3F4RA

Crystal structure of wolbachia pipientis alpha-dsba1
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
199
structure length
199
Chain Sequence
TSNELLLPLPNDKLLGDPKAPILMIEYASLTCYHCSLFHRNVFPKIKEKYIDTGKMLYIFRHFPLDYRGLKAAMLSHCYEKQEDYFNFNKAVFNSIDSWNYYNLSDLTLLQRIAALSNLKQDAFNQCINDKKIMDKIVNDKSLAINKLGITATPIFFIKLNDDKSYIEHNKVKHGGYKELKYFTNVIDKLYGKAIVKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of the Oxidoreductase alpha-DsbA1 from Wolbachia pipientis
pubmed doi rcsb
source organism Wolbachia pipientis
molecule tags Oxidoreductase
molecule keywords Putative uncharacterized protein
total genus 76
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2008-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.80 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Ribonucleotide Reductase Protein R1; domain 1 3f4rA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3f4rA01
2YZUA 1V58A 2ALBA 5ECSA 4JR6A 1GSYA 1TOFA 5H5QA 1JHBA 2V6KA 2C4JA 4GQCA 3DGQA 1WPIA 2VL2A 5EPFA 5H5RA 2XPEA 2M46A 3GN3A 3HZ4A 1X5DA 2M80A 2MZCA 3UL3A 2DJKA 4V2LA 5ECRB 4RI6A 1BG5A 4ZL9A 5F0GA 2LNSA 1KEBA 3L4NA 2JSYA 2YJHA 4WBJA 2OA7A 2DJ2A 3DMLA 3GSTA 1TI3A 3FZAA 5AIXA 2J23A 1IYIA 4DSSB 1WWJA 3E3EA 5IIZA 2F8FA 4G2EA 1TXXA 2YWMA 4YAVA 5ID2B 3EC3A 5IOWA 1GSUA 4GWRA 4EC0A 2VUPA 1VF2A 1SD8A 2PBJA 2HYXA 2DBCA 4QQ7A 1BEDA 4ECCA 3G7JA 5ECQB 1EEMA 2JZTA 3TJBA 2XBIA 3C73A 4F82A 2EIRA 2C8UA 4DVCA 5HFIA 3BCIA 4EF0A 2CVDA 2JU5A 3A2XA 3LWAA 2GDRA 4IS0A 2WZ9A 4HJMA 1DE1A 2K9FA 2VCTA 1M7TA 3LG6A 2O8VB 4OD7A 3GH6A 3KMNA 2X8CA 3IXRA 4IVFA 5HR1A 5A4VA 2DJ1A 3RHCA 3LORA 2B5YA 1YKCA 3UVHA 2IL3A 1UC7A 3FY7A 2VLVA 3RAZA 5ELGA 3NZNA 1NM3A 2HRNA 5J9BA 4PQ1A 3ME7A 3GUSA 2R6KA 4POLA 1AQWA 1AXDA 2FA4A 4MH3A 4BWQA 4KW6A 2X64A 2CVKA 1GH2A 3DEXA 4GF0A 2LRNA 3LXTA 3VWXA 2E0QA 3PGTA 5ECKB 5D8IA 4ZIJA 1O85A 1HNCA 4TR1B 3DD3A 4FYCA 5ELAA 5IO0A 1C72A 2LRCA 4MA9A 4KUNA 5DALB 1IYHA 4IQ1A 3IV4A 4V2MA 2X8GA 3HXSA 2DSAA 4PUFC 1EP7A 1ERVA 2VCWA 5AN1A 4EDZA 2VM2A 1OE7A 2VIMA 1VF3A 5B8BA 3H1NA 5J5NA 4MZCA 1JZOA 1Q4JA 3KMOA 4HEA2 4ZB9A 2CX3A 4YQUA 1XOAA 2DIZA 2LV3A 1YY7A 6GSUA 4XTSA 4LL4B 2B5EA 4RQRA 1SL1B 3A2VA 4GRFA 4OCEA 2H0GA 1TK5B 3KXOA 1H4OA 1A0RP 3IK7A 2H66A 3UBKA 4KAEA 1GTBA 4J56E 4RQXA 2O7KA 3HJOA 3UJ1A 2IFQB 3SBCA 2MBSA 2N5FA 1QGVA 1YF0A 2NPBA 1AW9A 1LBKA 2FD3A 4GLTA 3MWHA 4ML6A 3DVWA 1YQ1A 1KBNA 4IBPA 2H01A 1QUWA 1S3DA 1HQOA 5G5EA 1SKWB 1AUCA 4IJIA 5LD0A 5DAKB 4FYBA 1SK1A 4MK3A 1HNBA 3C1RA 1XW5A 4OMVA 6GSVA 1UVZA 2FHEA 5IMFA 4FYUA 4KE3A 1EZKA 2C3NA 1R7HA 5EVOA 4MJAA 2NBSA 2KP2A 3C1SA 3ZVJA 2HNLA 1VRSD 3FRCA 2FA8A 4N0ZA 4MPGA 1M2AA 2O87A 4AF2A 2L5OA 3D6IA 4ZL8A 1WIKA 2HI7A 1YEPA 2MMAA 2E7PA 2CA8A 2M72A 1PKZA 1T4ZA 2ZUPA 4HS1A 3KGKA 2P0GA 4HU9A 12GSA 6GSWA 2NVLA 3EVIA 3BD2A 4HU7A 1JFUA 2R4VA 2I3YA 4LLRA 1O6JA 2H1GA 5D96A 4MJBA 2PU9C 5LCZA 3TOTA 2KP1A 1G7EA 3DIEA 1G7OA 1AQVA 3APSA 1PL2A 1YF1A 1V9WA 4D73A 3VFIA 5CRDA 3KTBA 4L5OA 4L5LA 1ON4A 1XVWA 2E2GA 3ZITA 1H75A 3EWLA 2IMEA 3KP8A 4OWYA 2YWNA 3LYPA 1ZMAA 3QFAC 3LXZA 3GKKA 1FO5A 2RLIA 4FO5A 3GNJA 5DALA 3VURA 4ACSA 2HT9A 5GAPD 3RPNA 4WR5A 2H6ZA 2LKUA 4N30A 3BBYA 5CP1A 4QL7A 2C0FA 2GVPA 2YV9A 2HSHA 3WT2A 3M9JA 3MAKA 1X0RA 14GSA 1ZYEA 2WULA 1OC9A 2XC2A 4BA7A 4WKWA 3W6GA 4HZ4A 4PXOA 1GNWA 2KUCA 5GSTA 2OBKA 2N5AA 4KSMA 3NOFA 2MBTA 4H86A 4ML1A 3U6VA 1EOHA 3GL5A 4KSOA 2ON5A 5CO3A 3D4MA 1THXA 1S3CA 4OFMA 3QPMA 2GGTA 2L6DA 2QSIA 3GURA 3GSSA 5CYYA 2H8LA 4NMUA 1EWXA 4O32A 3F9UA 2EC4A 1M2DA 3H4KA 4DSSA 2RM5A 2AHEA 3D4TA 5B7CA 2LQOA 1GTAA 1VGLA 4IJ3A 1PQNA 2GS3A 2VL9A 4JU5A 1ZOFA 1JLVA 1FAAA 2VCZA 4P3YB 5DJMA 3ZMLA 3RDWA 2X8HA 3TJKA 3P8WA 3F4TA 2YCDA 3ZTLA 5IM9A 1Z3EA 4CHSA 1T4YA 1J0FA 2DMLA 2AYTA 1A2LA 5KN0A 2GZZA 2WDUA 4K7NA 5A5KA 3HDCA 1T8EB 5FHIA 3QAVA 1TK8B 5EL8A 2QGVA 3TRQA 4PUAA 1SL0B 4X0XA 2B7KA 2VD1A 3UMAA 4NHZA 2IMDA 3GV1A 4V2NA 5ECPB 1M99A 2CVBA 3P90A 4BWSA 2WB9A 2L6CA 4JR4A 4LMVA 5DJLA 4POKA 5IOXA 5ID2A 2H30A 4F2IA 2LUSA 3QCPA 1MEKA 4J2FA 4XRAA 3GH9A 2OKAA 1V57A 2LS5A 2B6MA 3CXGA 2IIYA 3AY8A 4XS4A 3H8QA 1XWBA 2B5XA 2OE0A 1KNGA 3G7YA 5D9XA 2V41A 3F3RA 3KM6A 5DVBA 3ZFBA 4AJ6A 3FZ9A 2BJXA 4EXJA 1X9MB 3N9JA 2ZNMA 4TR1A 2WJUA 3HCZA 4LL1B 2AB6A 1A2JA 2CX4A 3GTUB 5FWGA 2P5QA 4MF6A 1M2BA 1A23A 3I43A 4LMWA 3HHVA 4EL1A 3KP9A 2H72A 4K9ZA 2LRTA 5ECMB 5INYA 5L71A 2HRFA 1XFLA 4HDEA 1M9BA 1OYJA 3HY2A 1A8YA 1PA3A 1GULA 2WS2A 2IMKA 2O89A 4YQVA 3IA1A 4GQFA 2R2JA 4MMMA 4TXOA 3IK9A 2VLTA 3IOSA 2GSSA 2IFQA 3H79A 4I2TA 1ABAA 2C3QA 1J9BA 1F37A 2F9SA 1SYRA 4K0NA 2FWFA 1Z7PA 4RUVA 2K6VA 1YKAA 4YH2A 3GA4A 3FYGA 1NHYA 3FK8A 5DCGA 3TRPA 1R26A 1BAYA 1XXUA 1G0TA 2LJKA 3DYRA 3ERFA 4K8MA 1G6WA 2FWHA 3F0IA 1MDIA 5IMDA 3UEMA 3BCKA 2REMA 1GSFA 3P7XA 4EVMA 1QK8A 1EGRA 2H0HA 5ECIB 5F07A 1ACVA 5HFKA 4EE0A 5CRHA 5G30A 1B8XA 3QFBC 2OBIA 4ZBAA 1OKDA 4ISDA 5IPGA 1K0MA 5DQYA 1O81A 1XWAA 2V1MA 1F3AA 1A24A 4ILFA 1XWKA 1ZZYA 4I6XA 3ZIVA 1U3IA 2H1AA 1M9AA 3QAGA 3DKSA 2H6YA 4KA0A 1EOGA 4HUAA 5GZZB 2JZSA 4GSSA 1XW9A 3APOA 1GUKA 1MD3A 4GSTA 4Z7XA 3U5RE 3BOAA 4GXZA 3I9V2 2F3MA 1EGOA 2VCQA 3GKNA 4ULXA 2OACA 3FR6A 1KTEA 2A2SA 3GRXA 1CQGA 3F8UA 4KDUA 2C0DA 5D9TA 4BPYA 2H6XA 5IMZA 3F3QA 2I9HA 1YZXA 2ON7A 1TRVA 5F05A 5IO2A 2JACA 6GSSA 5IMVA 4ZL7A 2A2RA 4TRXA 3TJFA 1T1VA 19GSA 3FKFA 1PRXA 5DBQA 4NXIA 2OE3A 4IHUA 2LQQA 2H76A 2B3SA 3KIJA 1K3OA 4MCUA 1O8XA 2JZRA 2VOCA 2HFDA 3I6AA 5IQYA 3GL3A 4JBBA 1PKWA 1BX9A 2NDOA 1SYXA 2CAQA 1YDKA 3HD5A 4GSNA 3TCOA 1U88A 2H0IA 1K3LA 5G2ZA 1E2YA 4L0UA 3RHBA 2GT5A 3WGXA 4MABA 3L9VA 5JWRB 2G0FA 2LTKA 3CTGA 5CRWA 1GL8A 4MH2A 3KJYA 4IGJA 2WCIA 4J57E 4XS4B 1OVNA 1SK2A 4IN0A 3UARA 2YWOA 1DUGA 2VAFA 4OO4A 1PX7A 3FW2A 3TRXA 3VPTA 4PNFA 2CV4A 2H74A 3V1WA 1FVKA 1U87A 1M0UA 2LSTA 5AISA 4QL9A 2L5LA 3S9FA 3O76A 1X9WB 1DSBA 1MDKA 2CT6A 3CSJA 2K18A 1AQXA 3J7Yk 2J9HA 3FEUA 2FWGA 4G9HA 4BVXA 3GKXA 1OKTA 3EINA 2PWJA 2H19A 4TXOB 2IMIA 2NTOA 3TJJA 5KN3A 1O73A 1B4QA 4K7OA 1QFNA 3A5WA 1GRXA 1CQHA 1SKRB 1RW1A 3Q6OA 4BL7A 4PX1A 4XCSA 1FB6A 4BVYA 1SJZA 2K8SA 3APQA 3TUEA 2PMTA 2H75A 3WD6A 3GYKA 5G5FA 4E8EA 3ZZXA 4GCIA 3IHQA 1TU7A 2VM1A 2A4VA 2GSRA 2X99A 1RK4A 4WETA 3RPPA 2IWTA 2QC7A 3CYNA 2EIQA 3EMXA 2HSYA 3M9KA 3CMIA 4KGIA 3RBTA 3GHAA 3FHKA 4MZWA 5AGYA 4K2DA 4Q5RA 1TJDA 1W89A 2PVQA 3M3MA 1ZCPA 4L0WA 3C71A 3D5JA 2YOIA 1Z5YE 6GSTA 1PX6A 5DAKA 3TKSA 5H5SA 3IC4A 5LNKe 2VL3A 1GUHA 3TJGA 5J4UA 3GX0A 3CSHA 1OC8A 5HR2A 2MYGA 3FR3A 3L78A 2VCVA 1MTCA 1F2EA 4WEYA 4K0GA 4ZXGA 1GWCA 3GKMA 3UOMA 5DCHA 2KLXA 4YQMA 1JZDA 1S3AA 4FIWA 1V40A 2GQLA 4O5RA 3HVVA 5CREA 1JZWA 5CAXA 2D2ZA 3EU4A 1TP9A 4HQSA 1PN9A 3KH7A 1T3BA 2C1YA 3TKRA 2B7JA 1TTZA 2L4CA 5JCWA 16GSA 2ZCTA 5F06A 2C0EA 4G10A 3LEFA 1TDIA 3IE3A 2TRCP 2CQ9A 22GSA 1N8JA 2JL4A 2P5RA 1SK0A 3DVXA 3WYWA 4WF4A 1XWGA 1V98A 5G1LA 1ERWA 3IBHA 4EDYA 4L8EA 3F4RA 2V32A 3R2QA 13GSA 3CTFA 1T7PB 5DQSA 4G19A 2YPMA 3TGZA 1ZYQB 1XW6A 1Q98A 2I81A 4POMA 4N0VA 4Q5QA 4TN8A 3GIXA 3ZMKA 4KB3A 4F0BA 2CZ3A 2P31A 3ISOA 1UA5A 2IJYA 3KH9A 4NAXA 1K0BA 1Z6NA 5ECNB 1K0CA 2H73A 2JADA 1UN2A 4PQIA 1Z6MA 4ZBBA 5C04A 3LYKA 2C80A 3HVXA 1ERUA 3VWUA 3LGCA 1MD4A 4IP1A 5ECLB 2GLRA 1R5AA 1K0NA 1Z7RA 4MF7A 3PINA 4PNGA 3VWWA 1SL2B 4AJ8A 3EURA 2F8AA 3M8NA 20GSA 3ZIJA 2C3TA 4POBA 2PGTA 2GZPA 1GTIA 5G31A 1WP0A 3CSIA 4JEDA 1X9SB 1ML6A 3KD0A 2HLSA 4XS1A 4HI7A 1TKDB 3GX8A 4ZB8A 4MP4A 3F63A 2LJAA 1XIYA 2YWIA 4IP6A 1G6YA 1GNEA 4F9ZA 3FZ4A 4ZILA 3IAS2 1XBSA 2HE3A 1ST9A 4JRRA 6GSYA 3KZQA 3EMPA 3ZLPA 4OFNA 2IPAA 4KCAA 4E8HA 4KDXA 3VLNA 2RUEA 3DRNA 3TDGA 2DJ3A 4I5QA 3E0UA 1ERTA 2RM6A 2FLSA 4X43A 3QMXA 10GSA 3A2WA 2F51A 4F03A 2OE1A 4MJCA 4N11A 5KN2A 3IDVA 2I4AA 4ZBDA 2QKEA 3FR9A 5F8BA 1W4VA 1X5CA 4NWYA 5D73A 1ZL9A 3I69A 1HYUA 2YV7A 3GMFA 4OO5A 4WXTA 1WJKA 2FNOA 1V2AA 2WFCA 1URMA 2LEGA 2MMNA 3HA9A 3UBLA 2BTOT 1T00A 3IAM2 4HZ2A 5KEJA 5GAND 2XPDA 3ZYWA 1FOVA 3TKPA 3HJPA 2H70A 5J3RA 2GQKA 4ECBA 4D73B 3QOUA 5GSSA 1GSEA 2YNXA 3N5OA 4MDCA 4O92A 3EE2A 5E59A 1DE2A 2FY6A 1FG4A 3W8SA 3GFKA 2GT6A 4AJ7A 5HR0A 4CW9A 2YANA 4TXVA 2OADA 2HZEA 4JZQA 3HJMA 2V2GA 2PN8A 2VLUA 1XCCA 2TIRA 1F3BA 1JZRA 2VCXA 3ERGA 3WGDA 2B1KA 4DSQA 4I97A 4JE1A 3O3TA 3D22A 4DSRA 1SKSB 2H1DA 4YAPA 1Y6EA 2EIOA 3VI5A 3GTUA 1LU4A 4WR4A 2XHFA 3IR4A 2GQMA 1HD2A 1OC9B 3PR8A 5CNWA 2DJJA 2RUFA 3LSZA 1SJIA 2R3XA 4MPFA 8GSSA 2TRXA 5EY6A 1OAZA 4PGTA 3L9SA 1R4WA 5B6NA 1TRSA 1QQ2A 2ES7A 5COHA 2AJQB 4V1Ap 3VWVA 1PL1A 5D9VA 3KEBA 1B9YC 9GSSA 3EYTA 5J41A 5IPHA 1Y25A 4IQAA 4EO3A 1XOBA 1EP8A 2CAIA 4IELA 2VD0A 1XVQA 1K0DA 4K6XA 4MJEA 1O8WA 3F6FA 1GP1A 4DEJA 1GUMA 5G1KA 5ECOB 2DC5A 3CRTA 4GTUA 4KX4A 1YEXA 1Z9HA 1ILOA 1OE8A 1B48A 1B9XC 1GLPA 2E2MA 3WGEA 3Q74A 1WMJA 5ECHB 3ZRDA 2O85A 3K8NA 3CRUA 3HYPA 1TI1A 4PQHA 4WBRD 1SENA 1E6BA 18GSA 3ERWA 2GZYA 1U6TA 3PH9A 5JWOB 2PVOC 4NHWA 1TRWA 2R5GA 5E4WA 3VK9A 5ABRA 3C8EA 1I5GA 1HNAA 1EEJA 1JLWA 4TVEA 1QXHA 4FH8A 17GSA 1A2MA 4K1FA 3E9JB 1K3YA 2HZEB 4PURA 2GTUA 3Q19A 4N10A 3US3A 1ZGNA 4TR0A 4Q5NA 1TK0B 3UIWA 2L59A 3LJRA 3G9BA 1NHOA 3JCML 1OC3A 3W8JA 2L4QA 2YZHA 6GSXA 1USBA 1U3AA 3VI7A 2H71A 1XPVA 2YJ7A 4TOPA 2YP6A 5HR3A 4EUYA 2R37A 1FVJA 3HKRA 4NPBA 2G2QA 3KCMA 1YJ6A 3O6TA 1J08A 3Q18A 4TKYA 1A8LA 4AGSA 1VF4A 1WE0A 2YN1A 3NIVA 3F6DA 3MNGA 5D9WA 1PMTA 2FCHA 1R5PA 1F6MC 4OFTA 1PSQA 2AV4A 4ID0A 3A3TA 3QR6A 5ENUA 2DMMA 1GSDA 4HQZA 3IPZA 4F0CA 3MDKA 3QDNA 3LQ7A 4ECIA 4ECJA 5D93A 5JCGA 3M1GA 5HQPA 1RQMA 4LA1A 4XIHA 4Q5FA 1K0AA 4EKZA 5A4WA 2HZFA 4HOJA 2MMZA 2Z9SA 4X1UA 1SU9A 4KNDA 5HFGA 3ZL5A 2PERA 2AUVA 2XBQA 2DLXA 5KN1A 2GSQA 4TR3A 3C7MA 4NV2A 4MZBA 1QMVA 5J9CA 3TB2A 2GSTA 4K7IA 1FB0A 3ZREA 2H1BA 3DXBA 3M0FA 3G7IA 4NV5A 3FZ5A 1I9DA 2CZ2A 2HXKA 1DBYA 1AAZA 1NSWA 2DJ0A 4XRDA 1WRYA 1SD9A 1BJXA 2DIYA 5DDLA 2AAWA 11GSA 2FWEA 1VF1A 1AC1A 1EV9A 2V6OA 4RI7A 3TKSC 1F9MA 2WRTA 4TR4A 1WOUA 1BYEA 2IMFA 1GSSA 5AIVA 3BJ5A 2LNTA 4MLYA 2PUKC 1A0FA 4KDYA 3L9UA 1TW9A 4OCFA 2PPTA 1XWCA 5JCUA 5C00A 3ZVJD 4HJ2A 1FHEA 2MMOA 1THOA 1MDJA 4V1Ag 5CRGA 4KCEA 4WF5A 3TKQA 3EU3A 2K8VA 3H93A 2VO4A 3OR5A 1K0OA 1BQ7A 4IKHA 2KOKA 3IRAA 3UAPA 1GSQA 5JWQB 1PGTA 2FGXA 3HZ8A 1TRUA 2N5BA 4ZB6A 3P2AA 5IMAA 5B8AA 7GSSA 3QD9A 4IW9A 3F4SA 3HVSA 1FW1A 3TKSE 3ED3A 1X5EA 2L57A 3DWVA 3D21A 1N2AA 4XHMA 5B6MA 1B4PA 2KHPA 4I2UA 1XZOA 5FT3A 3ME8A 1PD21 5A4UA 4XS6A 1NW2A 5IMCA 4MF5A 4O7HA 3UVTA 2IN3A 1O7UA 3CBUA 3ZFLA 1EV4A 4TW5A 3LFLA 2WGRA 1GLQA 3VPQA 2FUG2 2RIIA 2C0GA 2I1UA 1AIUA 2JSZA 2LJRA 3QAWA 1LJRA 3J7Yb 1SJ6A 3KTLA 3D0ZA 2BMXA 3TOUA 3MSZA 3L0HA 2VL2C 4CDOA 1TU8A 2B1LA 4I8BA 4KH7A 2OJLA 1GTUA 3SWLA 3WT1A
