71 A;  4TR1 B;  2H70 A;  3GA4 A;  3HD5 A;  2L4C A;  1TRS A;  5F8B A;  4PQH A;  4HZ4 A;  3GUR A;  5DQS A;  4QQ7 A;  1GNW A;  3H1N A;  3IE3 A;  1M2B A;  3DRN A;  4K0N A;  3TRX A;  3QCP A;  4MP4 A;  1JZO A;  3F4S A;  2A4V A;  1EP8 A;  1X5C A;  2AB6 A;  2VCZ A;  1SK2 A;  2HZE B;  1TK5 B;  2OBK A;  3N5O A;  1U3I A;  4OD7 A;  2F9S A;  4ZBA A;  1XFL A;  2MMZ A;  1WE0 A;  5A4W A;  4AF2 A;  4DSS B;  4WEY A;  4N10 A;  2C3T A;  4MF7 A;  3D0Z A;  2K6V A;  5DBQ A;  2R2J A;  5H5Q A;  4JE1 A;  2EIO A;  1T4Z A;  4EVM A;  2YAN A;  1FVJ A;  1EOH A;  1T00 A;  3FYG A;  2BTO T;  4MDC A;  3CRU A;  3L0H A;  3S9F A;  1N8J A;  4KDU A;  1XVW A;  1R5A A;  3VI5 A;  3E0U A;  3EVI A;  3R2Q A;  3EUR A;  4GQC A;  2A2S A;  1GSF A;  3BCI A;  1WP0 A;  4G19 A;  1BJX A;  3UJ1 A;  2HSH A;  2WDU A;  2JZT A;  5F05 A;  4PQI A;  4NAX A;  1EV9 A;  2C3Q A;  2HZF A;  4I97 A;  4MF5 A;  1YQ1 A;  4I5Q A;  3EE2 A;  4MH3 A;  2N5F A;  2X99 A;  2N5A A;  4JU5 A;  1KTE A;  3C71 A;  1A0F A;  2P5R A;  3ZIV A;  5ECK B;  1USB A;  3H4K A;  2V6K A;  2JU5 A;  3VUR A;  2LJK A;  2CZ2 A;  2J23 A;  3WYW A;  5AGY A;  2M72 A;  2A2R A;  1U3A A;  2FWH A;  1AUC A;  5G1K A;  5HFI A;  1GSY A;  4G9H A;  4YH2 A;  3EWL A;  2VM1 A;  2V41 A;  3E9J B;  3PGT A;  4EL1 A;  1AIU A;  1QFN A;  2B6M A;  3IPZ A;  2GZZ A;  2JZR A;  1WIK A;  16GS A;  3KJY A;  1X0R A;  4MA9 A;  4XS6 A;  2WCI A;  2NVL A;  2JSY A;  2CAQ A;  3M9K A;  2H1D A;  2JZS A;  2YV9 A;  1SD8 A;  5A5K A;  1ERU A;  2PVO C;  2B1K A;  1AAZ A;  2VCV A;  1FB0 A;  4G2E A;  1OKT A;  1B9Y C;  3GN3 A;  4IP1 A;  3RPN A;  3BOA A;  3KMN A;  2LV3 A;  5KN2 A;  4WBR D;  4HS1 A;  2X64 A;  1GWC A;  2FWF A;  2LRC A;  1U88 A;  4HDE A;  6GSV A;  2O7K A;  1QK8 A;  4ZL8 A;  2NBS A;  3ZRE A;  1K0B A;  5HFG A;  3UBK A;  4LL4 B;  1M99 A;  1OKD A;  2C3N A;  2DIZ A;  1O7U A;  2K18 A;  2Z9S A;  3DML A;  2AAW A;  1LU4 A;  1VF3 A;  4HI7 A;  3Q18 A;  1B4Q A;  4HQZ A;  3F3Q A;  2KUC A;  1FOV A;  2FGX A;  4KND A;  4WF4 A;  2GZY A;  2YJ7 A;  1Z9H A;  3UBL A;  4GSS A;  1GTI A;  2F8A A;  2PMT A;  4POB A;  3F3R A;  2RM5 A;  4JED A;  1PQN A;  1YZX A;  2VUP A;  3FEU A;  3HVS A;  2XPD A;  3HZ4 A;  3L9S A;  2L5L A;  4MF6 A;  3DVX A;  1PMT A;  2VCX A;  2GZP A;  2I3Y A;  3CTF A;  3TJF A;  2B1L A;  4ZIL A;  4NV5 A;  2GT5 A;  2YZH A;  3D5J A;  2HLS A;  3FK8 A;  4TXV A;  3ZIT A;  3QPM A;  2NDO A;  2XBI A;  5CRE A;  1THX A;  9GSS A;  4GWR A;  3VWU A;  4PX1 A;  1XOA A;  4ILF A;  5IMZ A;  1ZOF A;  1A8L A;  1NW2 A;  2HRF A;  2C4J A;  2FY6 A;  2DSA A;  3GRX A;  1GTU A;  3MSZ A;  2DJ0 A;  1ABA A;  3L78 A;  4ZL9 A;  1O85 A;  2H71 A;  3APS A;  6GSY A;  3GX0 A;  2AYT A;  1ZL9 A;  3DEX A;  1XXU A;  2L57 A;  4ECI A;  2VD1 A;  2VL2 A;  3L4N A;  1F37 A;  2AUV A;  2LUS A;  5IMC A;  3HZ8 A;  3ZYW A;  4BVX A;  3KEB A;  4FYU A;  1ML6 A;  3UVH A;  1ACV A;  1VF4 A;  3VPQ A;  1EGR A;  4ZBD A;  3K8N A;  5JCG A;  3ISO A;  4ML1 A;  3VWW A;  3F4T A;  2IMI A;  2H1B A;  3QFA C;  3FZ4 A;  4D73 A;  4PXO A;  1H4O A;  2ALB A;  4XRD A;  2X8C A;  3ZL5 A;  1J9B A;  3ZMK A;  5HR3 A;  1PSQ A;  4OCF A;  2KP1 A;  3I43 A;  1PKW A;  5D8I A;  2TIR A;  3V1W A;  1WOU A;  2R3X A;  2IPA A;  1TI1 A;  3CSJ A;  3ZRD A;  1S3D A;  1UC7 A;  2K8S A;  1MDI A;  2L59 A;  2MBT A;  4JR4 A;  3H79 A;  1ERW A;  1XVQ A;  2ON7 A;  3O76 A;  1XOB A;  4E8H A;  3EIN A;  5F07 A;  4I2T A;  1Z7P A;  2FCH A;  1DBY A;  3M9J A;  1A24 A;  1EEM A;  1WRY A;  5HFK A;  2FUG 2;  4ECJ A;  3LYK A;  3FY7 A;  1YDK A;  2PVQ A;  3TB2 A;  3DYR A;  2IMD A;  3LWA A;  2JAC A;  1SKR B;  2PER A;  2GVP A;  2WUL A;  3W6G A;  3FZ9 A;  2DJ3 A;  3HJO A;  5CRH A;  2VL2 C;  4OCE A;  4JRR A;  5ECL B;  5H5R A;  2OA7 A;  2GQM A;  2LEG A;  1Y25 A;  2LQQ A;  5ECI B;  4GRF A;  4OWY A;  2IJY A;  1J0F A;  1JHB A;  5IMF A;  3A2X A;  3UAR A;  2JL4 A;  1BED A;  1GL8 A;  3VLN A;  1O6J A;  3G9B A;  2L5O A;  4MPG A;  2YN1 A;  3DKS A;  1GSU A;  4L0W A;  1HNC A;  4F0B A;  2VLT A;  1QQ2 A;  4Q5N A;  2CA8 A;  1FHE A;  3EU4 A;  1G7O A;  2DML A;  1AQW A;  2IMK A;  2YPM A;  3NIV A;  3HJP A;  2C80 A;  2L4Q A;  1ERV A;  2RII A;  3ZFB A;  2G2Q A;  1FAA A;  4XS1 A;  1A2M A;  1W4V A;  2K9F A;  3KM6 A;  2I9H A;  3FR3 A;  4WET A;  5J4U A;  4ID0 A;  2GS3 A;  5EVO A;  1SEN A;  3LXT A;  4YAV A;  3CSH A;  4ECB A;  5HR2 A;  4K7I A;  3IHQ A;  5F06 A;  3QMX A;  1SKW B;  1EP7 A;  5EPF A;  3HA9 A;  4EE0 A;  1A2L A;  2GSS A;  4LMW A;  5CYY A;  2PWJ A;  3IBH A;  3JCM L;  2V32 A;  5J9B A;  4YAP A;  3F63 A;  2C0F A;  3KP8 A;  3GL5 A;  3H93 A;  3MNG A;  3GYK A;  1FG4 A;  4J57 E;  1GSD A;  1KBN A;  4HJM A;  4KCA A;  1HNB A;  1EZK A;  3HDC A;  5F0G A;  2FA8 A;  2GSQ A;  3ZVJ A;  1R5P A;  1JZR A;  4ULX A;  4IGJ A;  2EIQ A;  3GHA A;  5ID2 A;  2YNX A;  3IR4 A;  1SKS B;  1TKD B;  1TRU A;  1GSS A;  2VD0 A;  3F6D A;  5ABR A;  4IQA A;  5ECP B;  5G5F A;  5J5N A;  1SYR A;  4FYB A;  3EMX A;  4TR0 A;  4POM A;  4ZB9 A;  1WJK A;  4MAB A;  4IEL A;  3ED3 A;  2B5X A;  5B7C A;  1W89 A;  1M9B A;  4XS4 B;  3M1G A;  2K8V A;  1VRS D;  5KN1 A;  2B5E A;  1ERT A;  3HVX A;  5A4V A;  3CSI A;  3KCM A;  2WB9 A;  4ISD A;  2VL3 A;  3VI7 A;  1O8W A;  2FWG A;  1V2A A;  4FH8 A;  4K6X A;  5D93 A;  3E3E A;  