3F4RA

Crystal structure of wolbachia pipientis alpha-dsba1
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
199
structure length
199
Chain Sequence
TSNELLLPLPNDKLLGDPKAPILMIEYASLTCYHCSLFHRNVFPKIKEKYIDTGKMLYIFRHFPLDYRGLKAAMLSHCYEKQEDYFNFNKAVFNSIDSWNYYNLSDLTLLQRIAALSNLKQDAFNQCINDKKIMDKIVNDKSLAINKLGITATPIFFIKLNDDKSYIEHNKVKHGGYKELKYFTNVIDKLYGKAIVKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative uncharacterized protein
publication title Structural and Functional Characterization of the Oxidoreductase alpha-DsbA1 from Wolbachia pipientis
pubmed doi rcsb
source organism Wolbachia pipientis
total genus 76
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2008-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.80 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Ribonucleotide Reductase Protein R1; domain 1 3f4rA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3f4rA01
2HLSA 2KUCA 2PVQA 1FVJA 1Z6NA 1B4PA 2L59A 3L9SA 1W4VA 5EVOA 4HI7A 2R5GA 1A8YA 3IRAA 2F8AA 1J9BA 2KP1A 4N10A 1GTBA 1O7UA 5H5SA 1EV9A 3RPNA 1PA3A 4GRFA 3HA9A 1ABAA 1DSBA 5ECRB 1B4QA 4WF5A 2WFCA 5ECSA 2HFDA 4K7OA 3ZVJD 4YQMA 2I1UA 1IYHA 2MBTA 3DVWA 3TRPA 2DMMA 2K8VA 3FR6A 4TXVA 2IMFA 4NWYA 1BX9A 1XOBA 4BWQA 1K0MA 1TK8B 4GF0A 4KDUA 2DIZA 1ML6A 2ES7A 4KSOA 17GSA 4J56E 1EOHA 3IE3A 4YH2A 3RBTA 4N0VA 2G2QA 4AJ6A 2L4QA 1FAAA 4P3YB 1YEPA 2LJKA 3PH9A 2LJRA 4IHUA 4G9HA 3TKSE 4GSSA 2IMDA 2DIYA 2HRNA 1O8WA 2JL4A 3ZIVA 2H72A 4ZBBA 3F8UA 2JZRA 5GSSA 2FHEA 1MDIA 3M0FA 1GSEA 1R5PA 3LYPA 5DQSA 3HDCA 5HFIA 2H30A 1EP7A 1SU9A 3EWLA 1Y25A 2FWEA 3TRXA 1YEXA 4EF0A 3DEXA 2VCZA 5D9TA 2C3TA 1SENA 1SKWB 1S3AA 3K8NA 2FCHA 22GSA 3DD3A 3ZFLA 4OO5A 3VK9A 2X8HA 3O3TA 1XXUA 1YF0A 1DBYA 3GL3A 1USBA 3DXBA 1QUWA 3CTFA 2PU9C 2GSRA 2IMIA 5IM9A 5HQPA 4FYCA 4IJIA 4POKA 6GSSA 1PQNA 4D73B 5IOXA 3F4SA 1M2AA 5G30A 19GSA 4JBBA 1R5AA 3TDGA 3DGQA 3NOFA 4QL9A 2CZ3A 4F03A 1BYEA 2H6YA 2I81A 2DBCA 4ID0A 2V2GA 3W8SA 3BBYA 1TXXA 1EGOA 4WXTA 5G1LA 4K7NA 3ZVJA 1AQWA 2R3XA 1AIUA 1N8JA 2YNXA 1FO5A 2P0GA 2H1AA 3EU3A 3FZ5A 3HHVA 2WDUA 4MH2A 1PX6A 2VLTA 2MMNA 3L4NA 2FWHA 3QR6A 2CZ2A 2HZEA 2R2JA 3ERWA 3DYRA 2VCQA 1OC9A 4MJCA 1QMVA 1BAYA 6GSVA 1UVZA 2H8LA 2IWTA 2GLRA 3ZYWA 5HFGA 1U3AA 6GSXA 2VLUA 3EVIA 5A4UA 2ON5A 1PKWA 4ZBAA 4EVMA 2GQLA 2HZFA 5D9XA 3E3EA 4IELA 4V2LA 1GLPA 3ZMLA 4ZILA 1F3AA 5IPGA 1E2YA 1GSDA 1ZCPA 3KH9A 1JZRA 3VPQA 1XPVA 3MAKA 2HZEB 5D96A 1WOUA 2H1BA 4KCEA 3IOSA 5KN3A 5IQYA 4FYUA 1OC9B 1WRYA 4Q5RA 3IDVA 2KOKA 3ZL5A 4J2FA 4TR0A 2EIRA 2VUPA 3HVSA 3FRCA 4WR5A 4GCIA 3W8JA 1Z3EA 4IW9A 2QC7A 2WS2A 3LSZA 3GRXA 4YAPA 4KB3A 4KUNA 1XVQA 4TRXA 3ZITA 3H8QA 9GSSA 2PWJA 1XCCA 4I2UA 4NXIA 3D6IA 4ML1A 1THXA 1GLQA 1Q98A 2X64A 4RQXA 2REMA 4IBPA 2LRCA 2GTUA 2RIIA 2P5QA 4HQZA 2X99A 4PGTA 4Z7XA 2C80A 3ZRDA 1HNCA 2XBIA 2DJ1A 1YKAA 3GHAA 3UJ1A 3QAWA 4Q5FA 5E4WA 1Z7PA 3EMPA 3TKRA 3I43A 2HI7A 1LU4A 3QAGA 1ZMAA 3RPPA 1NM3A 4WEYA 4K8MA 2E2MA 2LRNA 3S9FA 5LD0A 1OE7A 4DSRA 1XWBA 3FR9A 1YJ6A 3J7Yk 3TJBA 2VM2A 4F0BA 1O6JA 4RI6A 3GMFA 3IBHA 5B6NA 1KTEA 1RQMA 3H79A 2Z9SA 4HJ2A 4XCSA 3HY2A 4MZWA 1SKRB 4OMVA 3ME7A 4ILFA 4OCFA 2B1KA 4BWSA 3E0UA 3KGKA 4OCEA 3QAVA 1GTAA 1GNEA 4ZXGA 4XS4B 5CP1A 4EL1A 4HDEA 1F2EA 1K0CA 4QL7A 3C1SA 4HQSA 3W6GA 2FWGA 1F37A 1GSQA 1PGTA 3C71A 3GKMA 4X0XA 2DJJA 3U5RE 4PUFC 6GSUA 3RDWA 2GZPA 1TDIA 3GFKA 2YV7A 4I6XA 4IP1A 1OC8A 1YQ1A 4EDZA 4ZB9A 1GSYA 4OD7A 1OAZA 3TB2A 5KN0A 4MPGA 3M3MA 4BVXA 2CX3A 5LCZA 4EKZA 4AJ8A 2A2RA 1XIYA 2F8FA 2K6VA 2VM1A 5IO0A 4ULXA 1A24A 2V6KA 2NDOA 3EMXA 3GL5A 4XS6A 4PNGA 3GIXA 2LTKA 3BCKA 3R2QA 2TIRA 4O92A 5ID2A 2XPDA 2L6CA 2K18A 3UBKA 10GSA 4HOJA 1MDKA 4PURA 2MBSA 1H75A 6GSTA 5GSTA 5DBQA 2V6OA 1B9YC 4HZ4A 2VOCA 2ZCTA 2IMKA 2CAQA 2QGVA 4O32A 5F8BA 1MD3A 3GNJA 4Q5QA 3LG6A 4MPFA 5J9CA 1OKTA 5ECQB 5A4WA 2OACA 2R6KA 4MABA 2F51A 4OFNA 1G7OA 3MDKA 5ELAA 1HNBA 4TR4A 4YAVA 1FOVA 1FW1A 1AUCA 1U6TA 1GTIA 1K3YA 1O73A 4N11A 3A5WA 3DMLA 3F3RA 1K0AA 5LNKe 1E6BA 2C3NA 3FZAA 3TKQA 4L0UA 4ECCA 4PUAA 2H1DA 2YZUA 3FEUA 1SJ6A 2CX4A 3WGEA 5CYYA 4HU7A 5ECKB 4L5OA 4HU9A 4I8BA 2VLVA 4F0CA 1O85A 2VL9A 3BJ5A 4BVYA 1SYRA 4IKHA 3KMOA 5DAKA 4ECJA 1LBKA 2O87A 3F63A 4O7HA 2I9HA 4ZIJA 3CTGA 4QQ7A 5AISA 2O85A 1G7EA 2B3SA 4IVFA 2RLIA 2GZZA 1FG4A 3FZ9A 3A3TA 2HT9A 3D21A 5C04A 2GQKA 2C0EA 2K9FA 4L5LA 4JE1A 1GUHA 2XBQA 1URMA 1ERWA 4K6XA 4HJMA 1THOA 1PMTA 3QCPA 5IMZA 2M80A 1SJIA 3GH9A 5ECPB 1GNWA 2CV4A 2GSQA 3TKSC 1PL2A 1YY7A 4DSQA 1X0RA 4LMWA 1C72A 3BCIA 4G19A 2OADA 2H66A 1A0FA 1SK0A 4MF7A 3FK8A 5ECOB 3O76A 3F0IA 5D9WA 4V1Ap 3NIVA 2L6DA 1JZDA 2CAIA 1X5EA 3ERGA 1ON4A 4NHZA 1SL1B 1VGLA 4NV2A 1O81A 1YF1A 1YKCA 5DQYA 1JLWA 4LL4B 4ZL9A 2IN3A 1EV4A 2C0DA 2C0GA 2CVDA 1SJZA 3V1WA 5D9VA 3VFIA 5DVBA 2EC4A 2CT6A 3P8WA 3MNGA 4DSSA 1JFUA 2PBJA 3LXTA 2JADA 3UOMA 2TRXA 5HR0A 4YQVA 4EUYA 2AUVA 2VL2C 3C73A 11GSA 2FWFA 1A2MA 1PD21 4ZB8A 4BL7A 1TU7A 3D22A 14GSA 1T7PB 3KJYA 4F9ZA 4TOPA 1K0DA 2HNLA 3GV1A 1F3BA 1B48A 4Q5NA 1CQHA 5KN1A 3FY7A 1OC3A 4J57E 5G5FA 2E2GA 4KCAA 4LLRA 1H4OA 3CXGA 3CRTA 1AAZA 3F4TA 3TOUA 4EC0A 2NTOA 4TVEA 3TGZA 2RUFA 1SYXA 2DMLA 3L9VA 3QFAC 1TJDA 5HR1A 3UBLA 4MZBA 2YZHA 2GZYA 3DKSA 2IFQA 5IOWA 2YN1A 3G7JA 5AGYA 2ZNMA 3PGTA 3H93A 4IN0A 2YV9A 4KW6A 3KIJA 2G0FA 4RQRA 3KD0A 3P90A 3IAM2 4POBA 2MZCA 4GTUA 3F3QA 4MA9A 2YWNA 3GX0A 1A0RP 1X9MB 1AQVA 1R4WA 4GSTA 1V98A 3FZ4A 2H0GA 4G10A 3US3A 1X9SB 2AB6A 1PSQA 2FNOA 4KSMA 2H6ZA 4CW9A 3HYPA 3GN3A 4MF6A 4AJ7A 20GSA 1MEKA 5E59A 3U6VA 2LV3A 2OE1A 3LWAA 1FB0A 4GQCA 4I97A 4I2TA 4XHMA 3C1RA 3GURA 1J08A 1UC7A 1G6WA 1T4YA 2A4VA 5CRDA 4WBRD 3TKSA 2BMXA 2L5LA 1M2BA 3N9JA 5J3RA 1GSSA 4GSNA 2V41A 3UEMA 4JR6A 2RM6A 1GSUA 2R37A 3D0ZA 1RW1A 4FIWA 4NMUA 3RHBA 1SL2B 1TRVA 4WBJA 1XZOA 2I4AA 5COHA 3LXZA 4MDCA 1FHEA 2IJYA 2CA8A 2WJUA 5FT3A 4XTSA 1NHYA 2OKAA 3GX8A 2XPEA 2YWOA 2QSIA 5AIXA 3Q6OA 2M46A 3GH6A 3QDNA 5L71A 2B7KA 5ECLB 4TN8A 4ML6A 4IJ3A 2KLXA 2RM5A 1J0FA 3H1NA 1TKDB 5IIZA 5GAND 5D73A 2VL2A 3LEFA 3HD5A 1V2AA 2OE0A 5ELGA 4LMVA 3GKXA 3LORA 5HFKA 1ZL9A 4MJBA 4KH7A 2F9SA 4OO4A 5CREA 5CRHA 2VO4A 3CSIA 2H01A 3I69A 3VURA 2LNTA 1SD9A 2L4CA 2X8CA 5JCGA 4XIHA 2NVLA 5D93A 3G7YA 2LNSA 3GKKA 4IS0A 5G1KA 3UARA 1GH2A 3CSHA 3ZIJA 1TRWA 1OVNA 4EDYA 3RHCA 2YCDA 2PPTA 2RUEA 2IL3A 5AN1A 4TR1A 4V2MA 3F9UA 1HQOA 1ZOFA 5EPFA 2PERA 3HVVA 1XWGA 4FYBA 1BJXA 3ED3A 1V40A 4ZBDA 1MTCA 5EY6A 4L0WA 4ECBA 2WZ9A 2CVBA 4F82A 5D8IA 1PRXA 1PKZA 4OWYA 4MLYA 3ZMKA 3HJPA 3EURA 2PUKC 3VI7A 1TRSA 2YANA 3M8NA 1GUKA 3KP9A 4K0NA 5J4UA 2EIQA 5J5NA 2I3YA 5JCWA 1W89A 5IMAA 3LGCA 5A5KA 2JSZA 1KEBA 1K0NA 2HSYA 2V1MA 3F4RA 2FLSA 2H74A 1M9AA 4POLA 1SK1A 2GSSA 1R7HA 1V9WA 2VCVA 1TTZA 4NV5A 2GSTA 2OA7A 3C8EA 4MJEA 2FA4A 3M9JA 1B9XC 1T4ZA 7GSSA 3L78A 4H86A 5CRGA 3KMNA 2LUSA 5G5EA 1NW2A 5B8AA 2DC5A 4K7IA 2O8VB 3FYGA 3KXOA 4O5RA 4F2IA 4JEDA 1K3OA 3QOUA 2O7KA 5GAPD 3WD6A 1TU8A 1ZYEA 4WR4A 3WGDA 2H73A 3VPTA 4OFMA 2OBKA 4KDYA 4K0GA 1K0OA 1N2AA 5CO3A 2AYTA 1EEMA 1HD2A 5ID2B 1M99A 2VCXA 4TKYA 1XVWA 1TW9A 3TRQA 1T00A 1GULA 2PGTA 2B7JA 2HRFA 2LJAA 2WGRA 3SBCA 5B7CA 1AW9A 4FO5A 3GA4A 3VWUA 3MWHA 2TRCP 1SK2A 2H76A 5H5RA 2X8GA 1X9WB 3NZNA 5J41A 1XWCA 4L8EA 5ENUA 4BA7A 2O89A 2H6XA 5ECMB 4TW5A 5CNWA 8GSSA 1XOAA 3TKPA 3KZQA 4XRAA 2VD1A 1GWCA 3CRUA 3TUEA 1JZOA 2YP6A 2GGTA 3Q18A 1YDKA 2MMAA 1EP8A 3EE2A 6GSYA 2DLXA 4EE0A 2L57A 3QPMA 3BOAA 1A23A 1GP1A 1I9DA 3TJJA 1WWJA 1G0TA 2WCIA 4HEA2 2B6MA 2YOIA 3UVHA 3L9UA 3EINA 1I5GA 3LYKA 5FWGA 3APQA 1ST9A 3HXSA 2C8UA 1VF2A 2VCWA 4HZ2A 1WIKA 2FY6A 2ON7A 2GDRA 5JWRB 4ECIA 1BQ7A 3ZFBA 1Q4JA 5DAKB 4GWRA 2GT5A 4WF4A 2CQ9A 1QGVA 2H0IA 5DDLA 1TOFA 1CQGA 3ZLPA 1XFLA 3PR8A 3FW2A 1ZGNA 4KE3A 3JCML 2H1GA 3I6AA 4K2DA 1T1VA 3UAPA 1GUMA 2B5YA 3DVXA 3HCZA 1QFNA 3KTLA 2OJLA 1GSFA 5IMFA 4K9ZA 2H70A 2C1YA 1QXHA 5F0GA 5DJMA 2GQMA 5AIVA 2VCTA 2HXKA 3LJRA 3EYTA 3FHKA 4FH8A 3VWXA 2E7PA 1MDJA 4KAEA 2C0FA 1M0UA 1AQXA 2AHEA 1JLVA 4IQAA 2JZTA 1OYJA 3GYKA 16GSA 1Z6MA 1R26A 1FB6A 2XC2A 1EEJA 4K1FA 2NPBA 3WT1A 1TI1A 1Z9HA 2ALBA 2PN8A 4MF5A 4E8HA 3G9BA 1XW5A 2WB9A 4D73A 1FVKA 4IP6A 1BG5A 2AV4A 2D2ZA 5CRWA 1GL8A 3F6FA 4IGJA 1DE2A 2H71A 3GUSA 3ISOA 4XRDA 1X5CA 4V1Ag 2C3QA 5JWOB 1OE8A 2LSTA 5H5QA 4EXJA 1U87A 2XHFA 3OR5A 3KCMA 4DVCA 4NAXA 1WMJA 4DSSB 1A8LA 3IR4A 2FGXA 1S3CA 1UN2A 3DIEA 3M9KA 4MZCA 5JWQB 3VLNA 3GTUA 3WYWA 4ZB6A 4GLTA 2YJ7A 2DJ0A 1EGRA 3IPZA 1EWXA 2BJXA 3QMXA 1K3LA 1WE0A 4XS1A 4NHWA 2IMEA 1HNAA 1MD4A 3P7XA 4G2EA 3AY8A 2J23A 2FA8A 1LJRA 3WGXA 5ABRA 2PVOC 2V32A 4MK3A 2OE3A 4EO3A 5J9BA 3TCOA 2AAWA 3FR3A 1QQ2A 5CAXA 3IC4A 1VF1A 2H19A 3GKNA 1DE1A 5IPHA 3ZTLA 2KHPA 4HUAA 2C4JA 2B5EA 1VF4A 2DJ2A 2L5OA 4E8EA 3D4MA 3WT2A 3CMIA 5A4VA 3GTUB 1ZZYA 3TJKA 13GSA 4PX1A 2IFQB 1KNGA 1Y6EA 2B5XA 5ECIB 3G7IA 1WP0A 5EL8A 1UA5A 4POMA 1SL0B 4KNDA 18GSA 1S3DA 2N5FA 3ERFA 1XWKA 1JZWA 1TI3A 5IMCA 3APSA 2LQOA 4KA0A 5KN2A 1JHBA 1XWAA 1GTUA 4MP4A 5INYA 1U88A 4KGIA 2WRTA 4JU5A 3HVXA 3L0HA 3TJFA 1SKSB 3KH7A 1M2DA 2FUG2 2EIOA 2F3MA 1YZXA 3Q19A 3LQ7A 1AXDA 4LA1A 2OBIA 4JRRA 4PNFA 2QKEA 5DJLA 2GVPA 1Z7RA 4WETA 5HR3A 2LS5A 3VWVA 4N0ZA 3HJMA 3HKRA 3Q74A 3DRNA 1M7TA 2VIMA 2MMZA 4WKWA 4YQUA 3ZREA 4AF2A 3IXRA 1XW9A 5ECHB 2YWMA 2AJQB 1PX7A 3FKFA 4GXZA 1XW6A 2DJ3A 3ME8A 3TJGA 2A2SA 1Z5YE 5IMDA 4DEJA 1F6MC 3UMAA 2CVKA 4PQIA 2JZSA 4PQHA 3IHQA 2N5AA 1TK0B 4LL1B 3VWWA 3HZ4A 4JZQA 1ERUA 2R4VA 3VI5A 1PL1A 3PINA 1AC1A 2M72A 3CBUA 2B1LA 3QD9A 3KTBA 4JR4A 3TOTA 1B8XA 4MJAA 2HSHA 4OFTA 4RI7A 6GSWA 4HS1A 1VRSD 2GS3A 4XS4A 3A2VA 5KEJA 1TP9A 5JCUA 1GRXA 2P5RA 4TR3A 4ACSA 1ILOA 5DALA 5C00A 1HYUA 3I9V2 3DWVA 4N30A 3A2WA 2YJHA 4MH3A 4BPYA 1TK5B 3H4KA 2H0HA 5GZZB 3IK9A 2JSYA 2ZUPA 3IV4A 1U3IA 5HR2A 3J7Yb 1BEDA 3UIWA 5F05A 5F06A 2DSAA 1OKDA 2LEGA 1A2JA 3A2XA 5B6MA 4TR1B 3P2AA 2IPAA 4ZL7A 5DALB 1T8EB 1NHOA 3D4TA 2E0QA 1QK8A 1PN9A 3SWLA 3O6TA 5B8BA 3CYNA 1XBSA 4IQ1A 3KEBA 1O8XA 2LQQA 2KP2A 3N5OA 3D5JA 4ISDA 2JU5A 1VF3A 5IMVA 4KX4A 2VAFA 1K0BA 3BD2A 3KM6A 1T3BA 3IK7A 1DUGA 4MCUA 2FD3A 3F6DA 5IO2A 2NBSA 3APOA 3EU4A 2MMOA 2JACA 4RUVA 3UVTA 1V57A 3MSZA 3HJOA 5F07A 4MMMA 3GSSA 2VL3A 2BTOT 3CSJA 5DCGA 2DJKA 3EC3A 1EZKA 2N5BA 1ERTA 2YWIA 1SD8A 2IIYA 2HYXA 3RAZA 2WULA 1RK4A 1WPIA 2P31A 3KP8A 4X43A 1IYIA 3E9JB 4TXOA 4PXOA 1WJKA 1ACVA 4CDOA 3ZZXA 4I5QA 3UL3A 1TRUA 3IA1A 1A2LA 1KBNA 3LFLA 4ZL8A 5G31A 3QFBC 2VD0A 3GSTA 2GT6A 1ERVA 4NPBA 3C7MA 2PMTA 4KDXA 1F9MA 4GQFA 1V58A 2MYGA 2HE3A 3IAS2 1EOGA 5G2ZA 4V2NA 3HZ8A 2YPMA 3M1GA 4AGSA 2LRTA 12GSA 1NSWA 1ZYQB 1M9BA 1G6YA 5DCHA 4X1UA 2K8SA 2H75A 1X5DA 4TXOB 5ECNB 2J9HA 5FHIA 2LKUA 4PQ1A 4CHSA