chains in the Genus database with same CATH superfamily
1J3UA 2YZUA 1V58A 2ALBA 3HVNA 5ECSA 4Z2UA 4JR6A 1GSYA 1TOFA 2UZ8A 5H5QA 1JHBA 2V6KA 3GZHA 2R0GA 2C4JA 4GQCA 5KOWA 3DGQA 1WPIA 2VL2A 5EPFA 5H5RA 2XPEA 2M46A 3GN3A 3HZ4A 1X5DA 3BHGA 2M80A 2MZCA 3UL3A 2DJKA 4V2LA 5ECRB 4RI6A 1BG5A 4ZL9A 5F0GA 2LNSA 1KEBA 3L4NA 2JSYA 2YJHA 4WBJA 2OA7A 1M3JA 2DJ2A 3DMLA 3GSTA 1TI3A 3FZAA 5AIXA 4A5PA 2J23A 1IYIA 4DSSB 1WWJA 3E3EA 5IIZA 2F8FA 4G2EA 1TXXA 2YWMA 4YAVA 5ID2B 3EC3A 5IOWA 1GSUA 4GWRA 4EC0A 1Q5NA 2VUPA 1VF2A 1SD8A 2PBJA 2HYXA 2DBCA 4QQ7A 1BEDA 4ECCA 3G7JA 5ECQB 1EEMA 2JZTA 3TJBA 2XBIA 3C73A 4F82A 2EIRA 2C8UA 4DVCA 5HFIA 3BCIA 3R3EA 4EF0A 2CVDA 2JU5A 3A2XA 3LWAA 2GDRA 4IS0A 2WZ9A 4HJMA 1DE1A 2DKHA 2K9FA 2VCTA 1M7TA 3LG6A 2O8VB 4OD7A 3GH6A 3KMNA 2X8CA 3IXRA 4IVFA 5HR1A 5A4VA 2DJ1A 3RHCA 3LORA 2B5YA 1YKCA 1Z4LA 3UVHA 2IL3A 1UC7A 3FY7A 2VLVA 3RAZA 5ELGA 3NZNA 1NM3A 3R6VA 2HRNA 5J9BA 4PQ1A 3ME7A 3GUSA 2R6KA 4POLA 1AQWA 1AXDA 2FA4A 4MH3A 1S3RA 4BWQA 4KW6A 2X64A 2CVKA 2FUSA 1GH2A 3DEXA 4GF0A 4O5UA 4X4JA 1Q92A 2LRNA 3LXTA 3VWXA 2E0QA 3PGTA 5ECKB 5D8IA 4ZIJA 1O85A 1HNCA 4TR1B 3DD3A 4FYCA 5ELAA 5IO0A 3C8TA 4NSLA 1C72A 2LRCA 4MA9A 4KUNA 5DALB 1IYHA 4IQ1A 3IV4A 4V2MA 2X8GA 3HXSA 2DSAA 4YIHA 4PUFC 1EP7A 1ERVA 2VCWA 5AN1A 4EDZA 2VM2A 1OE7A 2VIMA 1VF3A 5B8BA 3H1NA 5J5NA 4MZCA 1JZOA 1Q4JA 3KMOA 4HEA2 4ZB9A 2CX3A 4YQUA 1XOAA 2DIZA 2LV3A 1YY7A 6GSUA 4XTSA 4LL4B 2B5EA 2QGAB 4RQRA 1SL1B 3A2VA 4GRFA 4OCEA 2H0GA 1TK5B 3KXOA 1H4OA 1A0RP 3IK7A 2H66A 3UBKA 4KAEA 1GTBA 4J56E 4RQXA 2O7KA 3HJOA 3UJ1A 2IFQB 3SBCA 2MBSA 2N5FA 1QGVA 1YF0A 2NPBA 1AW9A 1LBKA 2FD3A 4GLTA 2X4AA 3MWHA 4ML6A 3DVWA 1YQ1A 1KBNA 4IBPA 2H01A 1QUWA 1S3DA 1HQOA 2R0PA 5G5EA 1SKWB 1AUCA 4IJIA 5LD0A 5DAKB 2HSMA 3E04A 4FYBA 1SK1A 3MIXA 4MK3A 1HNBA 3C1RA 1XW5A 4OMVA 6GSVA 1UVZA 2FHEA 5IMFA 4FYUA 4KE3A 1EZKA 2C3NA 1R7HA 5EVOA 4MJAA 2NBSA 2KP2A 3C1SA 3ZVJA 2HNLA 1VRSD 3FRCA 3IHGA 2FA8A 4N0ZA 4MPGA 1M2AA 2O87A 4AF2A 2L5OA 3D6IA 4ZL8A 1WIKA 2HI7A 1YEPA 2MMAA 2E7PA 2CA8A 2M72A 1PKZA 1T4ZA 2ZUPA 4HS1A 4YKGA 3KGKA 2P0GA 4K2XA 4G0KA 4HU9A 12GSA 4Z2TA 4BIKA 6GSWA 2NVLA 3EVIA 3BD2A 4HU7A 1JFUA 2R4VA 2I3YA 2YV5A 2PFMA 4LLRA 1O6JA 2H1GA 5D96A 4MJBA 2PU9C 5LCZA 3TOTA 2KP1A 1G7EA 3DIEA 1G7OA 1AQVA 3APSA 1PL2A 1YF1A 1V9WA 4D73A 2JAWA 3VFIA 5CRDA 3KTBA 4L5OA 4L5LA 1ON4A 1Z4PX 1XVWA 2E2GA 3ZITA 1H75A 3EWLA 2IMEA 3KP8A 4OWYA 1HY0A 2YWNA 3LYPA 1ZMAA 3QFAC 3LXZA 3GKKA 1FO5A 2RLIA 1U15A 4FO5A 3GNJA 5DALA 1YFMA 3VURA 4ACSA 2HT9A 5GAPD 3RPNA 4WR5A 2H6ZA 2LKUA 4N30A 3BBYA 5CP1A 4QL7A 2C0FA 2GVPA 2YV9A 2HSHA 3WT2A 3M9JA 2JAUA 3MAKA 1X0RA 14GSA 1ZYEA 2WULA 4MNNA 2D27A 1OC9A 2XC2A 4BA7A 4WKWA 3W6GA 4HZ4A 4PXOA 1GNWA 2KUCA 5GSTA 1Z4QA 2OBKA 2N5AA 4KSMA 3NOFA 2MBTA 4H86A 4ML1A 3U6VA 1EOHA 3GL5A 4KSOA 2ON5A 5CO3A 3D4MA 1THXA 1S3CA 4OFMA 3QPMA 2GGTA 2L6DA 2QSIA 3GURA 3GSSA 5CYYA 2H8LA 4NMUA 1EWXA 4O32A 3F9UA 2EC4A 1M2DA 3H4KA 4DSSA 2RM5A 2AHEA 3D4TA 5B7CA 2LQOA 1GTAA 1VGLA 4IJ3A 1PQNA 2GS3A 2VL9A 4JU5A 1ZOFA 1JLVA 4KF9A 1FAAA 2VCZA 4Z2RA 4P3YB 5DJMA 3ZMLA 3RDWA 2X8HA 3TJKA 3P8WA 3F4TA 2YCDA 3ZTLA 5IM9A 1Z3EA 4CHSA 1T4YA 1J0FA 2DMLA 2D28C 2AYTA 1A2LA 5KN0A 2GZZA 2WDUA 4NFLA 4K7NA 5A5KA 3HDCA 1T8EB 5FHIA 3QAVA 1TK8B 5EL8A 2QGVA 3TRQA 4PUAA 1SL0B 4X0XA 2B7KA 2VD1A 3UMAA 4NHZA 4G0IA 2IMDA 3GV1A 4V2NA 5ECPB 1M99A 2CVBA 3P90A 2A4HA 4BWSA 4APAA 1TJVA 2WB9A 2L6CA 4JR4A 4LMVA 5DJLA 4POKA 5IOXA 5ID2A 2H30A 4F2IA 2LUSA 3QCPA 1MEKA 4J2FA 4CY6A 4XRAA 2E9FA 3GH9A 2OKAA 1V57A 2LS5A 2B6MA 3CXGA 2IIYA 3AY8A 4XS4A 3H8QA 1XWBA 2B5XA 2OE0A 1KNGA 3G7YA 5D9XA 2V41A 3F3RA 3KM6A 5DVBA 3ZFBA 4AJ6A 3FZ9A 2BJXA 4EXJA 1YFEA 1X9MB 3N9JA 2ZNMA 4TR1A 2WJUA 3HCZA 4LL1B 2AB6A 4YIKA 1A2JA 2CX4A 3GTUB 5FWGA 2P5QA 4MF6A 1M2BA 1A23A 3I43A 4LMWA 3HHVA 4EL1A 3KP9A 2H72A 4K9ZA 2LRTA 5ECMB 5INYA 5L71A 2HRFA 1XFLA 4HDEA 1M9BA 1OYJA 3HY2A 3FMWA 1A8YA 1PA3A 4USSA 1GULA 2WS2A 3A5IA 2IMKA 2O89A 4YQVA 3IA1A 4GQFA 1Z4KA 2R2JA 4MMMA 4TXOA 3IK9A 2VLTA 3IOSA 2GSSA 2IFQA 3H79A 4I2TA 1ABAA 1Q91A 2C3QA 1J9BA 1F37A 2F9SA 1SYRA 4K0NA 2FWFA 1Z7PA 4RUVA 2K6VA 1YKAA 4EIPA 4YH2A 3GA4A 3FYGA 1NHYA 3FK8A 5DCGA 3TRPA 1R26A 2RCNA 1BAYA 1XXUA 1G0TA 2LJKA 3DYRA 1FURA 3ERFA 4K8MA 1G6WA 2FWHA 3F0IA 1MDIA 5IMDA 3UEMA 3BCKA 2REMA 1GSFA 3P7XA 4EVMA 1QK8A 1EGRA 2H0HA 4NLEA 5ECIB 5F07A 1ACVA 5HFKA 4EE0A 5CRHA 5G30A 1B8XA 3QFBC 2OBIA 4ZBAA 1OKDA 4ISDA 5IPGA 1XWOA 1K0MA 5DQYA 1O81A 1XWAA 2V1MA 1F3AA 1A24A 4ILFA 1XWKA 1ZZYA 4I6XA 1JSWA 3ZIVA 1U3IA 2H1AA 1M9AA 3QAGA 3DKSA 2H6YA 4KA0A 1EOGA 4HUAA 2JZSA 4GSSA 5GZZB 1XW9A 3APOA 1GUKA 1MD3A 4GSTA 1Z4IA 4Z7XA 3U5RE 3BOAA 4GXZA 3I9V2 2F3MA 1EGOA 2VCQA 3GKNA 4ULXA 2OACA 3FR6A 1KTEA 1FUQA 2A2SA 3GRXA 1CQGA 3F8UA 4KDUA 2C0DA 5D9TA 4BPYA 2H6XA 5IMZA 4MWOA 3F3QA 2I9HA 1YZXA 3QBPA 2ON7A 1TRVA 5F05A 5IO2A 2JACA 6GSSA 5IMVA 4ZL7A 2A2RA 4TRXA 1C3CA 3TJFA 1T1VA 19GSA 3FKFA 1PRXA 5DBQA 4NXIA 2OE3A 4IHUA 2LQQA 2H76A 2B3SA 3KIJA 1K3OA 4MCUA 1O8XA 2JZRA 2VOCA 2HFDA 3I6AA 5IQYA 3GL3A 4JBBA 1PKWA 1FUOA 2X75A 1BX9A 2NDOA 1SYXA 2CAQA 1YDKA 3HD5A 4GSNA 3TCOA 1U88A 2H0IA 1K3LA 5G2ZA 1E2YA 4L0UA 3RHBA 2GT5A 3WGXA 3PPUA 4YKFA 4ADLA 4MABA 3L9VA 5JWRB 3OCEA 2G0FA 3NO9A 2LTKA 3CTGA 5CRWA 1K62A 1GL8A 4MH2A 3KJYA 4IGJA 2WCIA 4J57E 4XS4B 1OVNA 1SK2A 4IN0A 1XG8A 3UARA 3RD8A 2YWOA 1DUGA 2VAFA 4OO4A 1PX7A 3FW2A 3TRXA 3VPTA 4PNFA 2CV4A 2H74A 3V1WA 1FVKA 1U87A 1M0UA 2LSTA 5AISA 4QL9A 2L5LA 3S9FA 3O76A 1X9WB 1DSBA 1MDKA 2CT6A 3CSJA 2K18A 1AQXA 2JARA 3J7Yk 2J9HA 3FEUA 3OCFA 2FWGA 4G9HA 4BVXA 3GKXA 1KQ7A 1OKTA 3EINA 2PWJA 2H19A 4TXOB 2IMIA 2NTOA 3TJJA 5KN3A 2QA2A 3GTDA 1O73A 1B4QA 4K7OA 1QFNA 3A5WA 1GRXA 1CQHA 1SKRB 1RW1A 3Q6OA 4BL7A 4PX1A 4XCSA 1FB6A 4BVYA 4BL7B 1SJZA 2K8SA 3APQA 3TUEA 2PMTA 2H75A 5D6BA 3GYKA 3WD6A 5G5FA 5HW2A 4E8EA 3ZZXA 4GCIA 3IHQA 1TU7A 2VM1A 2A4VA 4G0LA 2GSRA 2X99A 1RK4A 4WETA 3RPPA 2IWTA 2QC7A 3CYNA 2EIQA 3EMXA 1DCNA 2HSYA 3M9KA 3CMIA 4KGIA 3RBTA 3GHAA 3FHKA 4MZWA 5AGYA 4K2DA 4EEIA 4Q5RA 1TJDA 1W89A 2PVQA 3M3MA 1ZCPA 4L0WA 3C71A 5BMUA 3D5JA 2YOIA 1Z5YE 6GSTA 1PX6A 1M3IA 5DAKA 1RE5A 3TKSA 5H5SA 3IC4A 5LNKe 2VL3A 1GUHA 3TJGA 5J4UA 3GX0A 3CSHA 1OC8A 5HR2A 2MYGA 3FR3A 3L78A 4K5SA 2VCVA 1MTCA 1F2EA 4WEYA 4K0GA 4ZXGA 1GWCA 1ZYPA 3GKMA 3UOMA 5DCHA 3CI0K 2KLXA 4YQMA 1JZDA 1S3AA 4FIWA 1V40A 2GQLA 4O5RA 3HVVA 4L6AA 5CREA 1JZWA 5CAXA 2D2ZA 3EU4A 1TP9A 4HQSA 1PN9A 3KH7A 1T3BA 2C1YA 3TKRA 2B7JA 1TTZA 2L4CA 5JCWA 16GSA 2ZCTA 3LW9A 5F06A 2C0EA 4G10A 3LEFA 1TDIA 3IE3A 2TRCP 2CQ9A 22GSA 1N8JA 2JL4A 2P5RA 1SK0A 3DVXA 3WYWA 4WF4A 1XWGA 1V98A 5G1LA 3MYDA 1MH9A 1ERWA 3IBHA 4EDYA 4L8EA 3F4RA 2V32A 3R2QA 13GSA 1C3UA 3CTFA 1T7PB 5DQSA 4G19A 2YPMA 3TGZA 1ZYQB 1XW6A 4E88A 1Q98A 2I81A 4POMA 4N0VA 4Q5QA 4TN8A 3GIXA 3ZMKA 4KB3A 5KOXA 4F0BA 2CZ3A 2P31A 3ISOA 1UA5A 4PTSA 2IJYA 3KH9A 4NAXA 1K0BA 1Z6NA 5ECNB 1K0CA 2H73A 2JADA 1UN2A 4PQIA 1Z6MA 4ZBBA 3RRPA 5C04A 2PTSA 3LYKA 2C80A 3HVXA 1ERUA 3VWUA 3LGCA 1MD4A 4IP1A 5ECLB 2GLRA 1R5AA 1K0NA 1Z7RA 4MF7A 3PINA 4PNGA 3VWWA 1SL2B 4AJ8A 3EURA 2F8AA 3M8NA 20GSA 3ZIJA 2C3TA 4POBA 2PGTA 2GZPA 1GTIA 5G31A 1WP0A 3CSIA 4JEDA 1X9SB 1ML6A 3KD0A 2HLSA 4XS1A 4MUMA 4HI7A 1TKDB 3GX8A 4ZB8A 4MP4A 3F63A 2LJAA 4BVYB 3U19A 1XIYA 2YWIA 4IP6A 5F92A 1G6YA 1GNEA 4F9ZA 3FZ4A 4ZILA 3IAS2 1XBSA 2HE3A 1ST9A 4JRRA 6GSYA 3KZQA 3EMPA 3ZLPA 2I7DA 4OFNA 2IPAA 4KCAA 4E8HA 4KDXA 3TV2A 3VLNA 2RUEA 3DRNA 3TDGA 2DJ3A 2A2PA 4ICYA 4I5QA 3E0UA 1ERTA 2RM6A 2FLSA 4X43A 3QMXA 10GSA 3A2WA 2F51A 4F03A 2OE1A 4MJCA 4N11A 5KN2A 3IDVA 2I4AA 2PTQA 4ZBDA 2QKEA 3FR9A 5F8BA 1W4VA 1X5CA 4NWYA 5D73A 1ZL9A 3I69A 1HYUA 2YV7A 3GMFA 4OO5A 4WXTA 1PN0A 1WJKA 2FNOA 1V2AA 2WFCA 1URMA 2LEGA 2MMNA 3HA9A 3UBLA 2BTOT 1T00A 3IAM2 4HZ2A 5KEJA 5GAND 1I0AA 2XPDA 3ZYWA 1FOVA 1Z4JA 3TKPA 3HJPA 2H70A 5J3RA 2GQKA 4ECBA 4D73B 3QOUA 5GSSA 1GSEA 2YNXA 3N5OA 4MDCA 4O92A 3EE2A 4L57A 5E59A 1DE2A 2FY6A 1FG4A 3W8SA 1IW7D 3GFKA 2GT6A 4AJ7A 5HR0A 4CW9A 2YANA 4TXVA 2OADA 2HZEA 4JZQA 3HJMA 2PTRA 2PN8A 2V2GA 2VLUA 1XCCA 2TIRA 1F3BA 5BRTA 1JZRA 2VCXA 3ERGA 3WGDA 2B1KA 4DSQA 4I97A 4JE1A 3O3TA 3D22A 4DSRA 1SKSB 2H1DA 4YAPA 1Y6EA 2EIOA 4MX2A 3VI5A 3GTUA 1LU4A 4WR4A 2XHFA 3IR4A 2GQMA 1HD2A 1OC9B 3PR8A 5CNWA 2DJJA 2RUFA 3LSZA 1SJIA 2R3XA 4MPFA 8GSSA 2TRXA 5EY6A 1OAZA 4PGTA 3L9SA 1R4WA 5B6NA 1TRSA 1QQ2A 2ES7A 2QA1A 5COHA 2AJQB 4V1Ap 3VWVA 4EIQA 4FQUA 1PL1A 5D9VA 3KEBA 1B9YC 9GSSA 3EYTA 5J41A 5IPHA 1Y25A 4IQAA 4CY8A 4EO3A 1XOBA 1EP8A 2CAIA 4IELA 2VD0A 1XVQA 1K0DA 4K6XA 4MJEA 1O8WA 3F6FA 1GP1A 4DEJA 1GUMA 5G1KA 5ECOB 2DC5A 3CRTA 4GTUA 4KX4A 1YEXA 1Z9HA 1ILOA 1OE8A 1B48A 1B9XC 1GLPA 2E2MA 3WGEA 3Q74A 1WMJA 5ECHB 3ZRDA 2O85A 3K8NA 3CRUA 1U16A 3HYPA 1TI1A 4PQHA 4WBRD 1SENA 1E6BA 5F91A 2DKIA 