3F4RA

Crystal structure of wolbachia pipientis alpha-dsba1
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
199
structure length
199
Chain Sequence
TSNELLLPLPNDKLLGDPKAPILMIEYASLTCYHCSLFHRNVFPKIKEKYIDTGKMLYIFRHFPLDYRGLKAAMLSHCYEKQEDYFNFNKAVFNSIDSWNYYNLSDLTLLQRIAALSNLKQDAFNQCINDKKIMDKIVNDKSLAINKLGITATPIFFIKLNDDKSYIEHNKVKHGGYKELKYFTNVIDKLYGKAIVKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structural and Functional Characterization of the Oxidoreductase alpha-DsbA1 from Wolbachia pipientis
pubmed doi rcsb
source organism Wolbachia pipientis
molecule tags Oxidoreductase
total genus 76
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2008-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.80 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Ribonucleotide Reductase Protein R1; domain 1 3f4rA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3f4rA01
3TRQA 1XW9A 2JSZA 3KH7A 3Q6OA 3D6IA 1HNAA 4BL7A 2JL4A 2HRNA 4FIWA 4L0UA 2I9HA 2Z9SA 2DMLA 5ENUA 2H75A 4WBJA 1ST9A 4KDUA 3TKPA 3TKQA 3VI7A 4RQXA 1B9YC 2VM1A 3BOAA 4O5RA 3LSZA 2MZCA 3J7Yb 2E2MA 3FRCA 3APQA 1R5PA 2YJHA 4KGIA 3F3QA 1XVQA 2R2JA 3DEXA 5G30A 2QKEA 1GUKA 1ILOA 4I6XA 2FCHA 4TR1B 2B7JA 2JSYA 1S3CA 3RAZA 5IOXA 1XW6A 3IC4A 3TJBA 1FVKA 3I69A 1YF0A 1EOHA 4WKWA 4IP1A 1O8XA 1M2BA 6GSWA 3GN3A 4KCEA 1TRWA 4FYCA 1PA3A 1UC7A 4EUYA 3Q19A 4N0ZA 12GSA 3RPNA 1TTZA 3E9JB 1Z7RA 2QGVA 5B8BA 4ZL7A 3TKSE 1ABAA 3CYNA 1BX9A 4KX4A 3UEMA 5CP1A 4MP4A 2VL2A 3HVVA 5A4WA 1QUWA 3CTGA 5D96A 3D0ZA 3DKSA 3GSSA 4JEDA 1DUGA 1GTIA 5ELGA 2X64A 3DD3A 5AN1A 3F9UA 4L5LA 1S3DA 2F51A 2JACA 3GH9A 1ZMAA 2P31A 1GSQA 5IO2A 3A2WA 3M0FA 3D4TA 2J9HA 2D2ZA 4TRXA 1XCCA 1XWBA 2ZNMA 5HR2A 3KTLA 4ECIA 4HJMA 7GSSA 3TJKA 4MZWA 2CV4A 4OCEA 2EIQA 2YPMA 1SJ6A 3GX8A 1CQGA 1M2DA 1H4OA 2H0HA 3K8NA 2FWHA 1UN2A 1O85A 3ZFLA 2YWIA 3QFAC 5HR3A 5D9XA 3ZITA 4YQVA 3IHQA 1PL1A 3F6DA 1K3LA 3ZIVA 4K2DA 3G7IA 5ECPB 3CRTA 3KM6A 1TKDB 2VCQA 3D5JA 5ECNB 1GUMA 4ID0A 2EIRA 6GSUA 2WULA 4TR0A 2N5FA 4LLRA 6GSTA 3F4SA 5DALB 2I81A 4ZB9A 2L5LA 3HDCA 1XPVA 2VLVA 2F8FA 1SKWB 1SK2A 5J4UA 6GSSA 4Q5QA 1EEMA 4OWYA 3EVIA 2X8CA 5ECIB 18GSA 2VOCA 3GH6A 4KSMA 1VF3A 2MMNA 3HJMA 2RM6A 2X99A 5EY6A 2AV4A 4G9HA 3L9VA 5ECMB 2B3SA 1Z7PA 2V2GA 1MDJA 5B6NA 4XS4B 1XIYA 1XWAA 5AGYA 4KUNA 1SKSB 1YJ6A 2R3XA 1JLVA 1G0TA 3TOTA 4YAPA 1AUCA 1WE0A 4G2EA 1K3OA 2HRFA 5EL8A 1R26A 1ZYEA 3EC3A 4ZL8A 2AB6A 1AXDA 4IJ3A 5IPHA 2XPEA 1DE1A 2GQLA 1WP0A 4GSSA 2AJQB 3G7YA 2O85A 2C0GA 3FR9A 3BD2A 3C8EA 2FWEA 1FB0A 6GSXA 2PPTA 2DJJA 2HZEA 2DIYA 2YZUA 2FWGA 2IFQB 3GTUA 1R7HA 1T00A 2LNSA 4OFNA 5IQYA 3NIVA 4NXIA 1J9BA 1TI1A 1EV9A 4WR4A 2H1GA 1JFUA 4NHWA 3ERWA 1JZRA 2B1LA 1MDKA 2H1DA 1NW2A 4EDYA 3KEBA 2KLXA 4ULXA 4XIHA 1YY7A 9GSSA 4MH2A 3A5WA 3DIEA 4ZIJA 3MSZA 1YKAA 4KCAA 3VWXA 4N0VA 2FHEA 2ES7A 2MBTA 1GUHA 4K6XA 4TXOB 2VO4A 1K0DA 3ERFA 5DAKA 1AW9A 1GRXA 1M7TA 1JLWA 2GSTA 2LNTA 2GZZA 2LQOA 1TXXA 4KSOA 3W8SA 1Q98A 4I2UA 4MJCA 3HVXA 3CTFA 1KTEA 1OKTA 3GKMA 5JCWA 4MF6A 4TN8A 2PUKC 3IBHA 4ZB6A 3US3A 4K7OA 3TDGA 3IA1A 4AJ6A 2IL3A 3GNJA 5B7CA 5A5KA 4K7NA 4MDCA 3TRPA 1GNWA 5CNWA 1SD8A 3SWLA 1WWJA 3UVTA 2EC4A 4J57E 3WGDA 4D73A 1GULA 3EYTA 5FHIA 3FK8A 5A4VA 3HJPA 1A23A 4PX1A 2J23A 2DLXA 2GZYA 4NMUA 4J56E 1K0MA 2LV3A 1EGOA 2RLIA 2X8HA 4MLYA 3PINA 1SJZA 1MEKA 4MZBA 1Z6NA 2IIYA 3F6FA 1AAZA 4H86A 1M9BA 5EVOA 3IV4A 4XHMA 3TJJA 1F9MA 4F0CA 1KBNA 3A2XA 2HI7A 2PMTA 4X43A 10GSA 1ZCPA 1SL0B 4DSRA 4TVEA 3L78A 2F9SA 3GKKA 1OC9B 4OFMA 3S9FA 4PURA 3H79A 2ZUPA 3WT2A 1V9WA 1K0CA 1FHEA 20GSA 3VURA 1KEBA 3DVXA 5IMVA 1UA5A 1EZKA 2VCVA 2C0EA 4LL1B 2IMKA 3OR5A 5IMZA 2OACA 3FZ5A 3ZIJA 4MPGA 4NV5A 2TIRA 4V1Ag 2FGXA 5JCGA 3QFBC 1JZWA 3GURA 3TKRA 1U6TA 5G2ZA 4Q5RA 3ZZXA 1CQHA 1TRSA 5JCUA 3LORA 4BA7A 3UBLA 3C1SA 1R5AA 3M1GA 2GS3A 1GSYA 1URMA 4RUVA 2DJKA 1N2AA 4WEYA 2TRXA 3FR3A 5H5RA 5CRGA 1XWGA 5F8BA 3KP8A 5IMAA 1M99A 3EWLA 2K9FA 1WMJA 1SK0A 4JE1A 1AIUA 2TRCP 1Y6EA 2AAWA 3GSTA 2M80A 3IDVA 4N10A 3ZRDA 4HU9A 4ML6A 3VI5A 2IJYA 2RIIA 4E8EA 3QOUA 2MYGA 2ZCTA 14GSA 2FUG2 2PVOC 2GQMA 4GRFA 2HSYA 1U3AA 1W89A 1TU8A 2QSIA 4F2IA 4N30A 1K0BA 2B1KA 1Q4JA 1EEJA 4Z7XA 1GLQA 1ZZYA 4EKZA 2A2SA 1SL1B 2H30A 1TOFA 1TK5B 1GH2A 5HR1A 3RDWA 1XBSA 4TKYA 2H73A 4HZ4A 1NHYA 5ID2B 1G6WA 3KP9A 2L4QA 3GKXA 4NHZA 2LJKA 4V2NA 2LQQA 1PD21 2R37A 2RUEA 2E7PA 3PH9A 3O3TA 3Q74A 1FB6A 3BBYA 3PR8A 1OKDA 3CSJA 4KDYA 1XW5A 1QQ2A 3CSIA 4BWQA 3FW2A 1FW1A 3DWVA 5LNKe 1JHBA 2LUSA 1A24A 2LJRA 4RI7A 1WIKA 4HS1A 3A2VA 2DJ2A 4TR3A 4MH3A 2ON5A 4HDEA 2DBCA 1EGRA 1OE7A 1TP9A 4MJEA 5DBQA 4FO5A 4K0NA 2PN8A 2GSQA 2AUVA 3G7JA 3I9V2 4GSTA 1BEDA 2M72A 4L5OA 5DALA 3ZREA 2H74A 3TRXA 2PERA 3LXTA 5G1KA 1XWCA 3EMPA 1TJDA 3F63A 2FD3A 1PSQA 5F07A 2GGTA 2LTKA 3ZVJA 5DJLA 2OKAA 4O7HA 2CQ9A 1ZGNA 4ZBBA 4IJIA 4MK3A 5J41A 4L8EA 5CAXA 1EP8A 5DCHA 2HLSA 4DSQA 4YH2A 2DJ3A 2H6ZA 2FLSA 1WOUA 3HA9A 3GKNA 3LYKA 1IYHA 4XS4A 1KNGA 4I97A 4GF0A 2A2RA 2YJ7A 1YQ1A 4HQZA 1MD3A 2P0GA 2VCXA 3VPQA 3U5RE 1F2EA 1T4ZA 2OBKA 4MPFA 3L0HA 1W4VA 3M9JA 4MABA 3PGTA 2L57A 3ME8A 3NOFA 4POKA 3IPZA 3TCOA 1FG4A 3FY7A 2IN3A 5FWGA 3L9UA 1ON4A 2GQKA 1X9WB 4HZ2A 4OD7A 2H72A 1A8YA 5IPGA 5GSSA 3QCPA 4EVMA 3MDKA 3QPMA 4HU7A 5KN1A 4EL1A 2O89A 5DJMA 4ECCA 2B5XA 3UVHA 2B5EA 1F3BA 2IMFA 2GSSA 4L0WA 5D9WA 3DGQA 4XS6A 4JRRA 1J0FA 3HKRA 4HUAA 2DMMA 2HFDA 3EMXA 3LXZA 1T4YA 1PKZA 2CX4A 4KA0A 2FA8A 4ZB8A 2ON7A 2O87A 4XS1A 1QXHA 4TXOA 4CHSA 3GUSA 5ECSA 4I5QA 1QFNA 17GSA 5INYA 5AISA 4KNDA 4P3YB 3LQ7A 3FYGA 3P8WA 5CRHA 2K6VA 5L71A 2HZFA 1AQVA 2O8VB 2RUFA 3TJGA 2GSRA 5HR0A 4FH8A 5GAPD 5D9TA 3L9SA 2VL3A 2H66A 3MWHA 4MJBA 4WF5A 3O6TA 5LCZA 4PQIA 5CRDA 1X5CA 2F8AA 1GSFA 3RPPA 3RHCA 16GSA 3GYKA 1SJIA 3E0UA 1XWKA 4GSNA 5COHA 5AIVA 2L59A 4ML1A 2H70A 2JZSA 3UL3A 3KTBA 1PKWA 1QMVA 2OJLA 3IOSA 1GSUA 2BTOT 2NVLA 4HI7A 1IYIA 1S3AA 4WF4A 1HYUA 1PN9A 2JADA 3GFKA 3GMFA 1O73A 4Q5NA 2GDRA 5G1LA 5D73A 2XC2A 1I9DA 3KIJA 4IVFA 2L5OA 2LS5A 1OC9A 2HE3A 4XCSA 5IM9A 1GLPA 2O7KA 1SL2B 2C80A 4F03A 5HFGA 2I1UA 2DC5A 1THXA 3RBTA 2H0IA 2H1BA 3H93A 2AYTA 5E59A 3WYWA 2XBIA 5G31A 1TW9A 3L4NA 4XRDA 1RK4A 1GTUA 4V2LA 5E4WA 2FNOA 1A2MA 3HD5A 2GT6A 1GL8A 4NWYA 4PNGA 4PUFC 3ZLPA 1X0RA 1XZOA 1O8WA 4J2FA 1HQOA 2KP2A 5KN2A 1GNEA 4DSSB 3HJOA 5IOWA 2BMXA 4IN0A 2HXKA 4EO3A 2C3QA 4ILFA 2YP6A 5HFKA 3ZL5A 3APOA 4K8MA 4IKHA 2WS2A 2R4VA 2H6XA 3VWWA 1HNCA 4MCUA 1QK8A 3I6AA 1BJXA 2CAQA 1BYEA 4MZCA 3IRAA 2CT6A 1OVNA 2E0QA 3GTUB 1WPIA 4HOJA 4X0XA 1GP1A 3H4KA 5DCGA 1ZL9A 5CREA 4I2TA 3UARA 5F06A 4HQSA 5GAND 5ID2A 1ERVA 2YNXA 2OE3A 4KB3A 1PX7A 5LD0A 1WRYA 1SYXA 3W6GA 2R6KA 2JZRA 3H8QA 1TK8B 2H8LA 2IMDA 4MMMA 1H75A 4POMA 2C0FA 3GX0A 1GTAA 1A2JA 1PMTA 3EE2A 4OFTA 4TR1A 2KOKA 4MJAA 2CVBA 3TUEA 4XTSA 2VD1A 4TOPA 4ZBAA 5DAKB 2OA7A 4LL4B 1A2LA 1ML6A 3UBKA 3ZYWA 1MDIA 4O92A 1B48A 2VAFA 1XXUA 1X5DA 4OMVA 1XVWA 3F3RA 3ED3A 3LEFA 1PL2A 1YDKA 2VD0A 2VLUA 3HZ4A 2NBSA 1M9AA 4K7IA 2OE0A 1V98A 3IAS2 2WZ9A 3UOMA 5IMDA 1JZOA 1V57A 3CMIA 1MD4A 3GA4A 1ERUA 3FEUA 1U87A 3DRNA 3D22A 3VWVA 3QAWA 2YANA 1B4PA 3JCML 1TI3A 4YQMA 2RM5A 4D73B 1A8LA 4GTUA 6GSYA 5CRWA 1E2YA 1G6YA 3GV1A 5DVBA 2IWTA 1U3IA 2IMEA 5G5FA 5H5SA 1DE2A 5HQPA 3M9KA 2B7KA 1SYRA 1TK0B 5GSTA 4JZQA 5IMFA 1THOA 1AQXA 5DDLA 2HSHA 2NDOA 4JR6A 4ACSA 5ECHB 4QL7A 13GSA 4WETA 5J9CA 4EE0A 3EU4A 3J7Yk 4QL9A 3WT1A 1Z5YE 4V2MA 2KP1A 4HEA2 1B4QA 4PQ1A 3EU3A 1HNBA 4POBA 5DQSA 2CVDA 4AJ8A 1GWCA 4K1FA 3F8UA 5EPFA 4DVCA 2YZHA 2V32A 1PGTA 4CW9A 2DJ0A 2DJ1A 2WRTA 1O7UA 5FT3A 1VF1A 4LMVA 1Z9HA 2CZ2A 2P5QA 4BPYA 3HY2A 3ZTLA 2QC7A 4F82A 3P7XA 2YCDA 4GCIA 4WBRD 2N5AA 2K8VA 2MBSA 3HCZA 3KMNA 5H5QA 1EP7A 1SENA 3C7MA 3I43A 1YZXA 2H0GA 3LWAA 1K0NA 3ME7A 2CAIA 5KN3A 2MMAA 1NSWA 2L4CA 3IR4A 1SKRB 1ZOFA 2L6DA 2H19A 2OE1A 1Y25A 2V41A 4F0BA 5D93A 1I5GA 1K3YA 3LFLA 1T7PB 2LRNA 4DEJA 3LG6A 3MNGA 1K0AA 4GQCA 2V6KA 3VFIA 4OO4A 2VIMA 4PUAA 4PNFA 3SBCA 3H1NA 2MMOA 4PXOA 5AIXA 1MTCA 5F0GA 3UJ1A 3IAM2 2LEGA 5C00A 2X8GA 3QAVA 4EF0A 2XBQA 4IP6A 1FAAA 4KE3A 5ECRB 3F4TA 4LMWA 2VCWA 4WR5A 2H1AA 1K0OA 4Q5FA 1OC8A 1YEPA 3VPTA 4ECBA 4RQRA 3C71A 1VF2A 3LJRA 3KJYA 4I8BA 3TB2A 3HYPA 4KW6A 1LBKA 4TR4A 3CSHA 1NM3A 1NHOA 1ZYQB 1G7EA 4NV2A 1SU9A 1GSSA 5ECKB 4OCFA 4RI6A 3HHVA 1C72A 4GXZA 3P2AA 3UAPA 3A3TA 2YWOA 1PQNA 4CDOA 5ECLB 2IFQA 2EIOA 5JWRB 4ZBDA 1Z3EA 1OC3A 4POLA 1PX6A 1X9SB 3U6VA 4QQ7A 2GT5A 1O81A 4IW9A 4XRAA 1RW1A 1AQWA 3NZNA 3TKSA 2L6CA 1A0RP 5IMCA 2V6OA 3QR6A 3F0IA 5ECOB 3GRXA 4EXJA 4GWRA 1YEXA 4ISDA 2YWNA 2I4AA 1HD2A 4TW5A 2WDUA 2YOIA 3IK7A 1ERWA 4IQAA 2WGRA 2YV7A 5D9VA 5ELAA 4KH7A 3EURA 4EC0A 1TRVA 3IXRA 1RQMA 5F05A 1T3BA 3Q18A 1QGVA 2KHPA 3W8JA 5B8AA 1LU4A 2YN1A 1FVJA 4O32A 2B6MA 4KDXA 2C1YA 3FZ9A 2PWJA 3N5OA 4TXVA 4BWSA 4PGTA 2V1MA 3FKFA 5D8IA 4E8HA 5HFIA 3KCMA 5IIZA 3F4RA 2I3YA 4G19A 1SD9A 3E3EA 2BJXA 2FY6A 1GSDA 1PRXA 3DXBA 4DSSA 1BG5A 5G5EA 4FYUA 2DSAA 3DYRA 3D21A 3KGKA 1FO5A 2JZTA 3GL5A 1XFLA 1R4WA 2REMA 5ABRA 2GZPA 1X9MB 2IMIA 3FR6A 2WCIA 1EOGA 3LGCA 4NAXA 4IHUA 3LYPA 4ZXGA 3VLNA 2JU5A 6GSVA 4PQHA 2VCZA 19GSA 5IO0A 5KEJA 5KN0A 2PGTA 1UVZA 1F6MC 3QMXA 5J5NA 3GHAA 4BVXA 3CXGA 4K0GA 5GZZB 2PU9C 3TJFA 1EWXA 2C4JA 2K18A 4IGJA 2YV9A 3KD0A 2MMZA 1T8EB 3BJ5A 3CRUA 4LA1A 3HZ8A 2VL9A 2LRTA 1XOAA 2N5BA 3WGEA 3EINA 1ACVA 2G0FA 3C73A 1DSBA 1U88A 3RHBA 5CYYA 1BQ7A 4WXTA 2M46A 4G10A 5JWOB 4JBBA 3QDNA 1F3AA 1V40A 1OE8A 2WFCA 3KZQA 4K9ZA 1TDIA 1DBYA 2PBJA 1T1VA 3ZVJD 2ALBA 1X5EA 4MF7A 3G9BA 2VUPA 4MF5A 4AGSA 1GSEA 2C8UA 2CX3A 4F9ZA 3N9JA 2VM2A 1USBA 3IE3A 3APSA 5ECQB 1O6JA 1B9XC 3TGZA 4BVYA 4YAVA 2H01A 4IBPA 1YF1A 1F37A 2LRCA 4EDZA 1B8XA 4GQFA 1GTBA 3R2QA 1VRSD 2A4VA 1FOVA 4JU5A 1OYJA 2CZ3A 1G7OA 4GLTA 3FZ4A 2KUCA 3FZAA 2HZEB 2G2QA 3FHKA 4IS0A 2DIZA 1V58A 2K8SA 3O76A 2H6YA 5C04A 3ZFBA 3TOUA 3MAKA 2CVKA 3IK9A 3VK9A 1VGLA 3HXSA 3C1RA 5J9BA 3UMAA 3AY8A 2HT9A 4MA9A 3UIWA 3HVSA 2LKUA 2WJUA 2B5YA 5CO3A 4AF2A 1BAYA 3P90A 3QAGA 2VLTA 2NPBA 2VL2C 1VF4A 4V1Ap 5DQYA 3WD6A 3ERGA 1Z6MA 1TU7A 3ZMLA 4YQUA 1LJRA 2GLRA 1N8JA 3DMLA 2HNLA 2R5GA 2FWFA 3ISOA 3CBUA 3V1WA 2HYXA 1JZDA 1M0UA 3VWUA 1J08A 3GIXA 4AJ7A 5J3RA 4IELA 4HJ2A 1YKCA 3WGXA 1A0FA 4KAEA 3ZMKA 2YWMA 4NPBA 4FYBA 1OAZA 1WJKA 2C3TA 3D4MA 2PVQA 3KXOA 1ERTA 1TRUA 5B6MA 1EV4A 2XPDA 2P5RA 1SK1A 3BCIA 2H76A 2F3MA 4JR4A 3M8NA 3DVWA 2GTUA 2OADA 2FA4A 2GVPA 3M3MA 1V2AA 8GSSA 4IQ1A 2LJAA 3BCKA 2OBIA 5JWQB 2AHEA 4ECJA 2C0DA 2IPAA 11GSA 3KMOA 4ZL9A 2H71A 2LSTA 4N11A 2NTOA 5A4UA 3TKSC 3GL3A 1AC1A 4OO5A 3KH9A 2CA8A 1XOBA 2WB9A 2XHFA 1M2AA 2C3NA 4X1UA 4ZILA 1E6BA 22GSA 3QD9A 2E2GA 2VCTA