chains in the Genus database with same CATH superfamily
2HLSA 2KUCA 2PVQA 1FVJA 1Z6NA 4EIPA 1B4PA 2L59A 3L9SA 1W4VA 4X4JA 5EVOA 4HI7A 2R5GA 1A8YA 3IRAA 2F8AA 1J9BA 2KP1A 4N10A 1GTBA 1O7UA 5H5SA 1EV9A 3RPNA 1PA3A 4PTSA 4GRFA 3HA9A 1ABAA 1DSBA 5ECRB 1B4QA 4WF5A 2WFCA 5ECSA 2HFDA 4K7OA 3ZVJD 4YQMA 2I1UA 1IYHA 2MBTA 3DVWA 3TRPA 2DMMA 2K8VA 3FR6A 4TXVA 2IMFA 4NWYA 1BX9A 1XOBA 4BWQA 1K0MA 4YIHA 1TK8B 4GF0A 1KQ7A 4KDUA 2R0PA 2DIZA 1ML6A 2ES7A 4KSOA 17GSA 4J56E 1EOHA 3IE3A 4YH2A 3RBTA 4N0VA 2G2QA 4AJ6A 2L4QA 1FAAA 4P3YB 1YEPA 2LJKA 3PH9A 2LJRA 3U13A 4IHUA 5BMUA 4G9HA 3TKSE 4GSSA 4BIKA 2IMDA 2DIYA 2HRNA 1O8WA 2JL4A 3ZIVA 2H72A 4ZBBA 3F8UA 2JZRA 5GSSA 2FHEA 1MDIA 3M0FA 1GSEA 3U19A 1R5PA 3LYPA 5DQSA 3HDCA 5HFIA 2H30A 1EP7A 1SU9A 3EWLA 1Y25A 2FWEA 3TRXA 1YEXA 4EF0A 3DEXA 2VCZA 5F92A 5D9TA 2C3TA 2D28C 1SENA 1SKWB 1S3AA 3K8NA 1M3IA 2FCHA 22GSA 3DD3A 3ZFLA 2QGAB 4OO5A 3VK9A 2X8HA 3O3TA 2JAWA 1XXUA 1YF0A 1DBYA 3GL3A 1USBA 3DXBA 1QUWA 3CTFA 2A2PA 2PU9C 2GSRA 2IMIA 3RRPA 1Q5NA 5IM9A 5HQPA 4NSLA 4FYCA 4IJIA 4POKA 6GSSA 1PQNA 4D73B 5IOXA 3F4SA 1M2AA 5G30A 19GSA 4JBBA 1Z4LA 1R5AA 3TDGA 3DGQA 3NOFA 4HSCX 4QL9A 2CZ3A 4F03A 1BYEA 4MUMA 2H6YA 2I81A 2DBCA 4ID0A 2V2GA 3W8SA 3BBYA 1TXXA 1EGOA 4WXTA 1TJVA 5G1LA 4K7NA 3ZVJA 1AQWA 2R3XA 1TJWA 1AIUA 1N8JA 2YNXA 1FO5A 2P0GA 2H1AA 3EU3A 3FZ5A 3HHVA 2WDUA 4MH2A 1PX6A 2VLTA 2MMNA 3L4NA 2FWHA 3QR6A 2CZ2A 2HZEA 2R2JA 3ERWA 5HW2A 3DYRA 2VCQA 1OC9A 4MJCA 1QMVA 1BAYA 6GSVA 1UVZA 2H8LA 2IWTA 2GLRA 3ZYWA 5HFGA 1U3AA 6GSXA 2VLUA 3EVIA 5A4UA 2ON5A 1PKWA 4ZBAA 4EVMA 2GQLA 2I7DA 2HZFA 5D9XA 3CQFA 3E3EA 4IELA 4V2LA 1GLPA 3ZMLA 4ZILA 1F3AA 5IPGA 1E2YA 1GSDA 1ZCPA 3KH9A 1JZRA 3VPQA 1XPVA 3MAKA 2HZEB 5D96A 1XWOA 1WOUA 2H1BA 4KCEA 3IOSA 5KN3A 5IQYA 4FYUA 1OC9B 1WRYA 4Q5RA 3IDVA 4O5UA 2KOKA 3ZL5A 4J2FA 4TR0A 2EIRA 2VUPA 3HVSA 3FRCA 4WR5A 4GCIA 3W8JA 1Z3EA 4IW9A 2QC7A 2WS2A 3LSZA 3GRXA 4YAPA 4KB3A 4KUNA 1XVQA 4TRXA 3ZITA 2JARA 1Z4KA 3H8QA 9GSSA 2PWJA 1XCCA 4I2UA 3EPTA 4NXIA 3D6IA 4ML1A 1THXA 4YKFA 1GLQA 1Q98A 1FUOA 2X64A 4RQXA 2REMA 4IBPA 2LRCA 4APBA 2GTUA 2RIIA 2P5QA 4HQZA 2X99A 4PGTA 1FUPA 4Z7XA 2C80A 3ZRDA 1HNCA 2XBIA 2DJ1A 1YKAA 3GHAA 3UJ1A 3QAWA 4Q5FA 5E4WA 1Z7PA 3EMPA 3TKRA 3I43A 4IQJM 2HI7A 1LU4A 3QAGA 4L6CA 4Z2TA 1ZMAA 3RPPA 1NM3A 4WEYA 4K8MA 2E2MA 2LRNA 3OCFA 3S9FA 5LD0A 1OE7A 4DSRA 1XWBA 3FR9A 1YJ6A 3J7Yk 3TJBA 2VM2A 4F0BA 1O6JA 4RI6A 4APAA 3GMFA 3IBHA 3RD8A 5B6NA 1KTEA 1RQMA 3FMWA 3H79A 4HJ2A 2Z9SA 4XCSA 3HY2A 4MZWA 1SKRB 4OMVA 3ME7A 4ILFA 4OCFA 2B1KA 4BWSA 3E0UA 3KGKA 4OCEA 3QAVA 1GTAA 1GNEA 4ZXGA 4XS4B 5CP1A 4EL1A 4HDEA 2UZ8A 1F2EA 1K0CA 4QL7A 3C1SA 4HQSA 3W6GA 2FWGA 1F37A 1GSQA 4MWOA 1PGTA 3C71A 3GKMA 4X0XA 2DJJA 3U5RE 4PUFC 6GSUA 3RDWA 2GZPA 1TDIA 3GFKA 2YV7A 4I6XA 4IP1A 1OC8A 1YQ1A 4EDZA 4ZB9A 1GSYA 4OD7A 1OAZA 3TB2A 1M3JA 5KN0A 4MPGA 3M3MA 4BVXA 2CX3A 5LCZA 4EKZA 4AJ8A 3TV2A 2A2RA 1XIYA 2F8FA 2K6VA 2VM1A 1S3RA 5IO0A 4ULXA 1A24A 2V6KA 2NDOA 3EMXA 3GL5A 4XS6A 4PNGA 3GIXA 2LTKA 3BCKA 3R2QA 2TIRA 4O92A 1Z4JA 2XPDA 5ID2A 2L6CA 2K18A 3UBKA 10GSA 4HOJA 1MDKA 4PURA 1K7WA 2MBSA 1H75A 6GSTA 5GSTA 5DBQA 2V6OA 1B9YC 4HZ4A 2VOCA 2ZCTA 2IMKA 3IHGA 4BVXB 2CAQA 2QGVA 4O32A 5F8BA 1MD3A 3GNJA 4Q5QA 3LG6A 4MPFA 5J9CA 1OKTA 3A5IA 5ECQB 5A4WA 2OACA 2R6KA 4MABA 2F51A 4OFNA 1G7OA 3MDKA 5ELAA 1HNBA 4TR4A 4YAVA 1FOVA 1FW1A 1AUCA 1U6TA 1GTIA 1K3YA 1O73A 4N11A 3A5WA 3DMLA 3F3RA 1K0AA 5LNKe 1E6BA 2C3NA 3FZAA 3TKQA 4L0UA 4ECCA 4PUAA 2H1DA 4E88A 2YZUA 4FQUA 3FEUA 1SJ6A 2CX4A 3WGEA 5CYYA 4HU7A 5ECKB 1DCNA 4L5OA 4HU9A 4I8BA 2VLVA 3CI0K 4F0CA 1O85A 2VL9A 3BJ5A 4BVYA 1SYRA 4IKHA 3KMOA 5DAKA 4ECJA 1LBKA 2O87A 3F63A 4O7HA 2I9HA 4ZIJA 3CTGA 4QQ7A 5AISA 2O85A 1G7EA 2B3SA 4IVFA 2RLIA 2GZZA 1FG4A 3FZ9A 3A3TA 2HT9A 4MX2A 3D21A 5C04A 2GQKA 2C0EA 2K9FA 4L5LA 4JE1A 1GUHA 4BVYB 2XBQA 1URMA 1ERWA 4K6XA 4HJMA 1THOA 1PMTA 3QCPA 5IMZA 2M80A 1SJIA 3GH9A 5ECPB 2PTRA 1GNWA 2CV4A 2GSQA 3TKSC 1PL2A 1YY7A 3R3EA 1JSWA 4DSQA 1X0RA 4LMWA 1C72A 1VDKA 3BCIA 4G19A 2OADA 2H66A 1A0FA 4USSA 1SK0A 4MF7A 3FK8A 5ECOB 3O76A 3F0IA 5D9WA 4V1Ap 3NIVA 2L6DA 1JZDA 2E9FA 2CAIA 1X5EA 3ERGA 4NFLA 1ON4A 5BRTA 4NHZA 1SL1B 1VGLA 4NV2A 1O81A 1YF1A 1YKCA 5DQYA 1YFMA 1JLWA 4LL4B 1HY0A 4ZL9A 2IN3A 1EV4A 2C0DA 2C0GA 2CVDA 1SJZA 3V1WA 5D9VA 3VFIA 5DVBA 4Z2UA 2EC4A 2CT6A 3P8WA 3MNGA 4DSSA 1JFUA 2PBJA 3LXTA 2JADA 3UOMA 2TRXA 5HR0A 4YQVA 4EUYA 2AUVA 2VL2C 3C73A 11GSA 2FWFA 1A2MA 1PD21 4ZB8A 4BL7A 4CY6A 1TU7A 3D22A 14GSA 1T7PB 3KJYA 4F9ZA 4TOPA 1K0DA 2HNLA 2QA1A 3GV1A 1F3BA 1B48A 4Q5NA 1CQHA 5KN1A 2X4AA 3FY7A 1OC3A 4J57E 1TJ7A 5G5FA 2E2GA 4KCAA 4LLRA 1H4OA 3CXGA 3CRTA 1AAZA 3F4TA 3TOUA 4EC0A 2NTOA 4Z2RA 4TVEA 3TGZA 2RUFA 1SYXA 2R0GA 2DMLA 3L9VA 3QFAC 1TJDA 5HR1A 3UBLA 4MZBA 4BL7B 2YZHA 2GZYA 3DKSA 2IFQA 5IOWA 2YN1A 3G7JA 5AGYA 2ZNMA 3PGTA 3H93A 4IN0A 2YV9A 4KW6A 3KIJA 2G0FA 2R0CA 4RQRA 3KD0A 3P90A 3IAM2 4POBA 2MZCA 4GTUA 3F3QA 1DOFA 4MA9A 2YWNA 3GX0A 1A0RP 1X9MB 1AQVA 1R4WA 4GSTA 1V98A 3FZ4A 2H0GA 4G10A 3US3A 1X9SB 2AB6A 1PSQA 2FNOA 4KSMA 2H6ZA 4CW9A 3HYPA 3GN3A 4MF6A 4AJ7A 4MNNA 20GSA 1MEKA 5E59A 3U6VA 2LV3A 2OE1A 3LWAA 1FB0A 4GQCA 4I97A 4I2TA 4XHMA 3C1RA 3GURA 1J08A 1UC7A 1G6WA 1U15A 1T4YA 2A4VA 5CRDA 4WBRD 3TKSA 2BMXA 2L5LA 1M2BA 3N9JA 3BWVA 5J3RA 1GSSA 4GSNA 2V41A 3UEMA 1Z4QA 4JR6A 2RM6A 1GSUA 2R37A 3D0ZA 4ADLA 1RW1A 4FIWA 5D6BA 4NMUA 3RHBA 1Q91A 1SL2B 1TRVA 2DKIA 4WBJA 1XZOA 2I4AA 5COHA 3LXZA 4MDCA 1FHEA 2IJYA 2CA8A 2WJUA 5FT3A 4XTSA 1NHYA 2OKAA 3GX8A 1HY1A 2XPEA 4K2XA 2YWOA 2QSIA 3HVNA 5AIXA 5F91A 3Q6OA 2M46A 3GH6A 3QDNA 5L71A 2B7KA 5ECLB 4TN8A 4ML6A 4IJ3A 2KLXA 2RM5A 1J0FA 4K5SA 3H1NA 1TKDB 5IIZA 3QBPA 5GAND 5D73A 2VL2A 3LEFA 3HD5A 1V2AA 2OE0A 5ELGA 4LMVA 3GKXA 3LORA 5HFKA 1ZL9A 4MJBA 4KH7A 2F9SA 4OO4A 5CREA 3R6QA 5CRHA 2VO4A 3CSIA 2H01A 3I69A 3VURA 2LNTA 1SD9A 2L4CA 2X8CA 5JCGA 4XIHA 2NVLA 5D93A 3G7YA 2LNSA 3GKKA 4IS0A 5G1KA 3UARA 1GH2A 3CSHA 3ZIJA 1TRWA 1Z4MA 1OVNA 4EDYA 3RHCA 2YCDA 2PPTA 2RUEA 2IL3A 5AN1A 4TR1A 4V2MA 3F9UA 1HQOA 1ZOFA 5EPFA 2PERA 3HVVA 1XWGA 4FYBA 1BJXA 3ED3A 1V40A 4ZBDA 1MTCA 5EY6A 4L0WA 4ICYA 4ECBA 2WZ9A 2CVBA 4F82A 1U0LA 5D8IA 1PRXA 1PKZA 1Z4PX 4OWYA 4MLYA 3ZMKA 3HJPA 4EEIA 4G0LA 2FUSA 3EURA 2PUKC 3VI7A 1J3UA 1TRSA 2YANA 3M8NA 1GUKA 3KP9A 4K0NA 5J4UA 2EIQA 5J5NA 3OCEA 2I3YA 5JCWA 1W89A 5IMAA 3LGCA 5A5KA 2JSZA 3IC8A 1KEBA 1K0NA 5KOXA 2HSYA 2V1MA 3F4RA 2FLSA 4YKGA 2H74A 1M9AA 4POLA 1SK1A 2GSSA 1R7HA 1V9WA 2VCVA 1TTZA 4NV5A 2GSTA 2OA7A 3C8EA 4MJEA 3GZHA 2FA4A 3M9JA 1B9XC 1T4ZA 7GSSA 3L78A 4H86A 5CRGA 3KMNA 2LUSA 5G5EA 1NW2A 5B8AA 2DC5A 4K7IA 2O8VB 3FYGA 3KXOA 4O5RA 4F2IA 4JEDA 2YV5A 1K3OA 3QOUA 2O7KA 5GAPD 3NO9A 3WD6A 1TU8A 1AUWA 4NLEA 1ZYEA 4WR4A 3WGDA 2H73A 3VPTA 4OFMA 2OBKA 4KDYA 4K0GA 1IW7D 1K0OA 1N2AA 5CO3A 2AYTA 1EEMA 1HD2A 5ID2B 1M99A 2VCXA 4TKYA 1XVWA 1TW9A 3TRQA 1T00A 1GULA 2PGTA 2B7JA 2HRFA 3C8TA 2LJAA 2WGRA 3SBCA 5B7CA 1AW9A 4FO5A 3GA4A 3VWUA 3MWHA 2TRCP 1SK2A 2H76A 1RE5A 5H5RA 2X8GA 1X9WB 4KF9A 3NZNA 5J41A 1XWCA 4L8EA 3MIXA 5ENUA 4BA7A 2O89A 2H6XA 5ECMB 1XG8A 4TW5A 5CNWA 1ZYPA 8GSSA 2PFMA 1XOAA 3TKPA 3KZQA 4XRAA 2VD1A 1GWCA 3CRUA 3TUEA 1JZOA 2YP6A 3Q18A 2GGTA 1YDKA 2MMAA 1EP8A 3EE2A 6GSYA 2DLXA 4EE0A 2L57A 3QPMA 3BOAA 1A23A 1GP1A 1I9DA 3TJJA 1WWJA 1G0TA 3R6VA 2WCIA 4HEA2 2HVGA 2B6MA 2YOIA 3UVHA 3L9UA 2X75A 3EINA 1I5GA 3LYKA 5FWGA 3APQA 1ST9A 3HXSA 2C8UA 1VF2A 2VCWA 4HZ2A 1WIKA 2FY6A 4HGVA 2ON7A 2GDRA 2D27A 5JWRB 4ECIA 1BQ7A 3ZFBA 1Q4JA 5DAKB 4GWRA 1PN0A 2GT5A 4WF4A 2CQ9A 1QGVA 2H0IA 5DDLA 1TOFA 1CQGA 3ZLPA 1XFLA 3PR8A 3FW2A 1ZGNA 4KE3A 3JCML 2H1GA 3I6AA 4K2DA 1C3UA 1T1VA 3UAPA 1GUMA 2B5YA 3DVXA 3HCZA 1QFNA 3KTLA 2OJLA 1GSFA 5IMFA 4K9ZA 2H70A 2C1YA 1QXHA 5F0GA 5DJMA 2GQMA 5AIVA 4YIKA 2VCTA 2HXKA 3LJRA 3EYTA 3FHKA 5KOWA 4FH8A 3VWXA 2E7PA 1MDJA 4KAEA 2C0FA 1T9HA 3GTDA 1M0UA 1AQXA 2AHEA 1JLVA 4IQAA 2JZTA 1OYJA 3GYKA 16GSA 1Z6MA 3LW9A 1R26A 1FB6A 2XC2A 1EEJA 4K1FA 2NPBA 1Z4IA 3WT1A 4EIQA 1TI1A 1Z9HA 2ALBA 2PN8A 4MF5A 4E8HA 3G9BA 1XW5A 2WB9A 4D73A 1FVKA 2DKHA 4IP6A 1BG5A 4EFCA 2AV4A 2D2ZA 4O5QA 2HRKA 5CRWA 1GL8A 3F6FA 4IGJA 1DE2A 2H71A 3GUSA 3ISOA 4XRDA 1X5CA 4G0KA 4V1Ag 2C3QA 5JWOB 1OE8A 2LSTA 5H5QA 4EXJA 1U87A 2XHFA 3OR5A 3KCMA 4DVCA 4NAXA 1WMJA 4DSSB 1A8LA 3IR4A 2JAUA 2FGXA 1S3CA 1UN2A 3DIEA 3M9KA 4MZCA 5JWQB 3VLNA 3GTUA 3WYWA 4ZB6A 3PPUA 4GLTA 2YJ7A 2DJ0A 1EGRA 3IPZA 1EWXA 2BJXA 3QMXA 1YFEA 1K3LA 1WE0A 4XS1A 4K5RA 4NHWA 2IMEA 1HNAA 1MD4A 3P7XA 4G2EA 3AY8A 2J23A 2FA8A 1LJRA 3WGXA 5ABRA 2PVOC 2V32A 4MK3A 2OE3A 4EO3A 5J9BA 3TCOA 2AAWA 3FR3A 1QQ2A 5CAXA 3IC4A 1VF1A 2X49A 2H19A 1Q92A 3GKNA 1DE1A 5IPHA 3ZTLA 2KHPA 4HUAA 2C4JA 2B5EA 1VF4A 2DJ2A 2L5OA 4E8EA 3D4MA 3MYDA 3WT2A 3CMIA 5A4VA 3GTUB 1ZZYA 