3Q74 A;  1LBK A;  1RQM A;  4AJ6 A;  2IN3 A;  4V2L A;  5B8A A;  2VCT A;  1G6Y A;  3ME7 A;  2OKA A;  2LQO A;  3N9J A;  5JWQ B;  11GS A;  2CVD A;  2FD3 A;  2CX3 A;  4GF0 A;  5B6N A;  4AJ8 A;  1I9D A;  3M0F A;  1JLV A;  2GGT A;  4YQU A;  1TDI A;  4BWQ A;  3BJ5 A;  2JAD A;  2GT6 A;  3F6F A;  1YF1 A;  3KP9 A;  1V57 A;  3Q6O A;  3PH9 A;  1R4W A;  1TOF A;  4L0U A;  2GDR A;  1GUM A;  2X8G A;  4NWY A;  4NPB A;  3D4M A;  1Z6M A;  2FWE A;  3TOT A;  2H66 A;  4IP6 A;  3F9U A;  3G7J A;  2DJK A;  2WRT A;  3LQ7 A;  1ZYE A;  5IPH A;  1B48 A;  2AV4 A;  2I81 A;  2OE3 A;  18GS A;  2D2Z A;  1B9X C;  3CXG A;  5HR1 A;  4NMU A;  4GSN A;  4IVF A;  4HU9 A;  2VIM A;  5JWR B;  2H19 A;  3IK7 A;  2YZU A;  1N2A A;  3SWL A;  5IQY A;  2RUE A;  6GST A;  3FW2 A;  3D22 A;  3NZN A;  1V9W A;  1ZGN A;  1HQO A;  5A4U A;  4KX4 A;  3ERW A;  3DIE A;  2JSZ A;  2BJX A;  2HFD A;  1THO A;  1S3A A;  1X5E A;  4I8B A;  1XW5 A;  4N30 A;  2MYG A;  4KE3 A;  5CP1 A;  4N0V A;  1OE8 A;  4QL9 A;  1K3Y A;  1NSW A;  3UEM A;  1SL1 B;  5CNW A;  3ERG A;  2N5B A;  1M2D A;  1RK4 A;  4X43 A;  4WKW A;  3QDN A;  1TK8 B;  4PNG A;  5C00 A;  2ZUP A;  4V2M A;  1RW1 A;  2GQK A;  3US3 A;  5LD0 A;  5DJM A;  4Q5F A;  3CTG A;  3LJR A;  3IRA A;  5IOW A;  2L6D A;  3TOU A;  3HVV A;  2H1G A;  4L5O A;  4KB3 A;  3DVW A;  4HQS A;  1X9M B;  3GFK A;  4TVE A;  4KUN A;  1G6W A;  2F51 A;  5G31 A;  3C7M A;  4XIH A;  3GSS A;  2FA4 A;  5E59 A;  5CAX A;  2H30 A;  3KGK A;  1YY7 A;  4CW9 A;  2FNO A;  1Z7R A;  3C73 A;  1X9S B;  2CVB A;  1XW9 A;  2FLS A;  4OO5 A;  2I4A A;  1PGT A;  5GAN D;  2PN8 A;  3TRQ A;  2H76 A;  5LNK e;  4TR4 A;  3O6T A;  3SBC A;  4ACS A;  4K2D A;  2VCQ A;  3HJM A;  2HE3 A;  1XWK A;  5ECR B;  3W8S A;  1MDJ A;  3RBT A;  4V1A g;  2ON5 A;  4GST A;  4BPY A;  2H73 A;  1F2E A;  3WD6 A;  1X5D A;  3RPP A;  1K0D A;  2MMO A;  1GSE A;  4E8E A;  4HEA 2;  2O85 A;  2DMM A;  5D9X A;  2YWM A;  4ECC A;  3ZVJ D;  5FWG A;  1OC8 A;  3ZIJ A;  3IDV A;  4TN8 A;  5FT3 A;  3D6I A;  4MZB A;  3M8N A;  2YCD A;  5D96 A;  2XPE A;  1R26 A;  5KN0 A;  3CMI A;  4TR3 A;  5DAK A;  4TOP A;  10GS A;  3J7Y k;  1VF2 A;  3A3T A;  2P31 A;  3APQ A;  4WBJ A;  2YWN A;  2DBC A;  2DLX A;  3I9V 2;  5DCH A;  4GCI A;  2R4V A;  4I2U A;  1OAZ A;  2OJL A;  1AW9 A;  3H8Q A;  1EOG A;  4RI7 A;  2F8F A;  1K0O A;  3UOM A;  3QR6 A;  1GTB A;  4PUR A;  3QOU A;  4KDX A;  1GUL A;  2M80 A;  2P5Q A;  2PUK C;  5CRG A;  4ZIJ A;  3TKQ A;  3GNJ A;  2CVK A;  2HT9 A;  3LFL A;  2DJJ A;  2LJR A;  2VL9 A;  2XHF A;  2KHP A;  4O7H A;  4MLY A;  1TP9 A;  4GXZ A;  5CO3 A;  4YQM A;  5ECQ B;  5J3R A;  2LTK A;  2E7P A;  4N0Z A;  5DQY A;  4K0G A;  3GTU A;  5IOX A;  5IMV A;  2YWO A;  3GMF A;  4F82 A;  5JCW A;  2IFQ A;  4IW9 A;  2HSY A;  5B8B A;  3A2W A;  3VK9 A;  14GS A;  3FR6 A;  2TRC P;  2H6Z A;  2RUF A;  4HJ2 A;  1A2J A;  2E0Q A;  1GH2 A;  3LYP A;  1X9W B;  4F9Z A;  1TU7 A;  3KZQ A;  4Q5R A;  1M2A A;  4IS0 A;  5LCZ A;  5IMA A;  4RUV A;  2VCW A;  7GSS A;  2H0H A;  5ECO B;  3WGE A;  4J2F A;  1FB6 A;  3GUS A;  1OC9 A;  2BMX A;  4Q5Q A;  3TCO A;  3ZZX A;  3VPT A;  5G5E A;  5INY A;  1U87 A;  4KAE A;  1XWC A;  1F6M C;  2HI7 A;  4KA0 A;  4NHZ A;  4MPF A;  5C04 A;  4IKH A;  1EV4 A;  1M7T A;  3M3M A;  4PQ1 A;  1I5G A;  3P8W A;  3EC3 A;  5ECN B;  2REM A;  1XIY A;  1EGO A;  2AJQ B;  5DAK B;  4X1U A;  3BCK A;  2WFC A;  2H01 A;  5HQP A;  3TUE A;  5D73 A;  3MWH A;  1QUW A;  4TXO A;  3RDW A;  2M46 A;  1OVN A;  1WPI A;  3KIJ A;  3GH9 A;  1OYJ A;  1GRX A;  1GLP A;  4HU7 A;  4MZC A;  2MMN A;  17GS A;  1QGV A;  3GKN A;  2GSR A;  1AXD A;  1VGL A;  3KXO A;  3LGC A;  4BL7 A;  3IC4 A;  1GUK A;  6GSU A;  2HZE A;  1BAY A;  4F2I A;  4HOJ A;  3UMA A;  1OC3 A;  2CT6 A;  1SYX A;  3ZTL A;  1F3A A;  4D73 B;  1YJ6 A;  3LSZ A;  3LXZ A;  5AIV A;  5D9W A;  3GTU B;  5D9V A;  4AJ7 A;  2LST A;  2R37 A;  2MZC A;  4EKZ A;  4MH2 A;  2ES7 A;  4WR4 A;  2MBS A;  1MD3 A;  4HUA A;  2CV4 A;  4P3Y B;  4OFN A;  4F03 A;  3ME8 A;  4MJC A;  1BX9 A;  4EXJ A;  1YEP A;  4MCU A;  2OAD A;  2PU9 C;  4MZW A;  1EEJ A;  3TKR A;  3C1R A;  4ZBB A;  8GSS A;  5FHI A;  3ZLP A;  2TRX A;  2YJH A;  2YOI A;  1ZMA A;  3FKF A;  3P90 A;  5DVB A;  1XCC A;  3ERF A;  5GSS A;  1E2Y A;  4KGI A;  1Q98 A;  1OC9 B;  1PL2 A;  1FVK A;  1ILO A;  4POK A;  1XZO A;  3EMP A;  1F3B A;  2KOK A;  3I6A A;  1YKA A;  4JZQ A;  1TTZ A;  1NM3 A;  2IL3 A;  1GP1 A;  4OO4 A;  4MJB A;  2NTO A;  2HYX A;  2IME A;  4QL7 A;  3VWV A;  1LJR A;  2WZ9 A;  4V1A p;  1PKZ A;  4POL A;  4EC0 A;  1NHO A;  3O3T A;  2CX4 A;  1PA3 A;  1Y6E A;  4TXO B;  2RM6 A;  3UL3 A;  1T7P B;  2E2G A;  3GST A;  4RQR A;  1TJD A;  2QKE A;  1T1V A;  2RLI A;  3NOF A;  3VFI A;  3QD9 A;  4IJ3 A;  2LNS A;  3KH9 A;  1K3L A;  4KW6 A;  2QGV A;  1MD4 A;  4EO3 A;  4KSO A;  2HNL A;  2IWT A;  5ECM B;  3QAW A;  5IM9 A;  2VO4 A;  3ZFL A;  4EUY A;  1H75 A;  4GTU A;  3WGX A;  1BQ7 A;  2VLU A;  5ECS A;  3GKM A;  5CRW A;  3RAZ A;  3DGQ A;  1T4Y A;  5DJL A;  2B7K A;  2OBI A;  2VLV A;  4MK3 A;  1CQH A;  5ENU A;  1KEB A;  4G10 A;  2HXK A;  4KH7 A;  3VWX A;  1PRX A;  1K3O A;  3FZA A;  4IHU A;  4DEJ A;  4K9Z A;  2PPT A;  2XC2 A;  3CYN A;  2LNT A;  3TJG A;  4CDO A;  3TJK A;  1Z6N A;  5ID2 B;  4YQV A;  2DIY A;  4I6X A;  3GH6 A;  2G0F A;  3C1S A;  3KMO A;  1TI3 A;  5D9T A;  2H72 A;  3RHB A;  4IJI A;  2C0E A;  1SL0 B;  2IIY A;  2GTU A;  3I69 A;  2H6X A;  4Z7X A;  1XWG A;  1SJI A;  4V2N A;  5E4W A;  2YWI A;  3WT2 A;  2EC4 A;  1K0N A;  4XTS A;  1Z3E A;  3TKS A;  3HXS A;  20GS A;  2ZCT A;  2H8L A;  5H5S A;  3GKK A;  1R7H A;  4O5R A;  3GL3 A; 