2HVGA 18GSA 3ERWA 2GZYA 1U6TA 3PH9A 5JWOB 2PVOC 4NHWA 1TRWA 2R5GA 5E4WA 3VK9A 5ABRA 3C8EA 1I5GA 2JAOA 1HNAA 1EEJA 1JLWA 4TVEA 1QXHA 4HSCX 4FH8A 17GSA 1A2MA 4K1FA 1TJWA 3E9JB 1K3YA 2HZEB 4PURA 2GTUA 3Q19A 4N10A 3US3A 1ZGNA 4TR0A 4Q5NA 1TK0B 3UIWA 2L59A 1Z4MA 4EFCA 3LJRA 3G9BA 1NHOA 3JCML 1OC3A 2L4QA 3W8JA 2YZHA 6GSXA 4APBA 1USBA 1U3AA 3VI7A 2H71A 1XPVA 2YJ7A 4TOPA 2YP6A 5HR3A 4EUYA 2R37A 1FVJA 4O5QA 3HKRA 4NPBA 2G2QA 3KCMA 1YJ6A 3O6TA 1J08A 3Q18A 4TKYA 1A8LA 4AGSA 1VF4A 1WE0A 2YN1A 3NIVA 2R0CA 3F6DA 3MNGA 5D9WA 1PMTA 2FCHA 1R5PA 1F6MC 4OFTA 1PSQA 2AV4A 4ID0A 3A3TA 3QR6A 1PFOA 1T9HA 5ENUA 2DMMA 1GSDA 1DOFA 4HQZA 3IPZA 4F0CA 3MDKA 3QDNA 3LQ7A 4ECIA 4ECJA 5D93A 1FUPA 5JCGA 3M1GA 5HQPA 1RQMA 4LA1A 4XIHA 4Q5FA 1K0AA 4EKZA 5A4WA 2HZFA 3R6QA 4BVXB 4HOJA 2MMZA 2HRKA 2Z9SA 4X1UA 1SU9A 4KNDA 5HFGA 3ZL5A 2PERA 2AUVA 2XBQA 2DLXA 5KN1A 2GSQA 4TR3A 1HY1A 3C7MA 4NV2A 4MZBA 1QMVA 5J9CA 2GSTA 4K7IA 1FB0A 3TB2A 3ZREA 2H1BA 3DXBA 3M0FA 3G7IA 4NV5A 3FZ5A 1I9DA 2CZ2A 2HXKA 1DBYA 1AAZA 1NSWA 2DJ0A 4XRDA 1WRYA 1SD9A 1BJXA 2DIYA 5DDLA 2AAWA 11GSA 1ZYNA 2FWEA 1VF1A 1AC1A 3IC8A 1EV9A 2V6OA 4RI7A 3TKSC 1F9MA 2WRTA 4TR4A 1WOUA 1BYEA 2IMFA 3EPTA 1GSSA 5AIVA 3BJ5A 2LNTA 4MLYA 2PUKC 1A0FA 4KDYA 3L9UA 1TW9A 4OCFA 2PPTA 1XWCA 5JCUA 5C00A 3ZVJD 4HJ2A 1FHEA 2MMOA 1THOA 1MDJA 4V1Ag 5CRGA 4KCEA 4WF5A 3TKQA 3EU3A 4IQJM 2K8VA 4HGVA 3H93A 2VO4A 3OR5A 1K0OA 1BQ7A 4IKHA 2KOKA 3IRAA 3UAPA 1GSQA 5JWQB 1PGTA 2FGXA 3HZ8A 1TRUA 2N5BA 4ZB6A 3P2AA 5IMAA 5B8AA 7GSSA 3QD9A 4IW9A 3F4SA 3HVSA 1FW1A 1TJUA 3TKSE 3ED3A 1X5EA 2L57A 3DWVA 3D21A 1N2AA 4XHMA 5B6MA 1AUWA 4K5RA 2X49A 1K7WA 1B4PA 2KHPA 3CQFA 4I2UA 1XZOA 5FT3A 3ME8A 1PD21 5A4UA 4XS6A 1NW2A 5IMCA 1VDKA 4MF5A 4O7HA 3UVTA 4L6CA 2IN3A 1O7UA 3U13A 4ADMA 3CBUA 3ZFLA 1EV4A 4TW5A 3LFLA 2WGRA 1GLQA 3VPQA 2FUG2 2RIIA 2C0GA 2I1UA 1AIUA 2JSZA 2LJRA 3BWVA 3QAWA 1LJRA 3J7Yb 1SJ6A 3KTLA 3D0ZA 1FOHA 2BMXA 3TOUA 3MSZA 3L0HA 2VL2C 4CDOA 1TJ7A 1TU8A 1U0LA 2B1LA 4I8BA 4KH7A 2OJLA 1GTUA 3SWLA 3WT1A 2HRAA
chains in the Genus database with same CATH topology
2YZUA 1V58A 2ALBA 5ECSA 4Z2UA 4JR6A 1GSYA 1TOFA 2UZ8A 5H5QA 1JHBA 2V6KA 2R0GA 2C4JA 4GQCA 5KOWA 3DGQA 1WPIA 2VL2A 5EPFA 5H5RA 2XPEA 2M46A 3GN3A 3HZ4A 1X5DA 2M80A 2MZCA 3UL3A 2DJKA 4V2LA 5ECRB 4RI6A 1BG5A 4ZL9A 5F0GA 2LNSA 1KEBA 3L4NA 2JSYA 2YJHA 4WBJA 2OA7A 2DJ2A 3DMLA 3GSTA 1TI3A 3FZAA 5AIXA 4A5PA 2J23A 1IYIA 4DSSB 1WWJA 3E3EA 5IIZA 2F8FA 4G2EA 1TXXA 2YWMA 4YAVA 5ID2B 3EC3A 5IOWA 1GSUA 4GWRA 4EC0A 2VUPA 1VF2A 1SD8A 2PBJA 2HYXA 2DBCA 4QQ7A 1BEDA 4ECCA 3G7JA 5ECQB 1EEMA 2JZTA 3TJBA 2XBIA 3C73A 4F82A 2EIRA 2C8UA 4DVCA 5HFIA 3BCIA 3R3EA 4EF0A 2CVDA 2JU5A 3A2XA 3LWAA 2GDRA 4IS0A 2WZ9A 4HJMA 1DE1A 2DKHA 2K9FA 2VCTA 1M7TA 3LG6A 2O8VB 4OD7A 3GH6A 3KMNA 2X8CA 3IXRA 4IVFA 5HR1A 5A4VA 2DJ1A 3RHCA 3LORA 2B5YA 1YKCA 3UVHA 2IL3A 1UC7A 3FY7A 2VLVA 3RAZA 5ELGA 3NZNA 1NM3A 2HRNA 5J9BA 4PQ1A 3ME7A 3GUSA 2R6KA 4POLA 1AQWA 1AXDA 2FA4A 4MH3A 4BWQA 4KW6A 2X64A 2CVKA 1GH2A 3DEXA 4GF0A 4O5UA 4X4JA 2LRNA 3LXTA 3VWXA 2E0QA 3PGTA 5ECKB 5D8IA 4ZIJA 1O85A 1HNCA 4TR1B 3DD3A 4FYCA 5ELAA 5IO0A 1C72A 2LRCA 4MA9A 4KUNA 5DALB 1IYHA 4IQ1A 3IV4A 4V2MA 2X8GA 3HXSA 2DSAA 4PUFC 1EP7A 1ERVA 2VCWA 5AN1A 4EDZA 2VM2A 1OE7A 2VIMA 1VF3A 5B8BA 3H1NA 5J5NA 4MZCA 1JZOA 1Q4JA 3KMOA 4HEA2 4ZB9A 2CX3A 4YQUA 1XOAA 2DIZA 2LV3A 1YY7A 6GSUA 4XTSA 4LL4B 2B5EA 4RQRA 1SL1B 3A2VA 4GRFA 4OCEA 2H0GA 1TK5B 3KXOA 1H4OA 1A0RP 3IK7A 2H66A 3UBKA 4KAEA 1GTBA 4J56E 4RQXA 2O7KA 3HJOA 3UJ1A 2IFQB 3SBCA 2MBSA 2N5FA 1QGVA 1YF0A 2NPBA 1AW9A 1LBKA 2FD3A 4GLTA 2X4AA 3MWHA 4ML6A 3DVWA 1YQ1A 1KBNA 4IBPA 2H01A 1QUWA 1S3DA 1HQOA 2R0PA 5G5EA 1SKWB 1AUCA 4IJIA 5LD0A 5DAKB 2HSMA 4FYBA 1SK1A 3MIXA 4MK3A 1HNBA 3C1RA 1XW5A 4OMVA 6GSVA 1UVZA 2FHEA 5IMFA 4FYUA 4KE3A 1EZKA 2C3NA 1R7HA 5EVOA 4MJAA 2NBSA 2KP2A 3C1SA 3ZVJA 2HNLA 1VRSD 3FRCA 3IHGA 2FA8A 4N0ZA 4MPGA 1M2AA 2O87A 4AF2A 2L5OA 3D6IA 4ZL8A 1WIKA 2HI7A 1YEPA 2MMAA 2E7PA 2CA8A 2M72A 1PKZA 1T4ZA 2ZUPA 4HS1A 4YKGA 3KGKA 2P0GA 4K2XA 4G0KA 4HU9A 12GSA 4Z2TA 6GSWA 2NVLA 3EVIA 3BD2A 4HU7A 1JFUA 2R4VA 2I3YA 4LLRA 1O6JA 2H1GA 5D96A 4MJBA 2PU9C 5LCZA 3TOTA 2KP1A 1G7EA 3DIEA 1G7OA 1AQVA 3APSA 1PL2A 1YF1A 1V9WA 4D73A 3VFIA 5CRDA 3KTBA 4L5OA 4L5LA 1ON4A 1XVWA 2E2GA 3ZITA 1H75A 3EWLA 2IMEA 3KP8A 4OWYA 2YWNA 3LYPA 1ZMAA 3QFAC 3LXZA 3GKKA 1FO5A 2RLIA 4FO5A 3GNJA 5DALA 3VURA 4ACSA 2HT9A 5GAPD 3RPNA 4WR5A 2H6ZA 2LKUA 4N30A 3BBYA 5CP1A 4QL7A 2C0FA 2GVPA 2YV9A 2HSHA 3WT2A 3M9JA 3MAKA 1X0RA 14GSA 1ZYEA 2WULA 4MNNA 2D27A 1OC9A 2XC2A 4BA7A 4WKWA 3W6GA 4HZ4A 4PXOA 1GNWA 2KUCA 5GSTA 2OBKA 2N5AA 4KSMA 3NOFA 2MBTA 4H86A 4ML1A 3U6VA 1EOHA 3GL5A 4KSOA 2ON5A 5CO3A 3D4MA 1THXA 1S3CA 4OFMA 3QPMA 2GGTA 2L6DA 2QSIA 3GURA 3GSSA 5CYYA 2H8LA 4NMUA 1EWXA 4O32A 3F9UA 2EC4A 1M2DA 3H4KA 4DSSA 2RM5A 2AHEA 3D4TA 5B7CA 2LQOA 1GTAA 1VGLA 4IJ3A 1PQNA 2GS3A 2VL9A 4JU5A 1ZOFA 1JLVA 4KF9A 1FAAA 2VCZA 4Z2RA 4P3YB 5DJMA 3ZMLA 3RDWA 2X8HA 3TJKA 3P8WA 3F4TA 2YCDA 3ZTLA 5IM9A 1Z3EA 4CHSA 1T4YA 1J0FA 2DMLA 2D28C 2AYTA 1A2LA 5KN0A 2GZZA 2WDUA 4K7NA 5A5KA 3HDCA 1T8EB 5FHIA 3QAVA 1TK8B 5EL8A 2QGVA 3TRQA 4PUAA 1SL0B 4X0XA 2B7KA 2VD1A 3UMAA 4NHZA 4G0IA 2IMDA 3GV1A 4V2NA 5ECPB 1M99A 2CVBA 3P90A 2A4HA 4BWSA 2WB9A 2L6CA 4JR4A 4LMVA 5DJLA 4POKA 5IOXA 5ID2A 2H30A 4F2IA 2LUSA 3QCPA 1MEKA 4J2FA 4CY6A 4XRAA 3GH9A 2OKAA 1V57A 2LS5A 2B6MA 3CXGA 2IIYA 3AY8A 4XS4A 3H8QA 1XWBA 2B5XA 2OE0A 1KNGA 3G7YA 5D9XA 2V41A 3F3RA 3KM6A 5DVBA 3ZFBA 4AJ6A 3FZ9A 2BJXA 4EXJA 1X9MB 3N9JA 2ZNMA 4TR1A 2WJUA 3HCZA 4LL1B 2AB6A 1A2JA 2CX4A 3GTUB 5FWGA 2P5QA 4MF6A 1M2BA 1A23A 3I43A 4LMWA 3HHVA 4EL1A 3KP9A 2H72A 4K9ZA 2LRTA 5ECMB 5INYA 5L71A 2HRFA 1XFLA 4HDEA 1M9BA 1OYJA 3HY2A 3FMWA 1A8YA 1PA3A 4USSA 1GULA 2WS2A 3A5IA 2IMKA 2O89A 4YQVA 3IA1A 4GQFA 2R2JA 4MMMA 4TXOA 3IK9A 2VLTA 3IOSA 2GSSA 2IFQA 3H79A 4I2TA 1ABAA 2C3QA 1J9BA 1F37A 2F9SA 1SYRA 4K0NA 2FWFA 1Z7PA 4RUVA 2K6VA 1YKAA 4EIPA 4YH2A 3GA4A 3FYGA 1NHYA 3FK8A 5DCGA 3TRPA 1R26A 1BAYA 1XXUA 1G0TA 2LJKA 3DYRA 3ERFA 4K8MA 1G6WA 2FWHA 3F0IA 1MDIA 5IMDA 3UEMA 3BCKA 2REMA 1GSFA 3P7XA 4EVMA 1QK8A 1EGRA 2H0HA 5ECIB 5F07A 1ACVA 5HFKA 4EE0A 5CRHA 5G30A 1B8XA 3QFBC 2OBIA 4ZBAA 1OKDA 4ISDA 5IPGA 1K0MA 5DQYA 1O81A 1XWAA 2V1MA 1F3AA 1A24A 4ILFA 1XWKA 1ZZYA 4I6XA 3ZIVA 1U3IA 2H1AA 1M9AA 3QAGA 3DKSA 2H6YA 4KA0A 1EOGA 4HUAA 5GZZB 2JZSA 4GSSA 1XW9A 3APOA 1GUKA 1MD3A 4GSTA 4Z7XA 3U5RE 3BOAA 4GXZA 3I9V2 2F3MA 1EGOA 2VCQA 3GKNA 4ULXA 2OACA 3FR6A 1KTEA 2A2SA 3GRXA 1CQGA 3F8UA 4KDUA 2C0DA 5D9TA 4BPYA 2H6XA 5IMZA 3F3QA 2I9HA 1YZXA 2ON7A 1TRVA 5F05A 5IO2A 2JACA 6GSSA 5IMVA 4ZL7A 2A2RA 4TRXA 3TJFA 1T1VA 19GSA 3FKFA 1PRXA 5DBQA 4NXIA 2OE3A 4IHUA 2LQQA 2H76A 2B3SA 3KIJA 1K3OA 4MCUA 1O8XA 2JZRA 2VOCA 2HFDA 3I6AA 5IQYA 3GL3A 4JBBA 1PKWA 1BX9A 2NDOA 1SYXA 2CAQA 1YDKA 3HD5A 4GSNA 3TCOA 1U88A 2H0IA 1K3LA 5G2ZA 1E2YA 4L0UA 3RHBA 2GT5A 3WGXA 3PPUA 4YKFA 4MABA 3L9VA 5JWRB 2G0FA 2LTKA 3CTGA 5CRWA 1GL8A 4MH2A 3KJYA 4IGJA 2WCIA 4J57E 4XS4B 1OVNA 1SK2A 4IN0A 3UARA 2YWOA 1DUGA 2VAFA 4OO4A 1PX7A 3FW2A 3TRXA 3VPTA 4PNFA 2CV4A 2H74A 3V1WA 1FVKA 1U87A 1M0UA 2LSTA 5AISA 4QL9A 2L5LA 3S9FA 3O76A 1X9WB 1DSBA 1MDKA 2CT6A 3CSJA 2K18A 1AQXA 3J7Yk 2J9HA 3FEUA 2FWGA 4G9HA 4BVXA 3GKXA 1OKTA 3EINA 2PWJA 2H19A 4TXOB 2IMIA 2NTOA 3TJJA 5KN3A 2QA2A 1O73A 1B4QA 4K7OA 1QFNA 3A5WA 1GRXA 1CQHA 1SKRB 1RW1A 3Q6OA 4BL7A 4PX1A 4XCSA 1FB6A 4BVYA 4BL7B 1SJZA 2K8SA 3APQA 3TUEA 2PMTA 2H75A 3WD6A 3GYKA 5G5FA 4E8EA 3ZZXA 4GCIA 3IHQA 1TU7A 2VM1A 2A4VA 4G0LA 2GSRA 2X99A 1RK4A 4WETA 3RPPA 2IWTA 2QC7A 3CYNA 2EIQA 3EMXA 2HSYA 3M9KA 3CMIA 4KGIA 3RBTA 3GHAA 3FHKA 4MZWA 5AGYA 4K2DA 4Q5RA 1TJDA 1W89A 2PVQA 3M3MA 1ZCPA 4L0WA 3C71A 5BMUA 3D5JA 2YOIA 1Z5YE 6GSTA 1PX6A 5DAKA 3TKSA 5H5SA 3IC4A 5LNKe 2VL3A 1GUHA 3TJGA 5J4UA 3GX0A 3CSHA 1OC8A 5HR2A 2MYGA 3FR3A 3L78A 4K5SA 2VCVA 1MTCA 1F2EA 4WEYA 4K0GA 4ZXGA 1GWCA 1ZYPA 3GKMA 3UOMA 5DCHA 2KLXA 4YQMA 1JZDA 1S3AA 4FIWA 1V40A 2GQLA 4O5RA 3HVVA 5CREA 1JZWA 5CAXA 2D2ZA 3EU4A 1TP9A 4HQSA 1PN9A 3KH7A 1T3BA 2C1YA 3TKRA 2B7JA 1TTZA 2L4CA 5JCWA 16GSA 2ZCTA 3LW9A 5F06A 2C0EA 4G10A 3LEFA 1TDIA 3IE3A 2TRCP 2CQ9A 22GSA 1N8JA 2JL4A 2P5RA 1SK0A 3DVXA 3WYWA 4WF4A 1XWGA 1V98A 5G1LA 3MYDA 1ERWA 3IBHA 4EDYA 4L8EA 3F4RA 2V32A 3R2QA 13GSA 3CTFA 1T7PB 5DQSA 4G19A 2YPMA 3TGZA 1ZYQB 1XW6A 1Q98A 2I81A 4POMA 4N0VA 4Q5QA 4TN8A 3GIXA 3ZMKA 4KB3A 5KOXA 4F0BA 2CZ3A 2P31A 3ISOA 1UA5A 4PTSA 2IJYA 3KH9A 4NAXA 1K0BA 1Z6NA 5ECNB 1K0CA 2H73A 2JADA 1UN2A 4PQIA 1Z6MA 4ZBBA 5C04A 3LYKA 2C80A 3HVXA 1ERUA 3VWUA 3LGCA 1MD4A 4IP1A 5ECLB 2GLRA 1R5AA 1K0NA 1Z7RA 4MF7A 3PINA 4PNGA 3VWWA 1SL2B 4AJ8A 3EURA 2F8AA 3M8NA 20GSA 3ZIJA 2C3TA 4POBA 2PGTA 2GZPA 1GTIA 5G31A 1WP0A 3CSIA 4JEDA 1X9SB 1ML6A 3KD0A 2HLSA 4XS1A 4HI7A 1TKDB 3GX8A 4ZB8A 4MP4A 3F63A 2LJAA 4BVYB 1XIYA 2YWIA 4IP6A 1G6YA 1GNEA 4F9ZA 3FZ4A 4ZILA 3IAS2 1XBSA 2HE3A 1ST9A 4JRRA 6GSYA 3KZQA 3EMPA 3ZLPA 4OFNA 2IPAA 4KCAA 4E8HA 4KDXA 3VLNA 2RUEA 3DRNA 3TDGA 2DJ3A 2A2PA 4ICYA 4I5QA 3E0UA 1ERTA 2RM6A 2FLSA 4X43A 3QMXA 10GSA 3A2WA 2F51A 4F03A 2OE1A 4MJCA 4N11A 5KN2A 3IDVA 2I4AA 4ZBDA 2QKEA 3FR9A 5F8BA 1W4VA 1X5CA 4NWYA 5D73A 1ZL9A 3I69A 1HYUA 2YV7A 3GMFA 4OO5A 4WXTA 1PN0A 1WJKA 2FNOA 1V2AA 2WFCA 1URMA 2LEGA 2MMNA 3HA9A 3UBLA 2BTOT 1T00A 3IAM2 4HZ2A 5KEJA 5GAND 2XPDA 3ZYWA 1FOVA 3TKPA 3HJPA 2H70A 5J3RA 2GQKA 4ECBA 4D73B 3QOUA 5GSSA 1GSEA 2YNXA 3N5OA 4MDCA 4O92A 3EE2A 5E59A 1DE2A 2FY6A 1FG4A 3W8SA 1IW7D 3GFKA 2GT6A 4AJ7A 5HR0A 4CW9A 2YANA 4TXVA 2OADA 2HZEA 4JZQA 3HJMA 2V2GA 2PN8A 2VLUA 1XCCA 2TIRA 1F3BA 5BRTA 1JZRA 2VCXA 3ERGA 3WGDA 2B1KA 4DSQA 4I97A 4JE1A 3O3TA 3D22A 4DSRA 1SKSB 