3F4SA

Crystal structure of wolbachia pipientis alpha-dsba1 t172v
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
199
structure length
199
Chain Sequence
TSNELLLPLPNDKLLGDPKAPILMIEYASLTCYHCSLFHRNVFPKIKEKYIDTGKMLYIFRHFPLDYRGLKAAMLSHCYEKQEDYFNFNKAVFNSIDSWNYYNLSDLTLLQRIAALSNLKQDAFNQCINDKKIMDKIVNDKSLAINKLGITAVPIFFIKLNDDKSYIEHNKVKHGGYKELKYFTNVIDKLYGKAIVKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of the Oxidoreductase alpha-DsbA1 from Wolbachia pipientis
pubmed doi rcsb
source organism Wolbachia pipientis
molecule tags Oxidoreductase
molecule keywords Putative uncharacterized protein
total genus 74
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2008-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.80 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Ribonucleotide Reductase Protein R1; domain 1 3f4sA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3f4sA01
1PQNA 3J7Yb 5IOXA 1PX6A 5D9WA 1GSEA 3L78A 2HFDA 5IPHA 5FHIA 1JZOA 4HQSA 2TIRA 4KA0A 3GNJA 2HRNA 5D73A 4MF5A 2IFQA 3CSJA 1UVZA 1XWKA 3O6TA 3GMFA 3TJBA 4MJBA 4KGIA 4ZL7A 1SJZA 4HEA2 1BJXA 2VLUA 3D6IA 4GSSA 4ILFA 2B6MA 3VPTA 5AIVA 3IBHA 4MH2A 4OO4A 3VI7A 1JHBA 4FIWA 3HJOA 5GAPD 2LJKA 3KZQA 5AGYA 1A8YA 2GZPA 2MMOA 5CP1A 2F3MA 3QAVA 3FZ5A 4D73A 2VL2A 1AIUA 3GSSA 4IGJA 4XS1A 3KJYA 2H0GA 2K18A 1Z9HA 1YEPA 1TRUA 5JCUA 3VLNA 13GSA 2K8SA 1XWAA 5B8BA 2WB9A 3BD2A 5ECSA 3GUSA 3QOUA 2PGTA 2HSYA 4GRFA 5C00A 1PMTA 1SENA 4HJMA 3ME8A 1EP7A 2LJAA 3EURA 5A4WA 5IMVA 4MZBA 3VK9A 1KTEA 1TJDA 1KBNA 2GQMA 1PX7A 1TXXA 4MCUA 1BX9A 1PKWA 2LS5A 2H75A 2IPAA 4EDZA 5IMFA 1SJ6A 1BYEA 2FY6A 2H76A 2YPMA 3ERFA 1XWBA 2LRNA 2JACA 2CVKA 2B7KA 1E6BA 1GSSA 2ZUPA 2C3TA 3TRQA 1Y25A 3PH9A 1I5GA 4KUNA 5J4UA 2FA8A 4O32A 1X5DA 3ME7A 4TXOB 3H4KA 3C1SA 4PX1A 1GLQA 1EOHA 5IM9A 2K9FA 1G6WA 1Q4JA 2N5FA 3TOUA 10GSA 2OE0A 4BVXA 2LJRA 2IMKA 2KP2A 3RHCA 2L5OA 3RHBA 4MZWA 1WJKA 5A5KA 4JU5A 4RI7A 1K0NA 1WRYA 2QGVA 4PUFC 3TGZA 1AXDA 2L6DA 1WP0A 3KH9A 1URMA 2YP6A 3RBTA 3HJMA 1VF3A 2CAQA 2N5AA 2LNTA 1B4QA 1FB6A 2IMEA 2EC4A 5GSSA 3HVXA 2CX4A 3A5WA 3W6GA 1YZXA 3CTFA 2L59A 5IO2A 4G2EA 1A2MA 1FVJA 3FZ9A 