#chains in the Genus database with same CATH topology
 1A8Y A;  3EU3 A;  4X0X A;  5ECH B;  4L6A A;  2F3M A;  1C72 A;  1U6T A;  4L5L A;  6GSX A;  2AHE A;  2V2G A;  2QGA B;  4OMV A;  5ELG A;  2YV5 A;  6GSW A;  2EIR A;  1QXH A;  3DWV A;  3MDK A;  1OE7 A;  4MMM A;  1IW7 D;  1ZCP A;  4DVC A;  5CRD A;  22GS A;  1MDK A;  3RHC A;  1SL2 B;  3DXB A;  3L9U A;  4EIQ A;  4LL1 B;  5G30 A;  4KDY A;  3TGZ A;  1XW6 A;  4HZ2 A;  4APA A;  4K1F A;  3IAS 2;  4CHS A;  4RI6 A;  4FYC A;  3R6Q A;  3A2V A;  3GKX A;  3TKP A;  2OE0 A;  4BA7 A;  3U6V A;  2LKU A;  4TKY A;  2B7J A;  4Z2R A;  2I1U A;  4IQ1 A;  2O8V B;  4ZB8 A;  3IC8 A;  3TDG A;  3LG6 A;  3U5R E;  2H0G A;  3IAM 2;  1TRV A;  2WGR A;  2H74 A;  2DJ1 A;  19GS A;  2IMF A;  2WS2 A;  4J56 E;  5EY6 A;  1AQV A;  1DSB A;  4IBP A;  1DE1 A;  3FHK A;  2C8U A;  1QMV A;  1ON4 A;  5IMD A;  5DAL A;  2B3S A;  2OAC A;  4EFC A;  1BYE A;  3TKS C;  4FO5 A;  3APO A;  1PL1 A;  4O32 A;  4BVY A;  1PX7 A;  4PNF A;  1A0R P;  5J9C A;  2ZNM A;  1GNE A;  3IA1 A;  3KH7 A;  3BWV A;  3KD0 A;  4ZXG A;  4MUM A;  2J9H A;  4EIP A;  1T8E B;  3IOS A;  1DUG A;  4GLT A;  1B8X A;  2L6C A;  1JZW A;  3KTB A;  4XCS A;  1HYU A;  2NPB A;  1E6B A;  5DCG A;  2R6K A;  2LJA A;  3G7I A;  1JLW A;  1FUR A;  1V40 A;  1C3C A;  4JBB A;  2VM2 A;  2KP2 A;  3QAG A;  2C1Y A;  1SJZ A;  3G7Y A;  5KN3 A;  1TXX A;  3BBY A;  2VAF A;  4ML6 A;  1FUP A;  1K0C A;  1ZZY A;  3J7Y b;  5GZZ B;  1TU8 A;  2XBQ A;  1YKC A;  2WJU A;  2H1A A;  3FRC A;  3D21 A;  1S3C A;  1PN9 A;  2O87 A;  1O81 A;  4MJE A;  5B6M A;  4OFT A;  3C8E A;  4WF5 A;  1TJU A;  1Z5Y E;  5G1L A;  2B5Y A;  1GSQ A;  1UA5 A;  3F4R A;  3CRT A;  1J08 A;  3PR8 A;  4DSR A;  5AIS A;  1IYI A;  1GLQ A;  4K7N A;  5JCU A;  3F8U A;  3HHV A;  4O92 A;  3F0I A;  1G7E A;  5JWO B;  4ZL7 A;  3GX8 A;  2QC7 A;  2H6Y A;  1XPV A;  4PUF C;  2KLX A;  1TW9 A;  4K2X A;  1HD2 A;  1VF1 A;  3P7X A;  2JAW A;  5EL8 A;  1O73 A;  3QAV A;  2X75 A;  1SJ6 A;  3UAP A;  1A23 A;  3UVT A;  1TRW A;  2DJ2 A;  2VOC A;  2R5G A;  2C0D A;  1MH9 A;  2JAR A;  3TKS E;  5IO2 A;  4KSM A;  1UVZ A;  2P0G A;  4OFM A;  5IO0 A;  3FMW A;  5DAL B;  2CAI A;  2QSI A;  1O8X A;  4L8E A;  4NXI A;  3EYT A;  2YP6 A;  3FZ5 A;  4PGT A;  3PIN A;  4BVY B;  2GQL A;  1URM A;  4EDY A;  4F0C A;  4LLR A;  5DDL A;  1IYH A;  3BD2 A;  4YIH A;  1YF0 A;  2V6O A;  3IK9 A;  3W8J A;  5F92 A;  2O89 A;  1DE2 A;  13GS A;  2GST A;  1CQG A;  3LW9 A;  1B4P A;  1XWB A;  2V1M A;  2OE1 A;  3GV1 A;  3IV4 A;  2R0G A;  3AY8 A;  1GUH A;  4TR1 A;  4XS4 A;  3CBU A;  3HCZ A;  4FQU A;  4BWS A;  2CQ9 A;  5IPG A;  4DSQ A;  1Q4J A;  4EDZ A;  2C0G A;  4GQF A;  4TRX A;  4XRA A;  1M3J A;  1FUO A;  1AUW A;  2FHE A;  2YV7 A;  5AN1 A;  1AQX A;  1TK0 B;  3L9V A;  1HNA A;  4EF0 A;  4KCE A;  5KOW A;  5IIZ A;  3WGD A;  2LRN A;  1PX6 A;  1G0T A;  1SU9 A;  1T9H A;  1SD9 A;  2E2M A;  2GLR A;  3FR9 A;  1GTA A;  4JR6 A;  1UN2 A;  3TJJ A;  1ZYQ B;  4DSS A;  4ZB6 A;  1M9A A;  4H86 A;  3DD3 A;  5GST A;  5G2Z A;  3Q19 A;  1BG5 A;  1EWX A;  3UIW A;  1MEK A;  1K0M A;  1WWJ A;  1SK1 A;  4YKF A;  2DKH A;  5KEJ A;  1V58 A;  1XBS A;  2H0I A;  2DC5 A;  5ELA A;  1F9M A;  3WT1 A;  3HYP A;  2IFQ B;  2MMA A;  1U0L A;  3P2A A;  4WXT A;  6GSS A;  2X8H A;  5COH A;  4MX2 A;  2LRT A;  3QFB C;  3OR5 A;  4AGS A;  2H75 A;  1SK0 A;  3TRP A;  1M0U A;  3HY2 A;  3GIX A;  4K8M A;  1T3B A;  4NHW A;  3LOR A;  3HKR A;  4WR5 A;  4PUA A;  3MAK A;  3TJB A;  3IXR A;  4FIW A;  1NHY A;  4NV2 A;  5AIX A;  4TW5 A;  1K0A A;  1MTC A;  4LA1 A;  1FW1 A;  2HRN A;  4N11 A;  4RQX A;  1PD2 1;  4K7O A;  3LEF A;  2PBJ A;  3D4T A;  1FO5 A;  4MJA A;  4XHM A;  4IN0 A;  4LMV A;  3KTL A;  4APB A;  5HR0 A;  2R0P A;  1YEX A;  1V98 A;  2LS5 A;  3ZML A;  1ST9 A;  2CZ3 A;  1XWA A;  2PGT A;  12GS A;  3A5W A;  5J41 A;  1JZD A;  5GAP D;  1JFU A;  1KNG A;  1WMJ A;  1AC1 A;  4G0I A;  5L71 A;  4TR1 B;  2H70 A;  1Z4M A;  3GA4 A;  3HD5 A;  2L4C A;  1TRS A;  5F8B A;  4PQH A;  4HZ4 A;  3GUR A;  5DQS A;  4QQ7 A;  1GNW A;  3H1N A;  3IE3 A;  1M2B A;  3DRN A;  4K0N A;  3TRX A;  3QCP A;  4MP4 A;  1JZO A;  3F4S A;  2A4V A;  1EP8 A;  1X5C A;  2AB6 A;  2VCZ A;  1SK2 A;  2HZE B;  1TK5 B;  4O5U A;  2OBK A;  3N5O A;  1U3I A;  4OD7 A;  2F9S A;  4ZBA A;  1XFL A;  2MMZ A;  1WE0 A;  5A4W A;  4AF2 A;  4DSS B;  4WEY A;  4N10 A;  2C3T A;  4MF7 A;  3D0Z A;  2K6V A;  5DBQ A;  2R2J A;  5H5Q A;  4JE1 A;  2A2P A;  2EIO A;  1T4Z A;  4EVM A;  2YAN A;  1FVJ A;  1EOH A;  1T00 A;  3FYG A;  2BTO T;  4MDC A;  3CRU A;  3L0H A;  3S9F A;  1N8J A;  4CY8 A;  4KDU A;  1XVW A;  1R5A A;  3VI5 A;  3E0U A;  3EVI A;  3R2Q A;  3EUR A;  4GQC A;  2A2S A;  1GSF A;  2FUS A;  3BCI A;  1WP0 A;  4G19 A;  1BJX A;  3UJ1 A;  2HSH A;  2WDU A;  2JZT A;  5F05 A;  4PQI A;  4NAX A;  1EV9 A;  3HVN A;  2C3Q A;  2HZF A;  4I97 A;  4MF5 