chains in the Genus database with same CATH superfamily
3TRQA 1XW9A 2JSZA 3KH7A 3Q6OA 3D6IA 1HNAA 4BL7A 2JL4A 2HRNA 4FIWA 4L0UA 2I9HA 2Z9SA 2DMLA 5ENUA 2H75A 4WBJA 1ST9A 4KDUA 3TKPA 3TKQA 3VI7A 4RQXA 1B9YC 2VM1A 3BOAA 4O5RA 3LSZA 2MZCA 3J7Yb 2E2MA 3FRCA 3APQA 1R5PA 2YJHA 4KGIA 1TJVA 1XVQA 3F3QA 2R2JA 2JAUA 3DEXA 5G30A 2QKEA 1GUKA 1FUOA 1ILOA 4I6XA 2FCHA 4TR1B 2B7JA 2JSYA 4HGVA 1S3CA 3RAZA 5IOXA 1XW6A 3IC4A 3TJBA 1FVKA 3I69A 1YF0A 1EOHA 4WKWA 4IP1A 1O8XA 1M2BA 6GSWA 3GN3A 4KCEA 1TRWA 4FYCA 1PA3A 1UC7A 4EUYA 3U19A 3Q19A 4N0ZA 12GSA 3RPNA 1TTZA 3E9JB 2HSMA 1Z7RA 2QGVA 5B8BA 4ZL7A 3TKSE 1ABAA 3CYNA 1BX9A 4KX4A 3UEMA 5CP1A 4MP4A 2VL2A 3HVVA 5A4WA 1QUWA 3CTGA 4JEDA 3D0ZA 3DKSA 3GSSA 5D96A 1DUGA 1GTIA 5ELGA 2X64A 3DD3A 5AN1A 3F9UA 4Z2UA 4L5LA 2PFMA 1S3DA 2F51A 2JACA 3GH9A 1ZMAA 2P31A 2QA1A 1HY0A 1GSQA 5IO2A 3A2WA 3M0FA 4MNNA 3D4TA 2J9HA 2D2ZA 4TRXA 1XCCA 1XWBA 2ZNMA 5HR2A 3KTLA 4ECIA 4HJMA 7GSSA 3TJKA 1Z4KA 1PFOA 4MZWA 2CV4A 4OCEA 2EIQA 2YPMA 1SJ6A 3GX8A 1CQGA 1M2DA 1H4OA 2H0HA 3K8NA 2FWHA 1UN2A 1O85A 3ZFLA 2YWIA 3QFAC 5HR3A 5D9XA 3ZITA 4YQVA 3IHQA 1PL1A 3F6DA 1K3LA 3ZIVA 4K2DA 3G7IA 5ECPB 3CRTA 3KM6A 4X4JA 1TKDB 2VCQA 3D5JA 5ECNB 1GUMA 4ID0A 2EIRA 6GSUA 2WULA 4TR0A 2N5FA 3R6VA 4LLRA 6GSTA 3F4SA 5DALB 2I81A 4ZB9A 3TV2A 2L5LA 3HDCA 4K2XA 1XPVA 2VLVA 2F8FA 1SKWB 1SK2A 5J4UA 6GSSA 4Q5QA 1EEMA 4OWYA 3EVIA 2X8CA 5ECIB 18GSA 2VOCA 3GH6A 1FURA 4KSMA 1VF3A 5BRTA 1TJWA 2MMNA 3HJMA 1YFMA 2RM6A 2X99A 5EY6A 3CQFA 2AV4A 4G9HA 4O5QA 4FQUA 3L9VA 5ECMB 2B3SA 1Z7PA 2V2GA 1MDJA 5B6NA 4XS4B 1XIYA 1XWAA 3BHGA 5AGYA 4KUNA 1SKSB 1YJ6A 2R3XA 1JLVA 1G0TA 3TOTA 4YAPA 1AUCA 1WE0A 4G2EA 1K3OA 2HRFA 5EL8A 1R26A 1ZYEA 3EC3A 4ZL8A 2AB6A 1AXDA 4IJ3A 5IPHA 2XPEA 1DE1A 2GQLA 1WP0A 4GSSA 2AJQB 3G7YA 4PTSA 2O85A 2C0GA 3FR9A 3BD2A 2RCNA 3C8EA 2FWEA 1FB0A 6GSXA 4O5UA 2PPTA 2DJJA 2HZEA 2DIYA 2YZUA 1TJUA 2FWGA 2IFQB 3GTUA 1R7HA 1T00A 4A5PA 2LNSA 4OFNA 5IQYA 3NIVA 4NXIA 1J9BA 1TI1A 1EV9A 4WR4A 2H1GA 1JFUA 4NHWA 3ERWA 3CI0K 1JZRA 2B1LA 1MDKA 2H1DA 1NW2A 4EDYA 3KEBA 2KLXA 4ULXA 4XIHA 1YY7A 9GSSA 4MH2A 3A5WA 3DIEA 2JAOA 4ZIJA 3MSZA 1KQ7A 1YKAA 4KCAA 3VWXA 4N0VA 2FHEA 2ES7A 2MBTA 1GUHA 4K6XA 4TXOB 2VO4A 1K0DA 3ERFA 5DAKA 1K62A 3LW9A 1AW9A 1GRXA 1M7TA 4USSA 1JLWA 2GSTA 2LNTA 4NSLA 2GZZA 2LQOA 1TXXA 4KSOA 3W8SA 1Q98A 4I2UA 4MJCA 3HVXA 3CTFA 1KTEA 1OKTA 3GKMA 5BMUA 5JCWA 4MF6A 4TN8A 2PUKC 3IBHA 4ZB6A 3US3A 4K7OA 3TDGA 3IA1A 4AJ6A 2IL3A 3GNJA 5B7CA 5A5KA 4K7NA 4MDCA 3TRPA 1GNWA 5CNWA 1SD8A 3SWLA 1WWJA 3UVTA 2PTRA 2EC4A 4J57E 3WGDA 4D73A 1GULA 2DKIA 3EYTA 5FHIA 3FK8A 5A4VA 3HJPA 1A23A 4PX1A 2J23A 2DLXA 4IQJM 2GZYA 4NMUA 4J56E 1K0MA 2LV3A 1EGOA 2RLIA 2X8HA 4MLYA 3PINA 1SJZA 1MEKA 4MZBA 1Z6NA 2IIYA 3F6FA 1AAZA 4H86A 1M9BA 5EVOA 2R0GA 3IV4A 4XHMA 3TJJA 1F9MA 4F0CA 1KBNA 3A2XA 2HI7A 2PMTA 4X43A 10GSA 1ZCPA 1SL0B 4DSRA 4TVEA 3L78A 4BVXB 2F9SA 3GKKA 1OC9B 4OFMA 3S9FA 3OCFA 4PURA 4ADLA 3H79A 2ZUPA 3WT2A 1V9WA 1K0CA 1FHEA 20GSA 3VURA 1KEBA 1TJ7A 3DVXA 5IMVA 4Z2TA 1UA5A 1EZKA 2VCVA 2C0EA 4LL1B 2IMKA 3OR5A 5IMZA 2OACA 3FZ5A 3ZIJA 4MPGA 4NV5A 2TIRA 4V1Ag 2FGXA 4BIKA 4EFCA 5JCGA 3QFBC 1JZWA 4L57A 3GURA 2X4AA 1VDKA 3TKRA 1U6TA 5G2ZA 4Q5RA 3ZZXA 1CQHA 1TRSA 5JCUA 3LORA 4BA7A 3UBLA 3C1SA 1R5AA 3M1GA 2GS3A 1GSYA 1URMA 4RUVA 2DJKA 4YKFA 1N2AA 4WEYA 2TRXA 1ZYPA 3FR3A 5H5RA 5CRGA 1XWGA 5F8BA 1C3CA 3KP8A 5IMAA 1IW7D 1M99A 3EWLA 2K9FA 1WMJA 1SK0A 4JE1A 1AIUA 2TRCP 1Y6EA 4G0IA 2AAWA 3GSTA 2M80A 3IDVA 4N10A 3ZRDA 4HU9A 4ML6A 3VI5A 2IJYA 2RIIA 4E8EA 3QOUA 2MYGA 2ZCTA 14GSA 2FUG2 2PVOC 2GQMA 4GRFA 2HSYA 1U3AA 1W89A 1TU8A 2QSIA 4F2IA 4N30A 1K0BA 2B1KA 1Q4JA 1EEJA 2D27A 4Z7XA 1GLQA 1ZZYA 4EKZA 2A2SA 1SL1B 2H30A 1TOFA 1TK5B 1GH2A 5HR1A 3RDWA 1XBSA 4TKYA 2H73A 4HZ4A 1NHYA 5ID2B 1Z4LA 1G6WA 3KP9A 2L4QA 3GKXA 4NHZA 2R0CA 2LJKA 4V2NA 4KF9A 2LQQA 1PD21 2R37A 2RUEA 2E7PA 3PH9A 3O3TA 3Q74A 1FB6A 3BBYA 3PR8A 1OKDA 3CSJA 4KDYA 1XW5A 1QQ2A 3CSIA 4BWQA 3FW2A 1FW1A 3DWVA 5LNKe 1JHBA 2LUSA 1A24A 2LJRA 4RI7A 1WIKA 4HS1A 3A2VA 2DJ2A 4TR3A 4MH3A 2ON5A 4HDEA 2DBCA 1EGRA 3OCEA 1OE7A 1TP9A 4MJEA 1PN0A 1FUPA 5DBQA 4FO5A 4K0NA 2PN8A 2GSQA 2AUVA 3G7JA 3I9V2 4GSTA 1Q91A 1BEDA 2M72A 4L5OA 5DALA 3ZREA 4G0LA 2H74A 3TRXA 2PERA 3LXTA 5G1KA 1XWCA 3EMPA 1TJDA 3F63A 2FD3A 1PSQA 5F07A 2GGTA 2LTKA 3ZVJA 5DJLA 2OKAA 4O7HA 2CQ9A 1ZGNA 1M3JA 4ZBBA 4IJIA 4MK3A 5J41A 4L8EA 5CAXA 1EP8A 5DCHA 2HLSA 1JSWA 4CY6A 4DSQA 3MYDA 4YH2A 2DJ3A 2H6ZA 3U13A 2FLSA 1WOUA 3HA9A 3GKNA 3LYKA 1IYHA 4XS4A 1KNGA 4I97A 4GF0A 2A2RA 2YJ7A 1YQ1A 4HQZA 1MD3A 2P0GA 2VCXA 3VPQA 3U5RE 1F2EA 1T4ZA 2OBKA 4MPFA 3L0HA 1W4VA 3M9JA 4MABA 3PGTA 2L57A 3ME8A 3NOFA 4POKA 3BWVA 3IPZA 3TCOA 1FG4A 3FY7A 2IN3A 5FWGA 3L9UA 1ON4A 2FUSA 2GQKA 1X9WB 4HZ2A 4OD7A 2H72A 1A8YA 5IPGA 5GSSA 3QCPA 4EVMA 3MDKA 3QPMA 4HU7A 5KN1A 4EL1A 4EEIA 2O89A 5DJMA 4ECCA 2B5XA 3UVHA 2B5EA 4Z2RA 1F3BA 2IMFA 2GSSA 4L0WA 5D9WA 3DGQA 4XS6A 4JRRA 1J0FA 3HKRA 4HUAA 2DMMA 2HFDA 3EMXA 3LXZA 1T4YA 3EPTA 1PKZA 2CX4A 4KA0A 2FA8A 2X75A 4ZB8A 2ON7A 2O87A 3FMWA 4XS1A 1MH9A 1QXHA 4TXOA 1Z4MA 4CHSA 3C8TA 3GUSA 5ECSA 4I5QA 1QFNA 5D6BA 17GSA 5INYA 5AISA 4KNDA 4P3YB 3LQ7A 3FYGA 3P8WA 5CRHA 2K6VA 5L71A 3R3EA 2HZFA 1AQVA 2O8VB 2RUFA 3TJGA 2GSRA 5HR0A 4FH8A 5GAPD 5D9TA 3L9SA 2VL3A 2H66A 3MWHA 4MJBA 4WF5A 3O6TA 5LCZA 4PQIA 4YKGA 5CRDA 1X5CA 2F8AA 1GSFA 3RPPA 3RHCA 16GSA 1YFEA 3GYKA 3HVNA 1SJIA 3E0UA 1XWKA 4GSNA 1Q92A 5COHA 5AIVA 2L59A 4ML1A 2H70A 4NLEA 2JZSA 3UL3A 3KTBA 1PKWA 1QMVA 2OJLA 3IOSA 1GSUA 2BTOT 2NVLA 4HI7A 1IYIA 1S3AA 4WF4A 1HYUA 1PN9A 2JADA 3GFKA 1FUQA 3GMFA 1O73A 4Q5NA 2GDRA 5G1LA 5D73A 5KOXA 2XC2A 1I9DA 3KIJA 4NFLA 4IVFA 2L5OA 2LS5A 1OC9A 2HE3A 2A2PA 4XCSA 5IM9A 1GLPA 2O7KA 1SL2B 2C80A 4F03A 5HFGA 4APBA 2I1UA 3GZHA 2DC5A 1THXA 3RBTA 2H0IA 3RD8A 2H1BA 2AYTA 3H93A 5E59A 3WYWA 2XBIA 2HRKA 5G31A 1TW9A 2JAWA 3L4NA 4MX2A 4XRDA 1RK4A 1GTUA 4V2LA 5E4WA 2FNOA 1A2MA 3HD5A 2GT6A 1GL8A 4NWYA 4PNGA 4PUFC 3ZLPA 1X0RA 1XZOA 1O8WA 4J2FA 1HQOA 2KP2A 5KN2A 1GNEA 4DSSB 3HJOA 5IOWA 2BMXA 4IN0A 2HXKA 4EO3A 2C3QA 4ILFA 2YP6A 5HFKA 3ZL5A 3APOA 4K8MA 4IKHA 2WS2A 2R4VA 2H6XA 3VWWA 3RRPA 1HNCA 4MCUA 1QK8A 3I6AA 1BJXA 2CAQA 1BYEA 4MZCA 3IRAA 2CT6A 1OVNA 2E0QA 3GTUB 1WPIA 4HOJA 4X0XA 1GP1A 3H4KA 5DCGA 1ZL9A 5CREA 4I2TA 3UARA 5F06A 4HQSA 5GAND 5ID2A 1ERVA 2YNXA 2OE3A 4KB3A 1PX7A 5LD0A 1WRYA 1SYXA 3W6GA 2R6KA 2JZRA 3H8QA 1TK8B 2H8LA 3A5IA 2IMDA 4MMMA 1H75A 4POMA 2C0FA 3GX0A 1GTAA 1A2JA 1PMTA 3EE2A 4OFTA 4TR1A 2KOKA 4MJAA 2CVBA 3TUEA 4XTSA 2VD1A 4TOPA 4ZBAA 5DAKB 2OA7A 4LL4B 1A2LA 1ML6A 3UBKA 3ZYWA 1MDIA 4O92A 1B48A 2VAFA 1XXUA 1X5DA 3E04A 4OMVA 1XVWA 2QA2A 3ED3A 3F3RA 3LEFA 1PL2A 1YDKA 2VD0A 2VLUA 3HZ4A 2NBSA 1M9AA 4K7IA 2OE0A 1V98A 3IAS2 2WZ9A 3UOMA 5IMDA 1JZOA 1V57A 3CMIA 1MD4A 3GA4A 1U15A 1ERUA 3FEUA 1U87A 1DOFA 3DRNA 1Q5NA 3D22A 3VWVA 3QAWA 2YANA 1B4PA 4BVYB 3JCML 1TI3A 4YQMA 2RM5A 4D73B 3NO9A 1A8LA 4GTUA 6GSYA 5CRWA 1E2YA 1G6YA 3GV1A 5DVBA 2IWTA 1U3IA 2IMEA 5G5FA 5H5SA 1DE2A 5HQPA 4HSCX 3IC8A 3M9KA 2B7KA 1SYRA 1TK0B 5GSTA 4JZQA 5IMFA 1THOA 1AQXA 5DDLA 2HSHA 2NDOA 4JR6A 4ACSA 5ECHB 4QL7A 13GSA 4WETA 4YIHA 5J9CA 4EE0A 3IHGA 3EU4A 3J7Yk 4QL9A 3WT1A 1Z5YE 4V2MA 2KP1A 4HEA2 1B4QA 2PTSA 2DKHA 1HNBA 3EU3A 4PQ1A 4POBA 1Z4IA 5DQSA 2CVDA 4AJ8A 1GWCA 4K1FA 3F8UA 5EPFA 4DVCA 2YZHA 4APAA 2V32A 1FOHA 1PGTA 4CW9A 2DJ0A 2DJ1A 2WRTA 1O7UA 5FT3A 4ADMA 2QGAB 1VF1A 4LMVA 1Z9HA 2CZ2A 2P5QA 4BPYA 3HY2A 3ZTLA 2QC7A 4F82A 3P7XA 2YCDA 4GCIA 4WBRD 2N5AA 2K8VA 2MBSA 3HCZA 3KMNA 5H5QA 1EP7A 1SENA 3C7MA 3I43A 1YZXA 2H0GA 3LWAA 1K0NA 3ME7A 4MWOA 2CAIA 3PPUA 5KN3A 2MMAA 1NSWA 2L4CA 3IR4A 1SKRB 1ZOFA 2L6DA 2H19A 1S3RA 2OE1A 1Y25A 2V41A 4F0BA 2PTQA 5D93A 1I5GA 1K3YA 3LFLA 1T7PB 2LRNA 4DEJA 3LG6A 3MNGA 1Z4PX 5F92A 1K0AA 4GQCA 2V6KA 1DCNA 3VFIA 4OO4A 2VIMA 4PUAA 4PNFA 2I7DA 3SBCA 3H1NA 2MMOA 4PXOA 2UZ8A 5AIXA 1MTCA 5F0GA 3UJ1A 3IAM2 2LEGA 2E9FA 2X49A 5C00A 2X8GA 3QAVA 4EF0A 2XBQA 4IP6A 1FAAA 1XG8A 4KE3A 5ECRB 3F4TA 4LMWA 2VCWA 4WR5A 2H1AA 1K0OA 4Q5FA 1OC8A 1YEPA 3VPTA 4ECBA 4RQRA 3C71A 1VF2A 3LJRA 3KJYA 4I8BA 4BL7B 3TB2A 1I0AA 3HYPA 4KW6A 1LBKA 4TR4A 3CSHA 1NM3A 1NHOA 1ZYQB 1G7EA 4NV2A 1SU9A 1GSSA 5ECKB 4OCFA 4RI6A 3HHVA 1C72A 4GXZA 1AUWA 3P2AA 3UAPA 3A3TA 2YWOA 1PQNA 4CDOA 5ECLB 2IFQA 5KOWA 2EIOA 5JWRB 4ZBDA 1Z3EA 1OC3A 4POLA 1PX6A 1X9SB 3U6VA 4QQ7A 2GT5A 1O81A 4IW9A 4XRAA 1RW1A 1M3IA 1AQWA 3NZNA 3TKSA 2L6CA 1A0RP 5IMCA 2V6OA 3QR6A 3MIXA 3F0IA 5ECOB 3GRXA 4EXJA 4GWRA 1YEXA 4ISDA 1J3UA 2YWNA 2I4AA 1HD2A 4TW5A 2WDUA 2YOIA 2D28C 3IK7A 1ERWA 4IQAA 2WGRA 2YV7A 5D9VA 5ELAA 4KH7A 3EURA 4EC0A 1TRVA 3IXRA 1RQMA 5F05A 1T3BA 3Q18A 1QGVA 2KHPA 3W8JA 5B8AA 1LU4A 2YN1A 1FVJA 4O32A 1Z4QA 2B6MA 4KDXA 2C1YA 3FZ9A 2PWJA 3N5OA 4TXVA 4BWSA 