2H1DA 4YAPA 1Y6EA 2EIOA 3VI5A 3GTUA 1LU4A 4WR4A 2XHFA 3IR4A 2GQMA 1HD2A 1OC9B 3PR8A 5CNWA 2DJJA 2RUFA 3LSZA 1SJIA 2R3XA 4MPFA 8GSSA 2TRXA 5EY6A 1OAZA 4PGTA 3L9SA 1R4WA 5B6NA 1TRSA 1QQ2A 2ES7A 2QA1A 5COHA 2AJQB 4V1Ap 3VWVA 4EIQA 4FQUA 1PL1A 5D9VA 3KEBA 1B9YC 9GSSA 3EYTA 5J41A 5IPHA 1Y25A 4IQAA 4CY8A 4EO3A 1XOBA 1EP8A 2CAIA 4IELA 2VD0A 1XVQA 1K0DA 4K6XA 4MJEA 1O8WA 3F6FA 1GP1A 4DEJA 1GUMA 5G1KA 5ECOB 2DC5A 3CRTA 4GTUA 4KX4A 1YEXA 1Z9HA 1ILOA 1OE8A 1B48A 1B9XC 1GLPA 2E2MA 3WGEA 3Q74A 1WMJA 5ECHB 3ZRDA 2O85A 3K8NA 3CRUA 3HYPA 1TI1A 4PQHA 4WBRD 1SENA 1E6BA 2DKIA 18GSA 3ERWA 2GZYA 1U6TA 3PH9A 5JWOB 2PVOC 4NHWA 1TRWA 2R5GA 5E4WA 3VK9A 5ABRA 3C8EA 1I5GA 1HNAA 1EEJA 1JLWA 4TVEA 1QXHA 4FH8A 17GSA 1A2MA 4K1FA 3E9JB 1K3YA 2HZEB 4PURA 2GTUA 3Q19A 4N10A 3US3A 1ZGNA 4TR0A 4Q5NA 1TK0B 3UIWA 2L59A 3LJRA 3G9BA 1NHOA 3JCML 1OC3A 2L4QA 3W8JA 2YZHA 6GSXA 1USBA 1U3AA 3VI7A 2H71A 1XPVA 2YJ7A 4TOPA 2YP6A 5HR3A 4EUYA 2R37A 1FVJA 4O5QA 3HKRA 4NPBA 2G2QA 3KCMA 1YJ6A 3O6TA 1J08A 3Q18A 4TKYA 1A8LA 4AGSA 1VF4A 1WE0A 2YN1A 3NIVA 2R0CA 3F6DA 3MNGA 5D9WA 1PMTA 2FCHA 1R5PA 1F6MC 4OFTA 1PSQA 2AV4A 4ID0A 3A3TA 3QR6A 5ENUA 2DMMA 1GSDA 4HQZA 3IPZA 4F0CA 3MDKA 3QDNA 3LQ7A 4ECIA 4ECJA 5D93A 5JCGA 3M1GA 5HQPA 1RQMA 4LA1A 4XIHA 4Q5FA 1K0AA 4EKZA 5A4WA 2HZFA 4BVXB 4HOJA 2MMZA 2HRKA 2Z9SA 4X1UA 1SU9A 4KNDA 5HFGA 3ZL5A 2PERA 2AUVA 2XBQA 2DLXA 5KN1A 2GSQA 4TR3A 3C7MA 4NV2A 4MZBA 1QMVA 5J9CA 3TB2A 2GSTA 4K7IA 1FB0A 3ZREA 2H1BA 3DXBA 3M0FA 3G7IA 4NV5A 3FZ5A 1I9DA 2CZ2A 2HXKA 1DBYA 1AAZA 1NSWA 2DJ0A 4XRDA 1WRYA 1SD9A 1BJXA 2DIYA 5DDLA 2AAWA 11GSA 1ZYNA 2FWEA 1VF1A 1AC1A 3IC8A 1EV9A 2V6OA 4RI7A 3TKSC 1F9MA 2WRTA 4TR4A 1WOUA 1BYEA 2IMFA 3EPTA 1GSSA 5AIVA 3BJ5A 2LNTA 4MLYA 2PUKC 1A0FA 4KDYA 3L9UA 1TW9A 4OCFA 2PPTA 1XWCA 5JCUA 5C00A 3ZVJD 4HJ2A 1FHEA 2MMOA 1THOA 1MDJA 4V1Ag 5CRGA 4KCEA 4WF5A 3TKQA 3EU3A 4IQJM 2K8VA 3H93A 2VO4A 3OR5A 1K0OA 1BQ7A 4IKHA 2KOKA 3IRAA 3UAPA 1GSQA 5JWQB 1PGTA 2FGXA 3HZ8A 1TRUA 2N5BA 4ZB6A 3P2AA 5IMAA 5B8AA 7GSSA 3QD9A 4IW9A 3F4SA 3HVSA 1FW1A 3TKSE 3ED3A 1X5EA 2L57A 3DWVA 3D21A 1N2AA 4XHMA 5B6MA 4K5RA 2X49A 1B4PA 2KHPA 4I2UA 1XZOA 5FT3A 3ME8A 1PD21 5A4UA 4XS6A 1NW2A 5IMCA 4MF5A 4O7HA 3UVTA 2IN3A 1O7UA 3CBUA 3ZFLA 1EV4A 4TW5A 3LFLA 2WGRA 1GLQA 3VPQA 2FUG2 2RIIA 2C0GA 2I1UA 1AIUA 2JSZA 2LJRA 3QAWA 1LJRA 3J7Yb 1SJ6A 3KTLA 3D0ZA 1FOHA 2BMXA 3TOUA 3MSZA 3L0HA 2VL2C 4CDOA 1TU8A 2B1LA 4I8BA 4KH7A 2OJLA 1GTUA 3SWLA 3WT1A 2HRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YZU A;  1V58 A;  2ALB A;  5ECS A;  4JR6 A;  1GSY A;  1TOF A;  5H5Q A;  1JHB A;  2V6K A;  2C4J A;  4GQC A;  3DGQ A;  1WPI A;  2VL2 A;  5EPF A;  5H5R A;  2XPE A;  2M46 A;  3GN3 A;  3HZ4 A;  1X5D A;  2M80 A;  2MZC A;  3UL3 A;  2DJK A;  4V2L A;  5ECR B;  4RI6 A;  1BG5 A;  4ZL9 A;  5F0G A;  2LNS A;  1KEB A;  3L4N A;  2JSY A;  2YJH A;  4WBJ A;  2OA7 A;  2DJ2 A;  3DML A;  3GST A;  1TI3 A;  3FZA A;  5AIX A;  2J23 A;  1IYI A;  4DSS B;  1WWJ A;  3E3E A;  5IIZ A;  2F8F A;  4G2E A;  1TXX A;  2YWM A;  4YAV A;  5ID2 B;  3EC3 A;  5IOW A;  1GSU A;  4GWR A;  4EC0 A;  2VUP A;  1VF2 A;  1SD8 A;  2PBJ A;  2HYX A;  2DBC A;  4QQ7 A;  1BED A;  4ECC A;  3G7J A;  5ECQ B;  1EEM A;  2JZT A;  3TJB A;  2XBI A;  3C73 A;  4F82 A;  2EIR A;  2C8U A;  4DVC A;  5HFI A;  3BCI A;  4EF0 A;  2CVD A;  2JU5 A;  3A2X A;  3LWA A;  2GDR A;  4IS0 A;  2WZ9 A;  4HJM A;  1DE1 A;  2K9F A;  2VCT A;  1M7T A;  3LG6 A;  2O8V B;  4OD7 A;  3GH6 A;  3KMN A;  2X8C A;  3IXR A;  4IVF A;  5HR1 A;  5A4V A;  2DJ1 A;  3RHC A;  3LOR A;  2B5Y A;  1YKC A;  3UVH A;  2IL3 A;  1UC7 A;  3FY7 A;  2VLV A;  3RAZ A;  5ELG A;  3NZN A;  1NM3 A;  2HRN A;  5J9B A;  4PQ1 A;  3ME7 A;  3GUS A;  2R6K A;  4POL A;  1AQW A;  1AXD A;  2FA4 A;  4MH3 A;  4BWQ A;  4KW6 A;  2X64 A;  2CVK A;  1GH2 A;  3DEX A;  4GF0 A;  2LRN A;  3LXT A;  3VWX A;  2E0Q A;  3PGT A;  5ECK B;  5D8I A;  4ZIJ A;  1O85 A;  1HNC A;  4TR1 B;  3DD3 A;  4FYC A;  5ELA A;  5IO0 A;  1C72 A;  2LRC A;  4MA9 A;  4KUN A;  5DAL B;  1IYH A;  4IQ1 A;  3IV4 A;  4V2M A;  2X8G A;  3HXS A;  2DSA A;  4PUF C;  1EP7 A;  1ERV A;  2VCW A;  5AN1 A;  4EDZ A;  2VM2 A;  1OE7 A;  2VIM A;  1VF3 A;  5B8B A;  3H1N A;  5J5N A;  4MZC A;  1JZO A;  1Q4J A;  3KMO A;  4HEA 2;  4ZB9 A;  2CX3 A;  4YQU A;  1XOA A;  2DIZ A;  2LV3 A;  1YY7 A;  6GSU A;  4XTS A;  4LL4 B;  2B5E A;  4RQR A;  1SL1 B;  3A2V A;  4GRF A;  4OCE A;  2H0G A;  1TK5 B;  3KXO A;  1H4O A;  1A0R P;  3IK7 A;  2H66 A;  3UBK A;  4KAE A;  1GTB A;  4J56 E;  4RQX A;  2O7K A;  3HJO A;  3UJ1 A;  2IFQ B;  3SBC A;  2MBS A;  2N5F A;  1QGV A;  1YF0 A;  2NPB A;  1AW9 A;  1LBK A;  2FD3 A;  4GLT A;  3MWH A;  4ML6 A;  3DVW A;  1YQ1 A;  1KBN A;  4IBP A;  2H01 A;  1QUW A;  1S3D A;  1HQO A;  5G5E A;  1SKW B;  1AUC A;  4IJI A;  5LD0 A;  5DAK B;  4FYB A;  1SK1 A;  4MK3 A;  1HNB A;  3C1R A;  1XW5 A;  4OMV A;  6GSV A;  1UVZ A;  2FHE A;  5IMF A;  4FYU A;  4KE3 A;  1EZK A;  2C3N A;  1R7H A;  5EVO A;  4MJA A;  2NBS A;  2KP2 A;  3C1S A;  3ZVJ A;  2HNL A;  1VRS D;  3FRC A;  2FA8 A;  4N0Z A;  4MPG A;  1M2A A;  2O87 A;  4AF2 A;  2L5O A;  3D6I A;  4ZL8 A;  1WIK A;  2HI7 A;  1YEP A;  2MMA A;  2E7P A;  2CA8 A;  2M72 A;  1PKZ A;  1T4Z A;  2ZUP A;  4HS1 A;  3KGK A;  2P0G A;  4HU9 A;  12GS A;  6GSW A;  2NVL A;  3EVI A;  3BD2 A;  4HU7 A;  1JFU A;  2R4V A;  2I3Y A;  4LLR A;  1O6J A;  2H1G A;  5D96 A;  4MJB A;  2PU9 C;  5LCZ A;  3TOT A;  2KP1 A;  1G7E A;  3DIE A;  1G7O A;  1AQV A;  3APS A;  1PL2 A;  1YF1 A;  1V9W A;  4D73 A;  3VFI A;  5CRD A;  3KTB A;  4L5O A;  4L5L A;  1ON4 A;  1XVW A;  2E2G A;  3ZIT A;  1H75 A;  3EWL A;  2IME A;  3KP8 A;  4OWY A;  2YWN A;  3LYP A;  1ZMA A;  3QFA C;  3LXZ A;  3GKK A;  1FO5 A;  2RLI A;  4FO5 A;  3GNJ A;  5DAL A;  3VUR A;  4ACS A;  2HT9 A;  5GAP D;  3RPN A;  4WR5 A;  2H6Z A;  2LKU A;  4N30 A;  3BBY A;  5CP1 A;  4QL7 A;  2C0F A;  2GVP A;  2YV9 A;  2HSH A;  3WT2 A;  3M9J A;  3MAK A;  1X0R A;  14GS A;  1ZYE A;  2WUL A;  1OC9 A;  2XC2 A;  4BA7 A;  4WKW A;  3W6G A;  4HZ4 A;  4PXO A;  1GNW A;  2KUC A;  5GST A;  2OBK A;  2N5A A;  4KSM A;  3NOF A;  2MBT A;  4H86 A;  4ML1 A;  3U6V A;  1EOH A;  3GL5 A;  4KSO A;  2ON5 A;  5CO3 A;  3D4M A;  1THX A;  1S3C A;  4OFM A;  3QPM A;  2GGT A;  2L6D A;  2QSI A;  3GUR A;  3GSS A;  5CYY A;  2H8L A;  4NMU A;  1EWX A;  4O32 A;  3F9U A;  2EC4 A;  1M2D A;  3H4K A;  4DSS A;  2RM5 A;  2AHE A;  3D4T A;  5B7C A;  2LQO A;  1GTA A;  1VGL A;  4IJ3 A;  1PQN A;  2GS3 A;  2VL9 A;  4JU5 A;  1ZOF A;  1JLV A;  1FAA A;  2VCZ A;  4P3Y B;  5DJM A;  3ZML A;  3RDW A;  2X8H A;  3TJK A;  3P8W A;  3F4T A;  2YCD A;  3ZTL A;  5IM9 A;  1Z3E A;  4CHS A;  1T4Y A;  1J0F A;  2DML A;  2AYT A;  1A2L A;  5KN0 A;  2GZZ A;  2WDU A;  4K7N A;  5A5K A;  3HDC A;  1T8E B;  5FHI A;  3QAV A;  1TK8 B;  5EL8 A;  2QGV A;  3TRQ A;  4PUA A;  1SL0 B;  4X0X A;  2B7K A;  2VD1 A;  3UMA A;  4NHZ A;  2IMD A;  3GV1 A;  4V2N A;  5ECP B;  1M99 A;  2CVB A;  3P90 A;  4BWS A;  2WB9 A;  2L6C A;  4JR4 A;  4LMV A;  5DJL A;  4POK A;  5IOX A;  5ID2 A;  2H30 A;  4F2I A;  2LUS A;  3QCP A;  1MEK A;  4J2F A;  4XRA A;  3GH9 A;  2OKA A;  1V57 A;  2LS5 A;  2B6M A;  3CXG A;  2IIY A;  3AY8 A;  4XS4 A;  3H8Q A;  1XWB A;  2B5X A;  2OE0 A;  1KNG A;  3G7Y A;  5D9X A;  2V41 A;  3F3R A;  3KM6 A;  5DVB A;  3ZFB A;  4AJ6 A;  3FZ9 A;  2BJX A;  4EXJ A;  1X9M B;  3N9J A;  2ZNM A;  4TR1 A;  2WJU A;  3HCZ A;  4LL1 B;  2AB6 A;  1A2J A;  2CX4 A;  3GTU B;  5FWG A;  2P5Q A;  4MF6 A;  1M2B A;  1A23 A;  3I43 A;  4LMW A;  3HHV A;  4EL1 A;  3KP9 A;  2H72 A;  4K9Z A;  2LRT A;  5ECM B;  5INY A;  5L71 A;  2HRF A;  1XFL A;  4HDE A;  1M9B A;  1OYJ A;  3HY2 A;  1A8Y A;  1PA3 A;  1GUL A;  2WS2 A;  2IMK A;  2O89 A;  4YQV A;  3IA1 A;  4GQF A;  2R2J A;  4MMM A;  4TXO A;  3IK9 A;  2VLT A;  3IOS A;  2GSS A;  2IFQ A;  3H79 A;  4I2T A;  1ABA A;  2C3Q A;  1J9B A;  1F37 A;  2F9S A;  1SYR A;  4K0N A;  2FWF A;  1Z7P A;  4RUV A;  2K6V A;  1YKA A;  4YH2 A;  3GA4 A;  3FYG A;  1NHY A;  3FK8 A;  5DCG A;  3TRP A;  1R26 A;  1BAY A;  1XXU A;  1G0T A;  2LJK A;  3DYR A;  3ERF A;  4K8M A;  1G6W A;  2FWH A;  3F0I A;  1MDI A;  5IMD A;  3UEM A;  3BCK A;  2REM A;  1GSF A;  3P7X A;  4EVM A;  1QK8 A;  1EGR A;  2H0H A;  5ECI B;  5F07 A;  1ACV A;  5HFK A;  4EE0 A;  5CRH A;  5G30 A;  1B8X A;  3QFB C;  2OBI A;  4ZBA A;  1OKD A;  4ISD A;  5IPG A;  1K0M A;  5DQY A;  1O81 A;  1XWA A;  2V1M A;  1F3A A;  1A24 A;  4ILF A;  1XWK A;  1ZZY A;  4I6X A;  3ZIV A;  1U3I A;  2H1A A;  1M9A A;  3QAG A;  3DKS A;  2H6Y A;  4KA0 A;  1EOG A;  4HUA A;  5GZZ B;  2JZS A;  4GSS A;  1XW9 A;  3APO A;  1GUK A;  1MD3 A;  4GST A;  4Z7X A;  3U5R E;  3BOA A;  4GXZ A;  3I9V 2;  2F3M A;  1EGO A;  2VCQ A;  3GKN A;  4ULX A;  2OAC A;  3FR6 A;  1KTE A;  2A2S A;  3GRX A;  1CQG A;  3F8U A;  4KDU A;  2C0D A;  5D9T A;  4BPY A;  2H6X A;  5IMZ A;  3F3Q A;  2I9H A;  1YZX A;  2ON7 A;  1TRV A;  5F05 A;  5IO2 A;  2JAC A;  6GSS A;  5IMV A;  4ZL7 A;  2A2R A;  4TRX A;  3TJF A;  1T1V A;  19GS A;  3FKF A;  1PRX A;  5DBQ A;  4NXI A;  2OE3 A;  4IHU A;  2LQQ A;  2H76 A;  2B3S A;  3KIJ A;  1K3O A;  4MCU A;  1O8X A;  2JZR A;  2VOC A;  2HFD A;  3I6A A;  5IQY A;  3GL3 A;  4JBB A;  1PKW A;  1BX9 A;  2NDO A;  1SYX A;  2CAQ A;  1YDK A;  3HD5 A;  4GSN A;  3TCO A;  1U88 A;  2H0I A;  1K3L A;  5G2Z A;  1E2Y A;  4L0U A;  3RHB A;  2GT5 A;  3WGX A;  4MAB A;  3L9V A;  5JWR B;  2G0F A;  2LTK A;  3CTG A;  5CRW A;  1GL8 A;  4MH2 A;  3KJY A;  4IGJ A;  2WCI A;  4J57 E;  4XS4 B;  1OVN A;  1SK2 A;  4IN0 A;  3UAR A;  2YWO A;  1DUG A;  2VAF A;  