A;  4O5Q A;  1YQ1 A;  4I5Q A;  3EE2 A;  4MH3 A;  2N5F A;  2X99 A;  2N5A A;  4JU5 A;  1KTE A;  3C71 A;  1A0F A;  2P5R A;  3ZIV A;  5ECK B;  1USB A;  3H4K A;  3IHG A;  2V6K A;  2JU5 A;  3VUR A;  4ADM A;  2LJK A;  2CZ2 A;  2J23 A;  3WYW A;  5AGY A;  2M72 A;  2A2R A;  4NSL A;  1U3A A;  2FWH A;  1AUC A;  5G1K A;  5HFI A;  1GSY A;  4G9H A;  4YH2 A;  3EWL A;  2VM1 A;  2V41 A;  3E9J B;  3PGT A;  4EL1 A;  1AIU A;  1QFN A;  2B6M A;  3IPZ A;  2GZZ A;  1TJW A;  2JZR A;  1WIK A;  16GS A;  3KJY A;  1X0R A;  4MA9 A;  4XS6 A;  2WCI A;  2NVL A;  2JSY A;  2CAQ A;  3M9K A;  2H1D A;  2JZS A;  2YV9 A;  1SD8 A;  5A5K A;  1ERU A;  2PVO C;  2B1K A;  1AAZ A;  2VCV A;  1FB0 A;  4G2E A;  1OKT A;  1B9Y C;  3GN3 A;  4IP1 A;  3RPN A;  3BOA A;  3KMN A;  2LV3 A;  5KN2 A;  4WBR D;  1TJV A;  4HS1 A;  2X64 A;  1GWC A;  2FWF A;  2LRC A;  1U88 A;  4HDE A;  6GSV A;  2O7K A;  1QK8 A;  4ZL8 A;  2NBS A;  3ZRE A;  1K0B A;  5HFG A;  3UBK A;  4LL4 B;  1M99 A;  1OKD A;  2C3N A;  2DIZ A;  1O7U A;  2K18 A;  2Z9S A;  3DML A;  2AAW A;  1LU4 A;  1VF3 A;  4HI7 A;  3Q18 A;  1Z4J A;  1B4Q A;  1K7W A;  4HQZ A;  3F3Q A;  4E88 A;  2KUC A;  1FOV A;  2FGX A;  4KND A;  4WF4 A;  1Q5N A;  2GZY A;  2YJ7 A;  1Z9H A;  3UBL A;  4GSS A;  1GTI A;  2F8A A;  2PMT A;  4POB A;  3F3R A;  2RM5 A;  4L57 A;  1PQN A;  1YZX A;  2VUP A;  4JED A;  3FEU A;  1U15 A;  3HVS A;  2XPD A;  3HZ4 A;  3L9S A;  2L5L A;  4MF6 A;  3DVX A;  1PMT A;  2VCX A;  4IQJ M;  2GZP A;  3CQF A;  2I3Y A;  3CTF A;  3TJF A;  2B1L A;  4ZIL A;  4NV5 A;  2GT5 A;  2YZH A;  3D5J A;  2HLS A;  3FK8 A;  1YFE A;  4TXV A;  3ZIT A;  3QPM A;  2NDO A;  1XWO A;  2XBI A;  5CRE A;  1THX A;  9GSS A;  4GWR A;  3VWU A;  4PX1 A;  1XOA A;  4ILF A;  5IMZ A;  1ZOF A;  1A8L A;  1NW2 A;  2HRF A;  2C4J A;  2FY6 A;  2DSA A;  3GRX A;  5KOX A;  1K62 A;  1GTU A;  2HSM A;  3MSZ A;  2DJ0 A;  1ABA A;  3L78 A;  4ZL9 A;  1O85 A;  2H71 A;  1DOF A;  3APS A;  6GSY A;  3GX0 A;  2AYT A;  1ZL9 A;  3DEX A;  1XXU A;  2L57 A;  4ECI A;  2VD1 A;  2VL2 A;  3L4N A;  1F37 A;  2AUV A;  2LUS A;  5IMC A;  3HZ8 A;  3ZYW A;  4BVX A;  3KEB A;  3R6V A;  4FYU A;  3OCE A;  1ML6 A;  3UVH A;  1ACV A;  1VF4 A;  3VPQ A;  1EGR A;  4ZBD A;  3K8N A;  5JCG A;  3ISO A;  4PTS A;  1ZYP A;  4ML1 A;  3VWW A;  3F4T A;  2IMI A;  2H1B A;  3QFA C;  3FZ4 A;  4D73 A;  4PXO A;  1H4O A;  2ALB A;  4XRD A;  2X8C A;  3ZL5 A;  1J9B A;  3ZMK A;  5HR3 A;  1PSQ A;  4OCF A;  2KP1 A;  3I43 A;  1PKW A;  3R3E A;  5D8I A;  2TIR A;  3V1W A;  1WOU A;  2R3X A;  2IPA A;  1HY1 A;  2PTS A;  1TI1 A;  3CSJ A;  1S3D A;  3ZRD A;  1UC7 A;  2K8S A;  1MDI A;  2L59 A;  2MBT A;  3NO9 A;  4JR4 A;  3H79 A;  1ERW A;  1XVQ A;  2ON7 A;  3O76 A;  1XOB A;  4E8H A;  3EIN A;  5F07 A;  4I2T A;  4MWO A;  1Z7P A;  2FCH A;  1DBY A;  3M9J A;  1A24 A;  1EEM A;  1WRY A;  5HFK A;  2FUG 2;  4ECJ A;  3LYK A;  3FY7 A;  1YDK A;  2PVQ A;  3TB2 A;  3DYR A;  2IMD A;  3LWA A;  2JAC A;  1SKR B;  2PER A;  2GVP A;  2HRA A;  2WUL A;  3W6G A;  3FZ9 A;  2DJ3 A;  3HJO A;  5CRH A;  2VL2 C;  4OCE A;  2PTR A;  4JRR A;  5ECL B;  5H5R A;  2OA7 A;  2GQM A;  2LEG A;  1Y25 A;  2LQQ A;  1RE5 A;  5ECI B;  5D6B A;  4GRF A;  4OWY A;  2IJY A;  1J0F A;  1JHB A;  5IMF A;  3A2X A;  3UAR A;  2JL4 A;  1BED A;  4ADL A;  1GL8 A;  3VLN A;  1O6J A;  3G9B A;  2L5O A;  4MPG A;  2YN1 A;  3DKS A;  1GSU A;  4L0W A;  1HNC A;  4F0B A;  2VLT A;  1QQ2 A;  4Q5N A;  2CA8 A;  1FHE A;  3EU4 A;  1G7O A;  2DML A;  1AQW A;  2QA1 A;  2IMK A;  2YPM A;  3NIV A;  3HJP A;  2C80 A;  2L4Q A;  1ERV A;  5BRT A;  1DCN A;  2RII A;  3ZFB A;  2G2Q A;  2E9F A;  1FAA A;  4XS1 A;  1A2M A;  1W4V A;  2K9F A;  3KM6 A;  2I9H A;  3FR3 A;  4WET A;  5J4U A;  1PN0 A;  4ID0 A;  2GS3 A;  5EVO A;  1TJ7 A;  1SEN A;  3LXT A;  4YAV A;  3CSH A;  3E04 A;  4ECB A;  5HR2 A;  4K7I A;  3IHQ A;  5F06 A;  3QMX A;  1SKW B;  1EP7 A;  5EPF A;  3HA9 A;  4EE0 A;  1A2L A;  2GSS A;  4LMW A;  5CYY A;  2PWJ A;  3MIX A;  3IBH A;  3JCM L;  2V32 A;  5J9B A;  4USS A;  4YAP A;  3F63 A;  2C0F A;  3KP8 A;  3GL5 A;  3H93 A;  3MNG A;  3GYK A;  1FG4 A;  4J57 E;  1GSD A;  1KBN A;  4HJM A;  1S3R A;  4KCA A;  1HNB A;  1EZK A;  3HDC A;  3A5I A;  5F0G A;  2FA8 A;  2GSQ A;  3ZVJ A;  1R5P A;  1JZR A;  4ULX A;  4IGJ A;  1U16 A;  2EIQ A;  3GHA A;  5ID2 A;  2YNX A;  3IR4 A;  1SKS B;  1TKD B;  1TRU A;  1GSS A;  2VD0 A;  3F6D A;  5ABR A;  4IQA A;  5ECP B;  5G5F A;  5J5N A;  1SYR A;  4FYB A;  4YKG A;  3EMX A;  4TR0 A;  4POM A;  4ZB9 A;  1WJK A;  4MAB A;  4IEL A;  3ED3 A;  2B5X A;  5B7C A;  1W89 A;  1M9B A;  4XS4 B;  3M1G A;  2K8V A;  1VRS D;  5KN1 A;  2B5E A;  4ICY A;  1ERT A;  3HVX A;  5A4V A;  3CSI A;  3KCM A;  2WB9 A;  4ISD A;  2VL3 A;  3VI7 A;  1O8W A;  2D27 A;  2FWG A;  2I7D A;  4G0L A;  1J3U A;  1V2A A;  4FH8 A;  4K6X A;  5D93 A;  3E3E A;  3Q74 A;  1LBK A;  1Q91 A;  1RQM A;  4AJ6 A;  2IN3 A;  4V2L A;  5B8A A;  2VCT A;  1G6Y A;  3ME7 A;  2OKA A;  2LQO A;  3N9J A;  5JWQ B;  11GS A;  2CVD A;  1Z4K A;  2FD3 A;  2X4A A;  2CX3 A;  4MNN A;  4GF0 A;  5B6N A;  4AJ8 A;  1I9D A;  4HGV A;  1JLV A;  3M0F A;  2GGT A;  4YQU A;  1TDI A;  4BWQ A;  3RD8 A;  3BJ5 A;  3GZH A;  2JAD A;  2GT6 A;  3F6F A;  1YF1 A;  3KP9 A;  1V57 A;  3Q6O