3TJKA 13GSA 4PX1A 2IFQB 1KNGA 1TJUA 1Y6EA 2B5XA 5ECIB 3G7IA 1WP0A 5EL8A 1UA5A 4POMA 1SL0B 4KNDA 18GSA 1S3DA 2N5FA 3ERFA 1XWKA 1JZWA 1TI3A 5IMCA 3APSA 2LQOA 4KA0A 5KN2A 1JHBA 1ZYNA 1XWAA 1GTUA 4MP4A 5INYA 1U88A 4KGIA 2WRTA 4JU5A 2JAOA 1K62A 3HVXA 2QA2A 3L0HA 3TJFA 1SKSB 2RCNA 3KH7A 1M2DA 2FUG2 3E04A 2EIOA 2F3MA 1YZXA 3Q19A 3LQ7A 1AXDA 4LA1A 2OBIA 4JRRA 4PNFA 2QKEA 5DJLA 2GVPA 1Z7RA 4WETA 5HR3A 2LS5A 1U16A 3VWVA 4N0ZA 3HJMA 3HKRA 3Q74A 3DRNA 1M7TA 2VIMA 2MMZA 4WKWA 4YQUA 3ZREA 4AF2A 3IXRA 1XW9A 5ECHB 2YWMA 2AJQB 1PX7A 1FUQA 3FKFA 4GXZA 1XW6A 2DJ3A 3ME8A 3TJGA 2A2SA 1Z5YE 5IMDA 4DEJA 1F6MC 3UMAA 2CVKA 4PQIA 2JZSA 4PQHA 3IHQA 2N5AA 1TK0B 4LL1B 3VWWA 3HZ4A 4JZQA 1ERUA 2A4HA 2R4VA 3VI5A 1PL1A 1FURA 3PINA 1AC1A 2M72A 3CBUA 2B1LA 2HSMA 3QD9A 2PTQA 3KTBA 4JR4A 3TOTA 1B8XA 4MJAA 2HSHA 4OFTA 4RI7A 6GSWA 4HS1A 1VRSD 2GS3A 4XS4A 3A2VA 4ADMA 5KEJA 1TP9A 5JCUA 1GRXA 2P5RA 4TR3A 1FOHA 4ACSA 1ILOA 5DALA 5C00A 1HYUA 3I9V2 3DWVA 4N30A 3A2WA 2YJHA 1MH9A 4MH3A 4BPYA 1TK5B 3H4KA 2H0HA 5GZZB 3IK9A 2JSYA 2ZUPA 3IV4A 1U3IA 5HR2A 3J7Yb 1BEDA 3UIWA 5F05A 5F06A 2DSAA 1OKDA 1PFOA 2LEGA 1C3CA 2HRAA 1A2JA 3A2XA 5B6MA 1I0AA 4TR1B 3P2AA 4L57A 2IPAA 2PTSA 4ZL7A 5DALB 1T8EB 1NHOA 3D4TA 4L6AA 2E0QA 1QK8A 1PN9A 3SWLA 4CY8A 3O6TA 5B8BA 3CYNA 1XBSA 4IQ1A 3KEBA 1O8XA 2LQQA 4G0IA 2KP2A 3N5OA 3D5JA 4ISDA 2JU5A 1VF3A 5IMVA 4KX4A 2VAFA 1K0BA 3BD2A 3KM6A 1T3BA 3IK7A 1DUGA 4MCUA 2FD3A 3F6DA 5IO2A 2NBSA 3APOA 3EU4A 2MMOA 2JACA 4RUVA 3UVTA 1V57A 3MSZA 3HJOA 5F07A 4MMMA 3GSSA 2VL3A 2BTOT 3CSJA 5DCGA 2DJKA 3EC3A 1EZKA 2N5BA 3BHGA 1ERTA 2YWIA 1SD8A 2IIYA 2HYXA 3RAZA 2WULA 1RK4A 1WPIA 2P31A 3KP8A 4X43A 1IYIA 3E9JB 4TXOA 4PXOA 1WJKA 1ACVA 4CDOA 3ZZXA 4I5QA 3UL3A 1TRUA 3IA1A 1A2LA 1KBNA 3LFLA 4ZL8A 4A5PA 5G31A 3QFBC 2VD0A 3GSTA 2GT6A 1ERVA 4NPBA 3C7MA 2PMTA 4KDXA 1F9MA 4GQFA 1V58A 2MYGA 2HE3A 3IAS2 1EOGA 5G2ZA 4V2NA 3HZ8A 2YPMA 3M1GA 4AGSA 2LRTA 12GSA 1NSWA 1ZYQB 1M9BA 1G6YA 5DCHA 4X1UA 2K8SA 2H75A 1X5DA 4TXOB 5ECNB 2J9HA 5FHIA 2LKUA 4PQ1A 4CHSA
chains in the Genus database with same CATH topology
2HLSA 2KUCA 2PVQA 1FVJA 1Z6NA 4EIPA 1B4PA 2L59A 3L9SA 1W4VA 4X4JA 5EVOA 4HI7A 2R5GA 1A8YA 3IRAA 2F8AA 1J9BA 2KP1A 4N10A 1GTBA 1O7UA 5H5SA 1EV9A 3RPNA 1PA3A 4PTSA 4GRFA 3HA9A 1ABAA 1DSBA 5ECRB 1B4QA 4WF5A 2WFCA 5ECSA 2HFDA 4K7OA 3ZVJD 4YQMA 2I1UA 1IYHA 2MBTA 3DVWA 3TRPA 2DMMA 2K8VA 3FR6A 4TXVA 2IMFA 4NWYA 1BX9A 1XOBA 4BWQA 1K0MA 1TK8B 4GF0A 4KDUA 2R0PA 2DIZA 1ML6A 2ES7A 4KSOA 17GSA 4J56E 1EOHA 3IE3A 4YH2A 3RBTA 4N0VA 2G2QA 4AJ6A 2L4QA 1FAAA 4P3YB 1YEPA 2LJKA 3PH9A 2LJRA 4IHUA 5BMUA 4G9HA 3TKSE 4GSSA 2IMDA 2DIYA 2HRNA 1O8WA 2JL4A 3ZIVA 2H72A 4ZBBA 3F8UA 2JZRA 5GSSA 2FHEA 1MDIA 3M0FA 1GSEA 1R5PA 3LYPA 5DQSA 3HDCA 5HFIA 2H30A 1EP7A 1SU9A 3EWLA 1Y25A 2FWEA 3TRXA 1YEXA 4EF0A 3DEXA 2VCZA 5D9TA 2C3TA 2D28C 1SENA 1SKWB 1S3AA 3K8NA 2FCHA 22GSA 3DD3A 3ZFLA 4OO5A 3VK9A 2X8HA 3O3TA 1XXUA 1YF0A 1DBYA 3GL3A 1USBA 3DXBA 1QUWA 3CTFA 2A2PA 2PU9C 2GSRA 2IMIA 5IM9A 5HQPA 4FYCA 4IJIA 4POKA 6GSSA 1PQNA 4D73B 5IOXA 3F4SA 1M2AA 5G30A 19GSA 4JBBA 1R5AA 3TDGA 3DGQA 3NOFA 4QL9A 2CZ3A 4F03A 1BYEA 2H6YA 2I81A 2DBCA 4ID0A 2V2GA 3W8SA 3BBYA 1TXXA 1EGOA 4WXTA 5G1LA 4K7NA 3ZVJA 1AQWA 2R3XA 1AIUA 1N8JA 2YNXA 1FO5A 2P0GA 2H1AA 3EU3A 3FZ5A 3HHVA 2WDUA 4MH2A 1PX6A 2VLTA 2MMNA 3L4NA 2FWHA 3QR6A 2CZ2A 2HZEA 2R2JA 3ERWA 3DYRA 2VCQA 1OC9A 4MJCA 1QMVA 1BAYA 6GSVA 1UVZA 2H8LA 2IWTA 2GLRA 3ZYWA 5HFGA 1U3AA 6GSXA 2VLUA 3EVIA 5A4UA 2ON5A 1PKWA 4ZBAA 4EVMA 2GQLA 2HZFA 5D9XA 3E3EA 4IELA 4V2LA 1GLPA 3ZMLA 4ZILA 1F3AA 5IPGA 1E2YA 1GSDA 1ZCPA 3KH9A 1JZRA 3VPQA 1XPVA 3MAKA 2HZEB 5D96A 1WOUA 2H1BA 4KCEA 3IOSA 5KN3A 5IQYA 4FYUA 1OC9B 1WRYA 4Q5RA 3IDVA 4O5UA 2KOKA 3ZL5A 4J2FA 4TR0A 2EIRA 2VUPA 3HVSA 3FRCA 4WR5A 4GCIA 3W8JA 1Z3EA 4IW9A 2QC7A 2WS2A 3LSZA 3GRXA 4YAPA 4KB3A 4KUNA 1XVQA 4TRXA 3ZITA 3H8QA 9GSSA 2PWJA 1XCCA 4I2UA 3EPTA 4NXIA 3D6IA 4ML1A 1THXA 4YKFA 1GLQA 1Q98A 2X64A 4RQXA 2REMA 4IBPA 2LRCA 2GTUA 2RIIA 2P5QA 4HQZA 2X99A 4PGTA 4Z7XA 2C80A 3ZRDA 1HNCA 2XBIA 2DJ1A 1YKAA 3GHAA 3UJ1A 3QAWA 4Q5FA 5E4WA 1Z7PA 3EMPA 3TKRA 3I43A 4IQJM 2HI7A 1LU4A 3QAGA 4Z2TA 1ZMAA 3RPPA 1NM3A 4WEYA 4K8MA 2E2MA 2LRNA 3S9FA 5LD0A 1OE7A 4DSRA 1XWBA 3FR9A 1YJ6A 3J7Yk 3TJBA 2VM2A 4F0BA 1O6JA 4RI6A 3GMFA 3IBHA 5B6NA 1KTEA 1RQMA 3FMWA 3H79A 2Z9SA 4HJ2A 4XCSA 3HY2A 4MZWA 1SKRB 4OMVA 3ME7A 4ILFA 4OCFA 2B1KA 4BWSA 3E0UA 3KGKA 4OCEA 3QAVA 1GTAA 1GNEA 4ZXGA 4XS4B 5CP1A 4EL1A 4HDEA 2UZ8A 1F2EA 1K0CA 4QL7A 3C1SA 4HQSA 3W6GA 2FWGA 1F37A 1GSQA 1PGTA 3C71A 3GKMA 4X0XA 2DJJA 3U5RE 4PUFC 6GSUA 3RDWA 2GZPA 1TDIA 3GFKA 2YV7A 4I6XA 4IP1A 1OC8A 1YQ1A 4EDZA 4ZB9A 1GSYA 4OD7A 1OAZA 3TB2A 5KN0A 4MPGA 3M3MA 4BVXA 2CX3A 5LCZA 4EKZA 4AJ8A 2A2RA 1XIYA 2F8FA 2K6VA 2VM1A 5IO0A 4ULXA 1A24A 2V6KA 2NDOA 3EMXA 3GL5A 4XS6A 4PNGA 3GIXA 2LTKA 3BCKA 3R2QA 2TIRA 4O92A 5ID2A 2XPDA 2L6CA 2K18A 3UBKA 10GSA 4HOJA 1MDKA 4PURA 2MBSA 1H75A 6GSTA 5GSTA 5DBQA 2V6OA 1B9YC 4HZ4A 2VOCA 2ZCTA 2IMKA 3IHGA 4BVXB 2CAQA 2QGVA 4O32A 5F8BA 1MD3A 3GNJA 4Q5QA 3LG6A 4MPFA 5J9CA 1OKTA 3A5IA 5ECQB 5A4WA 2OACA 2R6KA 4MABA 2F51A 4OFNA 1G7OA 3MDKA 5ELAA 1HNBA 4TR4A 4YAVA 1FOVA 1FW1A 1AUCA 1U6TA 1GTIA 1K3YA 1O73A 4N11A 3A5WA 3DMLA 3F3RA 1K0AA 5LNKe 1E6BA 2C3NA 3FZAA 3TKQA 4L0UA 4ECCA 4PUAA 2H1DA 2YZUA 4FQUA 3FEUA 1SJ6A 2CX4A 3WGEA 5CYYA 4HU7A 5ECKB 4L5OA 4HU9A 4I8BA 2VLVA 4F0CA 1O85A 2VL9A 3BJ5A 4BVYA 1SYRA 4IKHA 3KMOA 5DAKA 4ECJA 1LBKA 2O87A 3F63A 4O7HA 2I9HA 4ZIJA 4QQ7A 3CTGA 5AISA 2O85A 1G7EA 2B3SA 4IVFA 2RLIA 2GZZA 1FG4A 3FZ9A 3A3TA 2HT9A 3D21A 5C04A 2GQKA 2C0EA 2K9FA 4L5LA 4JE1A 1GUHA 4BVYB 2XBQA 1URMA 1ERWA 4K6XA 4HJMA 1THOA 1PMTA 3QCPA 5IMZA 2M80A 1SJIA 3GH9A 5ECPB 1GNWA 2CV4A 2GSQA 3TKSC 1PL2A 1YY7A 3R3EA 4DSQA 1X0RA 4LMWA 1C72A 3BCIA 4G19A 2OADA 2H66A 1A0FA 4USSA 1SK0A 4MF7A 3FK8A 5ECOB 3O76A 3F0IA 5D9WA 4V1Ap 3NIVA 2L6DA 1JZDA 2CAIA 1X5EA 3ERGA 1ON4A 5BRTA 4NHZA 1SL1B 1VGLA 4NV2A 1O81A 1YF1A 1YKCA 5DQYA 1JLWA 4LL4B 4ZL9A 2IN3A 1EV4A 2C0DA 2C0GA 2CVDA 1SJZA 3V1WA 5D9VA 3VFIA 5DVBA 4Z2UA 2EC4A 2CT6A 3P8WA 3MNGA 4DSSA 1JFUA 2PBJA 3LXTA 2JADA 3UOMA 2TRXA 5HR0A 4YQVA 4EUYA 2AUVA 2VL2C 3C73A 11GSA 2FWFA 1A2MA 1PD21 4ZB8A 4BL7A 4CY6A 1TU7A 3D22A 14GSA 1T7PB 3KJYA 4F9ZA 4TOPA 1K0DA 2HNLA 2QA1A 3GV1A 1F3BA 1B48A 4Q5NA 1CQHA 5KN1A 2X4AA 3FY7A 1OC3A 4J57E 5G5FA 2E2GA 4KCAA 4LLRA 1H4OA 3CXGA 3CRTA 1AAZA 3F4TA 3TOUA 4EC0A 2NTOA 4Z2RA 4TVEA 3TGZA 2RUFA 1SYXA 2R0GA 2DMLA 3L9VA 3QFAC 1TJDA 5HR1A 3UBLA 4MZBA 4BL7B 2YZHA 2GZYA 3DKSA 2IFQA 5IOWA 2YN1A 3G7JA 5AGYA 2ZNMA 3PGTA 3H93A 4IN0A 2YV9A 4KW6A 3KIJA 2G0FA 2R0CA 4RQRA 3KD0A 3P90A 3IAM2 4POBA 2MZCA 4GTUA 3F3QA 4MA9A 2YWNA 3GX0A 1A0RP 1X9MB 1AQVA 1R4WA 4GSTA 1V98A 3FZ4A 2H0GA 4G10A 3US3A 1X9SB 2AB6A 1PSQA 2FNOA 4KSMA 2H6ZA 4CW9A 3HYPA 3GN3A 4MF6A 4AJ7A 4MNNA 20GSA 1MEKA 5E59A 3U6VA 2LV3A 2OE1A 3LWAA 1FB0A 4GQCA 4I97A 4I2TA 4XHMA 3C1RA 3GURA 1J08A 1UC7A 1G6WA 1T4YA 2A4VA 5CRDA 4WBRD 3TKSA 2BMXA 2L5LA 1M2BA 3N9JA 5J3RA 1GSSA 4GSNA 2V41A 3UEMA 4JR6A 2RM6A 1GSUA 2R37A 3D0ZA 1RW1A 4FIWA 4NMUA 3RHBA 1SL2B 1TRVA 2DKIA 4WBJA 1XZOA 2I4AA 5COHA 3LXZA 4MDCA 1FHEA 2IJYA 2CA8A 2WJUA 5FT3A 4XTSA 1NHYA 2OKAA 3GX8A 2XPEA 4K2XA 2YWOA 2QSIA 5AIXA 3Q6OA 2M46A 3GH6A 3QDNA 5L71A 2B7KA 5ECLB 4TN8A 4ML6A 4IJ3A 2KLXA 2RM5A 1J0FA 4K5SA 3H1NA 1TKDB 5IIZA 5GAND 5D73A 2VL2A 3LEFA 3HD5A 1V2AA 2OE0A 5ELGA 4LMVA 3GKXA 3LORA 5HFKA 1ZL9A 4MJBA 4KH7A 2F9SA 4OO4A 5CREA 5CRHA 2VO4A 3CSIA 2H01A 3I69A 3VURA 2LNTA 1SD9A 2L4CA 2X8CA 5JCGA 4XIHA 2NVLA 5D93A 3G7YA 2LNSA 3GKKA 4IS0A 5G1KA 3UARA 1GH2A 3CSHA 3ZIJA 1TRWA 1OVNA 4EDYA 3RHCA 2YCDA 2PPTA 2RUEA 2IL3A 5AN1A 4TR1A 4V2MA 3F9UA 1HQOA 1ZOFA 5EPFA 2PERA 3HVVA 1XWGA 4FYBA 1BJXA 3ED3A 1V40A 4ZBDA 1MTCA 5EY6A 4L0WA 4ICYA 4ECBA 2WZ9A 2CVBA 4F82A 5D8IA 1PRXA 1PKZA 4OWYA 4MLYA 3ZMKA 3HJPA 4G0LA 3EURA 2PUKC 3VI7A 1TRSA 2YANA 3M8NA 1GUKA 3KP9A 4K0NA 5J4UA 2EIQA 5J5NA 2I3YA 5JCWA 1W89A 5IMAA 3LGCA 5A5KA 2JSZA 3IC8A 1KEBA 1K0NA 5KOXA 2HSYA 2V1MA 3F4RA 2FLSA 4YKGA 2H74A 1M9AA 4POLA 1SK1A 2GSSA 1R7HA 1V9WA 2VCVA 1TTZA 4NV5A 2GSTA 2OA7A 3C8EA 4MJEA 2FA4A 3M9JA 1B9XC 1T4ZA 7GSSA 3L78A 4H86A 5CRGA 3KMNA 2LUSA 5G5EA 1NW2A 5B8AA 2DC5A 4K7IA 2O8VB 3FYGA 3KXOA 4O5RA 4F2IA 4JEDA 1K3OA 3QOUA 2O7KA 5GAPD 3WD6A 1TU8A 1ZYEA 4WR4A 3WGDA 2H73A 3VPTA 4OFMA 2OBKA 4KDYA 4K0GA 1IW7D 1K0OA 1N2AA 5CO3A 2AYTA 1EEMA 1HD2A 5ID2B 1M99A 2VCXA 4TKYA 1XVWA 1TW9A 3TRQA 1T00A 1GULA 2PGTA 2B7JA 2HRFA 2LJAA 2WGRA 3SBCA 5B7CA 1AW9A 4FO5A 3GA4A 3VWUA 3MWHA 2TRCP 1SK2A 2H76A 5H5RA 2X8GA 1X9WB 4KF9A 3NZNA 5J41A 1XWCA 4L8EA 3MIXA 5ENUA 4BA7A 2O89A 2H6XA 5ECMB 4TW5A 5CNWA 1ZYPA 8GSSA 1XOAA 3TKPA 3KZQA 4XRAA 2VD1A 1GWCA 3CRUA 3TUEA 1JZOA 2YP6A 2GGTA 3Q18A 1YDKA 2MMAA 1EP8A 3EE2A 6GSYA 2DLXA 4EE0A 2L57A 3QPMA 3BOAA 1A23A 1GP1A 1I9DA 3TJJA 1WWJA 1G0TA 2WCIA 4HEA2 2B6MA 2YOIA 3UVHA 3L9UA 3EINA 1I5GA 3LYKA 5FWGA 3APQA 1ST9A 3HXSA 2C8UA 1VF2A 2VCWA 4HZ2A 1WIKA 2FY6A 2ON7A 2GDRA 2D27A 5JWRB 4ECIA 1BQ7A 3ZFBA 1Q4JA 5DAKB 4GWRA 1PN0A 2GT5A 4WF4A 2CQ9A 1QGVA 2H0IA 5DDLA 1TOFA 1CQGA 3ZLPA 1XFLA 3PR8A 3FW2A 1ZGNA 4KE3A 3JCML 2H1GA 3I6AA 4K2DA 1T1VA 3UAPA 1GUMA 2B5YA 3DVXA 3HCZA 1QFNA 3KTLA 2OJLA 1GSFA 5IMFA 4K9ZA 2H70A 2C1YA 1QXHA 5F0GA 5DJMA 2GQMA 5AIVA 2VCTA 2HXKA 3LJRA 3EYTA 3FHKA 5KOWA 4FH8A 3VWXA 2E7PA 1MDJA 4KAEA 2C0FA 1M0UA 1AQXA 2AHEA 1JLVA 4IQAA 2JZTA 1OYJA 3GYKA 16GSA 1Z6MA 3LW9A 1R26A 1FB6A 2XC2A 1EEJA 4K1FA 2NPBA 3WT1A 4EIQA 1TI1A 1Z9HA 2ALBA 2PN8A 4MF5A 4E8HA 3G9BA 1XW5A 2WB9A 4D73A 1FVKA 2DKHA 4IP6A 1BG5A 2AV4A 2D2ZA 4O5QA 2HRKA 5CRWA 1GL8A 3F6FA 4IGJA 1DE2A 2H71A 3GUSA 3ISOA 4XRDA 1X5CA 4G0KA 