4OO4 A;  1PX7 A;  3FW2 A;  3TRX A;  3VPT A;  4PNF A;  2CV4 A;  2H74 A;  3V1W A;  1FVK A;  1U87 A;  1M0U A;  2LST A;  5AIS A;  4QL9 A;  2L5L A;  3S9F A;  3O76 A;  1X9W B;  1DSB A;  1MDK A;  2CT6 A;  3CSJ A;  2K18 A;  1AQX A;  3J7Y k;  2J9H A;  3FEU A;  2FWG A;  4G9H A;  4BVX A;  3GKX A;  1OKT A;  3EIN A;  2PWJ A;  2H19 A;  4TXO B;  2IMI A;  2NTO A;  3TJJ A;  5KN3 A;  1O73 A;  1B4Q A;  4K7O A;  1QFN A;  3A5W A;  1GRX A;  1CQH A;  1SKR B;  1RW1 A;  3Q6O A;  4BL7 A;  4PX1 A;  4XCS A;  1FB6 A;  4BVY A;  1SJZ A;  2K8S A;  3APQ A;  3TUE A;  2PMT A;  2H75 A;  3WD6 A;  3GYK A;  5G5F A;  4E8E A;  3ZZX A;  4GCI A;  3IHQ A;  1TU7 A;  2VM1 A;  2A4V A;  2GSR A;  2X99 A;  1RK4 A;  4WET A;  3RPP A;  2IWT A;  2QC7 A;  3CYN A;  2EIQ A;  3EMX A;  2HSY A;  3M9K A;  3CMI A;  4KGI A;  3RBT A;  3GHA A;  3FHK A;  4MZW A;  5AGY A;  4K2D A;  4Q5R A;  1TJD A;  1W89 A;  2PVQ A;  3M3M A;  1ZCP A;  4L0W A;  3C71 A;  3D5J A;  2YOI A;  1Z5Y E;  6GST A;  1PX6 A;  5DAK A;  3TKS A;  5H5S A;  3IC4 A;  5LNK e;  2VL3 A;  1GUH A;  3TJG A;  5J4U A;  3GX0 A;  3CSH A;  1OC8 A;  5HR2 A;  2MYG A;  3FR3 A;  3L78 A;  2VCV A;  1MTC A;  1F2E A;  4WEY A;  4K0G A;  4ZXG A;  1GWC A;  3GKM A;  3UOM A;  5DCH A;  2KLX A;  4YQM A;  1JZD A;  1S3A A;  4FIW A;  1V40 A;  2GQL A;  4O5R A;  3HVV A;  5CRE A;  1JZW A;  5CAX A;  2D2Z A;  3EU4 A;  1TP9 A;  4HQS A;  1PN9 A;  3KH7 A;  1T3B A;  2C1Y A;  3TKR A;  2B7J A;  1TTZ A;  2L4C A;  5JCW A;  16GS A;  2ZCT A;  5F06 A;  2C0E A;  4G10 A;  3LEF A;  1TDI A;  3IE3 A;  2TRC P;  2CQ9 A;  22GS A;  1N8J A;  2JL4 A;  2P5R A;  1SK0 A;  3DVX A;  3WYW A;  4WF4 A;  1XWG A;  1V98 A;  5G1L A;  1ERW A;  3IBH A;  4EDY A;  4L8E A;  3F4R A;  2V32 A;  3R2Q A;  13GS A;  3CTF A;  1T7P B;  5DQS A;  4G19 A;  2YPM A;  3TGZ A;  1ZYQ B;  1XW6 A;  1Q98 A;  2I81 A;  4POM A;  4N0V A;  4Q5Q A;  4TN8 A;  3GIX A;  3ZMK A;  4KB3 A;  4F0B A;  2CZ3 A;  2P31 A;  3ISO A;  1UA5 A;  2IJY A;  3KH9 A;  4NAX A;  1K0B A;  1Z6N A;  5ECN B;  1K0C A;  2H73 A;  2JAD A;  1UN2 A;  4PQI A;  1Z6M A;  4ZBB A;  5C04 A;  3LYK A;  2C80 A;  3HVX A;  1ERU A;  3VWU A;  3LGC A;  1MD4 A;  4IP1 A;  5ECL B;  2GLR A;  1R5A A;  1K0N A;  1Z7R A;  4MF7 A;  3PIN A;  4PNG A;  3VWW A;  1SL2 B;  4AJ8 A;  3EUR A;  2F8A A;  3M8N A;  20GS A;  3ZIJ A;  2C3T A;  4POB A;  2PGT A;  2GZP A;  1GTI A;  5G31 A;  1WP0 A;  3CSI A;  4JED A;  1X9S B;  1ML6 A;  3KD0 A;  2HLS A;  4XS1 A;  4HI7 A;  1TKD B;  3GX8 A;  4ZB8 A;  4MP4 A;  3F63 A;  2LJA A;  1XIY A;  2YWI A;  4IP6 A;  1G6Y A;  1GNE A;  4F9Z A;  3FZ4 A;  4ZIL A;  3IAS 2;  1XBS A;  2HE3 A;  1ST9 A;  4JRR A;  6GSY A;  3KZQ A;  3EMP A;  3ZLP A;  4OFN A;  2IPA A;  4KCA A;  4E8H A;  4KDX A;  3VLN A;  2RUE A;  3DRN A;  3TDG A;  2DJ3 A;  4I5Q A;  3E0U A;  1ERT A;  2RM6 A;  2FLS A;  4X43 A;  3QMX A;  10GS A;  3A2W A;  2F51 A;  4F03 A;  2OE1 A;  4MJC A;  4N11 A;  5KN2 A;  3IDV A;  2I4A A;  4ZBD A;  2QKE A;  3FR9 A;  5F8B A;  1W4V A;  1X5C A;  4NWY A;  5D73 A;  1ZL9 A;  3I69 A;  1HYU A;  2YV7 A;  3GMF A;  4OO5 A;  4WXT A;  1WJK A;  2FNO A;  1V2A A;  2WFC A;  1URM A;  2LEG A;  2MMN A;  3HA9 A;  3UBL A;  2BTO T;  1T00 A;  3IAM 2;  4HZ2 A;  5KEJ A;  5GAN D;  2XPD A;  3ZYW A;  1FOV A;  3TKP A;  3HJP A;  2H70 A;  5J3R A;  2GQK A;  4ECB A;  4D73 B;  3QOU A;  5GSS A;  1GSE A;  2YNX A;  3N5O A;  4MDC A;  4O92 A;  3EE2 A;  5E59 A;  1DE2 A;  2FY6 A;  1FG4 A;  3W8S A;  3GFK A;  2GT6 A;  4AJ7 A;  5HR0 A;  4CW9 A;  2YAN A;  4TXV A;  2OAD A;  2HZE A;  4JZQ A;  3HJM A;  2V2G A;  2PN8 A;  2VLU A;  1XCC A;  2TIR A;  1F3B A;  1JZR A;  2VCX A;  3ERG A;  3WGD A;  2B1K A;  4DSQ A;  4I97 A;  4JE1 A;  3O3T A;  3D22 A;  4DSR A;  1SKS B;  2H1D A;  4YAP A;  1Y6E A;  2EIO A;  3VI5 A;  3GTU A;  1LU4 A;  4WR4 A;  2XHF A;  3IR4 A;  2GQM A;  1HD2 A;  1OC9 B;  3PR8 A;  5CNW A;  2DJJ A;  2RUF A;  3LSZ A;  1SJI A;  2R3X A;  4MPF A;  8GSS A;  2TRX A;  5EY6 A;  1OAZ A;  4PGT A;  3L9S A;  1R4W A;  5B6N A;  1TRS A;  1QQ2 A;  2ES7 A;  5COH A;  2AJQ B;  4V1A p;  3VWV A;  1PL1 A;  5D9V A;  3KEB A;  1B9Y C;  9GSS A;  3EYT A;  5J41 A;  5IPH A;  1Y25 A;  4IQA A;  4EO3 A;  1XOB A;  1EP8 A;  2CAI A;  4IEL A;  2VD0 A;  1XVQ A;  1K0D A;  4K6X A;  4MJE A;  1O8W A;  3F6F A;  1GP1 A;  4DEJ A;  1GUM A;  5G1K A;  5ECO B;  2DC5 A;  3CRT A;  4GTU A;  4KX4 A;  1YEX A;  1Z9H A;  1ILO A;  1OE8 A;  1B48 A;  1B9X C;  1GLP A;  2E2M A;  3WGE A;  3Q74 A;  1WMJ A;  5ECH B;  3ZRD A;  2O85 A;  3K8N A;  3CRU A;  3HYP A;  1TI1 A;  4PQH A;  4WBR D;  1SEN A;  1E6B A;  18GS A;  3ERW A;  2GZY A;  1U6T A;  3PH9 A;  5JWO B;  2PVO C;  4NHW A;  1TRW A;  2R5G A;  5E4W A;  3VK9 A;  5ABR A;  3C8E A;  1I5G A;  1HNA A;  1EEJ A;  1JLW A;  4TVE A;  1QXH A;  4FH8 A;  17GS A;  1A2M A;  4K1F A;  3E9J B;  1K3Y A;  2HZE B;  4PUR A;  2GTU A;  3Q19 A;  4N10 A;  3US3 A;  1ZGN A;  4TR0 A;  4Q5N A;  1TK0 B;  3UIW A;  2L59 A;  3LJR A;  3G9B A;  1NHO A;  3JCM L;  1OC3 A;  3W8J A;  2L4Q A;  2YZH A;  6GSX A;  1USB A;  1U3A A;  3VI7 A;  2H71 A;  1XPV A;  2YJ7 A;  4TOP A;  2YP6 A;  5HR3 A;  4EUY A;  2R37 A;  1FVJ A;  3HKR A;  4NPB A;  2G2Q A;  3KCM A;  1YJ6 A;  3O6T A;  1J08 A;  3Q18 A;  4TKY A;  1A8L A;  4AGS A;  1VF4 A;  1WE0 A;  2YN1 A;  3NIV A;  3F6D A;  3MNG A;  5D9W A;  1PMT A;  2FCH A;  1R5P A;  1F6M C;  4OFT A;  1PSQ A;  2AV4 A;  4ID0 A;  3A3T A;  3QR6 A;  5ENU A;  2DMM A;  1GSD A;  4HQZ A;  3IPZ A;  4F0C A;  3MDK A;  3QDN A;  3LQ7 A;  4ECI A;  4ECJ A;  5D93 A;  5JCG A;  3M1G A;  5HQP A;  1RQM A;  4LA1 A;  4XIH A;  4Q5F A;  1K0A A;  4EKZ A;  5A4W A;  2HZF A;  4HOJ A;  2MMZ A;  2Z9S A;  4X1U A;  1SU9 A;  4KND A;  5HFG A;  3ZL5 A;  2PER A;  2AUV A;  2XBQ A;  2DLX A;  5KN1 A;  2GSQ A;  4TR3 A;  3C7M A;  4NV2 A;  4MZB A;  1QMV A;  5J9C A;  3TB2 A;  2GST A;  4K7I A;  1FB0 A;  3ZRE A;  2H1B A;  3DXB A;  3M0F A;  3G7I A;  4NV5 A;  3FZ5 A;  1I9D A;  2CZ2 A;  2HXK A;  1DBY A;  1AAZ A;  1NSW A;  2DJ0 A;  4XRD A;  1WRY A;  1SD9 A;  1BJX A;  2DIY A;  5DDL A;  2AAW A;  11GS A;  2FWE A;  1VF1 A;  1AC1 A;  1EV9 A;  2V6O A;  4RI7 A;  3TKS C;  1F9M A;  2WRT A;  4TR4 A;  1WOU A;  1BYE A;  2IMF A;  1GSS A;  5AIV A;  3BJ5 A;  2LNT A;  4MLY A;  2PUK C;  1A0F A;  4KDY A;  3L9U A;  1TW9 A;  4OCF A;  2PPT A;  1XWC A;  5JCU A;  5C00 A;  3ZVJ D;  4HJ2 A;  1FHE A;  2MMO A;  1THO A;  1MDJ A;  4V1A g;  5CRG A;  4KCE A;  4WF5 A;  3TKQ A;  3EU3 A;  2K8V A;  3H93 A;  2VO4 A;  3OR5 A;  1K0O A;  1BQ7 A;  4IKH A;  2KOK A;  3IRA A;  3UAP A;  1GSQ A;  5JWQ B;  1PGT A;  2FGX A;  3HZ8 A;  1TRU A;  2N5B A;  4ZB6 A;  3P2A A;  5IMA A;  5B8A A;  7GSS A;  3QD9 A;  4IW9 A;  3F4S A;  3HVS A;  1FW1 A;  3TKS E;  3ED3 A;  1X5E A;  2L57 A;  3DWV A;  3D21 A;  1N2A A;  4XHM A;  5B6M A;  1B4P A;  2KHP A;  4I2U A;  1XZO A;  5FT3 A;  3ME8 A;  1PD2 1;  5A4U A;  4XS6 A;  1NW2 A;  5IMC A;  4MF5 A;  4O7H A;  3UVT A;  2IN3 A;  1O7U A;  3CBU A;  3ZFL A;  1EV4 A;  4TW5 A;  3LFL A;  2WGR A;  1GLQ A;  3VPQ A;  2FUG 2;  2RII A;  2C0G A;  2I1U A;  1AIU A;  2JSZ A;  2LJR A;  3QAW A;  1LJR A;  3J7Y b;  1SJ6 A;  3KTL A;  3D0Z A;  2BMX A;  3TOU A;  3MSZ A;  3L0H A;  2VL2 C;  4CDO A;  1TU8 A;  2B1L A;  4I8B A;  4KH7 A;  2OJL A;  1GTU A;  3SWL A;  3WT1 A; 
#chains in the Genus database with same CATH topology
 1J3U A;  2YZU A;  1V58 A;  2ALB A;  3HVN A;  5ECS A;  4Z2U A;  4JR6 A;  1GSY A;  1TOF A;  2UZ8 A;  5H5Q A;  1JHB A;  2V6K A;  3GZH A;  2R0G A;  2C4J A;  4GQC A;  5KOW A;  3DGQ A;  1WPI A;  2VL2 A;  5EPF A;  5H5R A;  2XPE A;  2M46 A;  3GN3 A;  3HZ4 A;  1X5D A;  3BHG A;  2M80 A;  2MZC A;  3UL3 A;  2DJK A;  4V2L A;  5ECR B;  4RI6 A;  1BG5 A;  4ZL9 A;  5F0G A;  2LNS A;  1KEB A;  3L4N A;  2JSY A;  2YJH A;  4WBJ A;  2OA7 A;  1M3J A;  2DJ2 A;  3DML A;  3GST A;  1TI3 A;  3FZA A;  5AIX A;  4A5P A;  2J23 A;  1IYI A;  4DSS B;  1WWJ A;  3E3E A;  5IIZ A;  2F8F A;  4G2E A;  1TXX A;  2YWM A;  4YAV A;  5ID2 B;  3EC3 A;  5IOW A;  1GSU A;  4GWR A;  4EC0 A;  1Q5N A;  2VUP A;  1VF2 A;  1SD8 A;  2PBJ A;  2HYX A;  2DBC A;  4QQ7 A;  1BED A;  4ECC A;  3G7J A;  5ECQ B;  1EEM A;  2JZT A;  3TJB A;  2XBI A;  3C73 A;  4F82 A;  2EIR A;  2C8U A;  4DVC A;  5HFI A;  3BCI A;  3R3E A;  4EF0 A;  2CVD A;  2JU5 A;  3A2X A;  3LWA A;  2GDR A;  4IS0 A;  2WZ9 A;  4HJM A;  1DE1 A;  2DKH A;  2K9F A;  2VCT A;  1M7T A;  3LG6 A;  2O8V B;  4OD7 A;  3GH6 A;  3KMN A;  2X8C A;  3IXR A;  4IVF A;  5HR1 A;  5A4V A;  2DJ1 A;  3RHC A;  3LOR A;  2B5Y A;  1YKC A;  1Z4L A;  3UVH A;  2IL3 A;  1UC7 A;  3FY7 A;  2VLV A;  3RAZ A;  5ELG A;  3NZN A;  1NM3 A;  3R6V A;  2HRN A;  5J9B A;  4PQ1 A;  3ME7 A;  3GUS A;  2R6K A;  4POL A;  1AQW A;  1AXD A;  2FA4 A;  4MH3 A;  1S3R A;  4BWQ A;  4KW6 A;  2X64 A;  2CVK A;  2FUS A;  1GH2 A;  3DEX A;  4GF0 A;  4O5U A;  4X4J A;  1Q92 A;  2LRN A;  3LXT A;  3VWX A;  2E0Q A;  3PGT A;  5ECK B;  5D8I A;  4ZIJ A;  1O85 A;  1HNC A;  4TR1 B;  3DD3 A;  4FYC A;  5ELA A;  5IO0 A;  3C8T A;  4NSL A;  1C72 A;  2LRC A;  4MA9 A;  4KUN A;  5DAL B;  1IYH A;  4IQ1 A;  3IV4 A;  4V2M A;  2X8G A;  3HXS A;  2DSA A;  4YIH A;  4PUF C;  1EP7 A;  1ERV A;  2VCW A;  5AN1 A;  4EDZ A;  2VM2 A;  1OE7 A;  2VIM A;  1VF3 A;  5B8B A;  3H1N A;  5J5N A;  4MZC A;  1JZO A;  1Q4J A;  3KMO A;  4HEA 2;  4ZB9 A;  2CX3 A;  4YQU A;  1XOA A;  2DIZ A;  2LV3 A;  1YY7 A;  6GSU A;  4XTS A;  4LL4 B;  2B5E A;  2QGA B;  4RQR A;  1SL1 B;  3A2V A;  4GRF A;  4OCE A;  2H0G A;  1TK5 B;  3KXO A;  1H4O A;  1A0R P;  3IK7 A;  2H66 A;  3UBK A;  4KAE A;  1GTB A;  4J56 E;  4RQX A;  2O7K A;  3HJO A;  3UJ1 