A;  3PH9 A;  1R4W A;  1TOF A;  4L0U A;  2GDR A;  1GUM A;  2X8G A;  4NWY A;  4NPB A;  3D4M A;  1Z6M A;  2FWE A;  1FUQ A;  3TOT A;  2H66 A;  4IP6 A;  3F9U A;  3G7J A;  2DJK A;  2WRT A;  1Q92 A;  3LQ7 A;  1ZYE A;  5IPH A;  1B48 A;  2AV4 A;  2UZ8 A;  2I81 A;  2OE3 A;  18GS A;  2D2Z A;  1B9X C;  3CXG A;  5HR1 A;  3U19 A;  4NMU A;  4GSN A;  4IVF A;  4HU9 A;  1I0A A;  2VIM A;  4X4J A;  5JWR B;  2H19 A;  3IK7 A;  2YZU A;  1N2A A;  3SWL A;  5IQY A;  2RUE A;  6GST A;  3FW2 A;  3D22 A;  3NZN A;  1V9W A;  1ZGN A;  1HQO A;  5A4U A;  4KX4 A;  3ERW A;  3DIE A;  2JSZ A;  1JSW A;  2BJX A;  2HFD A;  1THO A;  3PPU A;  1S3A A;  1X5E A;  4I8B A;  1XW5 A;  4N30 A;  2MYG A;  4KE3 A;  5CP1 A;  4N0V A;  3C8T A;  5HW2 A;  1OE8 A;  4QL9 A;  1K3Y A;  1PFO A;  1NSW A;  3UEM A;  1SL1 B;  4NLE A;  5CNW A;  3ERG A;  2N5B A;  1M2D A;  1RK4 A;  3EPT A;  4X43 A;  4WKW A;  3QDN A;  1TK8 B;  4PNG A;  5C00 A;  2ZUP A;  4V2M A;  1RW1 A;  2GQK A;  3US3 A;  5LD0 A;  5DJM A;  4Q5F A;  3CTG A;  3LJR A;  3IRA A;  5IOW A;  2L6D A;  3TOU A;  3HVV A;  2H1G A;  4L5O A;  4KB3 A;  3DVW A;  4HQS A;  1X9M B;  3GFK A;  4TVE A;  4KUN A;  1G6W A;  2F51 A;  5G31 A;  3C7M A;  4XIH A;  3GSS A;  2FA4 A;  5E59 A;  5CAX A;  2H30 A;  1M3I A;  3KGK A;  1YY7 A;  4CW9 A;  2FNO A;  1Z7R A;  3C73 A;  1X9S B;  2HRK A;  2CVB A;  1XW9 A;  2FLS A;  4OO5 A;  2I4A A;  1PGT A;  5GAN D;  2PN8 A;  3TRQ A;  2H76 A;  5LNK e;  4TR4 A;  3O6T A;  2D28 C;  3RRP A;  3SBC A;  4G0K A;  4ACS A;  3CI0 K;  4K2D A;  1ZYN A;  2VCQ A;  3HJM A;  2HE3 A;  4K5R A;  1XWK A;  5ECR B;  3W8S A;  1MDJ A;  3RBT A;  4V1A g;  2ON5 A;  4GST A;  4BPY A;  2H73 A;  1F2E A;  3WD6 A;  1X5D A;  3RPP A;  1K0D A;  1VDK A;  2MMO A;  1GSE A;  4E8E A;  4HEA 2;  2O85 A;  2DKI A;  2DMM A;  5D9X A;  1KQ7 A;  2YWM A;  4ECC A;  3ZVJ D;  5FWG A;  1OC8 A;  3ZIJ A;  3IDV A;  4TN8 A;  5FT3 A;  3D6I A;  4MZB A;  3M8N A;  2YCD A;  5D96 A;  2XPE A;  1R26 A;  5KN0 A;  3CMI A;  4TR3 A;  5DAK A;  4TOP A;  10GS A;  3J7Y k;  1VF2 A;  3A3T A;  2P31 A;  3APQ A;  4WBJ A;  2YWN A;  2DBC A;  2DLX A;  3I9V 2;  5DCH A;  4GCI A;  2R4V A;  4I2U A;  1OAZ A;  2OJL A;  1AW9 A;  3H8Q A;  1EOG A;  1XG8 A;  4RI7 A;  2F8F A;  1K0O A;  3UOM A;  3QR6 A;  1GTB A;  4PUR A;  3QOU A;  4KDX A;  1GUL A;  2M80 A;  2P5Q A;  2PUK C;  5CRG A;  4ZIJ A;  3TKQ A;  3GNJ A;  2CVK A;  2HT9 A;  2QA2 A;  3LFL A;  2DJJ A;  2LJR A;  2VL9 A;  4KF9 A;  2XHF A;  2KHP A;  1YFM A;  4O7H A;  4MLY A;  1TP9 A;  4GXZ A;  5CO3 A;  4YQM A;  5ECQ B;  5J3R A;  2LTK A;  2E7P A;  4N0Z A;  5DQY A;  4K0G A;  3GTU A;  5IOX A;  3QBP A;  5IMV A;  2YWO A;  3GMF A;  4BIK A;  4F82 A;  5JCW A;  5F91 A;  2IFQ A;  1Z4I A;  4IW9 A;  2HVG A;  2HSY A;  5B8B A;  4NFL A;  3A2W A;  3VK9 A;  14GS A;  3FR6 A;  2TRC P;  2H6Z A;  2RUF A;  4HJ2 A;  1A2J A;  2E0Q A;  1GH2 A;  3LYP A;  1X9W B;  4F9Z A;  1TU7 A;  3KZQ A;  2PFM A;  4Q5R A;  1M2A A;  4IS0 A;  5LCZ A;  5IMA A;  4RUV A;  2VCW A;  7GSS A;  2H0H A;  2A4H A;  5ECO B;  3WGE A;  4J2F A;  1FB6 A;  3GUS A;  1OC9 A;  2BMX A;  4Q5Q A;  3TCO A;  3ZZX A;  3VPT A;  5G5E A;  5INY A;  1U87 A;  4KAE A;  1XWC A;  1F6M C;  4EEI A;  2HI7 A;  4KA0 A;  4NHZ A;  2JAU A;  4MPF A;  5C04 A;  4IKH A;  1EV4 A;  4HSC X;  1M7T A;  3M3M A;  4PQ1 A;  1I5G A;  3P8W A;  3EC3 A;  1FOH A;  5ECN B;  2REM A;  1XIY A;  1EGO A;  2AJQ B;  5DAK B;  4X1U A;  3BCK A;  2WFC A;  2H01 A;  5BMU A;  5HQP A;  3TUE A;  5D73 A;  3MWH A;  1QUW A;  4TXO A;  3RDW A;  2M46 A;  1OVN A;  1WPI A;  3KIJ A;  3GH9 A;  1OYJ A;  1GRX A;  1GLP A;  4HU7 A;  1HY0 A;  4MZC A;  2MMN A;  17GS A;  4BVX B;  1QGV A;  3GKN A;  2GSR A;  1AXD A;  1VGL A;  3KXO A;  3LGC A;  4BL7 A;  3IC4 A;  1GUK A;  6GSU A;  2HZE A;  1BAY A;  4F2I A;  4HOJ A;  3UMA A;  1OC3 A;  2CT6 A;  1SYX A;  3ZTL A;  1F3A A;  2R0C A;  1YJ6 A;  4D73 B;  3LSZ A;  3LXZ A;  5AIV A;  3MYD A;  5D9W A;  3GTU B;  5D9V A;  4AJ7 A;  2LST A;  2R37 A;  2MZC A;  4EKZ A;  3BHG A;  4MH2 A;  2ES7 A;  4WR4 A;  2MBS A;  1MD3 A;  4HUA A;  2CV4 A;  4P3Y B;  2JAO A;  4OFN A;  4F03 A;  3ME8 A;  4MJC A;  1BX9 A;  4EXJ A;  1YEP A;  4MCU A;  2OAD A;  2PU9 C;  4Z2U A;  4MZW A;  1EEJ A;  3TKR A;  3C1R A;  4ZBB A;  8GSS A;  5FHI A;  3ZLP A;  2TRX A;  2YJH A;  2YOI A;  1ZMA A;  3FKF A;  3P90 A;  5DVB A;  1XCC A;  3ERF A;  5GSS A;  1E2Y A;  4KGI A;  1Q98 A;  3U13 A;  1OC9 B;  1PL2 A;  4Z2T A;  1FVK A;  1ILO A;  4POK A;  1XZO A;  3EMP A;  1F3B A;  2KOK A;  3I6A A;  1YKA A;  4JZQ A;  1TTZ A;  1NM3 A;  2IL3 A;  1GP1 A;  4OO4 A;  4MJB A;  2NTO A;  2HYX A;  2IME A;  4QL7 A;  3VWV A;  1LJR A;  4L6C A;  2WZ9 A;  4V1A p;  1PKZ A;  4POL A;  4EC0 A;  1NHO A;  3O3T A;  2CX4 A;  1PA3 A;  1Y6E A;  4TXO B;  4K5S A;  2RM6 A;  3UL3 A;  4A5P A;  1T7P B;  2E2G A;  3GST A;  4RQR A;  1TJD A;  2QKE A;  1T1V A;  2RLI A;  3NOF A;  4BL7 B;  3VFI A;  3QD9 A;  4IJ3 A;  2LNS A;  3KH9 A;  1K3L A;  4KW6 A;  4YIK A;  2QGV A;  4CY6 A;  1MD4 A;  4EO3 A;  4KSO A;  2HNL A;  2IWT A;  5ECM B;  3QAW A;  5IM9 A;  2VO4 A;  3ZFL A;  2PTQ A;  1C3U A;  2RCN A;  4EUY A;  1H75 A;  4GTU A;  3WGX A;  1BQ7 A;  2VLU A;  5ECS A;  3GKM A;  5CRW A;  3RAZ A;  3DGQ A;  1T4Y A;  5DJL A;  2B7K A;  2OBI A;  2X49 A;  2VLV A;  3GTD A;  4MK3 A;  1CQH A;  5ENU A;  1KEB A;  4G10 A;  2HXK A;  1Z4Q A;  4KH7 A;  3VWX A;  1PRX A;  1K3O A;  3FZA A;  4IHU A;  4DEJ A;  4K9Z A;  1Z4P X;  2PPT A;  2XC2 A;  3CYN A;  2LNT A;  3TJG A;  4CDO A;  3TJK A;  1Z6N A;  5ID2 B;  4YQV A;  2DIY A;  4I6X A;  3GH6 A;  2G0F A;  3C1S A;  3KMO A;  1TI3 A;  5D9T A;  2H72 A;  3RHB A;  4IJI A;  2C0E A;  1SL0 B;  2IIY A;  2GTU A;  3I69 A;  2H6X A;  4Z7X A;  1XWG A;  1SJI A;  4V2N A;  5E4W A;  2YWI A;  3WT2 A;  2EC4 A;  1K0N A;  4XTS A;  1Z3E A;  3TKS A;  1Z4L A;  3HXS A;  20GS A;  2ZCT A;  2H8L A;  3OCF A;  5H5S A;  3GKK A;  1R7H A;  4O5R A;  3TV2 A;  3GL3 A; 