4V1Ag 2C3QA 5JWOB 1OE8A 2LSTA 5H5QA 4EXJA 1U87A 2XHFA 3OR5A 3KCMA 4DVCA 4NAXA 1WMJA 4DSSB 1A8LA 3IR4A 2FGXA 1S3CA 1UN2A 3DIEA 3M9KA 4MZCA 5JWQB 3VLNA 3GTUA 3WYWA 4ZB6A 3PPUA 4GLTA 2YJ7A 2DJ0A 1EGRA 3IPZA 1EWXA 2BJXA 3QMXA 1K3LA 1WE0A 4XS1A 4K5RA 4NHWA 2IMEA 1HNAA 1MD4A 3P7XA 4G2EA 3AY8A 2J23A 2FA8A 1LJRA 3WGXA 5ABRA 2PVOC 2V32A 4MK3A 2OE3A 4EO3A 5J9BA 3TCOA 2AAWA 3FR3A 1QQ2A 5CAXA 3IC4A 1VF1A 2X49A 2H19A 3GKNA 1DE1A 5IPHA 3ZTLA 2KHPA 4HUAA 2C4JA 2B5EA 1VF4A 2DJ2A 2L5OA 4E8EA 3D4MA 3MYDA 3WT2A 3CMIA 5A4VA 3GTUB 1ZZYA 3TJKA 13GSA 4PX1A 2IFQB 1KNGA 1Y6EA 2B5XA 5ECIB 3G7IA 1WP0A 5EL8A 1UA5A 4POMA 1SL0B 4KNDA 18GSA 1S3DA 2N5FA 3ERFA 1XWKA 1JZWA 1TI3A 5IMCA 3APSA 2LQOA 4KA0A 5KN2A 1JHBA 1ZYNA 1XWAA 1GTUA 4MP4A 5INYA 1U88A 4KGIA 2WRTA 4JU5A 3HVXA 2QA2A 3L0HA 3TJFA 1SKSB 3KH7A 1M2DA 2FUG2 2EIOA 2F3MA 1YZXA 3Q19A 3LQ7A 1AXDA 4LA1A 2OBIA 4JRRA 4PNFA 2QKEA 5DJLA 2GVPA 1Z7RA 4WETA 5HR3A 2LS5A 3VWVA 4N0ZA 3HJMA 3HKRA 3Q74A 3DRNA 1M7TA 2VIMA 2MMZA 4WKWA 4YQUA 3ZREA 4AF2A 3IXRA 1XW9A 5ECHB 2YWMA 2AJQB 1PX7A 3FKFA 4GXZA 1XW6A 2DJ3A 3ME8A 3TJGA 2A2SA 1Z5YE 5IMDA 4DEJA 1F6MC 3UMAA 2CVKA 4PQIA 2JZSA 4PQHA 3IHQA 2N5AA 1TK0B 4LL1B 3VWWA 3HZ4A 4JZQA 1ERUA 2A4HA 2R4VA 3VI5A 1PL1A 3PINA 1AC1A 2M72A 3CBUA 2B1LA 2HSMA 3QD9A 3KTBA 4JR4A 3TOTA 1B8XA 4MJAA 2HSHA 4OFTA 4RI7A 6GSWA 4HS1A 1VRSD 2GS3A 4XS4A 3A2VA 5KEJA 1TP9A 5JCUA 1GRXA 2P5RA 4TR3A 1FOHA 4ACSA 1ILOA 5DALA 5C00A 1HYUA 3I9V2 3DWVA 4N30A 3A2WA 2YJHA 4MH3A 4BPYA 1TK5B 3H4KA 2H0HA 5GZZB 3IK9A 2JSYA 2ZUPA 3IV4A 1U3IA 5HR2A 3J7Yb 1BEDA 3UIWA 5F05A 5F06A 2DSAA 1OKDA 2LEGA 2HRAA 1A2JA 3A2XA 5B6MA 4TR1B 3P2AA 2IPAA 4ZL7A 5DALB 1T8EB 1NHOA 3D4TA 2E0QA 1QK8A 1PN9A 3SWLA 4CY8A 3O6TA 5B8BA 3CYNA 1XBSA 4IQ1A 3KEBA 1O8XA 2LQQA 4G0IA 2KP2A 3N5OA 3D5JA 4ISDA 2JU5A 1VF3A 5IMVA 4KX4A 2VAFA 1K0BA 3BD2A 3KM6A 1T3BA 3IK7A 1DUGA 4MCUA 2FD3A 3F6DA 5IO2A 2NBSA 3APOA 3EU4A 2MMOA 2JACA 4RUVA 3UVTA 1V57A 3MSZA 3HJOA 5F07A 4MMMA 3GSSA 2VL3A 2BTOT 3CSJA 5DCGA 2DJKA 3EC3A 1EZKA 2N5BA 1ERTA 2YWIA 1SD8A 2IIYA 2HYXA 3RAZA 2WULA 1RK4A 1WPIA 2P31A 3KP8A 4X43A 1IYIA 3E9JB 4TXOA 4PXOA 1WJKA 1ACVA 4CDOA 3ZZXA 4I5QA 3UL3A 1TRUA 3IA1A 1A2LA 1KBNA 3LFLA 4ZL8A 4A5PA 5G31A 3QFBC 2VD0A 3GSTA 2GT6A 1ERVA 4NPBA 3C7MA 2PMTA 4KDXA 1F9MA 4GQFA 1V58A 2MYGA 2HE3A 3IAS2 1EOGA 5G2ZA 4V2NA 3HZ8A 2YPMA 3M1GA 4AGSA 2LRTA 12GSA 1NSWA 1ZYQB 1M9BA 1G6YA 5DCHA 4X1UA 2K8SA 2H75A 1X5DA 4TXOB 5ECNB 2J9HA 5FHIA 2LKUA 4PQ1A 4CHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HLS A;  2KUC A;  2PVQ A;  1FVJ A;  1Z6N A;  1B4P A;  2L59 A;  3L9S A;  1W4V A;  5EVO A;  4HI7 A;  2R5G A;  1A8Y A;  3IRA A;  2F8A A;  1J9B A;  2KP1 A;  4N10 A;  1GTB A;  1O7U A;  5H5S A;  1EV9 A;  3RPN A;  1PA3 A;  4GRF A;  3HA9 A;  1ABA A;  1DSB A;  5ECR B;  1B4Q A;  4WF5 A;  2WFC A;  5ECS A;  2HFD A;  4K7O A;  3ZVJ D;  4YQM A;  2I1U A;  1IYH A;  2MBT A;  3DVW A;  3TRP A;  2DMM A;  2K8V A;  3FR6 A;  4TXV A;  2IMF A;  4NWY A;  1BX9 A;  1XOB A;  4BWQ A;  1K0M A;  1TK8 B;  4GF0 A;  4KDU A;  2DIZ A;  1ML6 A;  2ES7 A;  4KSO A;  17GS A;  4J56 E;  1EOH A;  3IE3 A;  4YH2 A;  3RBT A;  4N0V A;  2G2Q A;  4AJ6 A;  2L4Q A;  1FAA A;  4P3Y B;  1YEP A;  2LJK A;  3PH9 A;  2LJR A;  4IHU A;  4G9H A;  3TKS E;  4GSS A;  2IMD A;  2DIY A;  2HRN A;  1O8W A;  2JL4 A;  3ZIV A;  2H72 A;  4ZBB A;  3F8U A;  2JZR A;  5GSS A;  2FHE A;  1MDI A;  3M0F A;  1GSE A;  1R5P A;  3LYP A;  5DQS A;  3HDC A;  5HFI A;  2H30 A;  1EP7 A;  1SU9 A;  3EWL A;  1Y25 A;  2FWE A;  3TRX A;  1YEX A;  4EF0 A;  3DEX A;  2VCZ A;  5D9T A;  2C3T A;  1SEN A;  1SKW B;  1S3A A;  3K8N A;  2FCH A;  22GS A;  3DD3 A;  3ZFL A;  4OO5 A;  3VK9 A;  2X8H A;  3O3T A;  1XXU A;  1YF0 A;  1DBY A;  3GL3 A;  1USB A;  3DXB A;  1QUW A;  3CTF A;  2PU9 C;  2GSR A;  2IMI A;  5IM9 A;  5HQP A;  4FYC A;  4IJI A;  4POK A;  6GSS A;  1PQN A;  4D73 B;  5IOX A;  3F4S A;  1M2A A;  5G30 A;  19GS A;  4JBB A;  1R5A A;  3TDG A;  3DGQ A;  3NOF A;  4QL9 A;  2CZ3 A;  4F03 A;  1BYE A;  2H6Y A;  2I81 A;  2DBC A;  4ID0 A;  2V2G A;  3W8S A;  3BBY A;  1TXX A;  1EGO A;  4WXT A;  5G1L A;  4K7N A;  3ZVJ A;  1AQW A;  2R3X A;  1AIU A;  1N8J A;  2YNX A;  1FO5 A;  2P0G A;  2H1A A;  3EU3 A;  3FZ5 A;  3HHV A;  2WDU A;  4MH2 A;  1PX6 A;  2VLT A;  2MMN A;  3L4N A;  2FWH A;  3QR6 A;  2CZ2 A;  2HZE A;  2R2J A;  3ERW A;  3DYR A;  2VCQ A;  1OC9 A;  4MJC A;  1QMV A;  1BAY A;  6GSV A;  1UVZ A;  2H8L A;  2IWT A;  2GLR A;  3ZYW A;  5HFG A;  1U3A A;  6GSX A;  2VLU A;  3EVI A;  5A4U A;  2ON5 A;  1PKW A;  4ZBA A;  4EVM A;  2GQL A;  2HZF A;  5D9X A;  3E3E A;  4IEL A;  4V2L A;  1GLP A;  3ZML A;  4ZIL A;  1F3A A;  5IPG A;  1E2Y A;  1GSD A;  1ZCP A;  3KH9 A;  1JZR A;  3VPQ A;  1XPV A;  3MAK A;  2HZE B;  5D96 A;  1WOU A;  2H1B A;  4KCE A;  3IOS A;  5KN3 A;  5IQY A;  4FYU A;  1OC9 B;  1WRY A;  4Q5R A;  3IDV A;  2KOK A;  3ZL5 A;  4J2F A;  4TR0 A;  2EIR A;  2VUP A;  3HVS A;  3FRC A;  4WR5 A;  4GCI A;  3W8J A;  1Z3E A;  4IW9 A;  2QC7 A;  2WS2 A;  3LSZ A;  3GRX A;  4YAP A;  4KB3 A;  4KUN A;  1XVQ A;  4TRX A;  3ZIT A;  3H8Q A;  9GSS A;  2PWJ A;  1XCC A;  4I2U A;  4NXI A;  3D6I A;  4ML1 A;  1THX A;  1GLQ A;  1Q98 A;  2X64 A;  4RQX A;  2REM A;  4IBP A;  2LRC A;  2GTU A;  2RII A;  2P5Q A;  4HQZ A;  2X99 A;  4PGT A;  4Z7X A;  2C80 A;  3ZRD A;  1HNC A;  2XBI A;  2DJ1 A;  1YKA A;  3GHA A;  3UJ1 A;  3QAW A;  4Q5F A;  5E4W A;  1Z7P A;  3EMP A;  3TKR A;  3I43 A;  2HI7 A;  1LU4 A;  3QAG A;  1ZMA A;  3RPP A;  1NM3 A;  4WEY A;  4K8M A;  2E2M A;  2LRN A;  3S9F A;  5LD0 A;  1OE7 A;  4DSR A;  1XWB A;  3FR9 A;  1YJ6 A;  3J7Y k;  3TJB A;  2VM2 A;  4F0B A;  1O6J A;  4RI6 A;  3GMF A;  3IBH A;  5B6N A;  1KTE A;  1RQM A;  3H79 A;  2Z9S A;  4HJ2 A;  4XCS A;  3HY2 A;  4MZW A;  1SKR B;  4OMV A;  3ME7 A;  4ILF A;  4OCF A;  2B1K A;  4BWS A;  3E0U A;  3KGK A;  4OCE A;  3QAV A;  1GTA A;  1GNE A;  4ZXG A;  4XS4 B;  5CP1 A;  4EL1 A;  4HDE A;  1F2E A;  1K0C A;  4QL7 A;  3C1S A;  4HQS A;  3W6G A;  2FWG A;  1F37 A;  1GSQ A;  1PGT A;  3C71 A;  3GKM A;  4X0X A;  2DJJ A;  3U5R E;  4PUF C;  6GSU A;  3RDW A;  2GZP A;  1TDI A;  3GFK A;  2YV7 A;  4I6X A;  4IP1 A;  1OC8 A;  1YQ1 A;  4EDZ A;  4ZB9 A;  1GSY A;  4OD7 A;  1OAZ A;  3TB2 A;  5KN0 A;  4MPG A;  3M3M A;  4BVX A;  2CX3 A;  5LCZ A;  4EKZ A;  4AJ8 A;  2A2R A;  1XIY A;  2F8F A;  2K6V A;  2VM1 A;  5IO0 A;  4ULX A;  1A24 A;  2V6K A;  2NDO A;  3EMX A;  3GL5 A;  4XS6 A;  4PNG A;  3GIX A;  2LTK A;  3BCK A;  3R2Q A;  2TIR A;  4O92 A;  5ID2 A;  2XPD A;  2L6C A;  2K18 A;  3UBK A;  10GS A;  4HOJ A;  1MDK A;  4PUR A;  2MBS A;  1H75 A;  6GST A;  5GST A;  5DBQ A;  2V6O A;  1B9Y C;  4HZ4 A;  2VOC A;  2ZCT A;  2IMK A;  2CAQ A;  2QGV A;  4O32 A;  5F8B A;  1MD3 A;  3GNJ A;  4Q5Q A;  3LG6 A;  4MPF A;  5J9C A;  1OKT A;  5ECQ B;  5A4W A;  2OAC A;  2R6K A;  4MAB A;  2F51 A;  4OFN A;  1G7O A;  3MDK A;  5ELA A;  1HNB A;  4TR4 A;  4YAV A;  1FOV A;  1FW1 A;  1AUC A;  1U6T A;  1GTI A;  1K3Y A;  1O73 A;  4N11 A;  3A5W A;  3DML A;  3F3R A;  1K0A A;  5LNK e;  1E6B A;  2C3N A;  3FZA A;  3TKQ A;  4L0U A;  4ECC A;  4PUA A;  2H1D A;  2YZU A;  3FEU A;  1SJ6 A;  2CX4 A;  3WGE A;  5CYY A;  4HU7 A;  5ECK B;  4L5O A;  4HU9 A;  4I8B A;  2VLV A;  4F0C A;  1O85 A;  2VL9 A;  3BJ5 A;  4BVY A;  1SYR A;  4IKH A;  3KMO A;  5DAK A;  4ECJ A;  1LBK A;  2O87 A;  3F63 A;  4O7H A;  2I9H A;  4ZIJ A;  3CTG A;  4QQ7 A;  5AIS A;  2O85 A;  1G7E A;  2B3S A;  4IVF A;  2RLI A;  2GZZ A;  1FG4 A;  3FZ9 A;  3A3T A;  2HT9 A;  3D21 A;  5C04 A;  2GQK A;  2C0E A;  2K9F A;  4L5L A;  4JE1 A;  1GUH A;  2XBQ A;  1URM A;  1ERW A;  4K6X A;  4HJM A;  1THO A;  1PMT A;  3QCP A;  5IMZ A;  2M80 A;  1SJI A;  3GH9 A;  5ECP B;  1GNW A;  2CV4 A;  2GSQ A;  3TKS C;  1PL2 A;  1YY7 A;  4DSQ A;  1X0R A;  4LMW A;  1C72 A;  3BCI A;  4G19 A;  2OAD A;  2H66 A;  1A0F A;  1SK0 A;  4MF7 A;  3FK8 A;  5ECO B;  3O76 A;  3F0I A;  5D9W A;  4V1A p;  3NIV A;  2L6D A;  1JZD A;  2CAI A;  1X5E A;  3ERG A;  1ON4 A;  4NHZ A;  1SL1 B;  1VGL A;  4NV2 A;  1O81 A;  1YF1 A;  1YKC A;  5DQY A;  1JLW A;  4LL4 B;  4ZL9 A;  2IN3 A;  1EV4 A;  2C0D A;  2C0G A;  2CVD A;  1SJZ A;  3V1W A;  5D9V A;  3VFI A;  5DVB A;  2EC4 A;  2CT6 A;  3P8W A;  3MNG A;  4DSS A;  1JFU A;  2PBJ A;  3LXT A;  2JAD A;  3UOM A;  2TRX A;  5HR0 A;  4YQV A;  4EUY A;  2AUV A;  2VL2 C;  3C73 A;  11GS A;  2FWF A;  1A2M A;  1PD2 1;  4ZB8 A;  4BL7 A;  1TU7 A;  3D22 A;  14GS A;  1T7P B;  3KJY A;  4F9Z A;  4TOP A;  1K0D A;  2HNL A;  3GV1 A;  1F3B A;  1B48 A;  4Q5N A;  1CQH A;  5KN1 A;  3FY7 A;  1OC3 A;  4J57 E;  5G5F A;  2E2G A;  4KCA A;  4LLR A;  1H4O A;  3CXG A;  3CRT A;  1AAZ A;  3F4T A;  3TOU A;  4EC0 A;  2NTO A;  4TVE A;  3TGZ A;  2RUF A;  1SYX A;  2DML A;  3L9V A;  3QFA C;  1TJD A;  5HR1 A;  3UBL A;  4MZB A;  2YZH A;  2GZY A;  3DKS A;  2IFQ A;  5IOW A;  2YN1 A;  3G7J A;  5AGY A;  2ZNM A;  3PGT A;  3H93 A;  4IN0 A;  2YV9 A;  4KW6 A;  3KIJ A;  2G0F A;  4RQR A;  3KD0 A;  3P90 A;  3IAM 2;  4POB A;  2MZC A;  4GTU A;  3F3Q A;  4MA9 A;  2YWN A;  3GX0 A;  1A0R P;  1X9M B;  1AQV A;  1R4W A;  4GST A;  1V98 A;  3FZ4 A;  2H0G A;  4G10 A;  3US3 A;  1X9S B;  2AB6 A;  1PSQ A;  2FNO A;  4KSM A;  2H6Z A;  4CW9 A;  3HYP A;  3GN3 A;  4MF6 A;  4AJ7 A;  20GS A;  1MEK A;  5E59 A;  3U6V A;  2LV3 A;  2OE1 A;  3LWA A;  1FB0 A;  4GQC A;  4I97 A;  4I2T A;  4XHM A;  3C1R A;  3GUR A;  1J08 A;  1UC7 A;  1G6W A;  1T4Y A;  2A4V A;  5CRD A;  4WBR D;  3TKS A;  2BMX A;  2L5L A;  1M2B A;  3N9J A;  5J3R A;  1GSS A;  4GSN A;  2V41 A;  3UEM A;  4JR6 A;  2RM6 A;  1GSU