A;  2IFQ B;  3SBC A;  2MBS A;  2N5F A;  1QGV A;  1YF0 A;  2NPB A;  1AW9 A;  1LBK A;  2FD3 A;  4GLT A;  2X4A A;  3MWH A;  4ML6 A;  3DVW A;  1YQ1 A;  1KBN A;  4IBP A;  2H01 A;  1QUW A;  1S3D A;  1HQO A;  2R0P A;  5G5E A;  1SKW B;  1AUC A;  4IJI A;  5LD0 A;  5DAK B;  2HSM A;  3E04 A;  4FYB A;  1SK1 A;  3MIX A;  4MK3 A;  1HNB A;  3C1R A;  1XW5 A;  4OMV A;  6GSV A;  1UVZ A;  2FHE A;  5IMF A;  4FYU A;  4KE3 A;  1EZK A;  2C3N A;  1R7H A;  5EVO A;  4MJA A;  2NBS A;  2KP2 A;  3C1S A;  3ZVJ A;  2HNL A;  1VRS D;  3FRC A;  3IHG A;  2FA8 A;  4N0Z A;  4MPG A;  1M2A A;  2O87 A;  4AF2 A;  2L5O A;  3D6I A;  4ZL8 A;  1WIK A;  2HI7 A;  1YEP A;  2MMA A;  2E7P A;  2CA8 A;  2M72 A;  1PKZ A;  1T4Z A;  2ZUP A;  4HS1 A;  4YKG A;  3KGK A;  2P0G A;  4K2X A;  4G0K A;  4HU9 A;  12GS A;  4Z2T A;  4BIK A;  6GSW A;  2NVL A;  3EVI A;  3BD2 A;  4HU7 A;  1JFU A;  2R4V A;  2I3Y A;  2YV5 A;  2PFM A;  4LLR A;  1O6J A;  2H1G A;  5D96 A;  4MJB A;  2PU9 C;  5LCZ A;  3TOT A;  2KP1 A;  1G7E A;  3DIE A;  1G7O A;  1AQV A;  3APS A;  1PL2 A;  1YF1 A;  1V9W A;  4D73 A;  2JAW A;  3VFI A;  5CRD A;  3KTB A;  4L5O A;  4L5L A;  1ON4 A;  1Z4P X;  1XVW A;  2E2G A;  3ZIT A;  1H75 A;  3EWL A;  2IME A;  3KP8 A;  4OWY A;  1HY0 A;  2YWN A;  3LYP A;  1ZMA A;  3QFA C;  3LXZ A;  3GKK A;  1FO5 A;  2RLI A;  1U15 A;  4FO5 A;  3GNJ A;  5DAL A;  1YFM A;  3VUR A;  4ACS A;  2HT9 A;  5GAP D;  3RPN A;  4WR5 A;  2H6Z A;  2LKU A;  4N30 A;  3BBY A;  5CP1 A;  4QL7 A;  2C0F A;  2GVP A;  2YV9 A;  2HSH A;  3WT2 A;  3M9J A;  2JAU A;  3MAK A;  1X0R A;  14GS A;  1ZYE A;  2WUL A;  4MNN A;  2D27 A;  1OC9 A;  2XC2 A;  4BA7 A;  4WKW A;  3W6G A;  4HZ4 A;  4PXO A;  1GNW A;  2KUC A;  5GST A;  1Z4Q A;  2OBK A;  2N5A A;  4KSM A;  3NOF A;  2MBT A;  4H86 A;  4ML1 A;  3U6V A;  1EOH A;  3GL5 A;  4KSO A;  2ON5 A;  5CO3 A;  3D4M A;  1THX A;  1S3C A;  4OFM A;  3QPM A;  2GGT A;  2L6D A;  2QSI A;  3GUR A;  3GSS A;  5CYY A;  2H8L A;  4NMU A;  1EWX A;  4O32 A;  3F9U A;  2EC4 A;  1M2D A;  3H4K A;  4DSS A;  2RM5 A;  2AHE A;  3D4T A;  5B7C A;  2LQO A;  1GTA A;  1VGL A;  4IJ3 A;  1PQN A;  2GS3 A;  2VL9 A;  4JU5 A;  1ZOF A;  1JLV A;  4KF9 A;  1FAA A;  2VCZ A;  4Z2R A;  4P3Y B;  5DJM A;  3ZML A;  3RDW A;  2X8H A;  3TJK A;  3P8W A;  3F4T A;  2YCD A;  3ZTL A;  5IM9 A;  1Z3E A;  4CHS A;  1T4Y A;  1J0F A;  2DML A;  2D28 C;  2AYT A;  1A2L A;  5KN0 A;  2GZZ A;  2WDU A;  4NFL A;  4K7N A;  5A5K A;  3HDC A;  1T8E B;  5FHI A;  3QAV A;  1TK8 B;  5EL8 A;  2QGV A;  3TRQ A;  4PUA A;  1SL0 B;  4X0X A;  2B7K A;  2VD1 A;  3UMA A;  4NHZ A;  4G0I A;  2IMD A;  3GV1 A;  4V2N A;  5ECP B;  1M99 A;  2CVB A;  3P90 A;  2A4H A;  4BWS A;  4APA A;  1TJV A;  2WB9 A;  2L6C A;  4JR4 A;  4LMV A;  5DJL A;  4POK A;  5IOX A;  5ID2 A;  2H30 A;  4F2I A;  2LUS A;  3QCP A;  1MEK A;  4J2F A;  4CY6 A;  4XRA A;  2E9F A;  3GH9 A;  2OKA A;  1V57 A;  2LS5 A;  2B6M A;  3CXG A;  2IIY A;  3AY8 A;  4XS4 A;  3H8Q A;  1XWB A;  2B5X A;  2OE0 A;  1KNG A;  3G7Y A;  5D9X A;  2V41 A;  3F3R A;  3KM6 A;  5DVB A;  3ZFB A;  4AJ6 A;  3FZ9 A;  2BJX A;  4EXJ A;  1YFE A;  1X9M B;  3N9J A;  2ZNM A;  4TR1 A;  2WJU A;  3HCZ A;  4LL1 B;  2AB6 A;  4YIK A;  1A2J A;  2CX4 A;  3GTU B;  5FWG A;  2P5Q A;  4MF6 A;  1M2B A;  1A23 A;  3I43 A;  4LMW A;  3HHV A;  4EL1 A;  3KP9 A;  2H72 A;  4K9Z A;  2LRT A;  5ECM B;  5INY A;  5L71 A;  2HRF A;  1XFL A;  4HDE A;  1M9B A;  1OYJ A;  3HY2 A;  3FMW A;  1A8Y A;  1PA3 A;  4USS A;  1GUL A;  2WS2 A;  3A5I A;  2IMK A;  2O89 A;  4YQV A;  3IA1 A;  4GQF A;  1Z4K A;  2R2J A;  4MMM A;  4TXO A;  3IK9 A;  2VLT A;  3IOS A;  2GSS A;  2IFQ A;  3H79 A;  4I2T A;  1ABA A;  1Q91 A;  2C3Q A;  1J9B A;  1F37 A;  2F9S A;  1SYR A;  4K0N A;  2FWF A;  1Z7P A;  4RUV A;  2K6V A;  1YKA A;  4EIP A;  4YH2 A;  3GA4 A;  3FYG A;  1NHY A;  3FK8 A;  5DCG A;  3TRP A;  1R26 A;  2RCN A;  1BAY A;  1XXU A;  1G0T A;  2LJK A;  3DYR A;  1FUR A;  3ERF A;  4K8M A;  1G6W A;  2FWH A;  3F0I A;  1MDI A;  5IMD A;  3UEM A;  3BCK A;  2REM A;  1GSF A;  3P7X A;  4EVM A;  1QK8 A;  1EGR A;  2H0H A;  4NLE A;  5ECI B;  5F07 A;  1ACV A;  5HFK A;  4EE0 A;  5CRH A;  5G30 A;  1B8X A;  3QFB C;  2OBI A;  4ZBA A;  1OKD A;  4ISD A;  5IPG A;  1XWO A;  1K0M A;  5DQY A;  1O81 A;  1XWA A;  2V1M A;  1F3A A;  1A24 A;  4ILF A;  1XWK A;  1ZZY A;  4I6X A;  1JSW A;  3ZIV A;  1U3I A;  2H1A A;  1M9A A;  3QAG A;  3DKS A;  2H6Y A;  4KA0 A;  1EOG A;  4HUA A;  2JZS A;  4GSS A;  5GZZ B;  1XW9 A;  3APO A;  1GUK A;  1MD3 A;  4GST A;  1Z4I A;  4Z7X A;  3U5R E;  3BOA A;  4GXZ A;  3I9V 2;  2F3M A;  1EGO A;  2VCQ A;  3GKN A;  4ULX A;  2OAC A;  3FR6 A;  1KTE A;  1FUQ A;  2A2S A;  3GRX A;  1CQG A;  3F8U A;  4KDU A;  2C0D A;  5D9T A;  4BPY A;  2H6X A;  5IMZ A;  4MWO A;  3F3Q A;  2I9H A;  1YZX A;  3QBP A;  2ON7 A;  1TRV A;  5F05 A;  5IO2 A;  2JAC A;  6GSS A;  5IMV A;  4ZL7 A;  2A2R A;  4TRX A;  1C3C A;  3TJF A;  1T1V A;  19GS A;  3FKF A;  1PRX A;  5DBQ A;  4NXI A;  2OE3 A;  4IHU A;  2LQQ A;  2H76 A;  2B3S A;  3KIJ A;  1K3O A;  4MCU A;  1O8X A;  2JZR A;  2VOC A;  2HFD A;  3I6A A;  5IQY A;  3GL3 A;  4JBB A;  1PKW A;  1FUO A;  2X75 A;  1BX9 A;  2NDO A;  1SYX A;  2CAQ A;  1YDK A;  3HD5 A;  4GSN A;  3TCO A;  1U88 A;  2H0I A;  1K3L A;  5G2Z A;  1E2Y A;  4L0U A;  3RHB A;  2GT5 A;  3WGX A;  3PPU A;  4YKF A;  4ADL A;  4MAB A;  3L9V A;  5JWR B;  3OCE A;  2G0F A;  3NO9 A;  2LTK A;  3CTG A;  5CRW A;  1K62 A;  1GL8 A;  4MH2 A;  3KJY A;  4IGJ A;  2WCI A;  4J57 E;  4XS4 B;  1OVN A;  1SK2 A;  4IN0 A;  1XG8 A;  3UAR A;  3RD8 A;  2YWO A;  1DUG A;  2VAF A;  4OO4 A;  1PX7 A;  3FW2 A;  3TRX A;  3VPT A;  4PNF A;  2CV4 A;  2H74 A;  3V1W A;  1FVK A;  1U87 A;  1M0U A;  2LST A;  5AIS A;  4QL9 A;  2L5L A;  3S9F A;  3O76 A;  1X9W B;  1DSB A;  1MDK A;  2CT6 A;  3CSJ A;  2K18 A;  1AQX A;  2JAR A;  3J7Y k;  2J9H A;  3FEU A;  3OCF A;  2FWG A;  4G9H A;  4BVX A;  3GKX A;  1KQ7 A;  1OKT A;  3EIN A;  2PWJ A;  2H19 A;  4TXO B;  2IMI A;  2NTO A;  3TJJ A;  5KN3 A;  2QA2 A;  3GTD A;  1O73 A;  1B4Q A;  4K7O A;  1QFN A;  3A5W A;  1GRX A;  1CQH A;  1SKR B;  1RW1 A;  3Q6O A;  4BL7 A;  4PX1 A;  4XCS A;  1FB6 A;  4BVY A;  4BL7 B;  1SJZ A;  2K8S A;  3APQ A;  3TUE A;  2PMT A;  2H75 A;  5D6B A;  3GYK A;  3WD6 A;  5G5F A;  5HW2 A;  4E8E A;  3ZZX A;  4GCI A;  3IHQ A;  1TU7 A;  2VM1 A;  2A4V A;  4G0L A;  2GSR A;  2X99 A;  1RK4 A;  4WET A;  3RPP A;  2IWT A;  2QC7 A;  3CYN A;  2EIQ A;  3EMX A;  1DCN A;  2HSY A;  3M9K A;  3CMI A;  4KGI A;  3RBT A;  3GHA A;  3FHK A;  4MZW A;  5AGY A;  4K2D A;  4EEI A;  4Q5R A;  1TJD A;  1W89 A;  2PVQ A;  3M3M A;  1ZCP A;  4L0W A;  3C71 A;  5BMU A;  3D5J A;  2YOI A;  1Z5Y E;  6GST A;  1PX6 A;  1M3I A;  5DAK A;  1RE5 A;  3TKS A;  5H5S A;  3IC4 A;  5LNK e;  2VL3 A;  1GUH A;  3TJG A;  5J4U A;  3GX0 A;  3CSH A;  1OC8 A;  5HR2 A;  2MYG A;  3FR3 A;  3L78 A;  4K5S A;  2VCV A;  1MTC A;  1F2E A;  4WEY A;  4K0G A;  4ZXG A;  1GWC A;  1ZYP A;  3GKM A;  3UOM A;  5DCH A;  3CI0 K;  2KLX A;  4YQM A;  1JZD A;  1S3A A;  4FIW A;  1V40 A;  2GQL A;  4O5R A;  3HVV A;  4L6A A;  5CRE A;  1JZW A;  5CAX A;  2D2Z A;  3EU4 A;  1TP9 A;  4HQS A;  1PN9 A;  3KH7 A;  1T3B A;  2C1Y A;  3TKR A;  2B7J A;  1TTZ A;  2L4C A;  5JCW A;  16GS A;  2ZCT A;  3LW9 A;  5F06 A;  2C0E A;  4G10 A;  3LEF A;  1TDI A;  3IE3 A;  2TRC P;  2CQ9 A;  22GS A;  1N8J A;  2JL4 A;  2P5R A;  1SK0 A;  3DVX A;  3WYW A;  4WF4 A;  1XWG A;  1V98 A;  5G1L A;  3MYD A;  1MH9 A;  1ERW A;  3IBH A;  4EDY A;  4L8E A;  3F4R A;  2V32 A;  3R2Q A;  13GS A;  1C3U A;  3CTF A;  1T7P B;  5DQS A;  4G19 A;  2YPM A;  3TGZ A;  1ZYQ B;  1XW6 A;  4E88 A;  1Q98 A;  2I81 A;  4POM A;  4N0V A;  4Q5Q A;  4TN8 A;  3GIX A;  3ZMK A;  4KB3 A;  5KOX A;  4F0B A;  2CZ3 A;  2P31 A;  3ISO A;  1UA5 A;  4PTS A;  2IJY A;  3KH9 A;  4NAX A;  1K0B A;  1Z6N A;  5ECN B;  1K0C A;  2H73 A;  2JAD A;  1UN2 A;  4PQI A;  1Z6M A;  4ZBB A;  3RRP A;  5C04 A;  2PTS A;  3LYK A;  2C80 A;  3HVX A;  1ERU A;  3VWU A;  3LGC A;  1MD4 A;  4IP1 A;  5ECL B;  2GLR A;  1R5A A;  1K0N A;  1Z7R A;  4MF7 A;  3PIN A;  4PNG A;  3VWW A;  1SL2 B;  4AJ8 A;  3EUR A;  2F8A A;  3M8N A;  20GS A;  3ZIJ A;  2C3T A;  4POB A;  2PGT A;  2GZP A;  1GTI A;  5G31 A;  1WP0 A;  3CSI A;  4JED A;  1X9S B;  1ML6 A;  3KD0 A;  2HLS A;  4XS1 A;  4MUM A;  4HI7 A;  1TKD B;  3GX8 A;  4ZB8 A;  4MP4 A;  3F63 A;  2LJA A;  4BVY B;  3U19 A;  1XIY A;  2YWI A;  4IP6 A;  5F92 A;  1G6Y A;  1GNE A;  4F9Z A;  3FZ4 A;  4ZIL A;  3IAS 2;  1XBS A;  2HE3 A;  1ST9 A;  4JRR A;  6GSY A;  3KZQ A;  3EMP A;  3ZLP A;  2I7D A;  4OFN A;  2IPA A;  4KCA A;  4E8H A;  4KDX A;  3TV2 A;  3VLN A;  2RUE A;  3DRN A;  3TDG A;  2DJ3 A;  2A2P A;  4ICY A;  4I5Q A;  3E0U A;  1ERT A;  2RM6 A;  2FLS A;  4X43 A;  3QMX A;  10GS A;  3A2W A;  2F51 A;  4F03 A;  2OE1 A;  4MJC A;  4N11 A;  5KN2 A;  3IDV A;  2I4A A;  2PTQ A;  4ZBD A;  2QKE A;  3FR9 A;  5F8B A;  1W4V A;  1X5C A;  4NWY A;  5D73 A;  1ZL9 A;  3I69 A;  1HYU A;  2YV7 A;  3GMF A;  4OO5 A;  4WXT A;  1PN0 A;  1WJK A;  2FNO A;  1V2A A;  2WFC A;  1URM A;  2LEG A;  2MMN A;  3HA9 A;  3UBL A;  2BTO T;  1T00 A;  3IAM 2;  4HZ2 A;  5KEJ A;  5GAN D;  1I0A A;  2XPD A;  3ZYW A;  1FOV A;  1Z4J A;  3TKP A;  3HJP A;  2H70 A;  5J3R A;  2GQK A;  4ECB A;  4D73 B;  3QOU A;  5GSS A;  1GSE A;  2YNX A;  3N5O A;  4MDC A;  4O92 A;  3EE2 A;  4L57 A;  5E59 A;  1DE2 A;  2FY6 A;  1FG4 A;  3W8S A;  1IW7 D;  3GFK A;  2GT6 A;  4AJ7 A;  5HR0 A;  4CW9 A;  2YAN A;  4TXV A;  2OAD A;  2HZE A;  4JZQ A;  3HJM A;  2PTR A;  2PN8 A;  2V2G A;  2VLU A;  1XCC