#chains in the Genus database with same CATH homology
 1A8Y A;  3EU3 A;  4X0X A;  5ECH B;  2F3M A;  1C72 A;  1U6T A;  4L5L A;  6GSX A;  2AHE A;  2V2G A;  5ELG A;  4OMV A;  6GSW A;  2EIR A;  1QXH A;  3DWV A;  3MDK A;  1OE7 A;  4MMM A;  1IW7 D;  1ZCP A;  4DVC A;  5CRD A;  22GS A;  1MDK A;  3RHC A;  1SL2 B;  3DXB A;  3L9U A;  4EIQ A;  4LL1 B;  5G30 A;  4KDY A;  3TGZ A;  1XW6 A;  4HZ2 A;  4K1F A;  3IAS 2;  4CHS A;  4RI6 A;  4FYC A;  3A2V A;  3GKX A;  3TKP A;  2OE0 A;  4BA7 A;  3U6V A;  2LKU A;  4TKY A;  2B7J A;  4Z2R A;  2I1U A;  4IQ1 A;  2O8V B;  4ZB8 A;  3IC8 A;  3TDG A;  3LG6 A;  3U5R E;  2H0G A;  3IAM 2;  1TRV A;  2WGR A;  2H74 A;  2DJ1 A;  19GS A;  2IMF A;  2WS2 A;  4J56 E;  5EY6 A;  1AQV A;  1DSB A;  4IBP A;  1DE1 A;  3FHK A;  2C8U A;  1QMV A;  1ON4 A;  5IMD A;  5DAL A;  2B3S A;  2OAC A;  1BYE A;  3TKS C;  4FO5 A;  3APO A;  1PL1 A;  4O32 A;  4BVY A;  1PX7 A;  4PNF A;  1A0R P;  5J9C A;  2ZNM A;  1GNE A;  3IA1 A;  3KH7 A;  3KD0 A;  4ZXG A;  2J9H A;  4EIP A;  1T8E B;  3IOS A;  1DUG A;  4GLT A;  1B8X A;  2L6C A;  1JZW A;  3KTB A;  4XCS A;  1HYU A;  2NPB A;  1E6B A;  5DCG A;  2R6K A;  2LJA A;  3G7I A;  1JLW A;  1V40 A;  4JBB A;  2VM2 A;  2KP2 A;  3QAG A;  2C1Y A;  1SJZ A;  3G7Y A;  5KN3 A;  1TXX A;  3BBY A;  2VAF A;  4ML6 A;  1K0C A;  1ZZY A;  3J7Y b;  5GZZ B;  1TU8 A;  2XBQ A;  1YKC A;  2WJU A;  2H1A A;  3FRC A;  3D21 A;  1S3C A;  1PN9 A;  2O87 A;  1O81 A;  4MJE A;  5B6M A;  4OFT A;  3C8E A;  4WF5 A;  1Z5Y E;  5G1L A;  2B5Y A;  1GSQ A;  1UA5 A;  3F4R A;  3CRT A;  1J08 A;  3PR8 A;  4DSR A;  5AIS A;  1IYI A;  1GLQ A;  4K7N A;  5JCU A;  3F8U A;  3HHV A;  4O92 A;  3F0I A;  1G7E A;  5JWO B;  4ZL7 A;  3GX8 A;  2QC7 A;  2H6Y A;  1XPV A;  4PUF C;  2KLX A;  1TW9 A;  4K2X A;  1HD2 A;  1VF1 A;  3P7X A;  5EL8 A;  1O73 A;  3QAV A;  1SJ6 A;  3UAP A;  1A23 A;  3UVT A;  1TRW A;  2DJ2 A;  2VOC A;  2R5G A;  2C0D A;  3TKS E;  5IO2 A;  4KSM A;  1UVZ A;  2P0G A;  4OFM A;  5IO0 A;  3FMW A;  5DAL B;  2CAI A;  2QSI A;  1O8X A;  4L8E A;  4NXI A;  3EYT A;  2YP6 A;  3FZ5 A;  4PGT A;  3PIN A;  4BVY B;  2GQL A;  1URM A;  4EDY A;  4F0C A;  4LLR A;  5DDL A;  1IYH A;  3BD2 A;  1YF0 A;  2V6O A;  3IK9 A;  3W8J A;  2O89 A;  1DE2 A;  13GS A;  2GST A;  1CQG A;  3LW9 A;  1B4P A;  1XWB A;  2V1M A;  2OE1 A;  3GV1 A;  3IV4 A;  2R0G A;  3AY8 A;  1GUH A;  4TR1 A;  4XS4 A;  3CBU A;  3HCZ A;  4FQU A;  4BWS A;  2CQ9 A;  5IPG A;  4DSQ A;  1Q4J A;  4EDZ A;  2C0G A;  4GQF A;  4TRX A;  4XRA A;  2FHE A;  2YV7 A;  5AN1 A;  1AQX A;  1TK0 B;  3L9V A;  1HNA A;  4EF0 A;  4KCE A;  5KOW A;  5IIZ A;  3WGD A;  2LRN A;  1PX6 A;  1G0T A;  1SU9 A;  1SD9 A;  2E2M A;  2GLR A;  3FR9 A;  1GTA A;  4JR6 A;  1UN2 A;  3TJJ A;  1ZYQ B;  4DSS A;  4ZB6 A;  1M9A A;  4H86 A;  3DD3 A;  5GST A;  5G2Z A;  3Q19 A;  1BG5 A;  1EWX A;  3UIW A;  1MEK A;  1K0M A;  1WWJ A;  1SK1 A;  4YKF A;  2DKH A;  5KEJ A;  1V58 A;  1XBS A;  2H0I A;  2DC5 A;  5ELA A;  1F9M A;  3WT1 A;  3HYP A;  2IFQ B;  2MMA A;  3P2A A;  4WXT A;  6GSS A;  2X8H A;  5COH A;  2LRT A;  3QFB C;  3OR5 A;  4AGS A;  2H75 A;  1SK0 A;  3TRP A;  1M0U A;  3HY2 A;  3GIX A;  4K8M A;  1T3B A;  4NHW A;  3LOR A;  3HKR A;  4WR5 A;  4PUA A;  3MAK A;  3TJB A;  3IXR A;  4FIW A;  1NHY A;  4NV2 A;  5AIX A;  4TW5 A;  1K0A A;  1MTC A;  4LA1 A;  1FW1 A;  2HRN A;  4N11 A;  4RQX A;  1PD2 1;  4K7O A;  3LEF A;  2PBJ A;  3D4T A;  1FO5 A;  4MJA A;  4XHM A;  4IN0 A;  4LMV A;  3KTL A;  5HR0 A;  2R0P A;  1YEX A;  1V98 A;  2LS5 A;  3ZML A;  1ST9 A;  2CZ3 A;  1XWA A;  2PGT A;  12GS A;  3A5W A;  5J41 A;  1JZD A;  5GAP D;  1JFU A;  1KNG A;  1WMJ A;  1AC1 A;  4G0I A;  5L71 A;  4TR1 B;  2H70 A;  3GA4 A;  3HD5 A;  2L4C A;  1TRS A;  5F8B A;  4PQH A;  4HZ4 A;  3GUR A;  5DQS A;  4QQ7 A;  1GNW A;  3H1N A;  3IE3 A;  1M2B A;  3DRN A;  4K0N A;  3TRX A;  3QCP A;  4MP4 A;  1JZO A;  3F4S A;  2A4V A;  1EP8 A;  1X5C A;  2AB6 A;  2VCZ A;  1SK2 A;  2HZE B;  1TK5 B;  4O5U A;  2OBK A;  3N5O A;  1U3I A;  4OD7 A;  2F9S A;  4ZBA A;  1XFL A;  2MMZ A;  1WE0 A;  5A4W A;  4AF2 A;  4DSS B;  4WEY A;  4N10 A;  2C3T A;  4MF7 A;  3D0Z A;  2K6V A;  5DBQ A;  2R2J A;  5H5Q A;  4JE1 A;  2A2P A;  2EIO A;  1T4Z A;  4EVM A;  2YAN A;  1FVJ A;  1EOH A;  1T00 A;  3FYG A;  2BTO T;  4MDC A;  3CRU A;  3L0H A;  3S9F A;  1N8J A;  4CY8 A;  4KDU A;  1XVW A;  1R5A A;  3VI5 A;  3E0U A;  3EVI A;  3R2Q A;  3EUR A;  4GQC A;  2A2S A;  1GSF A;  3BCI A;  1WP0 A;  4G19 A;  1BJX A;  3UJ1 A;  2HSH A;  2WDU A;  2JZT A;  5F05 A;  4PQI A;  4NAX A;  1EV9 A;  2C3Q A;  