4PGTA 2V1MA 1C3UA 3FKFA 5D8IA 4E8HA 5HFIA 3KCMA 5IIZA 5HW2A 4E88A 3F4RA 2I3YA 4G19A 1SD9A 3E3EA 2BJXA 2FY6A 1GSDA 1PRXA 3DXBA 4DSSA 1BG5A 5G5EA 4FYUA 2DSAA 1U16A 3DYRA 3D21A 3KGKA 2YV5A 4YIKA 1FO5A 2JZTA 3GL5A 1XFLA 1R4WA 2REMA 5ABRA 2GZPA 1X9MB 2IMIA 3FR6A 2WCIA 1EOGA 3LGCA 4NAXA 4IHUA 3LYPA 4ZXGA 3VLNA 2JU5A 4MUMA 6GSVA 4PQHA 2VCZA 2A4HA 19GSA 5IO0A 5KEJA 5KN0A 2PGTA 1UVZA 1HY1A 1F6MC 3QMXA 1RE5A 5J5NA 3GHAA 4BVXA 3CXGA 4K0GA 5GZZB 2PU9C 3TJFA 1EWXA 2R0PA 2C4JA 2K18A 4IGJA 2YV9A 3KD0A 2MMZA 1T8EB 3BJ5A 1U0LA 3CRUA 4LA1A 3HZ8A 3QBPA 1Z4JA 2VL9A 2LRTA 1XOAA 2N5BA 3WGEA 1K7WA 3EINA 1ACVA 2G0FA 3C73A 1DSBA 1U88A 3RHBA 5CYYA 3GTDA 1BQ7A 4WXTA 2M46A 4G10A 5JWOB 4JBBA 3QDNA 1F3AA 1V40A 1OE8A 2WFCA 3KZQA 4K9ZA 1TDIA 1DBYA 2PBJA 1T1VA 4K5SA 3ZVJD 2ALBA 1X5EA 4MF7A 3G9BA 2VUPA 4MF5A 4AGSA 1GSEA 2C8UA 2CX3A 4F9ZA 3N9JA 2VM2A 1USBA 3IE3A 3APSA 5ECQB 1O6JA 1B9XC 3TGZA 4BVYA 4YAVA 2H01A 4IBPA 1YF1A 1F37A 2LRCA 4EDZA 1B8XA 4GQFA 1GTBA 3R2QA 1VRSD 2A4VA 2HRAA 1FOVA 4JU5A 4L6AA 1OYJA 2CZ3A 3R6QA 1G7OA 4L6CA 4GLTA 3FZ4A 2KUCA 3FZAA 2HZEB 2G2QA 3FHKA 4IS0A 2DIZA 1V58A 2K8SA 3O76A 2H6YA 5C04A 3ZFBA 5F91A 3TOUA 3MAKA 2CVKA 3IK9A 3VK9A 1VGLA 3HXSA 3C1RA 5J9BA 3UMAA 3AY8A 2HT9A 1ZYNA 4MA9A 3UIWA 3HVSA 2LKUA 2WJUA 2B5YA 5CO3A 4AF2A 1BAYA 3P90A 3QAGA 2VLTA 2NPBA 2VL2C 4EIPA 1VF4A 4ICYA 4V1Ap 5DQYA 3WD6A 4EIQA 3ERGA 1Z6MA 1TU7A 3ZMLA 4YQUA 1LJRA 2GLRA 1N8JA 4CY8A 3DMLA 2HNLA 2R5GA 2FWFA 3ISOA 3CBUA 3V1WA 2HYXA 1JZDA 1M0UA 3VWUA 1J08A 3GIXA 4AJ7A 5J3RA 4IELA 4HJ2A 1YKCA 3WGXA 1A0FA 4KAEA 3ZMKA 2YWMA 4NPBA 4FYBA 1OAZA 1WJKA 2C3TA 3D4MA 2PVQA 3KXOA 1ERTA 1TRUA 5B6MA 1EV4A 2XPDA 2P5RA 1SK1A 3BCIA 2H76A 2F3MA 4G0KA 4JR4A 3M8NA 3DVWA 2GTUA 2OADA 2FA4A 2GVPA 3M3MA 1V2AA 8GSSA 4IQ1A 2LJAA 2JARA 3BCKA 2OBIA 5JWQB 2AHEA 4ECJA 2C0DA 4K5RA 2IPAA 11GSA 3KMOA 4ZL9A 2H71A 2LSTA 2HVGA 4N11A 2NTOA 5A4UA 1T9HA 3TKSC 3GL3A 1AC1A 4OO5A 3KH9A 2CA8A 1XOBA 2WB9A 2XHFA 1XWOA 1M2AA 2C3NA 4X1UA 4ZILA 1E6BA 22GSA 3QD9A 2E2GA 2VCTA
chains in the Genus database with same CATH topology
3TRQA 1XW9A 2JSZA 3KH7A 3Q6OA 3D6IA 1HNAA 4BL7A 2JL4A 2HRNA 4FIWA 4L0UA 2I9HA 2Z9SA 2DMLA 5ENUA 2H75A 4WBJA 1ST9A 4KDUA 3TKPA 3TKQA 3VI7A 4RQXA 1B9YC 2VM1A 3BOAA 4O5RA 3LSZA 2MZCA 3J7Yb 2E2MA 3FRCA 3APQA 1R5PA 2YJHA 4KGIA 3F3QA 1XVQA 2R2JA 3DEXA 5G30A 2QKEA 1GUKA 1ILOA 4I6XA 2FCHA 4TR1B 2B7JA 2JSYA 1S3CA 3RAZA 5IOXA 1XW6A 3IC4A 3TJBA 1FVKA 3I69A 1YF0A 1EOHA 4WKWA 4IP1A 1O8XA 1M2BA 6GSWA 3GN3A 4KCEA 1TRWA 4FYCA 1PA3A 1UC7A 4EUYA 3Q19A 4N0ZA 12GSA 3RPNA 1TTZA 3E9JB 2HSMA 1Z7RA 2QGVA 5B8BA 4ZL7A 3TKSE 1ABAA 3CYNA 1BX9A 4KX4A 3UEMA 5CP1A 4MP4A 2VL2A 3HVVA 5A4WA 1QUWA 3CTGA 4JEDA 3D0ZA 3DKSA 3GSSA 5D96A 1DUGA 1GTIA 5ELGA 2X64A 3DD3A 5AN1A 3F9UA 4Z2UA 4L5LA 1S3DA 2F51A 2JACA 3GH9A 1ZMAA 2P31A 2QA1A 1GSQA 5IO2A 3A2WA 3M0FA 4MNNA 3D4TA 2J9HA 2D2ZA 4TRXA 1XCCA 1XWBA 2ZNMA 5HR2A 3KTLA 4ECIA 4HJMA 7GSSA 3TJKA 4MZWA 2CV4A 4OCEA 2EIQA 2YPMA 1SJ6A 3GX8A 1CQGA 1M2DA 1H4OA 2H0HA 3K8NA 2FWHA 1UN2A 1O85A 3ZFLA 2YWIA 3QFAC 5HR3A 5D9XA 3ZITA 4YQVA 3IHQA 1PL1A 3F6DA 1K3LA 3ZIVA 4K2DA 3G7IA 5ECPB 3CRTA 3KM6A 4X4JA 1TKDB 2VCQA 3D5JA 5ECNB 1GUMA 4ID0A 2EIRA 6GSUA 2WULA 4TR0A 2N5FA 4LLRA 6GSTA 3F4SA 5DALB 2I81A 4ZB9A 2L5LA 3HDCA 4K2XA 1XPVA 2VLVA 2F8FA 1SKWB 1SK2A 5J4UA 6GSSA 4Q5QA 1EEMA 4OWYA 3EVIA 2X8CA 5ECIB 18GSA 2VOCA 3GH6A 4KSMA 1VF3A 5BRTA 2MMNA 3HJMA 2RM6A 2X99A 5EY6A 2AV4A 4G9HA 4O5QA 4FQUA 3L9VA 5ECMB 2B3SA 1Z7PA 2V2GA 1MDJA 5B6NA 4XS4B 1XIYA 1XWAA 5AGYA 4KUNA 1SKSB 1YJ6A 2R3XA 1JLVA 1G0TA 3TOTA 4YAPA 1AUCA 1WE0A 4G2EA 1K3OA 2HRFA 5EL8A 1R26A 1ZYEA 3EC3A 4ZL8A 2AB6A 1AXDA 4IJ3A 5IPHA 2XPEA 1DE1A 2GQLA 1WP0A 4GSSA 2AJQB 3G7YA 4PTSA 2O85A 2C0GA 3FR9A 3BD2A 3C8EA 2FWEA 1FB0A 6GSXA 4O5UA 2PPTA 2DJJA 2HZEA 2DIYA 2YZUA 2FWGA 2IFQB 3GTUA 1R7HA 1T00A 4A5PA 2LNSA 4OFNA 5IQYA 3NIVA 4NXIA 1J9BA 1TI1A 1EV9A 4WR4A 2H1GA 1JFUA 4NHWA 3ERWA 1JZRA 2B1LA 1MDKA 2H1DA 1NW2A 4EDYA 3KEBA 2KLXA 4ULXA 4XIHA 1YY7A 9GSSA 4MH2A 3A5WA 3DIEA 4ZIJA 3MSZA 1YKAA 4KCAA 3VWXA 4N0VA 2FHEA 2ES7A 2MBTA 1GUHA 4K6XA 4TXOB 2VO4A 1K0DA 3ERFA 5DAKA 3LW9A 1AW9A 1GRXA 1M7TA 4USSA 1JLWA 2GSTA 2LNTA 2GZZA 2LQOA 1TXXA 4KSOA 3W8SA 1Q98A 4I2UA 4MJCA 3HVXA 3CTFA 1KTEA 1OKTA 3GKMA 5BMUA 5JCWA 4MF6A 4TN8A 2PUKC 3IBHA 4ZB6A 3US3A 4K7OA 3TDGA 3IA1A 4AJ6A 2IL3A 3GNJA 5B7CA 5A5KA 4K7NA 4MDCA 3TRPA 1GNWA 5CNWA 1SD8A 3SWLA 1WWJA 3UVTA 2EC4A 4J57E 3WGDA 4D73A 1GULA 2DKIA 3EYTA 5FHIA 3FK8A 5A4VA 3HJPA 1A23A 4PX1A 2J23A 2DLXA 4IQJM 2GZYA 4NMUA 4J56E 1K0MA 2LV3A 1EGOA 2RLIA 2X8HA 4MLYA 3PINA 1SJZA 1MEKA 4MZBA 1Z6NA 2IIYA 3F6FA 1AAZA 4H86A 1M9BA 5EVOA 2R0GA 3IV4A 4XHMA 3TJJA 1F9MA 4F0CA 1KBNA 3A2XA 2HI7A 2PMTA 4X43A 10GSA 1ZCPA 1SL0B 4DSRA 4TVEA 3L78A 4BVXB 2F9SA 3GKKA 1OC9B 4OFMA 3S9FA 4PURA 3H79A 2ZUPA 3WT2A 1V9WA 1K0CA 1FHEA 20GSA 3VURA 1KEBA 3DVXA 5IMVA 4Z2TA 1UA5A 1EZKA 2VCVA 2C0EA 4LL1B 2IMKA 3OR5A 5IMZA 2OACA 3FZ5A 3ZIJA 4MPGA 4NV5A 2TIRA 4V1Ag 2FGXA 5JCGA 3QFBC 1JZWA 3GURA 2X4AA 3TKRA 1U6TA 5G2ZA 4Q5RA 3ZZXA 1CQHA 1TRSA 5JCUA 3LORA 4BA7A 3UBLA 3C1SA 1R5AA 3M1GA 2GS3A 1GSYA 1URMA 4RUVA 2DJKA 4YKFA 1N2AA 4WEYA 2TRXA 1ZYPA 3FR3A 5H5RA 5CRGA 1XWGA 5F8BA 3KP8A 5IMAA 1IW7D 1M99A 3EWLA 2K9FA 1WMJA 1SK0A 4JE1A 1AIUA 2TRCP 1Y6EA 4G0IA 2AAWA 3GSTA 2M80A 3IDVA 4N10A 3ZRDA 4HU9A 4ML6A 3VI5A 2IJYA 2RIIA 4E8EA 3QOUA 2MYGA 2ZCTA 14GSA 2FUG2 2PVOC 2GQMA 4GRFA 2HSYA 1U3AA 1W89A 1TU8A 2QSIA 4F2IA 4N30A 1K0BA 2B1KA 1Q4JA 1EEJA 2D27A 4Z7XA 1GLQA 1ZZYA 4EKZA 2A2SA 1SL1B 2H30A 1TOFA 1TK5B 1GH2A 5HR1A 3RDWA 1XBSA 4TKYA 2H73A 4HZ4A 1NHYA 5ID2B 1G6WA 3KP9A 2L4QA 3GKXA 4NHZA 2R0CA 2LJKA 4V2NA 4KF9A 2LQQA 1PD21 2R37A 2RUEA 2E7PA 3PH9A 3O3TA 3Q74A 1FB6A 3BBYA 3PR8A 1OKDA 3CSJA 4KDYA 1XW5A 1QQ2A 3CSIA 4BWQA 3FW2A 1FW1A 3DWVA 5LNKe 1JHBA 2LUSA 1A24A 2LJRA 4RI7A 1WIKA 4HS1A 3A2VA 2DJ2A 4TR3A 4MH3A 2ON5A 4HDEA 2DBCA 1EGRA 1OE7A 1TP9A 4MJEA 1PN0A 5DBQA 4FO5A 4K0NA 2PN8A 2GSQA 2AUVA 3G7JA 3I9V2 4GSTA 1BEDA 2M72A 4L5OA 5DALA 3ZREA 4G0LA 2H74A 3TRXA 2PERA 3LXTA 5G1KA 1XWCA 3EMPA 1TJDA 3F63A 2FD3A 1PSQA 5F07A 2GGTA 2LTKA 3ZVJA 5DJLA 2OKAA 4O7HA 2CQ9A 1ZGNA 4ZBBA 4IJIA 4MK3A 5J41A 4L8EA 5CAXA 1EP8A 5DCHA 2HLSA 4CY6A 4DSQA 3MYDA 4YH2A 2DJ3A 2H6ZA 2FLSA 1WOUA 3HA9A 3GKNA 3LYKA 1IYHA 4XS4A 1KNGA 4I97A 4GF0A 2A2RA 2YJ7A 1YQ1A 4HQZA 1MD3A 2P0GA 2VCXA 3VPQA 3U5RE 1F2EA 1T4ZA 2OBKA 4MPFA 3L0HA 1W4VA 3M9JA 4MABA 3PGTA 2L57A 3ME8A 3NOFA 4POKA 3IPZA 3TCOA 1FG4A 3FY7A 2IN3A 5FWGA 3L9UA 1ON4A 2GQKA 1X9WB 4HZ2A 4OD7A 2H72A 1A8YA 5IPGA 5GSSA 3QCPA 4EVMA 3MDKA 3QPMA 4HU7A 5KN1A 4EL1A 2O89A 5DJMA 4ECCA 2B5XA 3UVHA 2B5EA 4Z2RA 1F3BA 2IMFA 2GSSA 4L0WA 5D9WA 3DGQA 4XS6A 4JRRA 1J0FA 3HKRA 4HUAA 2DMMA 2HFDA 3EMXA 3LXZA 1T4YA 3EPTA 1PKZA 2CX4A 4KA0A 2FA8A 4ZB8A 2ON7A 2O87A 3FMWA 4XS1A 1QXHA 4TXOA 4CHSA 3GUSA 5ECSA 4I5QA 1QFNA 17GSA 5INYA 5AISA 4KNDA 4P3YB 3LQ7A 3FYGA 3P8WA 5CRHA 2K6VA 5L71A 3R3EA 2HZFA 1AQVA 2O8VB 2RUFA 3TJGA 2GSRA 5HR0A 4FH8A 5GAPD 5D9TA 3L9SA 2VL3A 2H66A 3MWHA 4MJBA 4WF5A 3O6TA 5LCZA 4PQIA 4YKGA 5CRDA 1X5CA 2F8AA 1GSFA 3RPPA 3RHCA 16GSA 3GYKA 1SJIA 3E0UA 1XWKA 4GSNA 5COHA 5AIVA 2L59A 4ML1A 2H70A 2JZSA 3UL3A 3KTBA 1PKWA 1QMVA 2OJLA 3IOSA 1GSUA 2BTOT 2NVLA 4HI7A 1IYIA 1S3AA 4WF4A 1HYUA 1PN9A 2JADA 3GFKA 3GMFA 1O73A 4Q5NA 2GDRA 5G1LA 5D73A 5KOXA 2XC2A 1I9DA 3KIJA 4IVFA 2L5OA 2LS5A 1OC9A 2HE3A 2A2PA 4XCSA 5IM9A 1GLPA 2O7KA 1SL2B 2C80A 4F03A 5HFGA 2I1UA 2DC5A 1THXA 3RBTA 2H0IA 2H1BA 3H93A 2AYTA 5E59A 3WYWA 2XBIA 2HRKA 5G31A 1TW9A 3L4NA 4XRDA 1RK4A 1GTUA 4V2LA 5E4WA 2FNOA 1A2MA 3HD5A 2GT6A 1GL8A 4NWYA 4PNGA 4PUFC 3ZLPA 1X0RA 1XZOA 1O8WA 4J2FA 1HQOA 2KP2A 5KN2A 1GNEA 4DSSB 3HJOA 5IOWA 2BMXA 4IN0A 2HXKA 4EO3A 2C3QA 4ILFA 2YP6A 5HFKA 3ZL5A 3APOA 4K8MA 4IKHA 2WS2A 2R4VA 2H6XA 3VWWA 1HNCA 4MCUA 1QK8A 3I6AA 1BJXA 2CAQA 1BYEA 4MZCA 3IRAA 2CT6A 1OVNA 2E0QA 3GTUB 1WPIA 4HOJA 4X0XA 1GP1A 3H4KA 5DCGA 1ZL9A 5CREA 4I2TA 3UARA 5F06A 4HQSA 5GAND 5ID2A 1ERVA 2YNXA 2OE3A 4KB3A 1PX7A 5LD0A 1WRYA 1SYXA 3W6GA 2R6KA 2JZRA 3H8QA 1TK8B 2H8LA 3A5IA 2IMDA 4MMMA 1H75A 4POMA 2C0FA 3GX0A 1GTAA 1A2JA 1PMTA 3EE2A 4OFTA 4TR1A 2KOKA 4MJAA 2CVBA 3TUEA 4XTSA 2VD1A 4TOPA 4ZBAA 5DAKB 2OA7A 4LL4B 1A2LA 1ML6A 3UBKA 3ZYWA 1MDIA 4O92A 1B48A 2VAFA 1XXUA 1X5DA 4OMVA 1XVWA 2QA2A 3ED3A 3F3RA 3LEFA 1PL2A 1YDKA 2VD0A 2VLUA 3HZ4A 2NBSA 1M9AA 4K7IA 2OE0A 1V98A 3IAS2 2WZ9A 3UOMA 5IMDA 1JZOA 1V57A 3CMIA 1MD4A 3GA4A 1ERUA 3FEUA 1U87A 3DRNA 3D22A 3VWVA 3QAWA 2YANA 1B4PA 4BVYB 3JCML 1TI3A 4YQMA 2RM5A 4D73B 1A8LA 4GTUA 6GSYA 5CRWA 1E2YA 1G6YA 3GV1A 5DVBA 2IWTA 1U3IA 2IMEA 5G5FA 5H5SA 1DE2A 5HQPA 3IC8A 3M9KA 2B7KA 1SYRA 1TK0B 5GSTA 4JZQA 5IMFA 1THOA 1AQXA 5DDLA 2HSHA 2NDOA 4JR6A 4ACSA 5ECHB 4QL7A 13GSA 4WETA 5J9CA 4EE0A 3IHGA 3EU4A 3J7Yk 4QL9A 3WT1A 1Z5YE 4V2MA 2KP1A 4HEA2 1B4QA 4PQ1A 2DKHA 1HNBA 3EU3A 4POBA 5DQSA 2CVDA 4AJ8A 1GWCA 4K1FA 3F8UA 5EPFA 4DVCA 2YZHA 2V32A 1FOHA 1PGTA 4CW9A 2DJ0A 2DJ1A 2WRTA 1O7UA 5FT3A 1VF1A 4LMVA 1Z9HA 2CZ2A 2P5QA 4BPYA 3HY2A 3ZTLA 2QC7A 4F82A 3P7XA 2YCDA 4GCIA 4WBRD 2N5AA 2K8VA 2MBSA 3HCZA 3KMNA 5H5QA 1EP7A 1SENA 3C7MA 3I43A 1YZXA 2H0GA 3LWAA 1K0NA 3ME7A 2CAIA 3PPUA 5KN3A 2MMAA 1NSWA 2L4CA 3IR4A 1SKRB 1ZOFA 2L6DA 2H19A 2OE1A 1Y25A 2V41A 4F0BA 5D93A 1I5GA 1K3YA 3LFLA 1T7PB 2LRNA 4DEJA 3LG6A 3MNGA 1K0AA 4GQCA 2V6KA 3VFIA 4OO4A 2VIMA 4PUAA 4PNFA 3SBCA 3H1NA 2MMOA 4PXOA 2UZ8A 5AIXA 1MTCA 5F0GA 3UJ1A 3IAM2 2LEGA 2X49A 5C00A 2X8GA 3QAVA 4EF0A 2XBQA 4IP6A 1FAAA 4KE3A 5ECRB 3F4TA 4LMWA 2VCWA 4WR5A 2H1AA 1K0OA 4Q5FA 1OC8A 1YEPA 3VPTA 4ECBA 4RQRA 3C71A 1VF2A 3LJRA 3KJYA 4I8BA 4BL7B 3TB2A 3HYPA 4KW6A 1LBKA 4TR4A 3CSHA 1NM3A 