A;  2TIR A;  1F3B A;  5BRT A;  1JZR A;  2VCX A;  3ERG A;  3WGD A;  2B1K A;  4DSQ A;  4I97 A;  4JE1 A;  3O3T A;  3D22 A;  4DSR A;  1SKS B;  2H1D A;  4YAP A;  1Y6E A;  2EIO A;  4MX2 A;  3VI5 A;  3GTU A;  1LU4 A;  4WR4 A;  2XHF A;  3IR4 A;  2GQM A;  1HD2 A;  1OC9 B;  3PR8 A;  5CNW A;  2DJJ A;  2RUF A;  3LSZ A;  1SJI A;  2R3X A;  4MPF A;  8GSS A;  2TRX A;  5EY6 A;  1OAZ A;  4PGT A;  3L9S A;  1R4W A;  5B6N A;  1TRS A;  1QQ2 A;  2ES7 A;  2QA1 A;  5COH A;  2AJQ B;  4V1A p;  3VWV A;  4EIQ A;  4FQU A;  1PL1 A;  5D9V A;  3KEB A;  1B9Y C;  9GSS A;  3EYT A;  5J41 A;  5IPH A;  1Y25 A;  4IQA A;  4CY8 A;  4EO3 A;  1XOB A;  1EP8 A;  2CAI A;  4IEL A;  2VD0 A;  1XVQ A;  1K0D A;  4K6X A;  4MJE A;  1O8W A;  3F6F A;  1GP1 A;  4DEJ A;  1GUM A;  5G1K A;  5ECO B;  2DC5 A;  3CRT A;  4GTU A;  4KX4 A;  1YEX A;  1Z9H A;  1ILO A;  1OE8 A;  1B48 A;  1B9X C;  1GLP A;  2E2M A;  3WGE A;  3Q74 A;  1WMJ A;  5ECH B;  3ZRD A;  2O85 A;  3K8N A;  3CRU A;  1U16 A;  3HYP A;  1TI1 A;  4PQH A;  4WBR D;  1SEN A;  1E6B A;  5F91 A;  2DKI A;  2HVG A;  18GS A;  3ERW A;  2GZY A;  1U6T A;  3PH9 A;  5JWO B;  2PVO C;  4NHW A;  1TRW A;  2R5G A;  5E4W A;  3VK9 A;  5ABR A;  3C8E A;  1I5G A;  2JAO A;  1HNA A;  1EEJ A;  1JLW A;  4TVE A;  1QXH A;  4HSC X;  4FH8 A;  17GS A;  1A2M A;  4K1F A;  1TJW A;  3E9J B;  1K3Y A;  2HZE B;  4PUR A;  2GTU A;  3Q19 A;  4N10 A;  3US3 A;  1ZGN A;  4TR0 A;  4Q5N A;  1TK0 B;  3UIW A;  2L59 A;  1Z4M A;  4EFC A;  3LJR A;  3G9B A;  1NHO A;  3JCM L;  1OC3 A;  2L4Q A;  3W8J A;  2YZH A;  6GSX A;  4APB A;  1USB A;  1U3A A;  3VI7 A;  2H71 A;  1XPV A;  2YJ7 A;  4TOP A;  2YP6 A;  5HR3 A;  4EUY A;  2R37 A;  1FVJ A;  4O5Q A;  3HKR A;  4NPB A;  2G2Q A;  3KCM A;  1YJ6 A;  3O6T A;  1J08 A;  3Q18 A;  4TKY A;  1A8L A;  4AGS A;  1VF4 A;  1WE0 A;  2YN1 A;  3NIV A;  2R0C A;  3F6D A;  3MNG A;  5D9W A;  1PMT A;  2FCH A;  1R5P A;  1F6M C;  4OFT A;  1PSQ A;  2AV4 A;  4ID0 A;  3A3T A;  3QR6 A;  1PFO A;  1T9H A;  5ENU A;  2DMM A;  1GSD A;  1DOF A;  4HQZ A;  3IPZ A;  4F0C A;  3MDK A;  3QDN A;  3LQ7 A;  4ECI A;  4ECJ A;  5D93 A;  1FUP A;  5JCG A;  3M1G A;  5HQP A;  1RQM A;  4LA1 A;  4XIH A;  4Q5F A;  1K0A A;  4EKZ A;  5A4W A;  2HZF A;  3R6Q A;  4BVX B;  4HOJ A;  2MMZ A;  2HRK A;  2Z9S A;  4X1U A;  1SU9 A;  4KND A;  5HFG A;  3ZL5 A;  2PER A;  2AUV A;  2XBQ A;  2DLX A;  5KN1 A;  2GSQ A;  4TR3 A;  1HY1 A;  3C7M A;  4NV2 A;  4MZB A;  1QMV A;  5J9C A;  2GST A;  4K7I A;  1FB0 A;  3TB2 A;  3ZRE A;  2H1B A;  3DXB A;  3M0F A;  3G7I A;  4NV5 A;  3FZ5 A;  1I9D A;  2CZ2 A;  2HXK A;  1DBY A;  1AAZ A;  1NSW A;  2DJ0 A;  4XRD A;  1WRY A;  1SD9 A;  1BJX A;  2DIY A;  5DDL A;  2AAW A;  11GS A;  1ZYN A;  2FWE A;  1VF1 A;  1AC1 A;  3IC8 A;  1EV9 A;  2V6O A;  4RI7 A;  3TKS C;  1F9M A;  2WRT A;  4TR4 A;  1WOU A;  1BYE A;  2IMF A;  3EPT A;  1GSS A;  5AIV A;  3BJ5 A;  2LNT A;  4MLY A;  2PUK C;  1A0F A;  4KDY A;  3L9U A;  1TW9 A;  4OCF A;  2PPT A;  1XWC A;  5JCU A;  5C00 A;  3ZVJ D;  4HJ2 A;  1FHE A;  2MMO A;  1THO A;  1MDJ A;  4V1A g;  5CRG A;  4KCE A;  4WF5 A;  3TKQ A;  3EU3 A;  4IQJ M;  2K8V A;  4HGV A;  3H93 A;  2VO4 A;  3OR5 A;  1K0O A;  1BQ7 A;  4IKH A;  2KOK A;  3IRA A;  3UAP A;  1GSQ A;  5JWQ B;  1PGT A;  2FGX A;  3HZ8 A;  1TRU A;  2N5B A;  4ZB6 A;  3P2A A;  5IMA A;  5B8A A;  7GSS A;  3QD9 A;  4IW9 A;  3F4S A;  3HVS A;  1FW1 A;  1TJU A;  3TKS E;  3ED3 A;  1X5E A;  2L57 A;  3DWV A;  3D21 A;  1N2A A;  4XHM A;  5B6M A;  1AUW A;  4K5R A;  2X49 A;  1K7W A;  1B4P A;  2KHP A;  3CQF A;  4I2U A;  1XZO A;  5FT3 A;  3ME8 A;  1PD2 1;  5A4U A;  4XS6 A;  1NW2 A;  5IMC A;  1VDK A;  4MF5 A;  4O7H A;  3UVT A;  4L6C A;  2IN3 A;  1O7U A;  3U13 A;  4ADM A;  3CBU A;  3ZFL A;  1EV4 A;  4TW5 A;  3LFL A;  2WGR A;  1GLQ A;  3VPQ A;  2FUG 2;  2RII A;  2C0G A;  2I1U A;  1AIU A;  2JSZ A;  2LJR A;  3BWV A;  3QAW A;  1LJR A;  3J7Y b;  1SJ6 A;  3KTL A;  3D0Z A;  1FOH A;  2BMX A;  3TOU A;  3MSZ A;  3L0H A;  2VL2 C;  4CDO A;  1TJ7 A;  1TU8 A;  1U0L A;  2B1L A;  4I8B A;  4KH7 A;  2OJL A;  1GTU A;  3SWL A;  3WT1 A;  2HRA A; 
#chains in the Genus database with same CATH homology
 2YZU A;  1V58 A;  2ALB A;  5ECS A;  4Z2U A;  4JR6 A;  1GSY A;  1TOF A;  2UZ8 A;  5H5Q A;  1JHB A;  2V6K A;  2R0G A;  2C4J A;  4GQC A;  5KOW A;  3DGQ A;  1WPI A;  2VL2 A;  5EPF A;  5H5R A;  2XPE A;  2M46 A;  3GN3 A;  3HZ4 A;  1X5D A;  2M80 A;  2MZC A;  3UL3 A;  2DJK A;  4V2L A;  5ECR B;  4RI6 A;  1BG5 A;  4ZL9 A;  5F0G A;  2LNS A;  1KEB A;  3L4N A;  2JSY A;  2YJH A;  4WBJ A;  2OA7 A;  2DJ2 A;  3DML A;  3GST A;  1TI3 A;  3FZA A;  5AIX A;  4A5P A;  2J23 A;  1IYI A;  4DSS B;  1WWJ A;  3E3E A;  5IIZ A;  2F8F A;  4G2E A;  1TXX A;  2YWM A;  4YAV A;  5ID2 B;  3EC3 A;  5IOW A;  1GSU A;  4GWR A;  4EC0 A;  2VUP A;  1VF2 A;  1SD8 A;  2PBJ A;  2HYX A;  2DBC A;  4QQ7 A;  1BED A;  4ECC A;  3G7J A;  5ECQ B;  1EEM A;  2JZT A;  3TJB A;  2XBI A;  3C73 A;  4F82 A;  2EIR A;  2C8U A;  4DVC A;  5HFI A;  3BCI A;  3R3E A;  4EF0 A;  2CVD A;  2JU5 A;  3A2X A;  3LWA A;  2GDR A;  4IS0 A;  2WZ9 A;  4HJM A;  1DE1 A;  2DKH A;  2K9F A;  2VCT A;  1M7T A;  3LG6 A;  2O8V B;  4OD7 A;  3GH6 A;  3KMN A;  2X8C A;  3IXR A;  4IVF A;  5HR1 A;  5A4V A;  2DJ1 A;  3RHC A;  3LOR A;  2B5Y A;  1YKC A;  3UVH A;  2IL3 A;  1UC7 A;  3FY7 A;  2VLV A;  3RAZ A;  5ELG A;  3NZN A;  1NM3 A;  2HRN A;  5J9B A;  4PQ1 A;  3ME7 A;  3GUS A;  2R6K A;  4POL A;  1AQW A;  1AXD A;  2FA4 A;  4MH3 A;  4BWQ A;  4KW6 A;  2X64 A;  2CVK A;  1GH2 A;  3DEX A;  4GF0 A;  4O5U A;  4X4J A;  2LRN A;  3LXT A;  3VWX A;  2E0Q A;  3PGT A;  5ECK B;  5D8I A;  4ZIJ A;  1O85 A;  1HNC A;  4TR1 B;  3DD3 A;  4FYC A;  5ELA A;  5IO0 A;  1C72 A;  2LRC A;  4MA9 A;  4KUN A;  5DAL B;  1IYH A;  4IQ1 A;  3IV4 A;  4V2M A;  2X8G A;  3HXS A;  2DSA A;  4PUF C;  1EP7 A;  1ERV A;  2VCW A;  5AN1 A;  4EDZ A;  2VM2 A;  1OE7 A;  2VIM A;  1VF3 A;  5B8B A;  3H1N A;  5J5N A;  4MZC A;  1JZO A;  1Q4J A;  3KMO A;  4HEA 2;  4ZB9 A;  2CX3 A;  4YQU A;  1XOA A;  2DIZ A;  2LV3 A;  1YY7 A;  6GSU A;  4XTS A;  4LL4 B;  2B5E A;  4RQR A;  1SL1 B;  3A2V A;  4GRF A;  4OCE A;  2H0G A;  1TK5 B;  3KXO A;  1H4O A;  1A0R P;  3IK7 A;  2H66 A;  3UBK A;  4KAE A;  1GTB A;  4J56 E;  4RQX A;  2O7K A;  3HJO A;  3UJ1 A;  2IFQ B;  3SBC A;  2MBS A;  2N5F A;  1QGV A;  1YF0 A;  2NPB A;  1AW9 A;  1LBK A;  2FD3 A;  4GLT A;  2X4A A;  3MWH A;  4ML6 A;  3DVW A;  1YQ1 A;  1KBN A;  4IBP A;  2H01 A;  1QUW A;  1S3D A;  1HQO A;  2R0P A;  5G5E A;  1SKW B;  1AUC A;  4IJI A;  5LD0 A;  5DAK B;  2HSM A;  4FYB A;  1SK1 A;  3MIX A;  4MK3 A;  1HNB A;  3C1R A;  1XW5 A;  4OMV A;  6GSV A;  1UVZ A;  2FHE A;  5IMF A;  4FYU A;  4KE3 A;  1EZK A;  2C3N A;  1R7H A;  5EVO A;  4MJA A;  2NBS A;  2KP2 A;  3C1S A;  3ZVJ A;  2HNL A;  1VRS D;  3FRC A;  3IHG A;  2FA8 A;  4N0Z A;  4MPG A;  1M2A A;  2O87 A;  4AF2 A;  2L5O A;  3D6I A;  4ZL8 A;  1WIK A;  2HI7 A;  1YEP A;  2MMA A;  2E7P A;  2CA8 A;  2M72 A;  1PKZ A;  1T4Z A;  2ZUP A;  4HS1 A;  4YKG A;  3KGK A;  2P0G A;  4K2X A;  4G0K A;  4HU9 A;  12GS A;  4Z2T A;  6GSW A;  2NVL A;  3EVI A;  3BD2 A;  4HU7 A;  1JFU A;  2R4V A;  2I3Y A;  4LLR A;  1O6J A;  2H1G A;  5D96 A;  4MJB A;  2PU9 C;  5LCZ A;  3TOT A;  2KP1 A;  1G7E A;  3DIE A;  1G7O A;  1AQV A;  3APS A;  1PL2 A;  1YF1 A;  1V9W A;  4D73 A;  3VFI A;  5CRD A;  3KTB A;  4L5O A;  4L5L A;  1ON4 A;  1XVW A;  2E2G A;  3ZIT A;  1H75 A;  3EWL A;  2IME A;  3KP8 A;  4OWY A;  2YWN A;  3LYP A;  1ZMA A;  3QFA C;  3LXZ A;  3GKK A;  1FO5 A;  2RLI A;  4FO5 A;  3GNJ A;  5DAL A;  3VUR A;  4ACS A;  2HT9 A;  5GAP D;  3RPN A;  4WR5 A;  2H6Z A;  2LKU A;  4N30 A;  3BBY A;  5CP1 A;  4QL7 A;  2C0F A;  2GVP A;  2YV9 A;  2HSH A;  3WT2 A;  3M9J A;  3MAK A;  1X0R A;  14GS A;  1ZYE A;  2WUL A;  4MNN A;  2D27 A;  1OC9 A;  2XC2 A;  4BA7 A;  4WKW A;  3W6G A;  4HZ4 A;  4PXO A;  1GNW A;  2KUC A;  5GST A;  2OBK A;  2N5A A;  4KSM A;  3NOF A;  2MBT A;  4H86 A;  4ML1 A;  3U6V A;  1EOH A;  3GL5 A;  4KSO A;  2ON5 A;  5CO3 A;  3D4M A;  1THX A;  1S3C A;  4OFM A;  3QPM A;  2GGT A;  2L6D A;  2QSI A;  3GUR A;  3GSS A;  5CYY A;  2H8L A;  4NMU A;  1EWX A;  4O32 A;  3F9U A;  2EC4 A;  1M2D A;  3H4K A;  4DSS A;  2RM5 A;  2AHE A;  3D4T A;  5B7C A;  2LQO A;  1GTA A;  1VGL A;  4IJ3 A;  1PQN A;  2GS3 A;  2VL9 A;  4JU5 A;  1ZOF A;  1JLV A;  4KF9 A;  1FAA A;  2VCZ A;  4Z2R A;  4P3Y B;  5DJM A;  3ZML A;  3RDW A;  2X8H A;  3TJK A;  3P8W A;  3F4T A;  2YCD A;  3ZTL A;  5IM9 A;  1Z3E A;  4CHS A;  1T4Y A;  1J0F A;  2DML A;  2D28 C;  2AYT A;  1A2L A;  5KN0 A;  2GZZ A;  2WDU A;  4K7N A;  5A5K A;  3HDC A;  1T8E B;  5FHI A;  3QAV A;  1TK8 B;  5EL8 A;  2QGV A;  3TRQ A;  4PUA A;  1SL0 B;  4X0X A;  2B7K A;  2VD1 A;  3UMA A;  4NHZ A;  4G0I A;  2IMD A;  3GV1 A;  4V2N A;  5ECP B;  1M99 A;  2CVB A;  3P90 A;  2A4H A;  4BWS A;  2WB9 A;  2L6C A;  4JR4 A;  4LMV A;  5DJL A;  4POK A;  5IOX A;  5ID2 A;  2H30 A;  4F2I A;  2LUS A;  3QCP A;  1MEK A;  4J2F A;  4CY6 A;  4XRA A;  3GH9 A;  2OKA A;  1V57 A;  2LS5 A;  2B6M A;  3CXG A;  2IIY A;  3AY8 A;  4XS4 A;  3H8Q A;  1XWB A;  2B5X A;  2OE0 A;  1KNG A;  3G7Y A;  5D9X A;  2V41 A;  3F3R A;  3KM6 A;  5DVB A;  3ZFB A;  4AJ6 A;  3FZ9 A;  2BJX A;  4EXJ A;  1X9M B;  3N9J A;  2ZNM A;  4TR1 A;  2WJU A;  3HCZ A;  4LL1 B;  2AB6 A;  1A2J A;  2CX4 A;  3GTU B;  5FWG A;  2P5Q A;  4MF6 A;  1M2B A;  1A23 A;  3I43 A;  4LMW A;  3HHV A;  4EL1 A;  3KP9 A;  2H72 A;  4K9Z A;  2LRT A;  5ECM B;  5INY A;  5L71 A;  2HRF A;  1XFL A;  4HDE A;  1M9B A;  1OYJ A;  3HY2 A;  3FMW A;  