5ECKB 2J23A 3UMAA 1OE8A 1F37A 3I43A 5H5RA 2YWMA 3KMNA 4AGSA 1GTIA 1MEKA 5GZZB 1HNBA 2PVOC 1C72A 2H71A 2HLSA 2V1MA 3VFIA 4MMMA 4TR1A 1MTCA 3F63A 2O7KA 4NPBA 3U6VA 1SD9A 2CVDA 2C0EA 3FHKA 4EC0A 5AIXA 3FR6A 1O8XA 2GLRA 4IP6A 1DSBA 2P31A 4MPGA 4CW9A 5ECRB 1JFUA 1DBYA 4XS6A 2AV4A 2X64A 2MZCA 5CYYA 3IA1A 4MDCA 2EIQA 2HSHA 5ABRA 4MJAA 5B6NA 2F8AA 1OAZA 4D73B 3TKRA 1G6YA 4J56E 1AAZA 4K9ZA 5G5EA 2CV4A 2KHPA 4X43A 3K8NA 3GSTA 4ULXA 1PKZA 1GSUA 3NOFA 17GSA 3IE3A 1EGRA 4ACSA 3WGEA 5DALB 1B9XC 2YOIA 2WJUA 2C80A 4CHSA 3QFAC 4V2LA 4P3YB 4MPFA 1J08A 3WGXA 2FHEA 2V6KA 1YJ6A 4K7OA 1ACVA 3FZ4A 3JCML 5COHA 4PNGA 5IMZA 5D9VA 3DXBA 4PQIA 1VF2A 4MA9A 4H86A 2B3SA 3VWVA 3GYKA 3ZZXA 1SKRB 5LCZA 3HXSA 1OC3A 3QAGA 4OFMA 4X0XA 4GSNA 4ZIJA 2LV3A 2KUCA 1EV4A 4XCSA 1M2BA 2VO4A 1O85A 2WGRA 2NPBA 2PU9C 3EU3A 2BMXA 1VGLA 2XHFA 5J41A 3GL5A 3DVWA 3TB2A 3ZIJA 2ES7A 3IAM2 4I2TA 1V9WA 1ZYQB 5G2ZA 4O7HA 2CZ2A 2DLXA 2GT5A 2WRTA 2ZNMA 1BEDA 2GDRA 2JU5A 5JWQB 3LFLA 2DJ0A 3MNGA 1SKSB 3GRXA 5FT3A 2M72A 2YWIA 3CYNA 3EU4A 1TOFA 20GSA 2AB6A 1F2EA 4NXIA 5CRDA 4G19A 4NWYA 4YH2A 2LUSA 1HQOA 4ID0A 1G7EA 5EVOA 4WR5A 1A0FA 1O6JA 5G30A 2FWEA 2VCWA 3F9UA 2LSTA 4FYUA 3RDWA 1M2AA 4KX4A 1K0DA 1N8JA 1Z7PA 3DYRA 4K8MA 1NHOA 1F9MA 3KM6A 3EC3A 2ON5A 2QKEA 1WMJA 2E2GA 1ZYEA 1XW6A 1EWXA 3EMXA 3Q18A 2VD0A 5ECNB 2H66A 5ID2B 3F3QA 2WS2A 4OO5A 1Z6NA 6GSYA 3HY2A 5IO0A 1M0UA 1ZOFA 1M9BA 2DMMA 3OR5A 5LD0A 3NIVA 1GULA 1QK8A 4Q5FA 3TKPA 1FW1A 18GSA 4O92A 4AJ8A 1GSQA 1SK2A 3GA4A 4TR0A 4BVYA 1X5EA 5DAKA 4JBBA 3HZ8A 2VCXA 2H1AA 3FYGA 4F2IA 3EE2A 5E4WA 1NM3A 2LEGA 1SK1A 4MP4A 2H19A 1FOVA 4HZ2A 1T4ZA 3QAWA 3PR8A 1T1VA 1K0BA 1U6TA 3VWWA 3TJFA 2VL2C 3TRXA 3IR4A 1SYXA 1X0RA 1S3AA 5CRWA 3DVXA 5HQPA 3GKMA 3UVHA 2C3NA 3RAZA 3GH6A 3KP8A 3F8UA 1TP9A 5ELGA 4QL9A 1PL2A 2IL3A 5DQSA 4IJ3A 3LWAA 2XBIA 4Z7XA 3MDKA 1GSDA 1K3LA 3DMLA 1F3AA 3WT2A 1TW9A 3LYPA 2HYXA 2H0IA 2DBCA 1NW2A 2OBKA 3L4NA 4V1Ag 4ZL9A 3GKNA 2R5GA 4TRXA 5ECLB 2YCDA 4HS1A 3KIJA 2VL3A 16GSA 1K3YA 3FR3A 4YQVA 2H73A 2HI7A 2AHEA 4K2DA 1TRWA 3ZL5A 1UA5A 4WETA 4K7NA 4KDXA 3ZIVA 4XS4B 1A24A 1Y6EA 3DWVA 5IIZA 3APQA 1J9BA 1VF4A 2JZSA 2DJ1A 2HZFA 2WULA 