1NHOA 1ZYQB 1G7EA 4NV2A 1SU9A 1GSSA 5ECKB 4OCFA 4RI6A 3HHVA 1C72A 4GXZA 3P2AA 3UAPA 3A3TA 2YWOA 1PQNA 4CDOA 5ECLB 2IFQA 5KOWA 2EIOA 5JWRB 4ZBDA 1Z3EA 1OC3A 4POLA 1PX6A 1X9SB 3U6VA 4QQ7A 2GT5A 1O81A 4IW9A 4XRAA 1RW1A 1AQWA 3NZNA 3TKSA 2L6CA 1A0RP 5IMCA 2V6OA 3MIXA 3QR6A 3F0IA 5ECOB 3GRXA 4EXJA 4GWRA 1YEXA 4ISDA 2YWNA 2I4AA 1HD2A 4TW5A 2WDUA 2YOIA 2D28C 3IK7A 1ERWA 4IQAA 2WGRA 2YV7A 5D9VA 5ELAA 4KH7A 3EURA 4EC0A 1TRVA 3IXRA 1RQMA 5F05A 1T3BA 3Q18A 1QGVA 2KHPA 3W8JA 5B8AA 1LU4A 2YN1A 1FVJA 4O32A 2B6MA 4KDXA 2C1YA 3FZ9A 2PWJA 3N5OA 4TXVA 4BWSA 4PGTA 2V1MA 3FKFA 5D8IA 4E8HA 5HFIA 3KCMA 5IIZA 3F4RA 2I3YA 4G19A 1SD9A 3E3EA 2BJXA 2FY6A 1GSDA 1PRXA 3DXBA 4DSSA 1BG5A 5G5EA 4FYUA 2DSAA 3DYRA 3D21A 3KGKA 1FO5A 2JZTA 3GL5A 1XFLA 1R4WA 2REMA 5ABRA 2GZPA 1X9MB 2IMIA 3FR6A 2WCIA 1EOGA 3LGCA 4NAXA 4IHUA 3LYPA 4ZXGA 3VLNA 2JU5A 6GSVA 4PQHA 2VCZA 2A4HA 19GSA 5IO0A 5KEJA 5KN0A 2PGTA 1UVZA 1F6MC 3QMXA 5J5NA 3GHAA 4BVXA 3CXGA 4K0GA 5GZZB 2PU9C 3TJFA 1EWXA 2R0PA 2C4JA 2K18A 4IGJA 2YV9A 3KD0A 2MMZA 1T8EB 3BJ5A 3CRUA 4LA1A 3HZ8A 2VL9A 2LRTA 1XOAA 2N5BA 3WGEA 3EINA 1ACVA 2G0FA 3C73A 1DSBA 1U88A 3RHBA 5CYYA 1BQ7A 4WXTA 2M46A 4G10A 5JWOB 4JBBA 3QDNA 1F3AA 1V40A 1OE8A 2WFCA 3KZQA 4K9ZA 1TDIA 1DBYA 2PBJA 1T1VA 4K5SA 3ZVJD 2ALBA 1X5EA 4MF7A 3G9BA 2VUPA 4MF5A 4AGSA 1GSEA 2C8UA 2CX3A 4F9ZA 3N9JA 2VM2A 1USBA 3IE3A 3APSA 5ECQB 1O6JA 1B9XC 3TGZA 4BVYA 4YAVA 2H01A 4IBPA 1YF1A 1F37A 2LRCA 4EDZA 1B8XA 4GQFA 1GTBA 3R2QA 1VRSD 2A4VA 2HRAA 1FOVA 4JU5A 1OYJA 2CZ3A 1G7OA 4GLTA 3FZ4A 2KUCA 3FZAA 2HZEB 2G2QA 3FHKA 4IS0A 2DIZA 1V58A 2K8SA 3O76A 2H6YA 5C04A 3ZFBA 3TOUA 3MAKA 2CVKA 3IK9A 3VK9A 1VGLA 3HXSA 3C1RA 5J9BA 3UMAA 3AY8A 2HT9A 1ZYNA 4MA9A 3UIWA 3HVSA 2LKUA 2WJUA 2B5YA 5CO3A 4AF2A 1BAYA 3P90A 3QAGA 2VLTA 2NPBA 2VL2C 4EIPA 1VF4A 4ICYA 4V1Ap 5DQYA 3WD6A 4EIQA 3ERGA 1Z6MA 1TU7A 3ZMLA 4YQUA 1LJRA 2GLRA 1N8JA 4CY8A 3DMLA 2HNLA 2R5GA 2FWFA 3ISOA 3CBUA 3V1WA 2HYXA 1JZDA 1M0UA 3VWUA 1J08A 3GIXA 4AJ7A 5J3RA 4IELA 4HJ2A 1YKCA 3WGXA 1A0FA 4KAEA 3ZMKA 2YWMA 4NPBA 4FYBA 1OAZA 1WJKA 2C3TA 3D4MA 2PVQA 3KXOA 1ERTA 1TRUA 5B6MA 1EV4A 2XPDA 2P5RA 1SK1A 3BCIA 2H76A 2F3MA 4G0KA 4JR4A 3M8NA 3DVWA 2GTUA 2OADA 2FA4A 2GVPA 3M3MA 1V2AA 8GSSA 4IQ1A 2LJAA 3BCKA 2OBIA 5JWQB 2AHEA 4ECJA 2C0DA 4K5RA 2IPAA 11GSA 3KMOA 4ZL9A 2H71A 2LSTA 4N11A 2NTOA 5A4UA 3TKSC 3GL3A 1AC1A 4OO5A 3KH9A 2CA8A 1XOBA 2WB9A 2XHFA 1M2AA 2C3NA 4X1UA 4ZILA 1E6BA 22GSA 3QD9A 2E2GA 2VCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TRQ A;  1XW9 A;  2JSZ A;  3KH7 A;  3Q6O A;  3D6I A;  1HNA A;  4BL7 A;  2JL4 A;  2HRN A;  4FIW A;  4L0U A;  2I9H A;  2Z9S A;  2DML A;  5ENU A;  2H75 A;  4WBJ A;  1ST9 A;  4KDU A;  3TKP A;  3TKQ A;  3VI7 A;  4RQX A;  1B9Y C;  2VM1 A;  3BOA A;  4O5R A;  3LSZ A;  2MZC A;  3J7Y b;  2E2M A;  3FRC A;  3APQ A;  1R5P A;  2YJH A;  4KGI A;  3F3Q A;  1XVQ A;  2R2J A;  3DEX A;  5G30 A;  2QKE A;  1GUK A;  1ILO A;  4I6X A;  2FCH A;  4TR1 B;  2B7J A;  2JSY A;  1S3C A;  3RAZ A;  5IOX A;  1XW6 A;  3IC4 A;  3TJB A;  1FVK A;  3I69 A;  1YF0 A;  1EOH A;  4WKW A;  4IP1 A;  1O8X A;  1M2B A;  6GSW A;  3GN3 A;  4KCE A;  1TRW A;  4FYC A;  1PA3 A;  1UC7 A;  4EUY A;  3Q19 A;  4N0Z A;  12GS A;  3RPN A;  1TTZ A;  3E9J B;  1Z7R A;  2QGV A;  5B8B A;  4ZL7 A;  3TKS E;  1ABA A;  3CYN A;  1BX9 A;  4KX4 A;  3UEM A;  5CP1 A;  4MP4 A;  2VL2 A;  3HVV A;  5A4W A;  1QUW A;  3CTG A;  5D96 A;  3D0Z A;  3DKS A;  3GSS A;  4JED A;  1DUG A;  1GTI A;  5ELG A;  2X64 A;  3DD3 A;  5AN1 A;  3F9U A;  4L5L A;  1S3D A;  2F51 A;  2JAC A;  3GH9 A;  1ZMA A;  2P31 A;  1GSQ A;  5IO2 A;  3A2W A;  3M0F A;  3D4T A;  2J9H A;  2D2Z A;  4TRX A;  1XCC A;  1XWB A;  2ZNM A;  5HR2 A;  3KTL A;  4ECI A;  4HJM A;  7GSS A;  3TJK A;  4MZW A;  2CV4 A;  4OCE A;  2EIQ A;  2YPM A;  1SJ6 A;  3GX8 A;  1CQG A;  1M2D A;  1H4O A;  2H0H A;  3K8N A;  2FWH A;  1UN2 A;  1O85 A;  3ZFL A;  2YWI A;  3QFA C;  5HR3 A;  5D9X A;  3ZIT A;  4YQV A;  3IHQ A;  1PL1 A;  3F6D A;  1K3L A;  3ZIV A;  4K2D A;  3G7I A;  5ECP B;  3CRT A;  3KM6 A;  1TKD B;  2VCQ A;  3D5J A;  5ECN B;  1GUM A;  4ID0 A;  2EIR A;  6GSU A;  2WUL A;  4TR0 A;  2N5F A;  4LLR A;  6GST A;  3F4S A;  5DAL B;  2I81 A;  4ZB9 A;  2L5L A;  3HDC A;  1XPV A;  2VLV A;  2F8F A;  1SKW B;  1SK2 A;  5J4U A;  6GSS A;  4Q5Q A;  1EEM A;  4OWY A;  3EVI A;  2X8C A;  5ECI B;  18GS A;  2VOC A;  3GH6 A;  4KSM A;  1VF3 A;  2MMN A;  3HJM A;  2RM6 A;  2X99 A;  5EY6 A;  2AV4 A;  4G9H A;  3L9V A;  5ECM B;  2B3S A;  1Z7P A;  2V2G A;  1MDJ A;  5B6N A;  4XS4 B;  1XIY A;  1XWA A;  5AGY A;  4KUN A;  1SKS B;  1YJ6 A;  2R3X A;  1JLV A;  1G0T A;  3TOT A;  4YAP A;  1AUC A;  1WE0 A;  4G2E A;  1K3O A;  2HRF A;  5EL8 A;  1R26 A;  1ZYE A;  3EC3 A;  4ZL8 A;  2AB6 A;  1AXD A;  4IJ3 A;  5IPH A;  2XPE A;  1DE1 A;  2GQL A;  1WP0 A;  4GSS A;  2AJQ B;  3G7Y A;  2O85 A;  2C0G A;  3FR9 A;  3BD2 A;  3C8E A;  2FWE A;  1FB0 A;  6GSX A;  2PPT A;  2DJJ A;  2HZE A;  2DIY A;  2YZU A;  2FWG A;  2IFQ B;  3GTU A;  1R7H A;  1T00 A;  2LNS A;  4OFN A;  5IQY A;  3NIV A;  4NXI A;  1J9B A;  1TI1 A;  1EV9 A;  4WR4 A;  2H1G A;  1JFU A;  4NHW A;  3ERW A;  1JZR A;  2B1L A;  1MDK A;  2H1D A;  1NW2 A;  4EDY A;  3KEB A;  2KLX A;  4ULX A;  4XIH A;  1YY7 A;  9GSS A;  4MH2 A;  3A5W A;  3DIE A;  4ZIJ A;  3MSZ A;  1YKA A;  4KCA A;  3VWX A;  4N0V A;  2FHE A;  2ES7 A;  2MBT A;  1GUH A;  4K6X A;  4TXO B;  2VO4 A;  1K0D A;  3ERF A;  5DAK A;  1AW9 A;  1GRX A;  1M7T A;  1JLW A;  2GST A;  2LNT A;  2GZZ A;  2LQO A;  1TXX A;  4KSO A;  3W8S A;  1Q98 A;  4I2U A;  4MJC A;  3HVX A;  3CTF A;  1KTE A;  1OKT A;  3GKM A;  5JCW A;  4MF6 A;  4TN8 A;  2PUK C;  3IBH A;  4ZB6 A;  3US3 A;  4K7O A;  3TDG A;  3IA1 A;  4AJ6 A;  2IL3 A;  3GNJ A;  5B7C A;  5A5K A;  4K7N A;  4MDC A;  3TRP A;  1GNW A;  5CNW A;  1SD8 A;  3SWL A;  1WWJ A;  3UVT A;  2EC4 A;  4J57 E;  3WGD A;  4D73 A;  1GUL A;  3EYT A;  5FHI A;  3FK8 A;  5A4V A;  3HJP A;  1A23 A;  4PX1 A;  2J23 A;  2DLX A;  2GZY A;  4NMU A;  4J56 E;  1K0M A;  2LV3 A;  1EGO A;  2RLI A;  2X8H A;  4MLY A;  3PIN A;  1SJZ A;  1MEK A;  4MZB A;  1Z6N A;  2IIY A;  3F6F A;  1AAZ A;  4H86 A;  1M9B A;  5EVO A;  3IV4 A;  4XHM A;  3TJJ A;  1F9M A;  4F0C A;  1KBN A;  3A2X A;  2HI7 A;  2PMT A;  4X43 A;  10GS A;  1ZCP A;  1SL0 B;  4DSR A;  4TVE A;  3L78 A;  2F9S A;  3GKK A;  1OC9 B;  4OFM A;  3S9F A;  4PUR A;  3H79 A;  2ZUP A;  3WT2 A;  1V9W A;  1K0C A;  1FHE A;  20GS A;  3VUR A;  1KEB A;  3DVX A;  5IMV A;  1UA5 A;  1EZK A;  2VCV A;  2C0E A;  4LL1 B;  2IMK A;  3OR5 A;  5IMZ A;  2OAC A;  3FZ5 A;  3ZIJ A;  4MPG A;  4NV5 A;  2TIR A;  4V1A g;  2FGX A;  5JCG A;  3QFB C;  1JZW A;  3GUR A;  3TKR A;  1U6T A;  5G2Z A;  4Q5R A;  3ZZX A;  1CQH A;  1TRS A;  5JCU A;  3LOR A;  4BA7 A;  3UBL A;  3C1S A;  1R5A A;  3M1G A;  2GS3 A;  1GSY A;  1URM A;  4RUV A;  2DJK A;  1N2A A;  4WEY A;  2TRX A;  3FR3 A;  5H5R A;  5CRG A;  1XWG A;  5F8B A;  3KP8 A;  5IMA A;  1M99 A;  3EWL A;  2K9F A;  1WMJ A;  1SK0 A;  4JE1 A;  1AIU A;  2TRC P;  1Y6E A;  2AAW A;  3GST A;  2M80 A;  3IDV A;  4N10 A;  3ZRD A;  4HU9 A;  4ML6 A;  3VI5 A;  2IJY A;  2RII A;  4E8E A;  3QOU A;  2MYG A;  2ZCT A;  14GS A;  2FUG 2;  2PVO C;  2GQM A;  4GRF A;  2HSY A;  1U3A A;  1W89 A;  1TU8 A;  2QSI A;  4F2I A;  4N30 A;  1K0B A;  2B1K A;  1Q4J A;  1EEJ A;  4Z7X A;  1GLQ A;  1ZZY A;  4EKZ A;  2A2S A;  1SL1 B;  2H30 A;  1TOF A;  1TK5 B;  1GH2 A;  5HR1 A;  3RDW A;  1XBS A;  4TKY A;  2H73 A;  4HZ4 A;  1NHY A;  5ID2 B;  1G6W A;  3KP9 A;  2L4Q A;  3GKX A;  4NHZ A;  2LJK A;  4V2N A;  2LQQ A;  1PD2 1;  2R37 A;  2RUE A;  2E7P A;  3PH9 A;  3O3T A;  3Q74 A;  1FB6 A;  3BBY A;  3PR8 A;  1OKD A;  3CSJ A;  4KDY A;  1XW5 A;  1QQ2 A;  3CSI A;  4BWQ A;  3FW2 A;  1FW1 A;  3DWV A;  5LNK e;  1JHB A;  2LUS A;  1A24 A;  2LJR A;  4RI7 A;  1WIK A;  4HS1 A;  3A2V A;  2DJ2 A;  4TR3 A;  4MH3 A;  2ON5 A;  4HDE A;  2DBC A;  1EGR A;  1OE7 A;  1TP9 A;  4MJE A;  5DBQ A;  4FO5 A;  4K0N A;  2PN8 A;  2GSQ A;  2AUV A;  3G7J A;  3I9V 2;  4GST A;  1BED A;  2M72 A;  4L5O A;  5DAL A;  3ZRE A;  2H74 A;  3TRX A;  2PER A;  3LXT A;  5G1K A;  1XWC A;  3EMP A;  1TJD A;  3F63 A;  2FD3 A;  1PSQ A;  5F07 A;  2GGT A;  2LTK A;  3ZVJ A;  5DJL A;  2OKA A;  4O7H A;  2CQ9 A;  1ZGN A;  4ZBB A;  4IJI A;  4MK3 A;  5J41 A;  4L8E A;  5CAX A;  1EP8 A;  5DCH A;  2HLS A;  4DSQ A;  4YH2 A;  2DJ3 A;  2H6Z A;  2FLS A;  1WOU A;  3HA9 A;  3GKN A;  3LYK A;  1IYH A;  4XS4 A;  1KNG A;  4I97 A;  4GF0 A;  2A2R A;  2YJ7 A;  1YQ1 A;  4HQZ A;  1MD3 A;  2P0G A;  2VCX A;  3VPQ A;  3U5R E;  1F2E A;  1T4Z A;  2OBK A;  4MPF A;  3L0H A;  1W4V A;  3M9J A;  4MAB A;  3PGT A;  2L57 A;  3ME8 A;  3NOF A;  4POK A;  3IPZ A;  3TCO A;  1FG4 A;  3FY7 A;  2IN3 A;  5FWG A;  3L9U A;  1ON4 A;  2GQK A;  1X9W B;  4HZ2 A;  4OD7 A;  2H72 A;  1A8Y A;  5IPG A;  5GSS A;  3QCP A;  4EVM A;  3MDK A;  3QPM A;  4HU7 A;  5KN1 A;  4EL1 A;  2O89 A;  5DJM A;  4ECC A;  2B5X A;  3UVH A;  2B5E A;  1F3B A;  2IMF A;  2GSS A;  4L0W A;  5D9W A;  3DGQ A;  4XS6 A;  4JRR A;  1J0F A;  3HKR A;  4HUA A;  2DMM A;  2HFD A;  3EMX A;  3LXZ A;  1T4Y A;  1PKZ A;  2CX4 A;  4KA0 A;  2FA8 A;  4ZB8 A;  2ON7 A;  2O87 A;  4XS1 A;  1QXH A;  4TXO A;  4CHS A;  3GUS A;  5ECS A;  4I5Q A;  1QFN A;  17GS A;  5INY A;  5AIS A;  4KND A;  4P3Y B;  3LQ7 A;  3FYG A;  3P8W A;  5CRH A;  2K6V A;  5L71 A;  2HZF A;  1AQV A;  2O8V B;  2RUF A;  3TJG A;  2GSR A;  5HR0 A;  4FH8 A;  5GAP D;  5D9T A;  3L9S A;  2VL3 A;  2H66 A;  3MWH A;  4MJB A;  4WF5 A;  3O6T A;  5LCZ A;  4PQI A;  5CRD A;  1X5C A;  2F8A