2HZF A;  4I97 A;  4MF5 A;  4O5Q A;  1YQ1 A;  4I5Q A;  3EE2 A;  4MH3 A;  2N5F A;  2X99 A;  2N5A A;  4JU5 A;  1KTE A;  3C71 A;  1A0F A;  2P5R A;  3ZIV A;  5ECK B;  1USB A;  3H4K A;  3IHG A;  2V6K A;  2JU5 A;  3VUR A;  2LJK A;  2CZ2 A;  2J23 A;  3WYW A;  5AGY A;  2M72 A;  2A2R A;  1U3A A;  2FWH A;  1AUC A;  5G1K A;  5HFI A;  1GSY A;  4G9H A;  4YH2 A;  3EWL A;  2VM1 A;  2V41 A;  3E9J B;  3PGT A;  4EL1 A;  1AIU A;  1QFN A;  2B6M A;  3IPZ A;  2GZZ A;  2JZR A;  1WIK A;  16GS A;  3KJY A;  1X0R A;  4MA9 A;  4XS6 A;  2WCI A;  2NVL A;  2JSY A;  2CAQ A;  3M9K A;  2H1D A;  2JZS A;  2YV9 A;  1SD8 A;  5A5K A;  1ERU A;  2PVO C;  2B1K A;  1AAZ A;  2VCV A;  1FB0 A;  4G2E A;  1OKT A;  1B9Y C;  3GN3 A;  4IP1 A;  3RPN A;  3BOA A;  3KMN A;  2LV3 A;  5KN2 A;  4WBR D;  4HS1 A;  2X64 A;  1GWC A;  2FWF A;  2LRC A;  1U88 A;  4HDE A;  6GSV A;  2O7K A;  1QK8 A;  4ZL8 A;  2NBS A;  3ZRE A;  1K0B A;  5HFG A;  3UBK A;  4LL4 B;  1M99 A;  1OKD A;  2C3N A;  2DIZ A;  1O7U A;  2K18 A;  2Z9S A;  3DML A;  2AAW A;  1LU4 A;  1VF3 A;  4HI7 A;  3Q18 A;  1B4Q A;  4HQZ A;  3F3Q A;  2KUC A;  1FOV A;  2FGX A;  4KND A;  4WF4 A;  2GZY A;  2YJ7 A;  1Z9H A;  3UBL A;  4GSS A;  1GTI A;  2F8A A;  2PMT A;  4POB A;  3F3R A;  2RM5 A;  4JED A;  1PQN A;  1YZX A;  2VUP A;  3FEU A;  3HVS A;  2XPD A;  3HZ4 A;  3L9S A;  2L5L A;  4MF6 A;  3DVX A;  1PMT A;  2VCX A;  4IQJ M;  2GZP A;  2I3Y A;  3CTF A;  3TJF A;  2B1L A;  4ZIL A;  4NV5 A;  2GT5 A;  2YZH A;  3D5J A;  2HLS A;  3FK8 A;  4TXV A;  3ZIT A;  3QPM A;  2NDO A;  2XBI A;  5CRE A;  1THX A;  9GSS A;  4GWR A;  3VWU A;  4PX1 A;  1XOA A;  4ILF A;  5IMZ A;  1ZOF A;  1A8L A;  1NW2 A;  2HRF A;  2C4J A;  2FY6 A;  2DSA A;  3GRX A;  5KOX A;  1GTU A;  2HSM A;  3MSZ A;  2DJ0 A;  1ABA A;  3L78 A;  4ZL9 A;  1O85 A;  2H71 A;  3APS A;  6GSY A;  3GX0 A;  2AYT A;  1ZL9 A;  3DEX A;  1XXU A;  2L57 A;  4ECI A;  2VD1 A;  2VL2 A;  3L4N A;  1F37 A;  2AUV A;  2LUS A;  5IMC A;  3HZ8 A;  3ZYW A;  4BVX A;  3KEB A;  4FYU A;  1ML6 A;  3UVH A;  1ACV A;  1VF4 A;  3VPQ A;  1EGR A;  4ZBD A;  3K8N A;  5JCG A;  3ISO A;  4PTS A;  1ZYP A;  4ML1 A;  3VWW A;  3F4T A;  2IMI A;  2H1B A;  3QFA C;  3FZ4 A;  4D73 A;  4PXO A;  1H4O A;  2ALB A;  4XRD A;  2X8C A;  3ZL5 A;  1J9B A;  3ZMK A;  5HR3 A;  1PSQ A;  4OCF A;  2KP1 A;  3I43 A;  1PKW A;  3R3E A;  5D8I A;  2TIR A;  3V1W A;  1WOU A;  2R3X A;  2IPA A;  1TI1 A;  3CSJ A;  3ZRD A;  1S3D A;  1UC7 A;  2K8S A;  1MDI A;  2L59 A;  2MBT A;  4JR4 A;  3H79 A;  1ERW A;  1XVQ A;  2ON7 A;  3O76 A;  1XOB A;  4E8H A;  3EIN A;  5F07 A;  4I2T A;  1Z7P A;  2FCH A;  1DBY A;  3M9J A;  1A24 A;  1EEM A;  1WRY A;  5HFK A;  2FUG 2;  4ECJ A;  3LYK A;  3FY7 A;  1YDK A;  2PVQ A;  3TB2 A;  3DYR A;  2IMD A;  3LWA A;  2JAC A;  1SKR B;  2PER A;  2GVP A;  2HRA A;  2WUL A;  3W6G A;  3FZ9 A;  2DJ3 A;  3HJO A;  5CRH A;  2VL2 C;  4OCE A;  4JRR A;  5ECL B;  5H5R A;  2OA7 A;  2GQM A;  2LEG A;  1Y25 A;  2LQQ A;  5ECI B;  4GRF A;  4OWY A;  2IJY A;  1J0F A;  1JHB A;  5IMF A;  3A2X A;  3UAR A;  2JL4 A;  1BED A;  1GL8 A;  3VLN A;  1O6J A;  3G9B A;  2L5O A;  4MPG A;  2YN1 A;  3DKS A;  1GSU A;  4L0W A;  1HNC A;  4F0B A;  2VLT A;  1QQ2 A;  4Q5N A;  2CA8 A;  1FHE A;  3EU4 A;  1G7O A;  2DML A;  1AQW A;  2QA1 A;  2IMK A;  2YPM A;  3NIV A;  3HJP A;  2C80 A;  2L4Q A;  1ERV A;  5BRT A;  2RII A;  3ZFB A;  2G2Q A;  1FAA A;  4XS1 A;  1A2M A;  1W4V A;  2K9F A;  3KM6 A;  2I9H A;  3FR3 A;  4WET A;  5J4U A;  1PN0 A;  4ID0 A;  2GS3 A;  5EVO A;  1SEN A;  3LXT A;  4YAV A;  3CSH A;  4ECB A;  5HR2 A;  4K7I A;  3IHQ A;  5F06 A;  3QMX A;  1SKW B;  1EP7 A;  5EPF A;  3HA9 A;  4EE0 A;  1A2L A;  2GSS A;  4LMW A;  5CYY A;  2PWJ A;  3MIX A;  3IBH A;  3JCM L;  2V32 A;  5J9B A;  4USS A;  4YAP A;  3F63 A;  2C0F A;  3KP8 A;  3GL5 A;  3H93 A;  3MNG A;  3GYK A;  1FG4 A;  4J57 E;  1GSD A;  1KBN A;  4HJM A;  4KCA A;  1HNB A;  1EZK A;  3HDC A;  3A5I A;  5F0G A;  2FA8 A;  2GSQ A;  3ZVJ A;  1R5P A;  1JZR A;  4ULX A;  4IGJ A;  2EIQ A;  3GHA A;  5ID2 A;  2YNX A;  3IR4 A;  1SKS B;  1TKD B;  1TRU A;  1GSS A;  2VD0 A;  3F6D A;  5ABR A;  4IQA A;  5ECP B;  5G5F A;  5J5N A;  1SYR A;  4FYB A;  4YKG A;  3EMX A;  4TR0 A;  4POM A;  4ZB9 A;  1WJK A;  4MAB A;  4IEL A;  3ED3 A;  2B5X A;  5B7C A;  1W89 A;  1M9B A;  4XS4 B;  3M1G A;  2K8V A;  1VRS D;  5KN1 A;  2B5E A;  4ICY A;  1ERT A;  3HVX A;  5A4V A;  3CSI A;  3KCM A;  2WB9 A;  4ISD A;  2VL3 A;  3VI7 A;  1O8W A;  2D27 A;  2FWG A;  4G0L A;  1V2A A;  4FH8 A;  4K6X A;  5D93 A;  3E3E A;  3Q74 A;  1LBK A;  1RQM A;  4AJ6 A;  2IN3 A;  4V2L A;  5B8A A;  2VCT A;  1G6Y A;  3ME7 A;  2OKA A;  2LQO A;  3N9J A;  5JWQ B;  11GS A;  2CVD A;  2FD3 A;  2X4A A;  2CX3 A;  4MNN A;  4GF0 A;  5B6N A;  4AJ8 A;  1I9D A;  3M0F A;  1JLV A;  2GGT A;  4YQU A;  1TDI A;  4BWQ A;  3BJ5 A;  2JAD A;  2GT6 A;  3F6F A;  1YF1 A;  3KP9 A;  1V57 A;  3Q6O A;  3PH9 A;  1R4W A;  1TOF A;  4L0U A;  2GDR A;  1GUM A;  2X8G A;  4NWY A;  4NPB A;  3D4M A;  1Z6M A;  2FWE A;  3TOT A;  2H66 A;  4IP6 A;  3F9U A;  3G7J A;  2DJK A;  2WRT A;  3LQ7 A;  1ZYE A;  5IPH A;  1B48 A;  2AV4 A;  2UZ8 A;  2I81 A;  2OE3 A;  18GS A;  2D2Z A;  1B9X C;  3CXG A;  5HR1 A;  4NMU A;  4GSN A;  4IVF