A;  2R37 A;  3D0Z A;  1RW1 A;  4FIW A;  4NMU A;  3RHB A;  1SL2 B;  1TRV A;  4WBJ A;  1XZO A;  2I4A A;  5COH A;  3LXZ A;  4MDC A;  1FHE A;  2IJY A;  2CA8 A;  2WJU A;  5FT3 A;  4XTS A;  1NHY A;  2OKA A;  3GX8 A;  2XPE A;  2YWO A;  2QSI A;  5AIX A;  3Q6O A;  2M46 A;  3GH6 A;  3QDN A;  5L71 A;  2B7K A;  5ECL B;  4TN8 A;  4ML6 A;  4IJ3 A;  2KLX A;  2RM5 A;  1J0F A;  3H1N A;  1TKD B;  5IIZ A;  5GAN D;  5D73 A;  2VL2 A;  3LEF A;  3HD5 A;  1V2A A;  2OE0 A;  5ELG A;  4LMV A;  3GKX A;  3LOR A;  5HFK A;  1ZL9 A;  4MJB A;  4KH7 A;  2F9S A;  4OO4 A;  5CRE A;  5CRH A;  2VO4 A;  3CSI A;  2H01 A;  3I69 A;  3VUR A;  2LNT A;  1SD9 A;  2L4C A;  2X8C A;  5JCG A;  4XIH A;  2NVL A;  5D93 A;  3G7Y A;  2LNS A;  3GKK A;  4IS0 A;  5G1K A;  3UAR A;  1GH2 A;  3CSH A;  3ZIJ A;  1TRW A;  1OVN A;  4EDY A;  3RHC A;  2YCD A;  2PPT A;  2RUE A;  2IL3 A;  5AN1 A;  4TR1 A;  4V2M A;  3F9U A;  1HQO A;  1ZOF A;  5EPF A;  2PER A;  3HVV A;  1XWG A;  4FYB A;  1BJX A;  3ED3 A;  1V40 A;  4ZBD A;  1MTC A;  5EY6 A;  4L0W A;  4ECB A;  2WZ9 A;  2CVB A;  4F82 A;  5D8I A;  1PRX A;  1PKZ A;  4OWY A;  4MLY A;  3ZMK A;  3HJP A;  3EUR A;  2PUK C;  3VI7 A;  1TRS A;  2YAN A;  3M8N A;  1GUK A;  3KP9 A;  4K0N A;  5J4U A;  2EIQ A;  5J5N A;  2I3Y A;  5JCW A;  1W89 A;  5IMA A;  3LGC A;  5A5K A;  2JSZ A;  1KEB A;  1K0N A;  2HSY A;  2V1M A;  3F4R A;  2FLS A;  2H74 A;  1M9A A;  4POL A;  1SK1 A;  2GSS A;  1R7H A;  1V9W A;  2VCV A;  1TTZ A;  4NV5 A;  2GST A;  2OA7 A;  3C8E A;  4MJE A;  2FA4 A;  3M9J A;  1B9X C;  1T4Z A;  7GSS A;  3L78 A;  4H86 A;  5CRG A;  3KMN A;  2LUS A;  5G5E A;  1NW2 A;  5B8A A;  2DC5 A;  4K7I A;  2O8V B;  3FYG A;  3KXO A;  4O5R A;  4F2I A;  4JED A;  1K3O A;  3QOU A;  2O7K A;  5GAP D;  3WD6 A;  1TU8 A;  1ZYE A;  4WR4 A;  3WGD A;  2H73 A;  3VPT A;  4OFM A;  2OBK A;  4KDY A;  4K0G A;  1K0O A;  1N2A A;  5CO3 A;  2AYT A;  1EEM A;  1HD2 A;  5ID2 B;  1M99 A;  2VCX A;  4TKY A;  1XVW A;  1TW9 A;  3TRQ A;  1T00 A;  1GUL A;  2PGT A;  2B7J A;  2HRF A;  2LJA A;  2WGR A;  3SBC A;  5B7C A;  1AW9 A;  4FO5 A;  3GA4 A;  3VWU A;  3MWH A;  2TRC P;  1SK2 A;  2H76 A;  5H5R A;  2X8G A;  1X9W B;  3NZN A;  5J41 A;  1XWC A;  4L8E A;  5ENU A;  4BA7 A;  2O89 A;  2H6X A;  5ECM B;  4TW5 A;  5CNW A;  8GSS A;  1XOA A;  3TKP A;  3KZQ A;  4XRA A;  2VD1 A;  1GWC A;  3CRU A;  3TUE A;  1JZO A;  2YP6 A;  2GGT A;  3Q18 A;  1YDK A;  2MMA A;  1EP8 A;  3EE2 A;  6GSY A;  2DLX A;  4EE0 A;  2L57 A;  3QPM A;  3BOA A;  1A23 A;  1GP1 A;  1I9D A;  3TJJ A;  1WWJ A;  1G0T A;  2WCI A;  4HEA 2;  2B6M A;  2YOI A;  3UVH A;  3L9U A;  3EIN A;  1I5G A;  3LYK A;  5FWG A;  3APQ A;  1ST9 A;  3HXS A;  2C8U A;  1VF2 A;  2VCW A;  4HZ2 A;  1WIK A;  2FY6 A;  2ON7 A;  2GDR A;  5JWR B;  4ECI A;  1BQ7 A;  3ZFB A;  1Q4J A;  5DAK B;  4GWR A;  2GT5 A;  4WF4 A;  2CQ9 A;  1QGV A;  2H0I A;  5DDL A;  1TOF A;  1CQG A;  3ZLP A;  1XFL A;  3PR8 A;  3FW2 A;  1ZGN A;  4KE3 A;  3JCM L;  2H1G A;  3I6A A;  4K2D A;  1T1V A;  3UAP A;  1GUM A;  2B5Y A;  3DVX A;  3HCZ A;  1QFN A;  3KTL A;  2OJL A;  1GSF A;  5IMF A;  4K9Z A;  2H70 A;  2C1Y A;  1QXH A;  5F0G A;  5DJM A;  2GQM A;  5AIV A;  2VCT A;  2HXK A;  3LJR A;  3EYT A;  3FHK A;  4FH8 A;  3VWX A;  2E7P A;  1MDJ A;  4KAE A;  2C0F A;  1M0U A;  1AQX A;  2AHE A;  1JLV A;  4IQA A;  2JZT A;  1OYJ A;  3GYK A;  16GS A;  1Z6M A;  1R26 A;  1FB6 A;  2XC2 A;  1EEJ A;  4K1F A;  2NPB A;  3WT1 A;  1TI1 A;  1Z9H A;  2ALB A;  2PN8 A;  4MF5 A;  4E8H A;  3G9B A;  1XW5 A;  2WB9 A;  4D73 A;  1FVK A;  4IP6 A;  1BG5 A;  2AV4 A;  2D2Z A;  5CRW A;  1GL8 A;  3F6F A;  4IGJ A;  1DE2 A;  2H71 A;  3GUS A;  3ISO A;  4XRD A;  1X5C A;  4V1A g;  2C3Q A;  5JWO B;  1OE8 A;  2LST A;  5H5Q A;  4EXJ A;  1U87 A;  2XHF A;  3OR5 A;  3KCM A;  4DVC A;  4NAX A;  1WMJ A;  4DSS B;  1A8L A;  3IR4 A;  2FGX A;  1S3C A;  1UN2 A;  3DIE A;  3M9K A;  4MZC A;  5JWQ B;  3VLN A;  3GTU A;  3WYW A;  4ZB6 A;  4GLT A;  2YJ7 A;  2DJ0 A;  1EGR A;  3IPZ A;  1EWX A;  2BJX A;  3QMX A;  1K3L A;  1WE0 A;  4XS1 A;  4NHW A;  2IME A;  1HNA A;  1MD4 A;  3P7X A;  4G2E A;  3AY8 A;  2J23 A;  2FA8 A;  1LJR A;  3WGX A;  5ABR A;  2PVO C;  2V32 A;  4MK3 A;  2OE3 A;  4EO3 A;  5J9B A;  3TCO A;  2AAW A;  3FR3 A;  1QQ2 A;  5CAX A;  3IC4 A;  1VF1 A;  2H19 A;  3GKN A;  1DE1 A;  5IPH A;  3ZTL A;  2KHP A;  4HUA A;  2C4J A;  2B5E A;  1VF4 A;  2DJ2 A;  2L5O A;  4E8E A;  3D4M A;  3WT2 A;  3CMI A;  5A4V A;  3GTU B;  1ZZY A;  3TJK A;  13GS A;  4PX1 A;  2IFQ B;  1KNG A;  1Y6E A;  2B5X A;  5ECI B;  3G7I A;  1WP0 A;  5EL8 A;  1UA5 A;  4POM A;  1SL0 B;  4KND A;  18GS A;  1S3D A;  2N5F A;  3ERF A;  1XWK A;  1JZW A;  1TI3 A;  5IMC A;  3APS A;  2LQO A;  4KA0 A;  5KN2 A;  1JHB A;  1XWA A;  1GTU A;  4MP4 A;  5INY A;  1U88 A;  4KGI A;  2WRT A;  4JU5 A;  3HVX A;  3L0H A;  3TJF A;  1SKS B;  3KH7 A;  1M2D A;  2FUG 2;  2EIO A;  2F3M A;  1YZX A;  3Q19 A;  3LQ7 A;  1AXD A;  4LA1 A;  2OBI A;  4JRR A;  4PNF A;  2QKE A;  5DJL A;  2GVP A;  1Z7R A;  4WET A;  5HR3 A;  2LS5 A;  3VWV A;  4N0Z A;  3HJM A;  3HKR A;  3Q74 A;  3DRN A;  1M7T A;  2VIM A;  2MMZ A;  4WKW A;  4YQU A;  3ZRE A;  4AF2 A;  3IXR A;  1XW9 A;  5ECH B;  2YWM A;  2AJQ B;  1PX7 A;  3FKF A;  4GXZ A;  1XW6 A;  2DJ3 A;  3ME8 A;  3TJG A;  2A2S A;  1Z5Y E;  5IMD A;  4DEJ A;  1F6M C;  3UMA A;  2CVK A;  4PQI A;  2JZS A;  4PQH A;  3IHQ A;  2N5A A;  1TK0 B;  4LL1 B;  3VWW A;  3HZ4 A;  4JZQ A;  1ERU A;  2R4V A;  3VI5 A;  1PL1 A;  3PIN A;  1AC1 A;  2M72 A;  3CBU A;  2B1L A;  3QD9 A;  3KTB A;  4JR4 A;  3TOT A;  1B8X A;  4MJA A;  2HSH A;  4OFT A;  4RI7 A;  6GSW A;  4HS1 A;  1VRS D;  2GS3 A;  4XS4 A;  3A2V A;  5KEJ A;  1TP9 A;  5JCU A;  1GRX A;  2P5R A;  4TR3 A;  4ACS A;  1ILO A;  5DAL A;  5C00 A;  1HYU A;  3I9V 2;  3DWV A;  4N30 A;  3A2W A;  2YJH A;  4MH3 A;  4BPY A;  1TK5 B;  3H4K A;  2H0H A;  5GZZ B;  3IK9 A;  2JSY A;  2ZUP A;  3IV4 A;  1U3I A;  5HR2 A;  3J7Y b;  1BED A;  3UIW A;  5F05 A;  5F06 A;  2DSA A;  1OKD A;  2LEG A;  1A2J A;  3A2X A;  5B6M A;  4TR1 B;  3P2A A;  2IPA A;  4ZL7 A;  5DAL B;  1T8E B;  1NHO A;  3D4T A;  2E0Q A;  1QK8 A;  1PN9 A;  3SWL A;  3O6T A;  5B8B A;  3CYN A;  1XBS A;  4IQ1 A;  3KEB A;  1O8X A;  2LQQ A;  2KP2 A;  3N5O A;  3D5J A;  4ISD A;  2JU5 A;  1VF3 A;  5IMV A;  4KX4 A;  2VAF A;  1K0B A;  3BD2 A;  3KM6 A;  1T3B A;  3IK7 A;  1DUG A;  4MCU A;  2FD3 A;  3F6D A;  5IO2 A;  2NBS A;  3APO A;  3EU4 A;  2MMO A;  2JAC A;  4RUV A;  3UVT A;  1V57 A;  3MSZ A;  3HJO A;  5F07 A;  4MMM A;  3GSS A;  2VL3 A;  2BTO T;  3CSJ A;  5DCG A;  2DJK A;  3EC3 A;  1EZK A;  2N5B A;  1ERT A;  2YWI A;  1SD8 A;  2IIY A;  2HYX A;  3RAZ A;  2WUL A;  1RK4 A;  1WPI A;  2P31 A;  3KP8 A;  4X43 A;  1IYI A;  3E9J B;  4TXO A;  4PXO A;  1WJK A;  1ACV A;  4CDO A;  3ZZX A;  4I5Q A;  3UL3 A;  1TRU A;  3IA1 A;  1A2L A;  1KBN A;  3LFL A;  4ZL8 A;  5G31 A;  3QFB C;  2VD0 A;  3GST A;  2GT6 A;  1ERV A;  4NPB A;  3C7M A;  2PMT A;  4KDX A;  1F9M A;  4GQF A;  1V58 A;  2MYG A;  2HE3 A;  3IAS 2;  1EOG A;  5G2Z A;  4V2N A;  3HZ8 A;  2YPM A;  3M1G A;  4AGS A;  2LRT A;  12GS A;  1NSW A;  1ZYQ B;  1M9B A;  1G6Y A;  5DCH A;  4X1U A;  2K8S A;  2H75 A;  1X5D A;  4TXO B;  5ECN B;  2J9H A;  5FHI A;  2LKU A;  4PQ1 A;  4CHS A; 
#chains in the Genus database with same CATH topology
 2HLS A;  2KUC A;  2PVQ A;  1FVJ A;  1Z6N A;  4EIP A;  1B4P A;  2L59 A;  3L9S A;  1W4V A;  4X4J A;  5EVO A;  4HI7 A;  2R5G A;  1A8Y A;  3IRA A;  2F8A A;  1J9B A;  2KP1 A;  4N10 A;  1GTB A;  1O7U A;  5H5S A;  1EV9 A;  3RPN A;  1PA3 A;  4PTS A;  4GRF A;  3HA9 A;  1ABA A;  1DSB A;  5ECR B;  1B4Q A;  4WF5 A;  2WFC A;  5ECS A;  2HFD A;  4K7O A;  3ZVJ D;  4YQM A;  2I1U A;  1IYH A;  2MBT A;  3DVW A;  3TRP A;  2DMM A;  2K8V A;  3FR6 A;  4TXV A;  2IMF A;  4NWY A;  1BX9 A;  1XOB A;  4BWQ A;  1K0M A;  4YIH A;  1TK8 B;  4GF0 A;  1KQ7 A;  4KDU A;  2R0P A;  2DIZ A;  1ML6 A;  2ES7 A;  4KSO A;  17GS A;  4J56 E;  1EOH A;  3IE3 A;  4YH2 A;  3RBT A;  4N0V A;  2G2Q A;  4AJ6 A;  2L4Q A;  1FAA A;  4P3Y B;  1YEP A;  2LJK A;  3PH9 A;  2LJR A;  3U13 A;  4IHU A;  5BMU A;  4G9H A;  3TKS E;  4GSS A;  4BIK A;  2IMD A;  2DIY A;  2HRN A;  1O8W A;  2JL4 A;  3ZIV A;  2H72 A;  4ZBB A;  3F8U A;  2JZR A;  5GSS A;  2FHE A;  1MDI A;  3M0F A;  1GSE A;  3U19 A;  1R5P A;  3LYP A;  5DQS A;  3HDC A;  5HFI A;  2H30 A;  1EP7 A;  1SU9 A;  3EWL A;  1Y25 A;  2FWE A;  3TRX A;  1YEX A;  4EF0 A;  3DEX A;  2VCZ A;  5F92 A;  5D9T A;  2C3T A;  2D28 C;  1SEN A;  1SKW B;  1S3A A;  3K8N A;  1M3I A;  2FCH A;  22GS A;  3DD3 A;  3ZFL A;  2QGA B;  4OO5 A;  3VK9 A;  2X8H A;  3O3T A;  2JAW A;  1XXU A;  1YF0 A;  1DBY A;  3GL3 A;  1USB A;  3DXB A;  1QUW A;  3CTF A;  2A2P A;  2PU9 C;  2GSR A;  2IMI A;  3RRP A;  1Q5N A;  5IM9 A;  5HQP A;  4NSL A;  4FYC A;  4IJI A;  4POK A;  6GSS A;  1PQN A;  4D73 B;  5IOX A;  3F4S A;  1M2A A;  5G30 A;  19GS A;  4JBB A;  1Z4L A;  1R5A A;  3TDG A;  3DGQ A;  3NOF A;  4HSC X;  4QL9 A;  2CZ3 A;  4F03 A;  1BYE A;  4MUM A;  2H6Y A;  2I81 A;  2DBC A;  4ID0 A;  2V2G A;  3W8S A;  3BBY A;  1TXX A;  1EGO A;  4WXT A;  1TJV A;  5G1L A;  4K7N A;  3ZVJ A;  1AQW A;  2R3X A;  1TJW A;  1AIU A;  1N8J A;  2YNX A;  1FO5 A;  2P0G A;  2H1A A;  3EU3 A;  3FZ5 A;  3HHV A;  2WDU A;  4MH2 A;  1PX6 A;  2VLT A;  2MMN A;  3L4N A;  2FWH A;  3QR6 A;  2CZ2 A;  2HZE A;  2R2J A;  3ERW A;  5HW2 A;  3DYR A;  2VCQ A;  1OC9 A;  4MJC A;  1QMV A;  1BAY A;  6GSV A;  1UVZ A;  2H8L A;  2IWT A;  2GLR A;  3ZYW A;  5HFG A;  1U3A A;  6GSX A;  2VLU A;  3EVI A;  5A4U A;  2ON5 A;  1PKW A;  