A;  1GSF A;  3RPP A;  3RHC A;  16GS A;  3GYK A;  1SJI A;  3E0U A;  1XWK A;  4GSN A;  5COH A;  5AIV A;  2L59 A;  4ML1 A;  2H70 A;  2JZS A;  3UL3 A;  3KTB A;  1PKW A;  1QMV A;  2OJL A;  3IOS A;  1GSU A;  2BTO T;  2NVL A;  4HI7 A;  1IYI A;  1S3A A;  4WF4 A;  1HYU A;  1PN9 A;  2JAD A;  3GFK A;  3GMF A;  1O73 A;  4Q5N A;  2GDR A;  5G1L A;  5D73 A;  2XC2 A;  1I9D A;  3KIJ A;  4IVF A;  2L5O A;  2LS5 A;  1OC9 A;  2HE3 A;  4XCS A;  5IM9 A;  1GLP A;  2O7K A;  1SL2 B;  2C80 A;  4F03 A;  5HFG A;  2I1U A;  2DC5 A;  1THX A;  3RBT A;  2H0I A;  2H1B A;  3H93 A;  2AYT A;  5E59 A;  3WYW A;  2XBI A;  5G31 A;  1TW9 A;  3L4N A;  4XRD A;  1RK4 A;  1GTU A;  4V2L A;  5E4W A;  2FNO A;  1A2M A;  3HD5 A;  2GT6 A;  1GL8 A;  4NWY A;  4PNG A;  4PUF C;  3ZLP A;  1X0R A;  1XZO A;  1O8W A;  4J2F A;  1HQO A;  2KP2 A;  5KN2 A;  1GNE A;  4DSS B;  3HJO A;  5IOW A;  2BMX A;  4IN0 A;  2HXK A;  4EO3 A;  2C3Q A;  4ILF A;  2YP6 A;  5HFK A;  3ZL5 A;  3APO A;  4K8M A;  4IKH A;  2WS2 A;  2R4V A;  2H6X A;  3VWW A;  1HNC A;  4MCU A;  1QK8 A;  3I6A A;  1BJX A;  2CAQ A;  1BYE A;  4MZC A;  3IRA A;  2CT6 A;  1OVN A;  2E0Q A;  3GTU B;  1WPI A;  4HOJ A;  4X0X A;  1GP1 A;  3H4K A;  5DCG A;  1ZL9 A;  5CRE A;  4I2T A;  3UAR A;  5F06 A;  4HQS A;  5GAN D;  5ID2 A;  1ERV A;  2YNX A;  2OE3 A;  4KB3 A;  1PX7 A;  5LD0 A;  1WRY A;  1SYX A;  3W6G A;  2R6K A;  2JZR A;  3H8Q A;  1TK8 B;  2H8L A;  2IMD A;  4MMM A;  1H75 A;  4POM A;  2C0F A;  3GX0 A;  1GTA A;  1A2J A;  1PMT A;  3EE2 A;  4OFT A;  4TR1 A;  2KOK A;  4MJA A;  2CVB A;  3TUE A;  4XTS A;  2VD1 A;  4TOP A;  4ZBA A;  5DAK B;  2OA7 A;  4LL4 B;  1A2L A;  1ML6 A;  3UBK A;  3ZYW A;  1MDI A;  4O92 A;  1B48 A;  2VAF A;  1XXU A;  1X5D A;  4OMV A;  1XVW A;  3F3R A;  3ED3 A;  3LEF A;  1PL2 A;  1YDK A;  2VD0 A;  2VLU A;  3HZ4 A;  2NBS A;  1M9A A;  4K7I A;  2OE0 A;  1V98 A;  3IAS 2;  2WZ9 A;  3UOM A;  5IMD A;  1JZO A;  1V57 A;  3CMI A;  1MD4 A;  3GA4 A;  1ERU A;  3FEU A;  1U87 A;  3DRN A;  3D22 A;  3VWV A;  3QAW A;  2YAN A;  1B4P A;  3JCM L;  1TI3 A;  4YQM A;  2RM5 A;  4D73 B;  1A8L A;  4GTU A;  6GSY A;  5CRW A;  1E2Y A;  1G6Y A;  3GV1 A;  5DVB A;  2IWT A;  1U3I A;  2IME A;  5G5F A;  5H5S A;  1DE2 A;  5HQP A;  3M9K A;  2B7K A;  1SYR A;  1TK0 B;  5GST A;  4JZQ A;  5IMF A;  1THO A;  1AQX A;  5DDL A;  2HSH A;  2NDO A;  4JR6 A;  4ACS A;  5ECH B;  4QL7 A;  13GS A;  4WET A;  5J9C A;  4EE0 A;  3EU4 A;  3J7Y k;  4QL9 A;  3WT1 A;  1Z5Y E;  4V2M A;  2KP1 A;  4HEA 2;  1B4Q A;  4PQ1 A;  3EU3 A;  1HNB A;  4POB A;  5DQS A;  2CVD A;  4AJ8 A;  1GWC A;  4K1F A;  3F8U A;  5EPF A;  4DVC A;  2YZH A;  2V32 A;  1PGT A;  4CW9 A;  2DJ0 A;  2DJ1 A;  2WRT A;  1O7U A;  5FT3 A;  1VF1 A;  4LMV A;  1Z9H A;  2CZ2 A;  2P5Q A;  4BPY A;  3HY2 A;  3ZTL A;  2QC7 A;  4F82 A;  3P7X A;  2YCD A;  4GCI A;  4WBR D;  2N5A A;  2K8V A;  2MBS A;  3HCZ A;  3KMN A;  5H5Q A;  1EP7 A;  1SEN A;  3C7M A;  3I43 A;  1YZX A;  2H0G A;  3LWA A;  1K0N A;  3ME7 A;  2CAI A;  5KN3 A;  2MMA A;  1NSW A;  2L4C A;  3IR4 A;  1SKR B;  1ZOF A;  2L6D A;  2H19 A;  2OE1 A;  1Y25 A;  2V41 A;  4F0B A;  5D93 A;  1I5G A;  1K3Y A;  3LFL A;  1T7P B;  2LRN A;  4DEJ A;  3LG6 A;  3MNG A;  1K0A A;  4GQC A;  2V6K A;  3VFI A;  4OO4 A;  2VIM A;  4PUA A;  4PNF A;  3SBC A;  3H1N A;  2MMO A;  4PXO A;  5AIX A;  1MTC A;  5F0G A;  3UJ1 A;  3IAM 2;  2LEG A;  5C00 A;  2X8G A;  3QAV A;  4EF0 A;  2XBQ A;  4IP6 A;  1FAA A;  4KE3 A;  5ECR B;  3F4T A;  4LMW A;  2VCW A;  4WR5 A;  2H1A A;  1K0O A;  4Q5F A;  1OC8 A;  1YEP A;  3VPT A;  4ECB A;  4RQR A;  3C71 A;  1VF2 A;  3LJR A;  3KJY A;  4I8B A;  3TB2 A;  3HYP A;  4KW6 A;  1LBK A;  4TR4 A;  3CSH A;  1NM3 A;  1NHO A;  1ZYQ B;  1G7E A;  4NV2 A;  1SU9 A;  1GSS A;  5ECK B;  4OCF A;  4RI6 A;  3HHV A;  1C72 A;  4GXZ A;  3P2A A;  3UAP A;  3A3T A;  2YWO A;  1PQN A;  4CDO A;  5ECL B;  2IFQ A;  2EIO A;  5JWR B;  4ZBD A;  1Z3E A;  1OC3 A;  4POL A;  1PX6 A;  1X9S B;  3U6V A;  4QQ7 A;  2GT5 A;  1O81 A;  4IW9 A;  4XRA A;  1RW1 A;  1AQW A;  3NZN A;  3TKS A;  2L6C A;  1A0R P;  5IMC A;  2V6O A;  3QR6 A;  3F0I A;  5ECO B;  3GRX A;  4EXJ A;  4GWR A;  1YEX A;  4ISD A;  2YWN A;  2I4A A;  1HD2 A;  4TW5 A;  2WDU A;  2YOI A;  3IK7 A;  1ERW A;  4IQA A;  2WGR A;  2YV7 A;  5D9V A;  5ELA A;  4KH7 A;  3EUR A;  4EC0 A;  1TRV A;  3IXR A;  1RQM A;  5F05 A;  1T3B A;  3Q18 A;  1QGV A;  2KHP A;  3W8J A;  5B8A A;  1LU4 A;  2YN1 A;  1FVJ A;  4O32 A;  2B6M A;  4KDX A;  2C1Y A;  3FZ9 A;  2PWJ A;  3N5O A;  4TXV A;  4BWS A;  4PGT A;  2V1M A;  3FKF A;  5D8I A;  4E8H A;  5HFI A;  3KCM A;  5IIZ A;  3F4R A;  2I3Y A;  4G19 A;  1SD9 A;  3E3E A;  2BJX A;  2FY6 A;  1GSD A;  1PRX A;  3DXB A;  4DSS A;  1BG5 A;  5G5E A;  4FYU A;  2DSA A;  3DYR A;  3D21 A;  3KGK A;  1FO5 A;  2JZT A;  3GL5 A;  1XFL A;  1R4W A;  2REM A;  5ABR A;  2GZP A;  1X9M B;  2IMI A;  3FR6 A;  2WCI A;  1EOG A;  3LGC A;  4NAX A;  4IHU A;  3LYP A;  4ZXG A;  3VLN A;  2JU5 A;  6GSV A;  4PQH A;  2VCZ A;  19GS A;  5IO0 A;  5KEJ A;  5KN0 A;  2PGT A;  1UVZ A;  1F6M C;  3QMX A;  5J5N A;  3GHA A;  4BVX A;  3CXG A;  4K0G A;  5GZZ B;  2PU9 C;  3TJF A;  1EWX A;  2C4J A;  2K18 A;  4IGJ A;  2YV9 A;  3KD0 A;  2MMZ A;  1T8E B;  3BJ5 A;  3CRU A;  4LA1 A;  3HZ8 A;  2VL9 A;  2LRT A;  1XOA A;  2N5B A;  3WGE A;  3EIN A;  1ACV A;  2G0F A;  3C73 A;  1DSB A;  1U88 A;  3RHB A;  5CYY A;  1BQ7 A;  4WXT A;  2M46 A;  4G10 A;  5JWO B;  4JBB A;  3QDN A;  1F3A A;  1V40 A;  1OE8 A;  2WFC A;  3KZQ A;  4K9Z A;  1TDI A;  1DBY A;  2PBJ A;  1T1V A;  3ZVJ D;  2ALB A;  1X5E A;  4MF7 A;  3G9B A;  2VUP A;  4MF5 A;  4AGS A;  1GSE A;  2C8U A;  2CX3 A;  4F9Z A;  3N9J A;  2VM2 A;  1USB A;  3IE3 A;  3APS A;  5ECQ B;  1O6J A;  1B9X C;  3TGZ A;  4BVY A;  4YAV A;  2H01 A;  4IBP A;  1YF1 A;  1F37 A;  2LRC A;  4EDZ A;  1B8X A;  4GQF A;  1GTB A;  3R2Q A;  1VRS D;  2A4V A;  1FOV A;  4JU5 A;  1OYJ A;  2CZ3 A;  1G7O A;  4GLT A;  3FZ4 A;  2KUC A;  3FZA A;  2HZE B;  2G2Q A;  3FHK A;  4IS0 A;  2DIZ A;  1V58 A;  2K8S A;  3O76 A;  2H6Y A;  5C04 A;  3ZFB A;  3TOU A;  3MAK A;  2CVK A;  3IK9 A;  3VK9 A;  1VGL A;  3HXS A;  3C1R A;  5J9B A;  3UMA A;  3AY8 A;  2HT9 A;  4MA9 A;  3UIW A;  3HVS A;  2LKU A;  2WJU A;  2B5Y A;  5CO3 A;  4AF2 A;  1BAY A;  3P90 A;  3QAG A;  2VLT A;  2NPB A;  2VL2 C;  1VF4 A;  4V1A p;  5DQY A;  3WD6 A;  3ERG A;  1Z6M A;  1TU7 A;  3ZML A;  4YQU A;  1LJR A;  2GLR A;  1N8J A;  3DML A;  2HNL A;  2R5G A;  2FWF A;  3ISO A;  3CBU A;  3V1W A;  2HYX A;  1JZD A;  1M0U A;  3VWU A;  1J08 A;  3GIX A;  4AJ7 A;  5J3R A;  4IEL A;  4HJ2 A;  1YKC A;  3WGX A;  1A0F A;  4KAE A;  3ZMK A;  2YWM A;  4NPB A;  4FYB A;  1OAZ A;  1WJK A;  2C3T A;  3D4M A;  2PVQ A;  3KXO A;  1ERT A;  1TRU A;  5B6M A;  1EV4 A;  2XPD A;  2P5R A;  1SK1 A;  3BCI A;  2H76 A;  2F3M A;  4JR4 A;  3M8N A;  3DVW A;  2GTU A;  2OAD A;  2FA4 A;  2GVP A;  3M3M A;  1V2A A;  8GSS A;  4IQ1 A;  2LJA A;  3BCK A;  2OBI A;  5JWQ B;  2AHE A;  4ECJ A;  2C0D A;  2IPA A;  11GS A;  3KMO A;  4ZL9 A;  2H71 A;  2LST A;  4N11 A;  2NTO A;  5A4U A;  3TKS C;  3GL3 A;  1AC1 A;  4OO5 A;  3KH9 A;  2CA8 A;  1XOB A;  2WB9 A;  2XHF A;  1M2A A;  2C3N A;  4X1U A;  4ZIL A;  1E6B A;  22GS A;  3QD9 A;  2E2G A;  2VCT A; 
#chains in the Genus database with same CATH topology
 3TRQ A;  1XW9 A;  2JSZ A;  3KH7 A;  3Q6O A;  3D6I A;  1HNA A;  4BL7 A;  2JL4 A;  2HRN A;  4FIW A;  4L0U A;  2I9H A;  2Z9S A;  2DML A;  5ENU A;  2H75 A;  4WBJ A;  1ST9 A;  4KDU A;  3TKP A;  3TKQ A;  3VI7 A;  4RQX A;  1B9Y C;  2VM1 A;  3BOA A;  4O5R A;  3LSZ A;  2MZC A;  3J7Y b;  2E2M A;  3FRC A;  3APQ A;  1R5P A;  2YJH A;  4KGI A;  1TJV A;  1XVQ A;  3F3Q A;  2R2J A;  2JAU A;  3DEX A;  5G30 A;  2QKE A;  1GUK A;  1FUO A;  1ILO A;  4I6X A;  2FCH A;  4TR1 B;  2B7J A;  2JSY A;  4HGV A;  1S3C A;  3RAZ A;  5IOX A;  1XW6 A;  3IC4 A;  3TJB A;  1FVK A;  3I69 A;  1YF0 A;  1EOH A;  4WKW A;  4IP1 A;  1O8X A;  1M2B A;  6GSW A;  3GN3 A;  4KCE A;  1TRW A;  4FYC A;  1PA3 A;  1UC7 A;  4EUY A;  3U19 A;  3Q19 A;  4N0Z A;  12GS A;  3RPN A;  1TTZ A;  3E9J B;  2HSM A;  1Z7R A;  2QGV A;  5B8B A;  4ZL7 A;  3TKS E;  1ABA A;  3CYN A;  1BX9 A;  4KX4 A;  3UEM A;  5CP1 A;  4MP4 A;  2VL2 A;  3HVV A;  5A4W A;  1QUW A;  3CTG A;  4JED A;  3D0Z A;  3DKS A;  3GSS A;  5D96 A;  1DUG A;  1GTI A;  5ELG A;  2X64 A;  3DD3 A;  5AN1 A;  3F9U A;  4Z2U A;  4L5L A;  2PFM A;  1S3D A;  2F51 A;  2JAC A;  3GH9 A;  1ZMA A;  2P31 A;  2QA1 A;  1HY0 A;  1GSQ A;  5IO2 A;  3A2W A;  3M0F A;  4MNN A;  3D4T A;  2J9H A;  2D2Z A;  4TRX A;  1XCC A;  1XWB A;  2ZNM A;  5HR2 A;  3KTL A;  4ECI A;  4HJM A;  7GSS A;  3TJK A;  1Z4K A;  1PFO A;  4MZW A;  2CV4 A;  4OCE A;  2EIQ A;  2YPM A;  1SJ6 A;  3GX8 A;  1CQG A;  1M2D A;  1H4O A;  2H0H A;  3K8N A;  2FWH A;  1UN2 A;  1O85 A;  3ZFL A;  2YWI A;  3QFA C;  5HR3 A;  5D9X A;  3ZIT A;  4YQV A;  3IHQ A;  1PL1 A;  3F6D A;  1K3L A;  3ZIV A;  4K2D A;  3G7I A;  5ECP B;  3CRT A;  3KM6 A;  4X4J A;  1TKD B;  2VCQ A;  3D5J A;  5ECN B;  1GUM A;  4ID0 A;  2EIR A;  6GSU A;  2WUL A;  4TR0 A;  2N5F A;  3R6V A;  4LLR A;  6GST A;  3F4S A;  5DAL B;  2I81 A;  4ZB9 A;  3TV2 A;  2L5L A;  3HDC A;  4K2X A;  1XPV A;  2VLV A;  2F8F A;  1SKW B;  1SK2 A;  5J4U A;  6GSS A;  4Q5Q A;  1EEM A;  4OWY A;  3EVI A;  2X8C A;  5ECI B;  18GS A;  2VOC A;  3GH6 A;  1FUR A;  4KSM A;  1VF3 A;  5BRT A;  1TJW A;  2MMN A;  3HJM A;  1YFM A;  2RM6 A;  2X99 A;  5EY6 A;  3CQF A;  2AV4 A;  4G9H A;  4O5Q A;  4FQU A;  3L9V A;  5ECM B;  2B3S A;  1Z7P A;  2V2G A;  1MDJ A;  5B6N A;  4XS4 B;  