A;  4HU9 A;  2VIM A;  4X4J A;  5JWR B;  2H19 A;  3IK7 A;  2YZU A;  1N2A A;  3SWL A;  5IQY A;  2RUE A;  6GST A;  3FW2 A;  3D22 A;  3NZN A;  1V9W A;  1ZGN A;  1HQO A;  5A4U A;  4KX4 A;  3ERW A;  3DIE A;  2JSZ A;  2BJX A;  2HFD A;  1THO A;  3PPU A;  1S3A A;  1X5E A;  4I8B A;  1XW5 A;  4N30 A;  2MYG A;  4KE3 A;  5CP1 A;  4N0V A;  1OE8 A;  4QL9 A;  1K3Y A;  1NSW A;  3UEM A;  1SL1 B;  5CNW A;  3ERG A;  2N5B A;  1M2D A;  1RK4 A;  3EPT A;  4X43 A;  4WKW A;  3QDN A;  1TK8 B;  4PNG A;  5C00 A;  2ZUP A;  4V2M A;  1RW1 A;  2GQK A;  3US3 A;  5LD0 A;  5DJM A;  4Q5F A;  3CTG A;  3LJR A;  3IRA A;  5IOW A;  2L6D A;  3TOU A;  3HVV A;  2H1G A;  4L5O A;  4KB3 A;  3DVW A;  4HQS A;  1X9M B;  3GFK A;  4TVE A;  4KUN A;  1G6W A;  2F51 A;  5G31 A;  3C7M A;  4XIH A;  3GSS A;  2FA4 A;  5E59 A;  5CAX A;  2H30 A;  3KGK A;  1YY7 A;  4CW9 A;  2FNO A;  1Z7R A;  3C73 A;  1X9S B;  2HRK A;  2CVB A;  1XW9 A;  2FLS A;  4OO5 A;  2I4A A;  1PGT A;  5GAN D;  2PN8 A;  3TRQ A;  2H76 A;  5LNK e;  4TR4 A;  3O6T A;  2D28 C;  3SBC A;  4G0K A;  4ACS A;  4K2D A;  1ZYN A;  2VCQ A;  3HJM A;  2HE3 A;  4K5R A;  1XWK A;  5ECR B;  3W8S A;  1MDJ A;  3RBT A;  4V1A g;  2ON5 A;  4GST A;  4BPY A;  2H73 A;  1F2E A;  3WD6 A;  1X5D A;  3RPP A;  1K0D A;  2MMO A;  1GSE A;  4E8E A;  4HEA 2;  2O85 A;  2DKI A;  2DMM A;  5D9X A;  2YWM A;  4ECC A;  3ZVJ D;  5FWG A;  1OC8 A;  3ZIJ A;  3IDV A;  4TN8 A;  5FT3 A;  3D6I A;  4MZB A;  3M8N A;  2YCD A;  5D96 A;  2XPE A;  1R26 A;  5KN0 A;  3CMI A;  4TR3 A;  5DAK A;  4TOP A;  10GS A;  3J7Y k;  1VF2 A;  3A3T A;  2P31 A;  3APQ A;  4WBJ A;  2YWN A;  2DBC A;  2DLX A;  3I9V 2;  5DCH A;  4GCI A;  2R4V A;  4I2U A;  1OAZ A;  2OJL A;  1AW9 A;  3H8Q A;  1EOG A;  4RI7 A;  2F8F A;  1K0O A;  3UOM A;  3QR6 A;  1GTB A;  4PUR A;  3QOU A;  4KDX A;  1GUL A;  2M80 A;  2P5Q A;  2PUK C;  5CRG A;  4ZIJ A;  3TKQ A;  3GNJ A;  2CVK A;  2HT9 A;  2QA2 A;  3LFL A;  2DJJ A;  2LJR A;  2VL9 A;  4KF9 A;  2XHF A;  2KHP A;  4O7H A;  4MLY A;  1TP9 A;  4GXZ A;  5CO3 A;  4YQM A;  5ECQ B;  5J3R A;  2LTK A;  2E7P A;  4N0Z A;  5DQY A;  4K0G A;  3GTU A;  5IOX A;  5IMV A;  2YWO A;  3GMF A;  4F82 A;  5JCW A;  2IFQ A;  4IW9 A;  2HSY A;  5B8B A;  3A2W A;  3VK9 A;  14GS A;  3FR6 A;  2TRC P;  2H6Z A;  2RUF A;  4HJ2 A;  1A2J A;  2E0Q A;  1GH2 A;  3LYP A;  1X9W B;  4F9Z A;  1TU7 A;  3KZQ A;  4Q5R A;  1M2A A;  4IS0 A;  5LCZ A;  5IMA A;  4RUV A;  2VCW A;  7GSS A;  2H0H A;  2A4H A;  5ECO B;  3WGE A;  4J2F A;  1FB6 A;  3GUS A;  1OC9 A;  2BMX A;  4Q5Q A;  3TCO A;  3ZZX A;  3VPT A;  5G5E A;  5INY A;  1U87 A;  4KAE A;  1XWC A;  1F6M C;  2HI7 A;  4KA0 A;  4NHZ A;  4MPF A;  5C04 A;  4IKH A;  1EV4 A;  1M7T A;  3M3M A;  4PQ1 A;  1I5G A;  3P8W A;  3EC3 A;  1FOH A;  5ECN B;  2REM A;  1XIY A;  1EGO A;  2AJQ B;  5DAK B;  4X1U A;  3BCK A;  2WFC A;  2H01 A;  5BMU A;  5HQP A;  3TUE A;  5D73 A;  3MWH A;  1QUW A;  4TXO A;  3RDW A;  2M46 A;  1OVN A;  1WPI A;  3KIJ A;  3GH9 A;  1OYJ A;  1GRX A;  1GLP A;  4HU7 A;  4MZC A;  2MMN A;  17GS A;  4BVX B;  1QGV A;  3GKN A;  2GSR A;  1AXD A;  1VGL A;  3KXO A;  3LGC A;  4BL7 A;  3IC4 A;  1GUK A;  6GSU A;  2HZE A;  1BAY A;  4F2I A;  4HOJ A;  3UMA A;  1OC3 A;  2CT6 A;  1SYX A;  3ZTL A;  1F3A A;  2R0C A;  1YJ6 A;  4D73 B;  3LSZ A;  3LXZ A;  5AIV A;  3MYD A;  5D9W A;  3GTU B;  5D9V A;  4AJ7 A;  2LST A;  2R37 A;  2MZC A;  4EKZ A;  4MH2 A;  2ES7 A;  4WR4 A;  2MBS A;  1MD3 A;  4HUA A;  2CV4 A;  4P3Y B;  4OFN A;  4F03 A;  3ME8 A;  4MJC A;  1BX9 A;  4EXJ A;  1YEP A;  4MCU A;  2OAD A;  2PU9 C;  4Z2U A;  4MZW A;  1EEJ A;  3TKR A;  3C1R A;  4ZBB A;  8GSS A;  5FHI A;  3ZLP A;  2TRX A;  2YJH A;  2YOI A;  1ZMA A;  3FKF A;  3P90 A;  5DVB A;  1XCC A;  3ERF A;  5GSS A;  1E2Y A;  4KGI A;  1Q98 A;  1OC9 B;  1PL2 A;  4Z2T A;  1FVK A;  1ILO A;  4POK A;  1XZO A;  3EMP A;  1F3B A;  2KOK A;  3I6A A;  1YKA A;  4JZQ A;  1TTZ A;  1NM3 A;  2IL3 A;  1GP1 A;  4OO4 A;  4MJB A;  2NTO A;  2HYX A;  2IME A;  4QL7 A;  3VWV A;  1LJR A;  2WZ9 A;  4V1A p;  1PKZ A;  4POL A;  4EC0 A;  1NHO A;  3O3T A;  2CX4 A;  1PA3 A;  1Y6E A;  4TXO B;  4K5S A;  2RM6 A;  3UL3 A;  4A5P A;  1T7P B;  2E2G A;  3GST A;  4RQR A;  1TJD A;  2QKE A;  1T1V A;  2RLI A;  3NOF A;  4BL7 B;  3VFI A;  3QD9 A;  4IJ3 A;  2LNS A;  3KH9 A;  1K3L A;  4KW6 A;  2QGV A;  4CY6 A;  1MD4 A;  4EO3 A;  4KSO A;  2HNL A;  2IWT A;  5ECM B;  3QAW A;  5IM9 A;  2VO4 A;  3ZFL A;  4EUY A;  1H75 A;  4GTU A;  3WGX A;  1BQ7 A;  2VLU A;  5ECS A;  3GKM A;  5CRW A;  3RAZ A;  3DGQ A;  1T4Y A;  5DJL A;  2B7K A;  2OBI A;  2X49 A;  2VLV A;  4MK3 A;  1CQH A;  5ENU A;  1KEB A;  4G10 A;  2HXK A;  4KH7 A;  3VWX A;  1PRX A;  1K3O A;  3FZA A;  4IHU A;  4DEJ A;  4K9Z A;  2PPT A;  2XC2 A;  3CYN A;  2LNT A;  3TJG A;  4CDO A;  3TJK A;  1Z6N A;  5ID2 B;  4YQV A;  2DIY A;  4I6X A;  3GH6 A;  2G0F A;  3C1S A;  3KMO A;  1TI3 A;  5D9T A;  2H72 A;  3RHB A;  4IJI A;  2C0E A;  1SL0 B;  2IIY A;  2GTU A;  3I69 A;  2H6X A;  4Z7X A;  1XWG A;  1SJI A;  4V2N A;  5E4W A;  2YWI A;  3WT2 A;  2EC4 A;  1K0N A;  4XTS A;  1Z3E A;  3TKS A;  3HXS A;  20GS A;  2ZCT A;  2H8L A;  5H5S A;  3GKK A;  1R7H A;  4O5R A;  3GL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...