4ZBA A;  4EVM A;  2GQL A;  2I7D A;  2HZF A;  5D9X A;  3CQF A;  3E3E A;  4IEL A;  4V2L A;  1GLP A;  3ZML A;  4ZIL A;  1F3A A;  5IPG A;  1E2Y A;  1GSD A;  1ZCP A;  3KH9 A;  1JZR A;  3VPQ A;  1XPV A;  3MAK A;  2HZE B;  5D96 A;  1XWO A;  1WOU A;  2H1B A;  4KCE A;  3IOS A;  5KN3 A;  5IQY A;  4FYU A;  1OC9 B;  1WRY A;  4Q5R A;  3IDV A;  4O5U A;  2KOK A;  3ZL5 A;  4J2F A;  4TR0 A;  2EIR A;  2VUP A;  3HVS A;  3FRC A;  4WR5 A;  4GCI A;  3W8J A;  1Z3E A;  4IW9 A;  2QC7 A;  2WS2 A;  3LSZ A;  3GRX A;  4YAP A;  4KB3 A;  4KUN A;  1XVQ A;  4TRX A;  3ZIT A;  2JAR A;  1Z4K A;  3H8Q A;  9GSS A;  2PWJ A;  1XCC A;  4I2U A;  3EPT A;  4NXI A;  3D6I A;  4ML1 A;  1THX A;  4YKF A;  1GLQ A;  1Q98 A;  1FUO A;  2X64 A;  4RQX A;  2REM A;  4IBP A;  2LRC A;  4APB A;  2GTU A;  2RII A;  2P5Q A;  4HQZ A;  2X99 A;  4PGT A;  1FUP A;  4Z7X A;  2C80 A;  3ZRD A;  1HNC A;  2XBI A;  2DJ1 A;  1YKA A;  3GHA A;  3UJ1 A;  3QAW A;  4Q5F A;  5E4W A;  1Z7P A;  3EMP A;  3TKR A;  3I43 A;  4IQJ M;  2HI7 A;  1LU4 A;  3QAG A;  4L6C A;  4Z2T A;  1ZMA A;  3RPP A;  1NM3 A;  4WEY A;  4K8M A;  2E2M A;  2LRN A;  3OCF A;  3S9F A;  5LD0 A;  1OE7 A;  4DSR A;  1XWB A;  3FR9 A;  1YJ6 A;  3J7Y k;  3TJB A;  2VM2 A;  4F0B A;  1O6J A;  4RI6 A;  4APA A;  3GMF A;  3IBH A;  3RD8 A;  5B6N A;  1KTE A;  1RQM A;  3FMW A;  3H79 A;  4HJ2 A;  2Z9S A;  4XCS A;  3HY2 A;  4MZW A;  1SKR B;  4OMV A;  3ME7 A;  4ILF A;  4OCF A;  2B1K A;  4BWS A;  3E0U A;  3KGK A;  4OCE A;  3QAV A;  1GTA A;  1GNE A;  4ZXG A;  4XS4 B;  5CP1 A;  4EL1 A;  4HDE A;  2UZ8 A;  1F2E A;  1K0C A;  4QL7 A;  3C1S A;  4HQS A;  3W6G A;  2FWG A;  1F37 A;  1GSQ A;  4MWO A;  1PGT A;  3C71 A;  3GKM A;  4X0X A;  2DJJ A;  3U5R E;  4PUF C;  6GSU A;  3RDW A;  2GZP A;  1TDI A;  3GFK A;  2YV7 A;  4I6X A;  4IP1 A;  1OC8 A;  1YQ1 A;  4EDZ A;  4ZB9 A;  1GSY A;  4OD7 A;  1OAZ A;  3TB2 A;  1M3J A;  5KN0 A;  4MPG A;  3M3M A;  4BVX A;  2CX3 A;  5LCZ A;  4EKZ A;  4AJ8 A;  3TV2 A;  2A2R A;  1XIY A;  2F8F A;  2K6V A;  2VM1 A;  1S3R A;  5IO0 A;  4ULX A;  1A24 A;  2V6K A;  2NDO A;  3EMX A;  3GL5 A;  4XS6 A;  4PNG A;  3GIX A;  2LTK A;  3BCK A;  3R2Q A;  2TIR A;  4O92 A;  1Z4J A;  2XPD A;  5ID2 A;  2L6C A;  2K18 A;  3UBK A;  10GS A;  4HOJ A;  1MDK A;  4PUR A;  1K7W A;  2MBS A;  1H75 A;  6GST A;  5GST A;  5DBQ A;  2V6O A;  1B9Y C;  4HZ4 A;  2VOC A;  2ZCT A;  2IMK A;  3IHG A;  4BVX B;  2CAQ A;  2QGV A;  4O32 A;  5F8B A;  1MD3 A;  3GNJ A;  4Q5Q A;  3LG6 A;  4MPF A;  5J9C A;  1OKT A;  3A5I A;  5ECQ B;  5A4W A;  2OAC A;  2R6K A;  4MAB A;  2F51 A;  4OFN A;  1G7O A;  3MDK A;  5ELA A;  1HNB A;  4TR4 A;  4YAV A;  1FOV A;  1FW1 A;  1AUC A;  1U6T A;  1GTI A;  1K3Y A;  1O73 A;  4N11 A;  3A5W A;  3DML A;  3F3R A;  1K0A A;  5LNK e;  1E6B A;  2C3N A;  3FZA A;  3TKQ A;  4L0U A;  4ECC A;  4PUA A;  2H1D A;  4E88 A;  2YZU A;  4FQU A;  3FEU A;  1SJ6 A;  2CX4 A;  3WGE A;  5CYY A;  4HU7 A;  5ECK B;  1DCN A;  4L5O A;  4HU9 A;  4I8B A;  2VLV A;  3CI0 K;  4F0C A;  1O85 A;  2VL9 A;  3BJ5 A;  4BVY A;  1SYR A;  4IKH A;  3KMO A;  5DAK A;  4ECJ A;  1LBK A;  2O87 A;  3F63 A;  4O7H A;  2I9H A;  4ZIJ A;  3CTG A;  4QQ7 A;  5AIS A;  2O85 A;  1G7E A;  2B3S A;  4IVF A;  2RLI A;  2GZZ A;  1FG4 A;  3FZ9 A;  3A3T A;  2HT9 A;  4MX2 A;  3D21 A;  5C04 A;  2GQK A;  2C0E A;  2K9F A;  4L5L A;  4JE1 A;  1GUH A;  4BVY B;  2XBQ A;  1URM A;  1ERW A;  4K6X A;  4HJM A;  1THO A;  1PMT A;  3QCP A;  5IMZ A;  2M80 A;  1SJI A;  3GH9 A;  5ECP B;  2PTR A;  1GNW A;  2CV4 A;  2GSQ A;  3TKS C;  1PL2 A;  1YY7 A;  3R3E A;  1JSW A;  4DSQ A;  1X0R A;  4LMW A;  1C72 A;  1VDK A;  3BCI A;  4G19 A;  2OAD A;  2H66 A;  1A0F A;  4USS A;  1SK0 A;  4MF7 A;  3FK8 A;  5ECO B;  3O76 A;  3F0I A;  5D9W A;  4V1A p;  3NIV A;  2L6D A;  1JZD A;  2E9F A;  2CAI A;  1X5E A;  3ERG A;  4NFL A;  1ON4 A;  5BRT A;  4NHZ A;  1SL1 B;  1VGL A;  4NV2 A;  1O81 A;  1YF1 A;  1YKC A;  5DQY A;  1YFM A;  1JLW A;  4LL4 B;  1HY0 A;  4ZL9 A;  2IN3 A;  1EV4 A;  2C0D A;  2C0G A;  2CVD A;  1SJZ A;  3V1W A;  5D9V A;  3VFI A;  5DVB A;  4Z2U A;  2EC4 A;  2CT6 A;  3P8W A;  3MNG A;  4DSS A;  1JFU A;  2PBJ A;  3LXT A;  2JAD A;  3UOM A;  2TRX A;  5HR0 A;  4YQV A;  4EUY A;  2AUV A;  2VL2 C;  3C73 A;  11GS A;  2FWF A;  1A2M A;  1PD2 1;  4ZB8 A;  4BL7 A;  4CY6 A;  1TU7 A;  3D22 A;  14GS A;  1T7P B;  3KJY A;  4F9Z A;  4TOP A;  1K0D A;  2HNL A;  2QA1 A;  3GV1 A;  1F3B A;  1B48 A;  4Q5N A;  1CQH A;  5KN1 A;  2X4A A;  3FY7 A;  1OC3 A;  4J57 E;  1TJ7 A;  5G5F A;  2E2G A;  4KCA A;  4LLR A;  1H4O A;  3CXG A;  3CRT A;  1AAZ A;  3F4T A;  3TOU A;  4EC0 A;  2NTO A;  4Z2R A;  4TVE A;  3TGZ A;  2RUF A;  1SYX A;  2R0G A;  2DML A;  3L9V A;  3QFA C;  1TJD A;  5HR1 A;  3UBL A;  4MZB A;  4BL7 B;  2YZH A;  2GZY A;  3DKS A;  2IFQ A;  5IOW A;  2YN1 A;  3G7J A;  5AGY A;  2ZNM A;  3PGT A;  3H93 A;  4IN0 A;  2YV9 A;  4KW6 A;  3KIJ A;  2G0F A;  2R0C A;  4RQR A;  3KD0 A;  3P90 A;  3IAM 2;  4POB A;  2MZC A;  4GTU A;  3F3Q A;  1DOF A;  4MA9 A;  2YWN A;  3GX0 A;  1A0R P;  1X9M B;  1AQV A;  1R4W A;  4GST A;  1V98 A;  3FZ4 A;  2H0G A;  4G10 A;  3US3 A;  1X9S B;  2AB6 A;  1PSQ A;  2FNO A;  4KSM A;  2H6Z A;  4CW9 A;  3HYP A;  3GN3 A;  4MF6 A;  4AJ7 A;  4MNN A;  20GS A;  1MEK A;  5E59 A;  3U6V A;  2LV3 A;  2OE1 A;  3LWA A;  1FB0 A;  4GQC A;  4I97 A;  4I2T A;  4XHM A;  3C1R A;  3GUR A;  1J08 A;  1UC7 A;  1G6W A;  1U15 A;  1T4Y A;  2A4V A;  5CRD A;  4WBR D;  3TKS A;  2BMX A;  2L5L A;  1M2B A;  3N9J A;  3BWV A;  5J3R A;  1GSS A;  4GSN A;  2V41 A;  3UEM A;  1Z4Q A;  4JR6 A;  2RM6 A;  1GSU A;  2R37 A;  3D0Z A;  4ADL A;  1RW1 A;  4FIW A;  5D6B A;  4NMU A;  3RHB A;  1Q91 A;  1SL2 B;  1TRV A;  2DKI A;  4WBJ A;  1XZO A;  2I4A A;  5COH A;  3LXZ A;  4MDC A;  1FHE A;  2IJY A;  2CA8 A;  2WJU A;  5FT3 A;  4XTS A;  1NHY A;  2OKA A;  3GX8 A;  1HY1 A;  2XPE A;  4K2X A;  2YWO A;  2QSI A;  3HVN A;  5AIX A;  5F91 A;  3Q6O A;  2M46 A;  3GH6 A;  3QDN A;  5L71 A;  2B7K A;  5ECL B;  4TN8 A;  4ML6 A;  4IJ3 A;  2KLX A;  2RM5 A;  1J0F A;  4K5S A;  3H1N A;  1TKD B;  5IIZ A;  3QBP A;  5GAN D;  5D73 A;  2VL2 A;  3LEF A;  3HD5 A;  1V2A A;  2OE0 A;  5ELG A;  4LMV A;  3GKX A;  3LOR A;  5HFK A;  1ZL9 A;  4MJB A;  4KH7 A;  2F9S A;  4OO4 A;  5CRE A;  3R6Q A;  5CRH A;  2VO4 A;  3CSI A;  2H01 A;  3I69 A;  3VUR A;  2LNT A;  1SD9 A;  2L4C A;  2X8C A;  5JCG A;  4XIH A;  2NVL A;  5D93 A;  3G7Y A;  2LNS A;  3GKK A;  4IS0 A;  5G1K A;  3UAR A;  1GH2 A;  3CSH A;  3ZIJ A;  1TRW A;  1Z4M A;  1OVN A;  4EDY A;  3RHC A;  2YCD A;  2PPT A;  2RUE A;  2IL3 A;  5AN1 A;  4TR1 A;  4V2M A;  3F9U A;  1HQO A;  1ZOF A;  5EPF A;  2PER A;  3HVV A;  1XWG A;  4FYB A;  1BJX A;  3ED3 A;  1V40 A;  4ZBD A;  1MTC A;  5EY6 A;  4L0W A;  4ICY A;  4ECB A;  2WZ9 A;  2CVB A;  4F82 A;  1U0L A;  5D8I A;  1PRX A;  1PKZ A;  1Z4P X;  4OWY A;  4MLY A;  3ZMK A;  3HJP A;  4EEI A;  4G0L A;  2FUS A;  3EUR A;  2PUK C;  3VI7 A;  1J3U A;  1TRS A;  2YAN A;  3M8N A;  1GUK A;  3KP9 A;  4K0N A;  5J4U A;  2EIQ A;  5J5N A;  3OCE A;  2I3Y A;  5JCW A;  1W89 A;  5IMA A;  3LGC A;  5A5K A;  2JSZ A;  3IC8 A;  1KEB A;  1K0N A;  5KOX A;  2HSY A;  2V1M A;  3F4R A;  2FLS A;  4YKG A;  2H74 A;  1M9A A;  4POL A;  1SK1 A;  2GSS A;  1R7H A;  1V9W A;  2VCV A;  1TTZ A;  4NV5 A;  2GST A;  2OA7 A;  3C8E A;  4MJE A;  3GZH A;  2FA4 A;  3M9J A;  1B9X C;  1T4Z A;  7GSS A;  3L78 A;  4H86 A;  5CRG A;  3KMN A;  2LUS A;  5G5E A;  1NW2 A;  5B8A A;  2DC5 A;  4K7I A;  2O8V B;  3FYG A;  3KXO A;  4O5R A;  4F2I A;  4JED A;  2YV5 A;  1K3O A;  3QOU A;  2O7K A;  5GAP D;  3NO9 A;  3WD6 A;  1TU8 A;  1AUW A;  4NLE A;  1ZYE A;  4WR4 A;  3WGD A;  2H73 A;  3VPT A;  4OFM A;  2OBK A;  4KDY A;  4K0G A;  1IW7 D;  1K0O A;  1N2A A;  5CO3 A;  2AYT A;  1EEM A;  1HD2 A;  5ID2 B;  1M99 A;  2VCX A;  4TKY A;  1XVW A;  1TW9 A;  3TRQ A;  1T00 A;  1GUL A;  2PGT A;  2B7J A;  2HRF A;  3C8T A;  2LJA A;  2WGR A;  3SBC A;  5B7C A;  1AW9 A;  4FO5 A;  3GA4 A;  3VWU A;  3MWH A;  2TRC P;  1SK2 A;  2H76 A;  1RE5 A;  5H5R A;  2X8G A;  1X9W B;  4KF9 A;  3NZN A;  5J41 A;  1XWC A;  4L8E A;  3MIX A;  5ENU A;  4BA7 A;  2O89 A;  2H6X A;  5ECM B;  1XG8 A;  4TW5 A;  5CNW A;  1ZYP A;  8GSS A;  2PFM A;  1XOA A;  3TKP A;  3KZQ A;  4XRA A;  2VD1 A;  1GWC A;  3CRU A;  3TUE A;  1JZO A;  2YP6 A;  3Q18 A;  2GGT A;  1YDK A;  2MMA A;  1EP8 A;  3EE2 A;  6GSY A;  2DLX A;  4EE0 A;  2L57 A;  3QPM A;  3BOA A;  1A23 A;  1GP1 A;  1I9D A;  3TJJ A;  1WWJ A;  1G0T A;  3R6V A;  2WCI A;  4HEA 2;  2HVG A;  2B6M A;  2YOI A;  3UVH A;  3L9U A;  2X75 A;  3EIN A;  1I5G A;  3LYK A;  5FWG A;  3APQ A;  1ST9 A;  3HXS A;  2C8U A;  1VF2 A;  2VCW A;  4HZ2 A;  1WIK A;  2FY6 A;  4HGV A;  2ON7 A;  2GDR A;  2D27 A;  5JWR B;  4ECI A;  1BQ7 A;  3ZFB A;  1Q4J A;  5DAK B;  4GWR A;  1PN0 A;  2GT5 A;  4WF4 A;  2CQ9 A;  1QGV A;  2H0I A;  5DDL A;  1TOF A;  1CQG A;  3ZLP A;  1XFL A;  3PR8 A;  3FW2 A;  1ZGN A;  4KE3 A;  3JCM L;  2H1G A;  3I6A A;  4K2D A;  1C3U A;  1T1V A;  3UAP A;  1GUM A;  2B5Y A;  3DVX A;  3HCZ A;  1QFN A;  3KTL A;  2OJL A;  1GSF A;  5IMF A;  4K9Z A;  2H70 A;  2C1Y A;  1QXH A;  5F0G A;  5DJM A;  2GQM A;  5AIV A;  4YIK A;  2VCT A;  2HXK A;  3LJR A;  3EYT A;  3FHK A;  5KOW A;  4FH8 A;  3VWX A;  2E7P A;  1MDJ A;  4KAE A;  2C0F A;  1T9H A;  3GTD A;  1M0U A;  1AQX A;  2AHE A;  1JLV A;  4IQA A;  2JZT A;  1OYJ A;  3GYK A;  16GS A;  1Z6M A;  3LW9 A;  1R26 A;  1FB6 A;  2XC2 A;  1EEJ A;  4K1F A;  2NPB A;  1Z4I A;  3WT1 A;  4EIQ A;  1TI1 A;  1Z9H A;  2ALB A;  2PN8 A;  4MF5 A;  4E8H A;  3G9B A;  1XW5 A;  