1XIY A;  1XWA A;  3BHG A;  5AGY A;  4KUN A;  1SKS B;  1YJ6 A;  2R3X A;  1JLV A;  1G0T A;  3TOT A;  4YAP A;  1AUC A;  1WE0 A;  4G2E A;  1K3O A;  2HRF A;  5EL8 A;  1R26 A;  1ZYE A;  3EC3 A;  4ZL8 A;  2AB6 A;  1AXD A;  4IJ3 A;  5IPH A;  2XPE A;  1DE1 A;  2GQL A;  1WP0 A;  4GSS A;  2AJQ B;  3G7Y A;  4PTS A;  2O85 A;  2C0G A;  3FR9 A;  3BD2 A;  2RCN A;  3C8E A;  2FWE A;  1FB0 A;  6GSX A;  4O5U A;  2PPT A;  2DJJ A;  2HZE A;  2DIY A;  2YZU A;  1TJU A;  2FWG A;  2IFQ B;  3GTU A;  1R7H A;  1T00 A;  4A5P A;  2LNS A;  4OFN A;  5IQY A;  3NIV A;  4NXI A;  1J9B A;  1TI1 A;  1EV9 A;  4WR4 A;  2H1G A;  1JFU A;  4NHW A;  3ERW A;  3CI0 K;  1JZR A;  2B1L A;  1MDK A;  2H1D A;  1NW2 A;  4EDY A;  3KEB A;  2KLX A;  4ULX A;  4XIH A;  1YY7 A;  9GSS A;  4MH2 A;  3A5W A;  3DIE A;  2JAO A;  4ZIJ A;  3MSZ A;  1KQ7 A;  1YKA A;  4KCA A;  3VWX A;  4N0V A;  2FHE A;  2ES7 A;  2MBT A;  1GUH A;  4K6X A;  4TXO B;  2VO4 A;  1K0D A;  3ERF A;  5DAK A;  1K62 A;  3LW9 A;  1AW9 A;  1GRX A;  1M7T A;  4USS A;  1JLW A;  2GST A;  2LNT A;  4NSL A;  2GZZ A;  2LQO A;  1TXX A;  4KSO A;  3W8S A;  1Q98 A;  4I2U A;  4MJC A;  3HVX A;  3CTF A;  1KTE A;  1OKT A;  3GKM A;  5BMU A;  5JCW A;  4MF6 A;  4TN8 A;  2PUK C;  3IBH A;  4ZB6 A;  3US3 A;  4K7O A;  3TDG A;  3IA1 A;  4AJ6 A;  2IL3 A;  3GNJ A;  5B7C A;  5A5K A;  4K7N A;  4MDC A;  3TRP A;  1GNW A;  5CNW A;  1SD8 A;  3SWL A;  1WWJ A;  3UVT A;  2PTR A;  2EC4 A;  4J57 E;  3WGD A;  4D73 A;  1GUL A;  2DKI A;  3EYT A;  5FHI A;  3FK8 A;  5A4V A;  3HJP A;  1A23 A;  4PX1 A;  2J23 A;  2DLX A;  4IQJ M;  2GZY A;  4NMU A;  4J56 E;  1K0M A;  2LV3 A;  1EGO A;  2RLI A;  2X8H A;  4MLY A;  3PIN A;  1SJZ A;  1MEK A;  4MZB A;  1Z6N A;  2IIY A;  3F6F A;  1AAZ A;  4H86 A;  1M9B A;  5EVO A;  2R0G A;  3IV4 A;  4XHM A;  3TJJ A;  1F9M A;  4F0C A;  1KBN A;  3A2X A;  2HI7 A;  2PMT A;  4X43 A;  10GS A;  1ZCP A;  1SL0 B;  4DSR A;  4TVE A;  3L78 A;  4BVX B;  2F9S A;  3GKK A;  1OC9 B;  4OFM A;  3S9F A;  3OCF A;  4PUR A;  4ADL A;  3H79 A;  2ZUP A;  3WT2 A;  1V9W A;  1K0C A;  1FHE A;  20GS A;  3VUR A;  1KEB A;  1TJ7 A;  3DVX A;  5IMV A;  4Z2T A;  1UA5 A;  1EZK A;  2VCV A;  2C0E A;  4LL1 B;  2IMK A;  3OR5 A;  5IMZ A;  2OAC A;  3FZ5 A;  3ZIJ A;  4MPG A;  4NV5 A;  2TIR A;  4V1A g;  2FGX A;  4BIK A;  4EFC A;  5JCG A;  3QFB C;  1JZW A;  4L57 A;  3GUR A;  2X4A A;  1VDK A;  3TKR A;  1U6T A;  5G2Z A;  4Q5R A;  3ZZX A;  1CQH A;  1TRS A;  5JCU A;  3LOR A;  4BA7 A;  3UBL A;  3C1S A;  1R5A A;  3M1G A;  2GS3 A;  1GSY A;  1URM A;  4RUV A;  2DJK A;  4YKF A;  1N2A A;  4WEY A;  2TRX A;  1ZYP A;  3FR3 A;  5H5R A;  5CRG A;  1XWG A;  5F8B A;  1C3C A;  3KP8 A;  5IMA A;  1IW7 D;  1M99 A;  3EWL A;  2K9F A;  1WMJ A;  1SK0 A;  4JE1 A;  1AIU A;  2TRC P;  1Y6E A;  4G0I A;  2AAW A;  3GST A;  2M80 A;  3IDV A;  4N10 A;  3ZRD A;  4HU9 A;  4ML6 A;  3VI5 A;  2IJY A;  2RII A;  4E8E A;  3QOU A;  2MYG A;  2ZCT A;  14GS A;  2FUG 2;  2PVO C;  2GQM A;  4GRF A;  2HSY A;  1U3A A;  1W89 A;  1TU8 A;  2QSI A;  4F2I A;  4N30 A;  1K0B A;  2B1K A;  1Q4J A;  1EEJ A;  2D27 A;  4Z7X A;  1GLQ A;  1ZZY A;  4EKZ A;  2A2S A;  1SL1 B;  2H30 A;  1TOF A;  1TK5 B;  1GH2 A;  5HR1 A;  3RDW A;  1XBS A;  4TKY A;  2H73 A;  4HZ4 A;  1NHY A;  5ID2 B;  1Z4L A;  1G6W A;  3KP9 A;  2L4Q A;  3GKX A;  4NHZ A;  2R0C A;  2LJK A;  4V2N A;  4KF9 A;  2LQQ A;  1PD2 1;  2R37 A;  2RUE A;  2E7P A;  3PH9 A;  3O3T A;  3Q74 A;  1FB6 A;  3BBY A;  3PR8 A;  1OKD A;  3CSJ A;  4KDY A;  1XW5 A;  1QQ2 A;  3CSI A;  4BWQ A;  3FW2 A;  1FW1 A;  3DWV A;  5LNK e;  1JHB A;  2LUS A;  1A24 A;  2LJR A;  4RI7 A;  1WIK A;  4HS1 A;  3A2V A;  2DJ2 A;  4TR3 A;  4MH3 A;  2ON5 A;  4HDE A;  2DBC A;  1EGR A;  3OCE A;  1OE7 A;  1TP9 A;  4MJE A;  1PN0 A;  1FUP A;  5DBQ A;  4FO5 A;  4K0N A;  2PN8 A;  2GSQ A;  2AUV A;  3G7J A;  3I9V 2;  4GST A;  1Q91 A;  1BED A;  2M72 A;  4L5O A;  5DAL A;  3ZRE A;  4G0L A;  2H74 A;  3TRX A;  2PER A;  3LXT A;  5G1K A;  1XWC A;  3EMP A;  1TJD A;  3F63 A;  2FD3 A;  1PSQ A;  5F07 A;  2GGT A;  2LTK A;  3ZVJ A;  5DJL A;  2OKA A;  4O7H A;  2CQ9 A;  1ZGN A;  1M3J A;  4ZBB A;  4IJI A;  4MK3 A;  5J41 A;  4L8E A;  5CAX A;  1EP8 A;  5DCH A;  2HLS A;  1JSW A;  4CY6 A;  4DSQ A;  3MYD A;  4YH2 A;  2DJ3 A;  2H6Z A;  3U13 A;  2FLS A;  1WOU A;  3HA9 A;  3GKN A;  3LYK A;  1IYH A;  4XS4 A;  1KNG A;  4I97 A;  4GF0 A;  2A2R A;  2YJ7 A;  1YQ1 A;  4HQZ A;  1MD3 A;  2P0G A;  2VCX A;  3VPQ A;  3U5R E;  1F2E A;  1T4Z A;  2OBK A;  4MPF A;  3L0H A;  1W4V A;  3M9J A;  4MAB A;  3PGT A;  2L57 A;  3ME8 A;  3NOF A;  4POK A;  3BWV A;  3IPZ A;  3TCO A;  1FG4 A;  3FY7 A;  2IN3 A;  5FWG A;  3L9U A;  1ON4 A;  2FUS A;  2GQK A;  1X9W B;  4HZ2 A;  4OD7 A;  2H72 A;  1A8Y A;  5IPG A;  5GSS A;  3QCP A;  4EVM A;  3MDK A;  3QPM A;  4HU7 A;  5KN1 A;  4EL1 A;  4EEI A;  2O89 A;  5DJM A;  4ECC A;  2B5X A;  3UVH A;  2B5E A;  4Z2R A;  1F3B A;  2IMF A;  2GSS A;  4L0W A;  5D9W A;  3DGQ A;  4XS6 A;  4JRR A;  1J0F A;  3HKR A;  4HUA A;  2DMM A;  2HFD A;  3EMX A;  3LXZ A;  1T4Y A;  3EPT A;  1PKZ A;  2CX4 A;  4KA0 A;  2FA8 A;  2X75 A;  4ZB8 A;  2ON7 A;  2O87 A;  3FMW A;  4XS1 A;  1MH9 A;  1QXH A;  4TXO A;  1Z4M A;  4CHS A;  3C8T A;  3GUS A;  5ECS A;  4I5Q A;  1QFN A;  5D6B A;  17GS A;  5INY A;  5AIS A;  4KND A;  4P3Y B;  3LQ7 A;  3FYG A;  3P8W A;  5CRH A;  2K6V A;  5L71 A;  3R3E A;  2HZF A;  1AQV A;  2O8V B;  2RUF A;  3TJG A;  2GSR A;  5HR0 A;  4FH8 A;  5GAP D;  5D9T A;  3L9S A;  2VL3 A;  2H66 A;  3MWH A;  4MJB A;  4WF5 A;  3O6T A;  5LCZ A;  4PQI A;  4YKG A;  5CRD A;  1X5C A;  2F8A A;  1GSF A;  3RPP A;  3RHC A;  16GS A;  1YFE A;  3GYK A;  3HVN A;  1SJI A;  3E0U A;  1XWK A;  4GSN A;  1Q92 A;  5COH A;  5AIV A;  2L59 A;  4ML1 A;  2H70 A;  4NLE A;  2JZS A;  3UL3 A;  3KTB A;  1PKW A;  1QMV A;  2OJL A;  3IOS A;  1GSU A;  2BTO T;  2NVL A;  4HI7 A;  1IYI A;  1S3A A;  4WF4 A;  1HYU A;  1PN9 A;  2JAD A;  3GFK A;  1FUQ A;  3GMF A;  1O73 A;  4Q5N A;  2GDR A;  5G1L A;  5D73 A;  5KOX A;  2XC2 A;  1I9D A;  3KIJ A;  4NFL A;  4IVF A;  2L5O A;  2LS5 A;  1OC9 A;  2HE3 A;  2A2P A;  4XCS A;  5IM9 A;  1GLP A;  2O7K A;  1SL2 B;  2C80 A;  4F03 A;  5HFG A;  4APB A;  2I1U A;  3GZH A;  2DC5 A;  1THX A;  3RBT A;  2H0I A;  3RD8 A;  2H1B A;  2AYT A;  3H93 A;  5E59 A;  3WYW A;  2XBI A;  2HRK A;  5G31 A;  1TW9 A;  2JAW A;  3L4N A;  4MX2 A;  4XRD A;  1RK4 A;  1GTU A;  4V2L A;  5E4W A;  2FNO A;  1A2M A;  3HD5 A;  2GT6 A;  1GL8 A;  4NWY A;  4PNG A;  4PUF C;  3ZLP A;  1X0R A;  1XZO A;  1O8W A;  4J2F A;  1HQO A;  2KP2 A;  5KN2 A;  1GNE A;  4DSS B;  3HJO A;  5IOW A;  2BMX A;  4IN0 A;  2HXK A;  4EO3 A;  2C3Q A;  4ILF A;  2YP6 A;  5HFK A;  3ZL5 A;  3APO A;  4K8M A;  4IKH A;  2WS2 A;  2R4V A;  2H6X A;  3VWW A;  3RRP A;  1HNC A;  4MCU A;  1QK8 A;  3I6A A;  1BJX A;  2CAQ A;  1BYE A;  4MZC A;  3IRA A;  2CT6 A;  1OVN A;  2E0Q A;  3GTU B;  1WPI A;  4HOJ A;  4X0X A;  1GP1 A;  3H4K A;  5DCG A;  1ZL9 A;  5CRE A;  4I2T A;  3UAR A;  5F06 A;  4HQS A;  5GAN D;  5ID2 A;  1ERV A;  2YNX A;  2OE3 A;  4KB3 A;  1PX7 A;  5LD0 A;  1WRY A;  1SYX A;  3W6G A;  2R6K A;  2JZR A;  3H8Q A;  1TK8 B;  2H8L A;  3A5I A;  2IMD A;  4MMM A;  1H75 A;  4POM A;  2C0F A;  3GX0 A;  1GTA A;  1A2J A;  1PMT A;  3EE2 A;  4OFT A;  4TR1 A;  2KOK A;  4MJA A;  2CVB A;  3TUE A;  4XTS A;  2VD1 A;  4TOP A;  4ZBA A;  5DAK B;  2OA7 A;  4LL4 B;  1A2L A;  1ML6 A;  3UBK A;  3ZYW A;  1MDI A;  4O92 A;  1B48 A;  2VAF A;  1XXU A;  1X5D A;  3E04 A;  4OMV A;  1XVW A;  2QA2 A;  3ED3 A;  3F3R A;  3LEF A;  1PL2 A;  1YDK A;  2VD0 A;  2VLU A;  3HZ4 A;  2NBS A;  1M9A A;  4K7I A;  2OE0 A;  1V98 A;  3IAS 2;  2WZ9 A;  3UOM A;  5IMD A;  1JZO A;  1V57 A;  3CMI A;  1MD4 A;  3GA4 A;  1U15 A;  1ERU A;  3FEU A;  1U87 A;  1DOF A;  3DRN A;  1Q5N A;  3D22 A;  3VWV A;  3QAW A;  2YAN A;  1B4P A;  4BVY B;  3JCM L;  1TI3 A;  4YQM A;  2RM5 A;  4D73 B;  3NO9 A;  1A8L A;  4GTU A;  6GSY A;  5CRW A;  1E2Y A;  1G6Y A;  3GV1 A;  5DVB A;  2IWT A;  1U3I A;  2IME A;  5G5F A;  5H5S A;  1DE2 A;  5HQP A;  4HSC X;  3IC8 A;  3M9K A;  2B7K A;  1SYR A;  1TK0 B;  5GST A;  4JZQ A;  5IMF A;  1THO A;  1AQX A;  5DDL A;  2HSH A;  2NDO A;  4JR6 A;  4ACS A;  5ECH B;  4QL7 A;  13GS A;  4WET A;  4YIH A;  5J9C A;  4EE0 A;  3IHG A;  3EU4 A;  3J7Y k;  4QL9 A;  3WT1 A;  1Z5Y E;  4V2M A;  2KP1 A;  4HEA 2;  1B4Q A;  2PTS A;  2DKH A;  1HNB A;  3EU3 A;  4PQ1 A;  4POB A;  1Z4I A;  5DQS A;  2CVD A;  4AJ8 A;  1GWC A;  4K1F A;  3F8U A;  5EPF A;  4DVC A;  2YZH A;  4APA A;  2V32 A;  1FOH A;  1PGT A;  4CW9 A;  2DJ0 A;  2DJ1 A;  2WRT A;  1O7U A;  5FT3 A;  4ADM A;  2QGA B;  1VF1 A;  4LMV A;  1Z9H A;  2CZ2 A;  2P5Q A;  4BPY A;  3HY2 A;  3ZTL A;  2QC7 A;  4F82 A;  3P7X A;  2YCD A;  4GCI A;  4WBR D;  2N5A A;  2K8V A;  2MBS A;  3HCZ A;  3KMN A;  5H5Q A;  1EP7 A;  1SEN A;  3C7M A;  3I43 A;  1YZX A;  2H0G A;  3LWA A;  1K0N A;  3ME7 A;  4MWO A;  2CAI A;  3PPU A;  5KN3 A;  2MMA A;  1NSW A;  2L4C A;  3IR4 A;  1SKR B;  1ZOF A;  2L6D A;  2H19 A;  1S3R A;  2OE1 A;  1Y25 A;  2V41 A;  4F0B A;  2PTQ A;  5D93 A;  1I5G A;  1K3Y A;  3LFL A;  1T7P B;  2LRN A;  4DEJ A;  3LG6 A;  3MNG A;  1Z4P X;  5F92 A;  1K0A A;  4GQC A;  2V6K A;  1DCN A;  3VFI A;  4OO4 A;  2VIM A;  4PUA A;  4PNF A;  2I7D A;  3SBC A;  3H1N A;  2MMO A;  4PXO A;  2UZ8 A;  5AIX A;  1MTC A;  5F0G A;  3UJ1 A;  3IAM 2;  2LEG A;  2E9F A;  2X49 A;  5C00 A;  2X8G A;  3QAV A;  4EF0 A;  2XBQ A;  4IP6 A;  1FAA A;  1XG8 A;  4KE3 A;  5ECR B;  3F4T A;  4LMW A;  2VCW A;  4WR5 A;  2H1A A;  1K0O A;  4Q5F A;  1OC8 