1A8Y A;  1PA3 A;  4USS A;  1GUL A;  2WS2 A;  3A5I A;  2IMK A;  2O89 A;  4YQV A;  3IA1 A;  4GQF A;  2R2J A;  4MMM A;  4TXO A;  3IK9 A;  2VLT A;  3IOS A;  2GSS A;  2IFQ A;  3H79 A;  4I2T A;  1ABA A;  2C3Q A;  1J9B A;  1F37 A;  2F9S A;  1SYR A;  4K0N A;  2FWF A;  1Z7P A;  4RUV A;  2K6V A;  1YKA A;  4EIP A;  4YH2 A;  3GA4 A;  3FYG A;  1NHY A;  3FK8 A;  5DCG A;  3TRP A;  1R26 A;  1BAY A;  1XXU A;  1G0T A;  2LJK A;  3DYR A;  3ERF A;  4K8M A;  1G6W A;  2FWH A;  3F0I A;  1MDI A;  5IMD A;  3UEM A;  3BCK A;  2REM A;  1GSF A;  3P7X A;  4EVM A;  1QK8 A;  1EGR A;  2H0H A;  5ECI B;  5F07 A;  1ACV A;  5HFK A;  4EE0 A;  5CRH A;  5G30 A;  1B8X A;  3QFB C;  2OBI A;  4ZBA A;  1OKD A;  4ISD A;  5IPG A;  1K0M A;  5DQY A;  1O81 A;  1XWA A;  2V1M A;  1F3A A;  1A24 A;  4ILF A;  1XWK A;  1ZZY A;  4I6X A;  3ZIV A;  1U3I A;  2H1A A;  1M9A A;  3QAG A;  3DKS A;  2H6Y A;  4KA0 A;  1EOG A;  4HUA A;  5GZZ B;  2JZS A;  4GSS A;  1XW9 A;  3APO A;  1GUK A;  1MD3 A;  4GST A;  4Z7X A;  3U5R E;  3BOA A;  4GXZ A;  3I9V 2;  2F3M A;  1EGO A;  2VCQ A;  3GKN A;  4ULX A;  2OAC A;  3FR6 A;  1KTE A;  2A2S A;  3GRX A;  1CQG A;  3F8U A;  4KDU A;  2C0D A;  5D9T A;  4BPY A;  2H6X A;  5IMZ A;  3F3Q A;  2I9H A;  1YZX A;  2ON7 A;  1TRV A;  5F05 A;  5IO2 A;  2JAC A;  6GSS A;  5IMV A;  4ZL7 A;  2A2R A;  4TRX A;  3TJF A;  1T1V A;  19GS A;  3FKF A;  1PRX A;  5DBQ A;  4NXI A;  2OE3 A;  4IHU A;  2LQQ A;  2H76 A;  2B3S A;  3KIJ A;  1K3O A;  4MCU A;  1O8X A;  2JZR A;  2VOC A;  2HFD A;  3I6A A;  5IQY A;  3GL3 A;  4JBB A;  1PKW A;  1BX9 A;  2NDO A;  1SYX A;  2CAQ A;  1YDK A;  3HD5 A;  4GSN A;  3TCO A;  1U88 A;  2H0I A;  1K3L A;  5G2Z A;  1E2Y A;  4L0U A;  3RHB A;  2GT5 A;  3WGX A;  3PPU A;  4YKF A;  4MAB A;  3L9V A;  5JWR B;  2G0F A;  2LTK A;  3CTG A;  5CRW A;  1GL8 A;  4MH2 A;  3KJY A;  4IGJ A;  2WCI A;  4J57 E;  4XS4 B;  1OVN A;  1SK2 A;  4IN0 A;  3UAR A;  2YWO A;  1DUG A;  2VAF A;  4OO4 A;  1PX7 A;  3FW2 A;  3TRX A;  3VPT A;  4PNF A;  2CV4 A;  2H74 A;  3V1W A;  1FVK A;  1U87 A;  1M0U A;  2LST A;  5AIS A;  4QL9 A;  2L5L A;  3S9F A;  3O76 A;  1X9W B;  1DSB A;  1MDK A;  2CT6 A;  3CSJ A;  2K18 A;  1AQX A;  3J7Y k;  2J9H A;  3FEU A;  2FWG A;  4G9H A;  4BVX A;  3GKX A;  1OKT A;  3EIN A;  2PWJ A;  2H19 A;  4TXO B;  2IMI A;  2NTO A;  3TJJ A;  5KN3 A;  2QA2 A;  1O73 A;  1B4Q A;  4K7O A;  1QFN A;  3A5W A;  1GRX A;  1CQH A;  1SKR B;  1RW1 A;  3Q6O A;  4BL7 A;  4PX1 A;  4XCS A;  1FB6 A;  4BVY A;  4BL7 B;  1SJZ A;  2K8S A;  3APQ A;  3TUE A;  2PMT A;  2H75 A;  3WD6 A;  3GYK A;  5G5F A;  4E8E A;  3ZZX A;  4GCI A;  3IHQ A;  1TU7 A;  2VM1 A;  2A4V A;  4G0L A;  2GSR A;  2X99 A;  1RK4 A;  4WET A;  3RPP A;  2IWT A;  2QC7 A;  3CYN A;  2EIQ A;  3EMX A;  2HSY A;  3M9K A;  3CMI A;  4KGI A;  3RBT A;  3GHA A;  3FHK A;  4MZW A;  5AGY A;  4K2D A;  4Q5R A;  1TJD A;  1W89 A;  2PVQ A;  3M3M A;  1ZCP A;  4L0W A;  3C71 A;  5BMU A;  3D5J A;  2YOI A;  1Z5Y E;  6GST A;  1PX6 A;  5DAK A;  3TKS A;  5H5S A;  3IC4 A;  5LNK e;  2VL3 A;  1GUH A;  3TJG A;  5J4U A;  3GX0 A;  3CSH A;  1OC8 A;  5HR2 A;  2MYG A;  3FR3 A;  3L78 A;  4K5S A;  2VCV A;  1MTC A;  1F2E A;  4WEY A;  4K0G A;  4ZXG A;  1GWC A;  1ZYP A;  3GKM A;  3UOM A;  5DCH A;  2KLX A;  4YQM A;  1JZD A;  1S3A A;  4FIW A;  1V40 A;  2GQL A;  4O5R A;  3HVV A;  5CRE A;  1JZW A;  5CAX A;  2D2Z A;  3EU4 A;  1TP9 A;  4HQS A;  1PN9 A;  3KH7 A;  1T3B A;  2C1Y A;  3TKR A;  2B7J A;  1TTZ A;  2L4C A;  5JCW A;  16GS A;  2ZCT A;  3LW9 A;  5F06 A;  2C0E A;  4G10 A;  3LEF A;  1TDI A;  3IE3 A;  2TRC P;  2CQ9 A;  22GS A;  1N8J A;  2JL4 A;  2P5R A;  1SK0 A;  3DVX A;  3WYW A;  4WF4 A;  1XWG A;  1V98 A;  5G1L A;  3MYD A;  1ERW A;  3IBH A;  4EDY A;  4L8E A;  3F4R A;  2V32 A;  3R2Q A;  13GS A;  3CTF A;  1T7P B;  5DQS A;  4G19 A;  2YPM A;  3TGZ A;  1ZYQ B;  1XW6 A;  1Q98 A;  2I81 A;  4POM A;  4N0V A;  4Q5Q A;  4TN8 A;  3GIX A;  3ZMK A;  4KB3 A;  5KOX A;  4F0B A;  2CZ3 A;  2P31 A;  3ISO A;  1UA5 A;  4PTS A;  2IJY A;  3KH9 A;  4NAX A;  1K0B A;  1Z6N A;  5ECN B;  1K0C A;  2H73 A;  2JAD A;  1UN2 A;  4PQI A;  1Z6M A;  4ZBB A;  5C04 A;  3LYK A;  2C80 A;  3HVX A;  1ERU A;  3VWU A;  3LGC A;  1MD4 A;  4IP1 A;  5ECL B;  2GLR A;  1R5A A;  1K0N A;  1Z7R A;  4MF7 A;  3PIN A;  4PNG A;  3VWW A;  1SL2 B;  4AJ8 A;  3EUR A;  2F8A A;  3M8N A;  20GS A;  3ZIJ A;  2C3T A;  4POB A;  2PGT A;  2GZP A;  1GTI A;  5G31 A;  1WP0 A;  3CSI A;  4JED A;  1X9S B;  1ML6 A;  3KD0 A;  2HLS A;  4XS1 A;  4HI7 A;  1TKD B;  3GX8 A;  4ZB8 A;  4MP4 A;  3F63 A;  2LJA A;  4BVY B;  1XIY A;  2YWI A;  4IP6 A;  1G6Y A;  1GNE A;  4F9Z A;  3FZ4 A;  4ZIL A;  3IAS 2;  1XBS A;  2HE3 A;  1ST9 A;  4JRR A;  6GSY A;  3KZQ A;  3EMP A;  3ZLP A;  4OFN A;  2IPA A;  4KCA A;  4E8H A;  4KDX A;  3VLN A;  2RUE A;  3DRN A;  3TDG A;  2DJ3 A;  2A2P A;  4ICY A;  4I5Q A;  3E0U A;  1ERT A;  2RM6 A;  2FLS A;  4X43 A;  3QMX A;  10GS A;  3A2W A;  2F51 A;  4F03 A;  2OE1 A;  4MJC A;  4N11 A;  5KN2 A;  3IDV A;  2I4A A;  4ZBD A;  2QKE A;  3FR9 A;  5F8B A;  1W4V A;  1X5C A;  4NWY A;  5D73 A;  1ZL9 A;  3I69 A;  1HYU A;  2YV7 A;  3GMF A;  4OO5 A;  4WXT A;  1PN0 A;  1WJK A;  2FNO A;  1V2A A;  2WFC A;  1URM A;  2LEG A;  2MMN A;  3HA9 A;  3UBL A;  2BTO T;  1T00 A;  3IAM 2;  4HZ2 A;  5KEJ A;  5GAN D;  2XPD A;  3ZYW A;  1FOV A;  3TKP A;  3HJP A;  2H70 A;  5J3R A;  2GQK A;  4ECB A;  4D73 B;  3QOU A;  5GSS A;  1GSE A;  2YNX A;  3N5O A;  4MDC A;  4O92 A;  3EE2 A;  5E59 A;  1DE2 A;  2FY6 A;  1FG4 A;  3W8S A;  1IW7 D;  3GFK A;  2GT6 A;  4AJ7 A;  5HR0 A;  4CW9 A;  2YAN A;  4TXV A;  2OAD A;  2HZE A;  4JZQ A;  3HJM A;  2V2G A;  2PN8 A;  2VLU A;  1XCC A;  2TIR A;  1F3B A;  5BRT A;  1JZR A;  2VCX A;  3ERG A;  3WGD A;  2B1K A;  4DSQ A;  4I97 A;  4JE1 A;  3O3T A;  3D22 A;  4DSR A;  1SKS B;  2H1D A;  4YAP A;  1Y6E A;  2EIO A;  3VI5 A;  3GTU A;  1LU4 A;  4WR4 A;  2XHF A;  3IR4 A;  2GQM A;  1HD2 A;  1OC9 B;  3PR8 A;  5CNW A;  2DJJ A;  2RUF A;  3LSZ A;  1SJI A;  2R3X A;  4MPF A;  8GSS A;  2TRX A;  5EY6 A;  1OAZ A;  4PGT A;  3L9S A;  1R4W A;  5B6N A;  1TRS A;  1QQ2 A;  2ES7 A;  2QA1 A;  5COH A;  2AJQ B;  4V1A p;  3VWV A;  4EIQ A;  4FQU A;  1PL1 A;  5D9V A;  3KEB A;  1B9Y C;  9GSS A;  3EYT A;  5J41 A;  5IPH A;  1Y25 A;  4IQA A;  4CY8 A;  4EO3 A;  1XOB A;  1EP8 A;  2CAI A;  4IEL A;  2VD0 A;  1XVQ A;  1K0D A;  4K6X A;  4MJE A;  1O8W A;  3F6F A;  1GP1 A;  4DEJ A;  1GUM A;  5G1K A;  5ECO B;  2DC5 A;  3CRT A;  4GTU A;  4KX4 A;  1YEX A;  1Z9H A;  1ILO A;  1OE8 A;  1B48 A;  1B9X C;  1GLP A;  2E2M A;  3WGE A;  3Q74 A;  1WMJ A;  5ECH B;  3ZRD A;  2O85 A;  3K8N A;  3CRU A;  3HYP A;  1TI1 A;  4PQH A;  4WBR D;  1SEN A;  1E6B A;  2DKI A;  18GS A;  3ERW A;  2GZY A;  1U6T A;  3PH9 A;  5JWO B;  2PVO C;  4NHW A;  1TRW A;  2R5G A;  5E4W A;  3VK9 A;  5ABR A;  3C8E A;  1I5G A;  1HNA A;  1EEJ A;  1JLW A;  4TVE A;  1QXH A;  4FH8 A;  17GS A;  1A2M A;  4K1F A;  3E9J B;  1K3Y A;  2HZE B;  4PUR A;  2GTU A;  3Q19 A;  4N10 A;  3US3 A;  1ZGN A;  4TR0 A;  4Q5N A;  1TK0 B;  3UIW A;  2L59 A;  3LJR A;  3G9B A;  1NHO A;  3JCM L;  1OC3 A;  2L4Q A;  3W8J A;  2YZH A;  6GSX A;  1USB A;  1U3A A;  3VI7 A;  2H71 A;  1XPV A;  2YJ7 A;  4TOP A;  2YP6 A;  5HR3 A;  4EUY A;  2R37 A;  1FVJ A;  4O5Q A;  3HKR A;  4NPB A;  2G2Q A;  3KCM A;  1YJ6 A;  3O6T A;  1J08 A;  3Q18 A;  4TKY A;  1A8L A;  4AGS A;  1VF4 A;  1WE0 A;  2YN1 A;  3NIV A;  2R0C A;  3F6D A;  3MNG A;  5D9W A;  1PMT A;  2FCH A;  1R5P A;  1F6M C;  4OFT A;  1PSQ A;  2AV4 A;  4ID0 A;  3A3T A;  3QR6 A;  5ENU A;  2DMM A;  1GSD A;  4HQZ A;  3IPZ A;  4F0C A;  3MDK A;  3QDN A;  3LQ7 A;  4ECI A;  4ECJ A;  5D93 A;  5JCG A;  3M1G A;  5HQP A;  1RQM A;  4LA1 A;  4XIH A;  4Q5F A;  1K0A A;  4EKZ A;  5A4W A;  2HZF A;  4BVX B;  4HOJ A;  2MMZ A;  2HRK A;  2Z9S A;  4X1U A;  1SU9 A;  4KND A;  5HFG A;  3ZL5 A;  2PER A;  2AUV A;  2XBQ A;  2DLX A;  5KN1 A;  2GSQ A;  4TR3 A;  3C7M A;  4NV2 A;  4MZB A;  1QMV A;  5J9C A;  3TB2 A;  2GST A;  4K7I A;  1FB0 A;  3ZRE A;  2H1B A;  3DXB A;  3M0F A;  3G7I A;  4NV5 A;  3FZ5 A;  1I9D A;  2CZ2 A;  2HXK A;  1DBY A;  1AAZ A;  1NSW A;  2DJ0 A;  4XRD A;  1WRY A;  1SD9 A;  1BJX A;  2DIY A;  5DDL A;  2AAW A;  11GS A;  1ZYN A;  2FWE A;  1VF1 A;  1AC1 A;  3IC8 A;  1EV9 A;  2V6O A;  4RI7 A;  3TKS C;  1F9M A;  2WRT A;  4TR4 A;  1WOU A;  1BYE A;  2IMF A;  3EPT A;  1GSS A;  5AIV A;  3BJ5 A;  2LNT A;  4MLY A;  2PUK C;  1A0F A;  4KDY A;  3L9U A;  1TW9 A;  4OCF A;  2PPT A;  1XWC A;  5JCU A;  5C00 A;  3ZVJ D;  4HJ2 A;  1FHE A;  2MMO A;  1THO A;  1MDJ A;  4V1A g;  5CRG A;  4KCE A;  4WF5 A;  3TKQ A;  3EU3 A;  4IQJ M;  2K8V A;  3H93 A;  2VO4 A;  3OR5 A;  1K0O A;  1BQ7 A;  4IKH A;  2KOK A;  3IRA A;  3UAP A;  1GSQ A;  5JWQ B;  1PGT A;  2FGX A;  3HZ8 A;  1TRU A;  2N5B A;  4ZB6 A;  3P2A A;  5IMA A;  5B8A A;  7GSS A;  3QD9 A;  4IW9 A;  3F4S A;  3HVS A;  1FW1 A;  3TKS E;  3ED3 A;  1X5E A;  2L57 A;  3DWV A;  3D21 A;  1N2A A;  4XHM A;  5B6M A;  4K5R A;  2X49 A;  1B4P A;  2KHP A;  4I2U A;  1XZO A;  5FT3 A;  3ME8 A;  1PD2 1;  5A4U A;  4XS6 A;  1NW2 A;  5IMC A;  4MF5 A;  4O7H A;  3UVT A;  2IN3 A;  1O7U A;  3CBU A;  3ZFL A;  1EV4 A;  4TW5 A;  3LFL A;  2WGR A;  1GLQ A;  3VPQ A;  2FUG 2;  2RII A;  2C0G A;  2I1U A;  1AIU A;  2JSZ A;  2LJR A;  3QAW A;  1LJR A;  3J7Y b;  1SJ6 A;  3KTL A;  3D0Z A;  1FOH A;  2BMX A;  3TOU A;  3MSZ A;  3L0H A;  2VL2 C;  4CDO A;  1TU8 A;  2B1L A;  4I8B A;  4KH7 A;  2OJL A;  1GTU A;  3SWL A;  3WT1 A;  2HRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...