2WB9 A;  4D73 A;  1FVK A;  2DKH A;  4IP6 A;  1BG5 A;  4EFC A;  2AV4 A;  2D2Z A;  4O5Q A;  2HRK A;  5CRW A;  1GL8 A;  3F6F A;  4IGJ A;  1DE2 A;  2H71 A;  3GUS A;  3ISO A;  4XRD A;  1X5C A;  4G0K A;  4V1A g;  2C3Q A;  5JWO B;  1OE8 A;  2LST A;  5H5Q A;  4EXJ A;  1U87 A;  2XHF A;  3OR5 A;  3KCM A;  4DVC A;  4NAX A;  1WMJ A;  4DSS B;  1A8L A;  3IR4 A;  2JAU A;  2FGX A;  1S3C A;  1UN2 A;  3DIE A;  3M9K A;  4MZC A;  5JWQ B;  3VLN A;  3GTU A;  3WYW A;  4ZB6 A;  3PPU A;  4GLT A;  2YJ7 A;  2DJ0 A;  1EGR A;  3IPZ A;  1EWX A;  2BJX A;  3QMX A;  1YFE A;  1K3L A;  1WE0 A;  4XS1 A;  4K5R A;  4NHW A;  2IME A;  1HNA A;  1MD4 A;  3P7X A;  4G2E A;  3AY8 A;  2J23 A;  2FA8 A;  1LJR A;  3WGX A;  5ABR A;  2PVO C;  2V32 A;  4MK3 A;  2OE3 A;  4EO3 A;  5J9B A;  3TCO A;  2AAW A;  3FR3 A;  1QQ2 A;  5CAX A;  3IC4 A;  1VF1 A;  2X49 A;  2H19 A;  1Q92 A;  3GKN A;  1DE1 A;  5IPH A;  3ZTL A;  2KHP A;  4HUA A;  2C4J A;  2B5E A;  1VF4 A;  2DJ2 A;  2L5O A;  4E8E A;  3D4M A;  3MYD A;  3WT2 A;  3CMI A;  5A4V A;  3GTU B;  1ZZY A;  3TJK A;  13GS A;  4PX1 A;  2IFQ B;  1KNG A;  1TJU A;  1Y6E A;  2B5X A;  5ECI B;  3G7I A;  1WP0 A;  5EL8 A;  1UA5 A;  4POM A;  1SL0 B;  4KND A;  18GS A;  1S3D A;  2N5F A;  3ERF A;  1XWK A;  1JZW A;  1TI3 A;  5IMC A;  3APS A;  2LQO A;  4KA0 A;  5KN2 A;  1JHB A;  1ZYN A;  1XWA A;  1GTU A;  4MP4 A;  5INY A;  1U88 A;  4KGI A;  2WRT A;  4JU5 A;  2JAO A;  1K62 A;  3HVX A;  2QA2 A;  3L0H A;  3TJF A;  1SKS B;  2RCN A;  3KH7 A;  1M2D A;  2FUG 2;  3E04 A;  2EIO A;  2F3M A;  1YZX A;  3Q19 A;  3LQ7 A;  1AXD A;  4LA1 A;  2OBI A;  4JRR A;  4PNF A;  2QKE A;  5DJL A;  2GVP A;  1Z7R A;  4WET A;  5HR3 A;  2LS5 A;  1U16 A;  3VWV A;  4N0Z A;  3HJM A;  3HKR A;  3Q74 A;  3DRN A;  1M7T A;  2VIM A;  2MMZ A;  4WKW A;  4YQU A;  3ZRE A;  4AF2 A;  3IXR A;  1XW9 A;  5ECH B;  2YWM A;  2AJQ B;  1PX7 A;  1FUQ A;  3FKF A;  4GXZ A;  1XW6 A;  2DJ3 A;  3ME8 A;  3TJG A;  2A2S A;  1Z5Y E;  5IMD A;  4DEJ A;  1F6M C;  3UMA A;  2CVK A;  4PQI A;  2JZS A;  4PQH A;  3IHQ A;  2N5A A;  1TK0 B;  4LL1 B;  3VWW A;  3HZ4 A;  4JZQ A;  1ERU A;  2A4H A;  2R4V A;  3VI5 A;  1PL1 A;  1FUR A;  3PIN A;  1AC1 A;  2M72 A;  3CBU A;  2B1L A;  2HSM A;  3QD9 A;  2PTQ A;  3KTB A;  4JR4 A;  3TOT A;  1B8X A;  4MJA A;  2HSH A;  4OFT A;  4RI7 A;  6GSW A;  4HS1 A;  1VRS D;  2GS3 A;  4XS4 A;  3A2V A;  4ADM A;  5KEJ A;  1TP9 A;  5JCU A;  1GRX A;  2P5R A;  4TR3 A;  1FOH A;  4ACS A;  1ILO A;  5DAL A;  5C00 A;  1HYU A;  3I9V 2;  3DWV A;  4N30 A;  3A2W A;  2YJH A;  1MH9 A;  4MH3 A;  4BPY A;  1TK5 B;  3H4K A;  2H0H A;  5GZZ B;  3IK9 A;  2JSY A;  2ZUP A;  3IV4 A;  1U3I A;  5HR2 A;  3J7Y b;  1BED A;  3UIW A;  5F05 A;  5F06 A;  2DSA A;  1OKD A;  1PFO A;  2LEG A;  1C3C A;  2HRA A;  1A2J A;  3A2X A;  5B6M A;  1I0A A;  4TR1 B;  3P2A A;  4L57 A;  2IPA A;  2PTS A;  4ZL7 A;  5DAL B;  1T8E B;  1NHO A;  3D4T A;  4L6A A;  2E0Q A;  1QK8 A;  1PN9 A;  3SWL A;  4CY8 A;  3O6T A;  5B8B A;  3CYN A;  1XBS A;  4IQ1 A;  3KEB A;  1O8X A;  2LQQ A;  4G0I A;  2KP2 A;  3N5O A;  3D5J A;  4ISD A;  2JU5 A;  1VF3 A;  5IMV A;  4KX4 A;  2VAF A;  1K0B A;  3BD2 A;  3KM6 A;  1T3B A;  3IK7 A;  1DUG A;  4MCU A;  2FD3 A;  3F6D A;  5IO2 A;  2NBS A;  3APO A;  3EU4 A;  2MMO A;  2JAC A;  4RUV A;  3UVT A;  1V57 A;  3MSZ A;  3HJO A;  5F07 A;  4MMM A;  3GSS A;  2VL3 A;  2BTO T;  3CSJ A;  5DCG A;  2DJK A;  3EC3 A;  1EZK A;  2N5B A;  3BHG A;  1ERT A;  2YWI A;  1SD8 A;  2IIY A;  2HYX A;  3RAZ A;  2WUL A;  1RK4 A;  1WPI A;  2P31 A;  3KP8 A;  4X43 A;  1IYI A;  3E9J B;  4TXO A;  4PXO A;  1WJK A;  1ACV A;  4CDO A;  3ZZX A;  4I5Q A;  3UL3 A;  1TRU A;  3IA1 A;  1A2L A;  1KBN A;  3LFL A;  4ZL8 A;  4A5P A;  5G31 A;  3QFB C;  2VD0 A;  3GST A;  2GT6 A;  1ERV A;  4NPB A;  3C7M A;  2PMT A;  4KDX A;  1F9M A;  4GQF A;  1V58 A;  2MYG A;  2HE3 A;  3IAS 2;  1EOG A;  5G2Z A;  4V2N A;  3HZ8 A;  2YPM A;  3M1G A;  4AGS A;  2LRT A;  12GS A;  1NSW A;  1ZYQ B;  1M9B A;  1G6Y A;  5DCH A;  4X1U A;  2K8S A;  2H75 A;  1X5D A;  4TXO B;  5ECN B;  2J9H A;  5FHI A;  2LKU A;  4PQ1 A;  4CHS A; 
#chains in the Genus database with same CATH homology
 2HLS A;  2KUC A;  2PVQ A;  1FVJ A;  1Z6N A;  4EIP A;  1B4P A;  2L59 A;  3L9S A;  1W4V A;  4X4J A;  5EVO A;  4HI7 A;  2R5G A;  1A8Y A;  3IRA A;  2F8A A;  1J9B A;  2KP1 A;  4N10 A;  1GTB A;  1O7U A;  5H5S A;  1EV9 A;  3RPN A;  1PA3 A;  4PTS A;  4GRF A;  3HA9 A;  1ABA A;  1DSB A;  5ECR B;  1B4Q A;  4WF5 A;  2WFC A;  5ECS A;  2HFD A;  4K7O A;  3ZVJ D;  4YQM A;  2I1U A;  1IYH A;  2MBT A;  3DVW A;  3TRP A;  2DMM A;  2K8V A;  3FR6 A;  4TXV A;  2IMF A;  4NWY A;  1BX9 A;  1XOB A;  4BWQ A;  1K0M A;  1TK8 B;  4GF0 A;  4KDU A;  2R0P A;  2DIZ A;  1ML6 A;  2ES7 A;  4KSO A;  17GS A;  4J56 E;  1EOH A;  3IE3 A;  4YH2 A;  3RBT A;  4N0V A;  2G2Q A;  4AJ6 A;  2L4Q A;  1FAA A;  4P3Y B;  1YEP A;  2LJK A;  3PH9 A;  2LJR A;  4IHU A;  5BMU A;  4G9H A;  3TKS E;  4GSS A;  2IMD A;  2DIY A;  2HRN A;  1O8W A;  2JL4 A;  3ZIV A;  2H72 A;  4ZBB A;  3F8U A;  2JZR A;  5GSS A;  2FHE A;  1MDI A;  3M0F A;  1GSE A;  1R5P A;  3LYP A;  5DQS A;  3HDC A;  5HFI A;  2H30 A;  1EP7 A;  1SU9 A;  3EWL A;  1Y25 A;  2FWE A;  3TRX A;  1YEX A;  4EF0 A;  3DEX A;  2VCZ A;  5D9T A;  2C3T A;  2D28 C;  1SEN A;  1SKW B;  1S3A A;  3K8N A;  2FCH A;  22GS A;  3DD3 A;  3ZFL A;  4OO5 A;  3VK9 A;  2X8H A;  3O3T A;  1XXU A;  1YF0 A;  1DBY A;  3GL3 A;  1USB A;  3DXB A;  1QUW A;  3CTF A;  2A2P A;  2PU9 C;  2GSR A;  2IMI A;  5IM9 A;  5HQP A;  4FYC A;  4IJI A;  4POK A;  6GSS A;  1PQN A;  4D73 B;  5IOX A;  3F4S A;  1M2A A;  5G30 A;  19GS A;  4JBB A;  1R5A A;  3TDG A;  3DGQ A;  3NOF A;  4QL9 A;  2CZ3 A;  4F03 A;  1BYE A;  2H6Y A;  2I81 A;  2DBC A;  4ID0 A;  2V2G A;  3W8S A;  3BBY A;  1TXX A;  1EGO A;  4WXT A;  5G1L A;  4K7N A;  3ZVJ A;  1AQW A;  2R3X A;  1AIU A;  1N8J A;  2YNX A;  1FO5 A;  2P0G A;  2H1A A;  3EU3 A;  3FZ5 A;  3HHV A;  2WDU A;  4MH2 A;  1PX6 A;  2VLT A;  2MMN A;  3L4N A;  2FWH A;  3QR6 A;  2CZ2 A;  2HZE A;  2R2J A;  3ERW A;  3DYR A;  2VCQ A;  1OC9 A;  4MJC A;  1QMV A;  1BAY A;  6GSV A;  1UVZ A;  2H8L A;  2IWT A;  2GLR A;  3ZYW A;  5HFG A;  1U3A A;  6GSX A;  2VLU A;  3EVI A;  5A4U A;  2ON5 A;  1PKW A;  4ZBA A;  4EVM A;  2GQL A;  2HZF A;  5D9X A;  3E3E A;  4IEL A;  4V2L A;  1GLP A;  3ZML A;  4ZIL A;  1F3A A;  5IPG A;  1E2Y A;  1GSD A;  1ZCP A;  3KH9 A;  1JZR A;  3VPQ A;  1XPV A;  3MAK A;  2HZE B;  5D96 A;  1WOU A;  2H1B A;  4KCE A;  3IOS A;  5KN3 A;  5IQY A;  4FYU A;  1OC9 B;  1WRY A;  4Q5R A;  3IDV A;  4O5U A;  2KOK A;  3ZL5 A;  4J2F A;  4TR0 A;  2EIR A;  2VUP A;  3HVS A;  3FRC A;  4WR5 A;  4GCI A;  3W8J A;  1Z3E A;  4IW9 A;  2QC7 A;  2WS2 A;  3LSZ A;  3GRX A;  4YAP A;  4KB3 A;  4KUN A;  1XVQ A;  4TRX A;  3ZIT A;  3H8Q A;  9GSS A;  2PWJ A;  1XCC A;  4I2U A;  3EPT A;  4NXI A;  3D6I A;  4ML1 A;  1THX A;  4YKF A;  1GLQ A;  1Q98 A;  2X64 A;  4RQX A;  2REM A;  4IBP A;  2LRC A;  2GTU A;  2RII A;  2P5Q A;  4HQZ A;  2X99 A;  4PGT A;  4Z7X A;  2C80 A;  3ZRD A;  1HNC A;  2XBI A;  2DJ1 A;  1YKA A;  3GHA A;  3UJ1 A;  3QAW A;  4Q5F A;  5E4W A;  1Z7P A;  3EMP A;  3TKR A;  3I43 A;  4IQJ M;  2HI7 A;  1LU4 A;  3QAG A;  4Z2T A;  1ZMA A;  3RPP A;  1NM3 A;  4WEY A;  4K8M A;  2E2M A;  2LRN A;  3S9F A;  5LD0 A;  1OE7 A;  4DSR A;  1XWB A;  3FR9 A;  1YJ6 A;  3J7Y k;  3TJB A;  2VM2 A;  4F0B A;  1O6J A;  4RI6 A;  3GMF A;  3IBH A;  5B6N A;  1KTE A;  1RQM A;  3FMW A;  3H79 A;  2Z9S A;  4HJ2 A;  4XCS A;  3HY2 A;  4MZW A;  1SKR B;  4OMV A;  3ME7 A;  4ILF A;  4OCF A;  2B1K A;  4BWS A;  3E0U A;  3KGK A;  4OCE A;  3QAV A;  1GTA A;  1GNE A;  4ZXG A;  4XS4 B;  5CP1 A;  4EL1 A;  4HDE A;  2UZ8 A;  1F2E A;  1K0C A;  4QL7 A;  3C1S A;  4HQS A;  3W6G A;  2FWG A;  1F37 A;  1GSQ A;  1PGT A;  3C71 A;  3GKM A;  4X0X A;  2DJJ A;  3U5R E;  4PUF C;  6GSU A;  3RDW A;  2GZP A;  1TDI A;  3GFK A;  2YV7 A;  4I6X A;  4IP1 A;  1OC8 A;  1YQ1 A;  4EDZ A;  4ZB9 A;  1GSY A;  4OD7 A;  1OAZ A;  3TB2 A;  5KN0 A;  4MPG A;  3M3M A;  4BVX A;  2CX3 A;  5LCZ A;  4EKZ A;  4AJ8 A;  2A2R A;  1XIY A;  2F8F A;  2K6V A;  2VM1 A;  5IO0 A;  4ULX A;  1A24 A;  2V6K A;  2NDO A;  3EMX A;  3GL5 A;  4XS6 A;  4PNG A;  3GIX A;  2LTK A;  3BCK A;  3R2Q A;  2TIR A;  4O92 A;  5ID2 A;  2XPD A;  2L6C A;  2K18 A;  3UBK A;  10GS A;  4HOJ A;  1MDK A;  4PUR A;  2MBS A;  1H75 A;  6GST A;  5GST A;  5DBQ A;  2V6O A;  1B9Y C;  4HZ4 A;  2VOC A;  2ZCT A;  2IMK A;  3IHG A;  4BVX B;  2CAQ A;  2QGV A;  4O32 A;  5F8B A;  1MD3 A;  3GNJ A;  4Q5Q A;  3LG6 A;  4MPF A;  5J9C A;  1OKT A;  3A5I A;  5ECQ B;  5A4W A;  2OAC A;  2R6K A;  4MAB A;  2F51 A;  4OFN A;  1G7O A;  3MDK A;  5ELA A;  1HNB A;  4TR4 A;  4YAV A;  1FOV A;  1FW1 A;  1AUC A;  1U6T A;  1GTI A;  1K3Y A;  1O73 A;  4N11 A;  3A5W A;  3DML A;  3F3R A;  1K0A A;  5LNK e;  1E6B A;  2C3N A;  3FZA A;  3TKQ A;  4L0U A;  4ECC A;  4PUA A;  2H1D A;  2YZU A;  4FQU A;  3FEU A;  1SJ6 A;  2CX4 A;  3WGE A;  5CYY A;  4HU7 A;  5ECK B;  4L5O A;  4HU9 A;  4I8B A;  2VLV A;  4F0C A;  1O85 A;  2VL9 A;  3BJ5 A;  4BVY A;  1SYR A;  4IKH A;  3KMO A;  5DAK A;  4ECJ A;  1LBK A;  2O87 A;  3F63 A;  4O7H A;  2I9H A;  4ZIJ A;  4QQ7 A;  3CTG A;  5AIS A;  2O85 A;  1G7E A;  2B3S A;  4IVF A;  2RLI A;  2GZZ A;  1FG4 A;  3FZ9 A;  3A3T A;  2HT9 A;  3D21 A;  5C04 A;  2GQK A;  2C0E A;  2K9F A;  4L5L A;  4JE1 A;  1GUH A;  4BVY B;  2XBQ A;  1URM A;  1ERW A;  4K6X A;  4HJM A;  1THO A;  1PMT A;  3QCP A;  5IMZ A;  2M80 A;  1SJI A;  3GH9 A;  5ECP B;  1GNW A;  2CV4 A;  2GSQ A;  3TKS