A;  1YEP A;  3VPT A;  4ECB A;  4RQR A;  3C71 A;  1VF2 A;  3LJR A;  3KJY A;  4I8B A;  4BL7 B;  3TB2 A;  1I0A A;  3HYP A;  4KW6 A;  1LBK A;  4TR4 A;  3CSH A;  1NM3 A;  1NHO A;  1ZYQ B;  1G7E A;  4NV2 A;  1SU9 A;  1GSS A;  5ECK B;  4OCF A;  4RI6 A;  3HHV A;  1C72 A;  4GXZ A;  1AUW A;  3P2A A;  3UAP A;  3A3T A;  2YWO A;  1PQN A;  4CDO A;  5ECL B;  2IFQ A;  5KOW A;  2EIO A;  5JWR B;  4ZBD A;  1Z3E A;  1OC3 A;  4POL A;  1PX6 A;  1X9S B;  3U6V A;  4QQ7 A;  2GT5 A;  1O81 A;  4IW9 A;  4XRA A;  1RW1 A;  1M3I A;  1AQW A;  3NZN A;  3TKS A;  2L6C A;  1A0R P;  5IMC A;  2V6O A;  3QR6 A;  3MIX A;  3F0I A;  5ECO B;  3GRX A;  4EXJ A;  4GWR A;  1YEX A;  4ISD A;  1J3U A;  2YWN A;  2I4A A;  1HD2 A;  4TW5 A;  2WDU A;  2YOI A;  2D28 C;  3IK7 A;  1ERW A;  4IQA A;  2WGR A;  2YV7 A;  5D9V A;  5ELA A;  4KH7 A;  3EUR A;  4EC0 A;  1TRV A;  3IXR A;  1RQM A;  5F05 A;  1T3B A;  3Q18 A;  1QGV A;  2KHP A;  3W8J A;  5B8A A;  1LU4 A;  2YN1 A;  1FVJ A;  4O32 A;  1Z4Q A;  2B6M A;  4KDX A;  2C1Y A;  3FZ9 A;  2PWJ A;  3N5O A;  4TXV A;  4BWS A;  4PGT A;  2V1M A;  1C3U A;  3FKF A;  5D8I A;  4E8H A;  5HFI A;  3KCM A;  5IIZ A;  5HW2 A;  4E88 A;  3F4R A;  2I3Y A;  4G19 A;  1SD9 A;  3E3E A;  2BJX A;  2FY6 A;  1GSD A;  1PRX A;  3DXB A;  4DSS A;  1BG5 A;  5G5E A;  4FYU A;  2DSA A;  1U16 A;  3DYR A;  3D21 A;  3KGK A;  2YV5 A;  4YIK A;  1FO5 A;  2JZT A;  3GL5 A;  1XFL A;  1R4W A;  2REM A;  5ABR A;  2GZP A;  1X9M B;  2IMI A;  3FR6 A;  2WCI A;  1EOG A;  3LGC A;  4NAX A;  4IHU A;  3LYP A;  4ZXG A;  3VLN A;  2JU5 A;  4MUM A;  6GSV A;  4PQH A;  2VCZ A;  2A4H A;  19GS A;  5IO0 A;  5KEJ A;  5KN0 A;  2PGT A;  1UVZ A;  1HY1 A;  1F6M C;  3QMX A;  1RE5 A;  5J5N A;  3GHA A;  4BVX A;  3CXG A;  4K0G A;  5GZZ B;  2PU9 C;  3TJF A;  1EWX A;  2R0P A;  2C4J A;  2K18 A;  4IGJ A;  2YV9 A;  3KD0 A;  2MMZ A;  1T8E B;  3BJ5 A;  1U0L A;  3CRU A;  4LA1 A;  3HZ8 A;  3QBP A;  1Z4J A;  2VL9 A;  2LRT A;  1XOA A;  2N5B A;  3WGE A;  1K7W A;  3EIN A;  1ACV A;  2G0F A;  3C73 A;  1DSB A;  1U88 A;  3RHB A;  5CYY A;  3GTD A;  1BQ7 A;  4WXT A;  2M46 A;  4G10 A;  5JWO B;  4JBB A;  3QDN A;  1F3A A;  1V40 A;  1OE8 A;  2WFC A;  3KZQ A;  4K9Z A;  1TDI A;  1DBY A;  2PBJ A;  1T1V A;  4K5S A;  3ZVJ D;  2ALB A;  1X5E A;  4MF7 A;  3G9B A;  2VUP A;  4MF5 A;  4AGS A;  1GSE A;  2C8U A;  2CX3 A;  4F9Z A;  3N9J A;  2VM2 A;  1USB A;  3IE3 A;  3APS A;  5ECQ B;  1O6J A;  1B9X C;  3TGZ A;  4BVY A;  4YAV A;  2H01 A;  4IBP A;  1YF1 A;  1F37 A;  2LRC A;  4EDZ A;  1B8X A;  4GQF A;  1GTB A;  3R2Q A;  1VRS D;  2A4V A;  2HRA A;  1FOV A;  4JU5 A;  4L6A A;  1OYJ A;  2CZ3 A;  3R6Q A;  1G7O A;  4L6C A;  4GLT A;  3FZ4 A;  2KUC A;  3FZA A;  2HZE B;  2G2Q A;  3FHK A;  4IS0 A;  2DIZ A;  1V58 A;  2K8S A;  3O76 A;  2H6Y A;  5C04 A;  3ZFB A;  5F91 A;  3TOU A;  3MAK A;  2CVK A;  3IK9 A;  3VK9 A;  1VGL A;  3HXS A;  3C1R A;  5J9B A;  3UMA A;  3AY8 A;  2HT9 A;  1ZYN A;  4MA9 A;  3UIW A;  3HVS A;  2LKU A;  2WJU A;  2B5Y A;  5CO3 A;  4AF2 A;  1BAY A;  3P90 A;  3QAG A;  2VLT A;  2NPB A;  2VL2 C;  4EIP A;  1VF4 A;  4ICY A;  4V1A p;  5DQY A;  3WD6 A;  4EIQ A;  3ERG A;  1Z6M A;  1TU7 A;  3ZML A;  4YQU A;  1LJR A;  2GLR A;  1N8J A;  4CY8 A;  3DML A;  2HNL A;  2R5G A;  2FWF A;  3ISO A;  3CBU A;  3V1W A;  2HYX A;  1JZD A;  1M0U A;  3VWU A;  1J08 A;  3GIX A;  4AJ7 A;  5J3R A;  4IEL A;  4HJ2 A;  1YKC A;  3WGX A;  1A0F A;  4KAE A;  3ZMK A;  2YWM A;  4NPB A;  4FYB A;  1OAZ A;  1WJK A;  2C3T A;  3D4M A;  2PVQ A;  3KXO A;  1ERT A;  1TRU A;  5B6M A;  1EV4 A;  2XPD A;  2P5R A;  1SK1 A;  3BCI A;  2H76 A;  2F3M A;  4G0K A;  4JR4 A;  3M8N A;  3DVW A;  2GTU A;  2OAD A;  2FA4 A;  2GVP A;  3M3M A;  1V2A A;  8GSS A;  4IQ1 A;  2LJA A;  2JAR A;  3BCK A;  2OBI A;  5JWQ B;  2AHE A;  4ECJ A;  2C0D A;  4K5R A;  2IPA A;  11GS A;  3KMO A;  4ZL9 A;  2H71 A;  2LST A;  2HVG A;  4N11 A;  2NTO A;  5A4U A;  1T9H A;  3TKS C;  3GL3 A;  1AC1 A;  4OO5 A;  3KH9 A;  2CA8 A;  1XOB A;  2WB9 A;  2XHF A;  1XWO A;  1M2A A;  2C3N A;  4X1U A;  4ZIL A;  1E6B A;  22GS A;  3QD9 A;  2E2G A;  2VCT A; 
#chains in the Genus database with same CATH homology
 3TRQ A;  1XW9 A;  2JSZ A;  3KH7 A;  3Q6O A;  3D6I A;  1HNA A;  4BL7 A;  2JL4 A;  2HRN A;  4FIW A;  4L0U A;  2I9H A;  2Z9S A;  2DML A;  5ENU A;  2H75 A;  4WBJ A;  1ST9 A;  4KDU A;  3TKP A;  3TKQ A;  3VI7 A;  4RQX A;  1B9Y C;  2VM1 A;  3BOA A;  4O5R A;  3LSZ A;  2MZC A;  3J7Y b;  2E2M A;  3FRC A;  3APQ A;  1R5P A;  2YJH A;  4KGI A;  3F3Q A;  1XVQ A;  2R2J A;  3DEX A;  5G30 A;  2QKE A;  1GUK A;  1ILO A;  4I6X A;  2FCH A;  4TR1 B;  2B7J A;  2JSY A;  1S3C A;  3RAZ A;  5IOX A;  1XW6 A;  3IC4 A;  3TJB A;  1FVK A;  3I69 A;  1YF0 A;  1EOH A;  4WKW A;  4IP1 A;  1O8X A;  1M2B A;  6GSW A;  3GN3 A;  4KCE A;  1TRW A;  4FYC A;  1PA3 A;  1UC7 A;  4EUY A;  3Q19 A;  4N0Z A;  12GS A;  3RPN A;  1TTZ A;  3E9J B;  2HSM A;  1Z7R A;  2QGV A;  5B8B A;  4ZL7 A;  3TKS E;  1ABA A;  3CYN A;  1BX9 A;  4KX4 A;  3UEM A;  5CP1 A;  4MP4 A;  2VL2 A;  3HVV A;  5A4W A;  1QUW A;  3CTG A;  4JED A;  3D0Z A;  3DKS A;  3GSS A;  5D96 A;  1DUG A;  1GTI A;  5ELG A;  2X64 A;  3DD3 A;  5AN1 A;  3F9U A;  4Z2U A;  4L5L A;  1S3D A;  2F51 A;  2JAC A;  3GH9 A;  1ZMA A;  2P31 A;  2QA1 A;  1GSQ A;  5IO2 A;  3A2W A;  3M0F A;  4MNN A;  3D4T A;  2J9H A;  2D2Z A;  4TRX A;  1XCC A;  1XWB A;  2ZNM A;  5HR2 A;  3KTL A;  4ECI A;  4HJM A;  7GSS A;  3TJK A;  4MZW A;  2CV4 A;  4OCE A;  2EIQ A;  2YPM A;  1SJ6 A;  3GX8 A;  1CQG A;  1M2D A;  1H4O A;  2H0H A;  3K8N A;  2FWH A;  1UN2 A;  1O85 A;  3ZFL A;  2YWI A;  3QFA C;  5HR3 A;  5D9X A;  3ZIT A;  4YQV A;  3IHQ A;  1PL1 A;  3F6D A;  1K3L A;  3ZIV A;  4K2D A;  3G7I A;  5ECP B;  3CRT A;  3KM6 A;  4X4J A;  1TKD B;  2VCQ A;  3D5J A;  5ECN B;  1GUM A;  4ID0 A;  2EIR A;  6GSU A;  2WUL A;  4TR0 A;  2N5F A;  4LLR A;  6GST A;  3F4S A;  5DAL B;  2I81 A;  4ZB9 A;  2L5L A;  3HDC A;  4K2X A;  1XPV A;  2VLV A;  2F8F A;  1SKW B;  1SK2 A;  5J4U A;  6GSS A;  4Q5Q A;  1EEM A;  4OWY A;  3EVI A;  2X8C A;  5ECI B;  18GS A;  2VOC A;  3GH6 A;  4KSM A;  1VF3 A;  5BRT A;  2MMN A;  3HJM A;  2RM6 A;  2X99 A;  5EY6 A;  2AV4 A;  4G9H A;  4O5Q A;  4FQU A;  3L9V A;  5ECM B;  2B3S A;  1Z7P A;  2V2G A;  1MDJ A;  5B6N A;  4XS4 B;  1XIY A;  1XWA A;  5AGY A;  4KUN A;  1SKS B;  1YJ6 A;  2R3X A;  1JLV A;  1G0T A;  3TOT A;  4YAP A;  1AUC A;  1WE0 A;  4G2E A;  1K3O A;  2HRF A;  5EL8 A;  1R26 A;  1ZYE A;  3EC3 A;  4ZL8 A;  2AB6 A;  1AXD A;  4IJ3 A;  5IPH A;  2XPE A;  1DE1 A;  2GQL A;  1WP0 A;  4GSS A;  2AJQ B;  3G7Y A;  4PTS A;  2O85 A;  2C0G A;  3FR9 A;  3BD2 A;  3C8E A;  2FWE A;  1FB0 A;  6GSX A;  4O5U A;  2PPT A;  2DJJ A;  2HZE A;  2DIY A;  2YZU A;  2FWG A;  2IFQ B;  3GTU A;  1R7H A;  1T00 A;  4A5P A;  2LNS A;  4OFN A;  5IQY A;  3NIV A;  4NXI A;  1J9B A;  1TI1 A;  1EV9 A;  4WR4 A;  2H1G A;  1JFU A;  4NHW A;  3ERW A;  1JZR A;  2B1L A;  1MDK A;  2H1D A;  1NW2 A;  4EDY A;  3KEB A;  2KLX A;  4ULX A;  4XIH A;  1YY7 A;  9GSS A;  4MH2 A;  3A5W A;  3DIE A;  4ZIJ A;  3MSZ A;  1YKA A;  4KCA A;  3VWX A;  4N0V A;  2FHE A;  2ES7 A;  2MBT A;  1GUH A;  4K6X A;  4TXO B;  2VO4 A;  1K0D A;  3ERF A;  5DAK A;  3LW9 A;  1AW9 A;  1GRX A;  1M7T A;  4USS A;  1JLW A;  2GST A;  2LNT A;  2GZZ A;  2LQO A;  1TXX A;  4KSO A;  3W8S A;  1Q98 A;  4I2U A;  4MJC A;  3HVX A;  3CTF A;  1KTE A;  1OKT A;  3GKM A;  5BMU A;  5JCW A;  4MF6 A;  4TN8 A;  2PUK C;  3IBH A;  4ZB6 A;  3US3 A;  4K7O A;  3TDG A;  3IA1 A;  4AJ6 A;  2IL3 A;  3GNJ A;  5B7C A;  5A5K A;  4K7N A;  4MDC A;  3TRP A;  1GNW A;  5CNW A;  1SD8 A;  3SWL A;  1WWJ A;  3UVT A;  2EC4 A;  4J57 E;  3WGD A;  4D73 A;  1GUL A;  2DKI A;  3EYT A;  5FHI A;  3FK8 A;  5A4V A;  3HJP A;  1A23 A;  4PX1 A;  2J23 A;  2DLX A;  4IQJ M;  2GZY A;  4NMU A;  4J56 E;  1K0M A;  2LV3 A;  1EGO A;  2RLI A;  2X8H A;  4MLY A;  3PIN A;  1SJZ A;  1MEK A;  4MZB A;  1Z6N A;  2IIY A;  3F6F A;  1AAZ A;  4H86 A;  1M9B A;  5EVO A;  2R0G A;  3IV4 A;  4XHM A;  3TJJ A;  1F9M A;  4F0C A;  1KBN A;  3A2X A;  2HI7 A;  2PMT A;  4X43 A;  10GS A;  1ZCP A;  1SL0 B;  4DSR A;  4TVE A;  3L78 A;  4BVX B;  2F9S A;  3GKK A;  1OC9 B;  4OFM A;  3S9F A;  4PUR A;  3H79 A;  2ZUP A;  3WT2 A;  1V9W A;  1K0C A;  1FHE A;  20GS A;  3VUR A;  1KEB A;  3DVX A;  5IMV A;  4Z2T A;  1UA5 A;  1EZK A;  2VCV A;  2C0E A;  4LL1 B;  2IMK A;  3OR5 A;  5IMZ A;  2OAC A;  3FZ5 A;  3ZIJ A;  4MPG A;  4NV5 A;  2TIR A;  4V1A g;  2FGX A;  5JCG A;  3QFB C;  1JZW A;  3GUR A;  2X4A A;  3TKR A;  1U6T A;  5G2Z A;  4Q5R A;  3ZZX A;  1CQH A;  1TRS A;  5JCU A;  3LOR A;  4BA7 A;  3UBL A;  3C1S A;  1R5A A;  3M1G A;  2GS3 A;  1GSY A;  1URM A;  4RUV A;  2DJK A;  4YKF A;  1N2A A;  4WEY A;  2TRX A;  1ZYP A;  3FR3 A;  5H5R A;  5CRG A;  1XWG A;  5F8B A;  3KP8 A;  5IMA A;  1IW7 D;  1M99 A;  3EWL A;  2K9F A;  1WMJ A;  1SK0 A;  4JE1 A;  1AIU A;  2TRC P;  1Y6E A;  4G0I A;  2AAW A;  3GST A;  2M80 A;  3IDV A;  4N10 A;  3ZRD A;  4HU9 A;  4ML6 A;  3VI5 A;  2IJY A;  2RII A;  4E8E A;  3QOU A;  2MYG A;  2ZCT A;  14GS A;  2FUG 2;  2PVO C;  2GQM A;  4GRF A;  2HSY A;  1U3A A;  1W89 A;  1TU8 A;  2QSI A;  4F2I A;  4N30 A;  1K0B A;  2B1K A;  1Q4J A;  1EEJ A;  2D27 A;  4Z7X A;  1GLQ A;  1ZZY A;  4EKZ A;  2A2S A;  1SL1 B;  2H30 A;  1TOF A;  1TK5 B;  1GH2 A;  5HR1 A;  3RDW A;  1XBS A;  4TKY A;  2H73 A;  4HZ4 A;  1NHY A;  5ID2 B;  1G6W A;  3KP9 A;  2L4Q A;  3GKX A;  4NHZ A;  2R0C A;  2LJK A;  4V2N A;  4KF9 A;  2LQQ A;  1PD2 1;  2R37 A;  2RUE A;  2E7P A;  3PH9 A;  3O3T A;  3Q74 A;  1FB6 A;  3BBY A;  3PR8 A;  1OKD A;  3CSJ A;  4KDY A;  1XW5 A;  1QQ2 A;  3CSI A;  4BWQ A;  3FW2 A;  1FW1 A;  3DWV A;  5LNK e;  1JHB A;  2LUS A;  1A24 A;  2LJR A;  4RI7 A;  1WIK A;  4HS1 A;  3A2V A;  2DJ2 A;  4TR3 A;  4MH3 A;  2ON5 A;  4HDE A;  2DBC A;  1EGR A;  1OE7 A;  1TP9 A;  4MJE A;  1PN0 A;  5DBQ A;  4FO5 A;  4K0N A;  2PN8 A;  2GSQ A;  2AUV A;  3G7J A;  3I9V 2;  4GST A;  1BED A;  2M72 A;  4L5O A;  5DAL A;  3ZRE A;  4G0L A;  2H74 A;  3TRX A;  2PER A;  3LXT A;  5G1K A;  1XWC A;  3EMP A;  1TJD A;  3F63 A;  2FD3 A;  1PSQ A;  5F07 A;  2GGT A;  2LTK A;  3ZVJ A;  5DJL A;  2OKA A;  4O7H A;  2CQ9 A;  1ZGN A;  4ZBB A;  4IJI A;  4MK3 A;  5J41 A;  4L8E A;  5CAX A;  1EP8 A;  5DCH A;  2HLS A;  4CY6 A;  4DSQ A;  3MYD A;  4YH2 A;  2DJ3 A;  2H6Z A;  2FLS A;  1WOU A;  3HA9 A;  3GKN A;  3LYK A;  1IYH A;  4XS4 A;  1KNG A;  4I97 A;  4GF0 A;  2A2R A;  2YJ7 A;  1YQ1 A;  4HQZ A;  1MD3 A;  2P0G A;  2VCX A;  3VPQ A;  3U5R E;  1F2E A;  1T4Z A;  2OBK A;  4MPF A;  3L0H A;  1W4V A;  3M9J A;  4MAB A;  3PGT A;  2L57 A;  3ME8 A;  3NOF A;  4POK A;  3IPZ A;  3TCO A;  1FG4 A;  3FY7 A;  2IN3 A;  5FWG A;  3L9U A;  1ON4 A;  2GQK A;  1X9W B;  4HZ2 A;  4OD7 A;  2H72 A;  1A8Y A;  5IPG A;  5GSS A;  3QCP A;  4EVM A;  3MDK A;  3QPM A;  4HU7 A;  5KN1 A;  4EL1 A;  2O89 A;  5DJM A;  4ECC A;  2B5X A;  3UVH A;  2B5E A;  4Z2R A;  1F3B A;  2IMF A;  2GSS A;  4L0W A;  5D9W A;  3DGQ A;  4XS6 A;  4JRR A;  1J0F A;  3HKR A;  4HUA A;  2DMM A;  2HFD A;  3EMX A;  3LXZ A;  1T4Y A;  3EPT A;  1PKZ A;  2CX4 A;  4KA0 A;  2FA8 A;  4ZB8 A;  2ON7 A;  2O87 A;  3FMW A;  4XS1 A;  1QXH A;  4TXO A;  4CHS A;  3GUS A;  5ECS A;  4I5Q A;  1QFN A;  17GS A;  5INY A;  5AIS A;  4KND A;  4P3Y B;  3LQ7 A;  3FYG A;  3P8W A;  5CRH A;  2K6V A;  5L71 A;  3R3E A;  2HZF A;  1AQV A;  2O8V B;  2RUF A;  3TJG A;  2GSR A;  5HR0 A;  4FH8 A;  5GAP D;  5D9T A;  3L9S A;  2VL3 A;  2H66 A;  3MWH A;  4MJB A;  4WF5 A;  3O6T A;  5LCZ A;  4PQI A;  4YKG A;  5CRD A;  1X5C A;  2F8A A;  1GSF A;  3RPP A;  3RHC A;  16GS A;  3GYK A;  1SJI A;  3E0U A;  1XWK A;  4GSN A;  5COH A;  5AIV A;  2L59 A;  4ML1 A;  2H70 A;  2JZS A;  3UL3 A;  3KTB A;  1PKW A;  1QMV A;  2OJL A;  3IOS A;  1GSU A;  2BTO T;  2NVL A;  4HI7 A;  1IYI A;  1S3A A;  4WF4 A;  1HYU A;  1PN9 A;  2JAD A;  3GFK A;  3GMF A;  1O73 A;  4Q5N A;  2GDR A;  5G1L A;  5D73 A;  5KOX A;  2XC2 A;  1I9D A;  3KIJ A;  4IVF A;  2L5O A;  2LS5 A;  1OC9 A;  2HE3 A;  2A2P A;  4XCS A;  5IM9 A;  1GLP A;  2O7K A;  1SL2 B;  2C80 A;  4F03 A;  5HFG A;  2I1U A;  2DC5 A;  1THX A;  3RBT A;  2H0I A;  2H1B A;  3H93 A;  2AYT A;  5E59 A;  3WYW A;  2XBI A;  2HRK A;  5G31 A;  1TW9 A;  3L4N A;  4XRD A;  1RK4 A;  1GTU A;  4V2L A;  5E4W A;  2FNO A;  1A2M A;  3HD5 A;  2GT6 A;  1GL8 A;  4NWY A;  4PNG A;  4PUF C;  3ZLP A;  1X0R A;  1XZO A;  1O8W A;  4J2F A;  1HQO A;  2KP2 A;  5KN2 A;  1GNE A;  4DSS B;  3HJO A;  5IOW A;  2BMX A;  4IN0 A;  2HXK A;  4EO3 A;  2C3Q A;  4ILF A;  2YP6 A;  5HFK A;  3ZL5 A;  3APO A;  4K8M A;  4IKH A;  2WS2 A;  2R4V A;  2H6X A;  3VWW A;  1HNC A;  4MCU A;  1QK8 A;  3I6A A;  1BJX A;  2CAQ A;  1BYE A;  4MZC A;  3IRA A;  2CT6 A;  1OVN A;  2E0Q A;  3GTU B;  1WPI A;  4HOJ A;  4X0X A;  1GP1 A;  3H4K A;  5DCG A;  1ZL9 A;  5CRE A;  4I2T A;  3UAR A;  5F06 A;  4HQS A;  5GAN D;  5ID2 A;  1ERV A;  2YNX A;  2OE3 A;  4KB3 A;  1PX7 A;  5LD0 A;  1WRY A;  1SYX A;  3W6G A;  2R6K A;  2JZR A;  3H8Q A;  1TK8 B;  2H8L A;  3A5I A;  2IMD A;  4MMM A;  1H75 A;  4POM A;  2C0F A;  3GX0 A;  1GTA A;  1A2J A;  1PMT A;  3EE2 A;  4OFT A;  4TR1 A;  2KOK A;  4MJA A;  2CVB A;  3TUE A;  4XTS A;  2VD1 A;  4TOP A;  4ZBA A;  5DAK B;  2OA7 A;  4LL4 B;  1A2L A;  1ML6 A;  3UBK A;  3ZYW A;  1MDI A;  4O92 A;  1B48 A;  2VAF A;  1XXU A;  1X5D A;  4OMV A;  1XVW A;  2QA2 A;  3ED3 A;  3F3R A;  3LEF A;  1PL2 A;  1YDK A;  2VD0 A;  2VLU A;  3HZ4 A;  2NBS A;  1M9A A;  4K7I A;  2OE0 A;  1V98 A;  3IAS 2;  2WZ9 A;  3UOM A;  5IMD A;  1JZO A;  1V57 A;  3CMI A;  1MD4 A;  3GA4 A;  1ERU A;  3FEU A;  1U87 A;  3DRN A;  3D22 A;  3VWV A;  3QAW A;  2YAN A;  1B4P A;  4BVY B;  3JCM L;  1TI3 A;  4YQM A;  2RM5 A;  4D73 B;  1A8L A;  4GTU A;  6GSY A;  5CRW A;  1E2Y A;  1G6Y A;  3GV1 A;  5DVB A;  2IWT A;  1U3I A;  2IME A;  5G5F A;  5H5S A;  1DE2 A;  5HQP A;  3IC8 A;  3M9K A;  2B7K A;  1SYR A;  1TK0 B;  5GST A;  4JZQ A;  5IMF A;  1THO A;  1AQX A;  5DDL A;  2HSH A;  2NDO A;  4JR6 A;  4ACS A;  5ECH B;  4QL7 A;  13GS A;  4WET A;  5J9C A;  4EE0 A;  3IHG A;  3EU4 A;  3J7Y k;  4QL9 A;  3WT1 A;  1Z5Y E;  4V2M A;  2KP1 A;  4HEA 2;  1B4Q A;  4PQ1 A;  2DKH A;  1HNB A;  3EU3 A;  4POB A;  5DQS A;  2CVD A;  4AJ8 A;  1GWC A;  4K1F A;  3F8U A;  5EPF A;  4DVC A;  2YZH A;  2V32 A;  1FOH A;  1PGT A;  4CW9 A;  2DJ0 A;  2DJ1 A;  2WRT A;  1O7U A;  5FT3 A;  1VF1 A;  4LMV A;  1Z9H A;  2CZ2 A;  2P5Q A;  4BPY A;  3HY2 A;  3ZTL A;  2QC7 A;  4F82 A;  3P7X A;  2YCD A;  4GCI A;  4WBR D;  2N5A A;  2K8V A;  2MBS A;  3HCZ A;  3KMN A;  5H5Q A;  1EP7 A;  1SEN A;  3C7M A;  3I43 A;  1YZX A;  2H0G A;  3LWA A;  1K0N A;  3ME7 A;  2CAI A;  3PPU A;  5KN3 A;  2MMA A;  1NSW A;  2L4C A;  3IR4 A;  1SKR B;  1ZOF A;  2L6D A;  2H19 A;  2OE1 A;  1Y25 A;  2V41 A;  4F0B A;  5D93 A;  1I5G A;  1K3Y A;  3LFL A;  1T7P B;  2LRN A;  4DEJ A;  3LG6 A;  3MNG A;  1K0A A;  4GQC A;  2V6K A;  3VFI A;  4OO4 A;  2VIM A;  4PUA A;  4PNF A;  3SBC A;  3H1N A;  2MMO A;  4PXO A;  2UZ8 A;  5AIX A;  1MTC A;  5F0G A;  3UJ1 A;  3IAM 2;  2LEG A;  2X49 A;  5C00 A;  2X8G A;  3QAV A;  4EF0 A;  2XBQ A;  4IP6 A;  1FAA A;  4KE3 A;  5ECR B;  3F4T A;  4LMW A;  2VCW A;  4WR5 A;  2H1A A;  1K0O A;  4Q5F A;  1OC8 A;  1YEP A;  3VPT A;  4ECB A;  4RQR A;  3C71 A;  1VF2 A;  3LJR A;  3KJY A;  4I8B A;  4BL7 B;  3TB2 A;  3HYP A;  4KW6 A;  1LBK A;  4TR4 A;  3CSH A;  1NM3 A;  1NHO A;  1ZYQ B;  1G7E A;  4NV2 A;  1SU9 A;  1GSS A;  5ECK B;  4OCF A;  4RI6 A;  3HHV A;  1C72 A;  4GXZ A;  3P2A A;  3UAP A;  3A3T A;  2YWO A;  1PQN A;  4CDO A;  5ECL B;  2IFQ A;  5KOW A;  2EIO A;  5JWR B;  4ZBD A;  1Z3E A;  1OC3 A;  4POL A;  1PX6 A;  1X9S B;  3U6V A;  4QQ7 A;  2GT5 A;  1O81 A;  4IW9 A;  4XRA A;  1RW1 A;  1AQW A;  3NZN A;  3TKS A;  2L6C A;  1A0R P;  5IMC A;  2V6O A;  3MIX A;  3QR6 A;  3F0I A;  5ECO B;  3GRX A;  4EXJ A;  4GWR A;  1YEX A;  4ISD A;  2YWN A;  2I4A A;  1HD2 A;  4TW5 A;  2WDU A;  2YOI A;  2D28 C;  3IK7 A;  1ERW A;  4IQA A;  2WGR A;  2YV7 A;  5D9V A;  5ELA A;  4KH7 A;  3EUR A;  4EC0 A;  1TRV A;  3IXR A;  1RQM A;  5F05 A;  1T3B A;  3Q18 A;  1QGV A;  2KHP A;  3W8J A;  5B8A A;  1LU4 A;  2YN1 A;  1FVJ A;  4O32 A;  2B6M A;  4KDX A;  2C1Y A;  3FZ9 A;  2PWJ A;  3N5O A;  4TXV A;  4BWS A;  4PGT A;  2V1M A;  3FKF A;  5D8I A;  4E8H A;  5HFI A;  3KCM A;  5IIZ A;  3F4R A;  2I3Y A;  4G19 A;  1SD9 A;  3E3E A;  2BJX A;  2FY6 A;  1GSD A;  1PRX A;  3DXB A;  4DSS A;  1BG5 A;  5G5E A;  4FYU A;  2DSA A;  3DYR A;  3D21 A;  3KGK A;  1FO5 A;  2JZT A;  3GL5 A;  1XFL A;  1R4W A;  2REM A;  5ABR A;  2GZP A;  1X9M B;  2IMI A;  3FR6 A;  2WCI A;  1EOG A;  3LGC A;  4NAX A;  4IHU A;  3LYP A;  4ZXG A;  3VLN A;  2JU5 A;  6GSV A;  4PQH A;  2VCZ A;  2A4H A;  19GS A;  5IO0 A;  5KEJ A;  5KN0 A;  2PGT A;  1UVZ A;  1F6M C;  3QMX A;  5J5N A;  3GHA A;  4BVX A;  3CXG A;  4K0G A;  5GZZ B;  2PU9 C;  3TJF A;  1EWX A;  2R0P A;  2C4J A;  2K18 A;  4IGJ A;  2YV9 A;  3KD0 A;  2MMZ A;  1T8E B;  3BJ5 A;  3CRU A;  4LA1 A;  3HZ8 A;  2VL9 A;  2LRT A;  1XOA A;  2N5B A;  3WGE A;  3EIN A;  1ACV A;  2G0F A;  3C73 A;  1DSB A;  1U88 A;  3RHB A;  5CYY A;  1BQ7 A;  4WXT A;  2M46 A;  4G10 A;  5JWO B;  4JBB A;  3QDN A;  1F3A A;  1V40 A;  1OE8 A;  2WFC A;  3KZQ A;  4K9Z A;  1TDI A;  1DBY A;  2PBJ A;  1T1V A;  4K5S A;  3ZVJ D;  2ALB A;  1X5E A;  4MF7 A;  3G9B A;  2VUP A;  4MF5 A;  4AGS A;  1GSE A;  2C8U A;  2CX3 A;  4F9Z A;  3N9J A;  2VM2 A;  1USB A;  3IE3 A;  3APS A;  5ECQ B;  1O6J A;  1B9X C;  3TGZ A;  4BVY A;  4YAV A;  2H01 A;  4IBP A;  1YF1 A;  1F37 A;  2LRC A;  4EDZ A;  1B8X A;  4GQF A;  1GTB A;  3R2Q A;  1VRS D;  2A4V A;  2HRA A;  1FOV A;  4JU5 A;  1OYJ A;  2CZ3 A;  1G7O A;  4GLT A;  3FZ4 A;  2KUC A;  3FZA A;  2HZE B;  2G2Q A;  3FHK A;  4IS0 A;  2DIZ A;  1V58 A;  2K8S A;  3O76 A;  2H6Y A;  5C04 A;  3ZFB A;  3TOU A;  3MAK A;  2CVK A;  3IK9 A;  3VK9 A;  1VGL A;  3HXS A;  3C1R A;  5J9B A;  3UMA A;  3AY8 A;  2HT9 A;  1ZYN A;  4MA9 A;  3UIW A;  3HVS A;  2LKU A;  2WJU A;  2B5Y A;  5CO3 A;  4AF2 A;  1BAY A;  3P90 A;  3QAG A;  2VLT A;  2NPB A;  2VL2 C;  4EIP A;  1VF4 A;  4ICY A;  4V1A p;  5DQY A;  3WD6 A;  4EIQ A;  3ERG A;  1Z6M A;  1TU7 A;  3ZML A;  4YQU A;  1LJR A;  2GLR A;  1N8J A;  4CY8 A;  3DML A;  2HNL A;  2R5G A;  2FWF A;  3ISO A;  3CBU A;  3V1W A;  2HYX A;  1JZD A;  1M0U A;  3VWU A;  1J08 A;  3GIX A;  4AJ7 A;  5J3R A;  4IEL A;  4HJ2 A;  1YKC A;  3WGX A;  1A0F A;  4KAE A;  3ZMK A;  2YWM A;  4NPB A;  4FYB A;  1OAZ A;  1WJK A;  2C3T A;  3D4M A;  2PVQ A;  3KXO A;  1ERT A;  1TRU A;  5B6M A;  1EV4 A;  2XPD A;  2P5R A;  1SK1 A;  3BCI A;  2H76 A;  2F3M A;  4G0K A;  4JR4 A;  3M8N A;  3DVW A;  2GTU A;  2OAD A;  2FA4 A;  2GVP A;  3M3M A;  1V2A A;  8GSS A;  4IQ1 A;  2LJA A;  3BCK A;  2OBI A;  5JWQ B;  2AHE A;  4ECJ A;  2C0D A;  4K5R A;  2IPA A;  11GS A;  3KMO A;  4ZL9 A;  2H71 A;  2LST A;  4N11 A;  2NTO A;  5A4U A;  3TKS C;  3GL3 A;  1AC1 A;  4OO5 A;  3KH9 A;  2CA8 A;  1XOB A;  2WB9 A;  2XHF A;  1M2A A;  2C3N A;  4X1U A;  4ZIL A;  1E6B A;  22GS A;  3QD9 A;  2E2G A;  2VCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...