C;  1PL2 A;  1YY7 A;  3R3E A;  4DSQ A;  1X0R A;  4LMW A;  1C72 A;  3BCI A;  4G19 A;  2OAD A;  2H66 A;  1A0F A;  4USS A;  1SK0 A;  4MF7 A;  3FK8 A;  5ECO B;  3O76 A;  3F0I A;  5D9W A;  4V1A p;  3NIV A;  2L6D A;  1JZD A;  2CAI A;  1X5E A;  3ERG A;  1ON4 A;  5BRT A;  4NHZ A;  1SL1 B;  1VGL A;  4NV2 A;  1O81 A;  1YF1 A;  1YKC A;  5DQY A;  1JLW A;  4LL4 B;  4ZL9 A;  2IN3 A;  1EV4 A;  2C0D A;  2C0G A;  2CVD A;  1SJZ A;  3V1W A;  5D9V A;  3VFI A;  5DVB A;  4Z2U A;  2EC4 A;  2CT6 A;  3P8W A;  3MNG A;  4DSS A;  1JFU A;  2PBJ A;  3LXT A;  2JAD A;  3UOM A;  2TRX A;  5HR0 A;  4YQV A;  4EUY A;  2AUV A;  2VL2 C;  3C73 A;  11GS A;  2FWF A;  1A2M A;  1PD2 1;  4ZB8 A;  4BL7 A;  4CY6 A;  1TU7 A;  3D22 A;  14GS A;  1T7P B;  3KJY A;  4F9Z A;  4TOP A;  1K0D A;  2HNL A;  2QA1 A;  3GV1 A;  1F3B A;  1B48 A;  4Q5N A;  1CQH A;  5KN1 A;  2X4A A;  3FY7 A;  1OC3 A;  4J57 E;  5G5F A;  2E2G A;  4KCA A;  4LLR A;  1H4O A;  3CXG A;  3CRT A;  1AAZ A;  3F4T A;  3TOU A;  4EC0 A;  2NTO A;  4Z2R A;  4TVE A;  3TGZ A;  2RUF A;  1SYX A;  2R0G A;  2DML A;  3L9V A;  3QFA C;  1TJD A;  5HR1 A;  3UBL A;  4MZB A;  4BL7 B;  2YZH A;  2GZY A;  3DKS A;  2IFQ A;  5IOW A;  2YN1 A;  3G7J A;  5AGY A;  2ZNM A;  3PGT A;  3H93 A;  4IN0 A;  2YV9 A;  4KW6 A;  3KIJ A;  2G0F A;  2R0C A;  4RQR A;  3KD0 A;  3P90 A;  3IAM 2;  4POB A;  2MZC A;  4GTU A;  3F3Q A;  4MA9 A;  2YWN A;  3GX0 A;  1A0R P;  1X9M B;  1AQV A;  1R4W A;  4GST A;  1V98 A;  3FZ4 A;  2H0G A;  4G10 A;  3US3 A;  1X9S B;  2AB6 A;  1PSQ A;  2FNO A;  4KSM A;  2H6Z A;  4CW9 A;  3HYP A;  3GN3 A;  4MF6 A;  4AJ7 A;  4MNN A;  20GS A;  1MEK A;  5E59 A;  3U6V A;  2LV3 A;  2OE1 A;  3LWA A;  1FB0 A;  4GQC A;  4I97 A;  4I2T A;  4XHM A;  3C1R A;  3GUR A;  1J08 A;  1UC7 A;  1G6W A;  1T4Y A;  2A4V A;  5CRD A;  4WBR D;  3TKS A;  2BMX A;  2L5L A;  1M2B A;  3N9J A;  5J3R A;  1GSS A;  4GSN A;  2V41 A;  3UEM A;  4JR6 A;  2RM6 A;  1GSU A;  2R37 A;  3D0Z A;  1RW1 A;  4FIW A;  4NMU A;  3RHB A;  1SL2 B;  1TRV A;  2DKI A;  4WBJ A;  1XZO A;  2I4A A;  5COH A;  3LXZ A;  4MDC A;  1FHE A;  2IJY A;  2CA8 A;  2WJU A;  5FT3 A;  4XTS A;  1NHY A;  2OKA A;  3GX8 A;  2XPE A;  4K2X A;  2YWO A;  2QSI A;  5AIX A;  3Q6O A;  2M46 A;  3GH6 A;  3QDN A;  5L71 A;  2B7K A;  5ECL B;  4TN8 A;  4ML6 A;  4IJ3 A;  2KLX A;  2RM5 A;  1J0F A;  4K5S A;  3H1N A;  1TKD B;  5IIZ A;  5GAN D;  5D73 A;  2VL2 A;  3LEF A;  3HD5 A;  1V2A A;  2OE0 A;  5ELG A;  4LMV A;  3GKX A;  3LOR A;  5HFK A;  1ZL9 A;  4MJB A;  4KH7 A;  2F9S A;  4OO4 A;  5CRE A;  5CRH A;  2VO4 A;  3CSI A;  2H01 A;  3I69 A;  3VUR A;  2LNT A;  1SD9 A;  2L4C A;  2X8C A;  5JCG A;  4XIH A;  2NVL A;  5D93 A;  3G7Y A;  2LNS A;  3GKK A;  4IS0 A;  5G1K A;  3UAR A;  1GH2 A;  3CSH A;  3ZIJ A;  1TRW A;  1OVN A;  4EDY A;  3RHC A;  2YCD A;  2PPT A;  2RUE A;  2IL3 A;  5AN1 A;  4TR1 A;  4V2M A;  3F9U A;  1HQO A;  1ZOF A;  5EPF A;  2PER A;  3HVV A;  1XWG A;  4FYB A;  1BJX A;  3ED3 A;  1V40 A;  4ZBD A;  1MTC A;  5EY6 A;  4L0W A;  4ICY A;  4ECB A;  2WZ9 A;  2CVB A;  4F82 A;  5D8I A;  1PRX A;  1PKZ A;  4OWY A;  4MLY A;  3ZMK A;  3HJP A;  4G0L A;  3EUR A;  2PUK C;  3VI7 A;  1TRS A;  2YAN A;  3M8N A;  1GUK A;  3KP9 A;  4K0N A;  5J4U A;  2EIQ A;  5J5N A;  2I3Y A;  5JCW A;  1W89 A;  5IMA A;  3LGC A;  5A5K A;  2JSZ A;  3IC8 A;  1KEB A;  1K0N A;  5KOX A;  2HSY A;  2V1M A;  3F4R A;  2FLS A;  4YKG A;  2H74 A;  1M9A A;  4POL A;  1SK1 A;  2GSS A;  1R7H A;  1V9W A;  2VCV A;  1TTZ A;  4NV5 A;  2GST A;  2OA7 A;  3C8E A;  4MJE A;  2FA4 A;  3M9J A;  1B9X C;  1T4Z A;  7GSS A;  3L78 A;  4H86 A;  5CRG A;  3KMN A;  2LUS A;  5G5E A;  1NW2 A;  5B8A A;  2DC5 A;  4K7I A;  2O8V B;  3FYG A;  3KXO A;  4O5R A;  4F2I A;  4JED A;  1K3O A;  3QOU A;  2O7K A;  5GAP D;  3WD6 A;  1TU8 A;  1ZYE A;  4WR4 A;  3WGD A;  2H73 A;  3VPT A;  4OFM A;  2OBK A;  4KDY A;  4K0G A;  1IW7 D;  1K0O A;  1N2A A;  5CO3 A;  2AYT A;  1EEM A;  1HD2 A;  5ID2 B;  1M99 A;  2VCX A;  4TKY A;  1XVW A;  1TW9 A;  3TRQ A;  1T00 A;  1GUL A;  2PGT A;  2B7J A;  2HRF A;  2LJA A;  2WGR A;  3SBC A;  5B7C A;  1AW9 A;  4FO5 A;  3GA4 A;  3VWU A;  3MWH A;  2TRC P;  1SK2 A;  2H76 A;  5H5R A;  2X8G A;  1X9W B;  4KF9 A;  3NZN A;  5J41 A;  1XWC A;  4L8E A;  3MIX A;  5ENU A;  4BA7 A;  2O89 A;  2H6X A;  5ECM B;  4TW5 A;  5CNW A;  1ZYP A;  8GSS A;  1XOA A;  3TKP A;  3KZQ A;  4XRA A;  2VD1 A;  1GWC A;  3CRU A;  3TUE A;  1JZO A;  2YP6 A;  2GGT A;  3Q18 A;  1YDK A;  2MMA A;  1EP8 A;  3EE2 A;  6GSY A;  2DLX A;  4EE0 A;  2L57 A;  3QPM A;  3BOA A;  1A23 A;  1GP1 A;  1I9D A;  3TJJ A;  1WWJ A;  1G0T A;  2WCI A;  4HEA 2;  2B6M A;  2YOI A;  3UVH A;  3L9U A;  3EIN A;  1I5G A;  3LYK A;  5FWG A;  3APQ A;  1ST9 A;  3HXS A;  2C8U A;  1VF2 A;  2VCW A;  4HZ2 A;  1WIK A;  2FY6 A;  2ON7 A;  2GDR A;  2D27 A;  5JWR B;  4ECI A;  1BQ7 A;  3ZFB A;  1Q4J A;  5DAK B;  4GWR A;  1PN0 A;  2GT5 A;  4WF4 A;  2CQ9 A;  1QGV A;  2H0I A;  5DDL A;  1TOF A;  1CQG A;  3ZLP A;  1XFL A;  3PR8 A;  3FW2 A;  1ZGN A;  4KE3 A;  3JCM L;  2H1G A;  3I6A A;  4K2D A;  1T1V A;  3UAP A;  1GUM A;  2B5Y A;  3DVX A;  3HCZ A;  1QFN A;  3KTL A;  2OJL A;  1GSF A;  5IMF A;  4K9Z A;  2H70 A;  2C1Y A;  1QXH A;  5F0G A;  5DJM A;  2GQM A;  5AIV A;  2VCT A;  2HXK A;  3LJR A;  3EYT A;  3FHK A;  5KOW A;  4FH8 A;  3VWX A;  2E7P A;  1MDJ A;  4KAE A;  2C0F A;  1M0U A;  1AQX A;  2AHE A;  1JLV A;  4IQA A;  2JZT A;  1OYJ A;  3GYK A;  16GS A;  1Z6M A;  3LW9 A;  1R26 A;  1FB6 A;  2XC2 A;  1EEJ A;  4K1F A;  2NPB A;  3WT1 A;  4EIQ A;  1TI1 A;  1Z9H A;  2ALB A;  2PN8 A;  4MF5 A;  4E8H A;  3G9B A;  1XW5 A;  2WB9 A;  4D73 A;  1FVK A;  2DKH A;  4IP6 A;  1BG5 A;  2AV4 A;  2D2Z A;  4O5Q A;  2HRK A;  5CRW A;  1GL8 A;  3F6F A;  4IGJ A;  1DE2 A;  2H71 A;  3GUS A;  3ISO A;  4XRD A;  1X5C A;  4G0K A;  4V1A g;  2C3Q A;  5JWO B;  1OE8 A;  2LST A;  5H5Q A;  4EXJ A;  1U87 A;  2XHF A;  3OR5 A;  3KCM A;  4DVC A;  4NAX A;  1WMJ A;  4DSS B;  1A8L A;  3IR4 A;  2FGX A;  1S3C A;  1UN2 A;  3DIE A;  3M9K A;  4MZC A;  5JWQ B;  3VLN A;  3GTU A;  3WYW A;  4ZB6 A;  3PPU A;  4GLT A;  2YJ7 A;  2DJ0 A;  1EGR A;  3IPZ A;  1EWX A;  2BJX A;  3QMX A;  1K3L A;  1WE0 A;  4XS1 A;  4K5R A;  4NHW A;  2IME A;  1HNA A;  1MD4 A;  3P7X A;  4G2E A;  3AY8 A;  2J23 A;  2FA8 A;  1LJR A;  3WGX A;  5ABR A;  2PVO C;  2V32 A;  4MK3 A;  2OE3 A;  4EO3 A;  5J9B A;  3TCO A;  2AAW A;  3FR3 A;  1QQ2 A;  5CAX A;  3IC4 A;  1VF1 A;  2X49 A;  2H19 A;  3GKN A;  1DE1 A;  5IPH A;  3ZTL A;  2KHP A;  4HUA A;  2C4J A;  2B5E A;  1VF4 A;  2DJ2 A;  2L5O A;  4E8E A;  3D4M A;  3MYD A;  3WT2 A;  3CMI A;  5A4V A;  3GTU B;  1ZZY A;  3TJK A;  13GS A;  4PX1 A;  2IFQ B;  1KNG A;  1Y6E A;  2B5X A;  5ECI B;  3G7I A;  1WP0 A;  5EL8 A;  1UA5 A;  4POM A;  1SL0 B;  4KND A;  18GS A;  1S3D A;  2N5F A;  3ERF A;  1XWK A;  1JZW A;  1TI3 A;  5IMC A;  3APS A;  2LQO A;  4KA0 A;  5KN2 A;  1JHB A;  1ZYN A;  1XWA A;  1GTU A;  4MP4 A;  5INY A;  1U88 A;  4KGI A;  2WRT A;  4JU5 A;  3HVX A;  2QA2 A;  3L0H A;  3TJF A;  1SKS B;  3KH7 A;  1M2D A;  2FUG 2;  2EIO A;  2F3M A;  1YZX A;  3Q19 A;  3LQ7 A;  1AXD A;  4LA1 A;  2OBI A;  4JRR A;  4PNF A;  2QKE A;  5DJL A;  2GVP A;  1Z7R A;  4WET A;  5HR3 A;  2LS5 A;  3VWV A;  4N0Z A;  3HJM A;  3HKR A;  3Q74 A;  3DRN A;  1M7T A;  2VIM A;  2MMZ A;  4WKW A;  4YQU A;  3ZRE A;  4AF2 A;  3IXR A;  1XW9 A;  5ECH B;  2YWM A;  2AJQ B;  1PX7 A;  3FKF A;  4GXZ A;  1XW6 A;  2DJ3 A;  3ME8 A;  3TJG A;  2A2S A;  1Z5Y E;  5IMD A;  4DEJ A;  1F6M C;  3UMA A;  2CVK A;  4PQI A;  2JZS A;  4PQH A;  3IHQ A;  2N5A A;  1TK0 B;  4LL1 B;  3VWW A;  3HZ4 A;  4JZQ A;  1ERU A;  2A4H A;  2R4V A;  3VI5 A;  1PL1 A;  3PIN A;  1AC1 A;  2M72 A;  3CBU A;  2B1L A;  2HSM A;  3QD9 A;  3KTB A;  4JR4 A;  3TOT A;  1B8X A;  4MJA A;  2HSH A;  4OFT A;  4RI7 A;  6GSW A;  4HS1 A;  1VRS D;  2GS3 A;  4XS4 A;  3A2V A;  5KEJ A;  1TP9 A;  5JCU A;  1GRX A;  2P5R A;  4TR3 A;  1FOH A;  4ACS A;  1ILO A;  5DAL A;  5C00 A;  1HYU A;  3I9V 2;  3DWV A;  4N30 A;  3A2W A;  2YJH A;  4MH3 A;  4BPY A;  1TK5 B;  3H4K A;  2H0H A;  5GZZ B;  3IK9 A;  2JSY A;  2ZUP A;  3IV4 A;  1U3I A;  5HR2 A;  3J7Y b;  1BED A;  3UIW A;  5F05 A;  5F06 A;  2DSA A;  1OKD A;  2LEG A;  2HRA A;  1A2J A;  3A2X A;  5B6M A;  4TR1 B;  3P2A A;  2IPA A;  4ZL7 A;  5DAL B;  1T8E B;  1NHO A;  3D4T A;  2E0Q A;  1QK8 A;  1PN9 A;  3SWL A;  4CY8 A;  3O6T A;  5B8B A;  3CYN A;  1XBS A;  4IQ1 A;  3KEB A;  1O8X A;  2LQQ A;  4G0I A;  2KP2 A;  3N5O A;  3D5J A;  4ISD A;  2JU5 A;  1VF3 A;  5IMV A;  4KX4 A;  2VAF A;  1K0B A;  3BD2 A;  3KM6 A;  1T3B A;  3IK7 A;  1DUG A;  4MCU A;  2FD3 A;  3F6D A;  5IO2 A;  2NBS A;  3APO A;  3EU4 A;  2MMO A;  2JAC A;  4RUV A;  3UVT A;  1V57 A;  3MSZ A;  3HJO A;  5F07 A;  4MMM A;  3GSS A;  2VL3 A;  2BTO T;  3CSJ A;  5DCG A;  2DJK A;  3EC3 A;  1EZK A;  2N5B A;  1ERT A;  2YWI A;  1SD8 A;  2IIY A;  2HYX A;  3RAZ A;  2WUL A;  1RK4 A;  1WPI A;  2P31 A;  3KP8 A;  4X43 A;  1IYI A;  3E9J B;  4TXO A;  4PXO A;  1WJK A;  1ACV A;  4CDO A;  3ZZX A;  4I5Q A;  3UL3 A;  1TRU A;  3IA1 A;  1A2L A;  1KBN A;  3LFL A;  4ZL8 A;  4A5P A;  5G31 A;  3QFB C;  2VD0 A;  3GST A;  2GT6 A;  1ERV A;  4NPB A;  3C7M A;  2PMT A;  4KDX A;  1F9M A;  4GQF A;  1V58 A;  2MYG A;  2HE3 A;  3IAS 2;  1EOG A;  5G2Z A;  4V2N A;  3HZ8 A;  2YPM A;  3M1G A;  4AGS A;  2LRT A;  12GS A;  1NSW A;  1ZYQ B;  1M9B A;  1G6Y A;  5DCH A;  4X1U A;  2K8S A;  2H75 A;  1X5D A;  4TXO B;  5ECN B;  2J9H A;  5FHI A;  2LKU A;  4PQ1 A;  4CHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...