3BCKA 3VWXA 4WXTA 1GLPA 4ZB9A 5JWRB 3GTUB 3UOMA 5DDLA 1HNAA 3BBYA 1MDIA 5IMCA 1BG5A 4POBA 5D9XA 3TDGA 2HT9A 2LRTA 2REMA 3KMOA 1ERWA 5HR3A 2FWHA 2NDOA 1ZL9A 3EYTA 4OMVA 2FLSA 2F8FA 2OKAA 3D4MA 1K0AA 4MLYA 3GHAA 5E59A 1YY7A 1GTUA 2V2GA 1AC1A 4L5LA 2O85A 4LMWA 2IFQB 4OCEA 1AQWA 3HVSA 4OCFA 2FD3A 2GSQA 1GTBA 2VCQA 4XRAA 2VCTA 1LJRA 3QD9A 1FAAA 3MSZA 5HFGA 2TRCP 5DBQA 2C0FA 2H01A 4GCIA 3EMPA 1YF1A 4RQXA 4EKZA 2E7PA 3D0ZA 3GURA 5AN1A 5H5SA 1HNCA 2QC7A 1SL0B 3QR6A 2AJQB 1RK4A 4Q5NA 4HDEA 3FRCA 2P0GA 1ON4A 4X1UA 4KDYA 3HJPA 1FHEA 5KN0A 1U3AA 4HZ4A 2YZUA 4ECIA 1NHYA 4HU7A 3HKRA 3WT1A 4K7IA 4IN0A 3TKSA 3C8EA 4DVCA 4J57E 2C8UA 4ML1A 4EF0A 3LQ7A 1TK8B 4XTSA 5JCWA 4NHWA 2VUPA 2I4AA 4BL7A 3Q19A 3ZVJA 3FY7A 3TCOA 3VWUA 1FG4A 3IOSA 2MBTA 5J3RA 1XIYA 2EIOA 2MBSA 2FGXA 1LBKA 2LQOA 5ECIB 4AJ6A 1DE1A 5A4VA 1JLVA 4CDOA 3IAS2 5ECMB 2F9SA 6GSTA 1V2AA 4NV2A 4MH3A 2L5LA 5CRHA 2C3QA 1EGOA 1R4WA 2VOCA 3GN3A 1K0CA 1HD2A 2TRXA 3LXTA 5G1KA 1H4OA 2C1YA 5ECQB 1Z6MA 5HR1A 5D96A 3IK7A 2DJKA 4KW6A 3H8QA 1GUMA 11GSA 5D9TA 4POKA 1OYJA 5CREA 2NVLA 2BTOT 3L9UA 4KE3A 1EP8A 1ZZYA 4ZB6A 5F06A 3E9JB 3WD6A 3UIWA 4GTUA 3DEXA 3KGKA 5DCHA 2J9HA 2MMZA 1WOUA 3TKQA 1O81A 1TTZA 19GSA 2IJYA 2LNSA 3KEBA 5F05A 1TI1A 2MMNA 3M1GA 1XW5A 2YJHA 4GQFA 3KD0A 1USBA 4WR4A 5AISA 3GFKA 2GQKA 2PVQA 1DE2A 2MYGA 5DALA 4ZBAA 4WF4A 4OWYA 4WBRD 1A8LA 2FCHA 1THXA 1J0FA 5DCGA 14GSA 4WKWA 2H1BA 1WE0A 4NHZA 3C7MA 5G1LA 2B1KA 2FWGA 2C4JA 1SD8A 2GZYA 3CSIA 3TKSE 2M80A 2DIYA 4KSOA 1S3DA 3VPQA 5HR0A 2H74A 3P8WA 3TUEA 1ZCPA 3FR9A 4O5RA 4YAVA 1K0OA 5J9CA 2FA4A 2O89A 3E3EA 2H30A 2H1GA 3R2QA 4I6XA 4JR4A 4EO3A 4HUAA 3ZLPA 3ZFLA 1RQMA 5EY6A 2I1UA 1PGTA 3WYWA 5L71A 3J7Yk 3VI5A 4TR1B 3DIEA 4L0WA 4YAPA 3ZFBA 3F3RA 3GX8A 8GSSA 3F6FA 2G2QA 2HNLA 4GSTA 2CT6A 4TVEA 1HYUA 2YN1A 4OFNA 1AQVA 2YZHA 1T00A 4AJ7A 2HZEA 1F3BA 3D22A 3TJGA 4LL4B 4DSSA 1Q98A 1X9MB 4DEJA 1TRVA 2CZ3A 4ZILA 3QCPA 3FW2A 4ECCA 1EEJA 4NV5A 1OKTA 2DSAA 3CRUA 1M9AA 2B5XA 1TK0B 4LA1A 1OC8A 4ZXGA 4WF5A 2D2ZA 2HZEB 5GAND 3ERGA 3PINA 3W8SA 4I8BA 2VM2A 3UEMA 3D21A 2K6VA 3ZREA 5F8BA 4HOJA 1AW9A 5B7CA 1WIKA 1OC9B 4GWRA 5JWOB 4K0NA 1XW9A 1U88A 4IELA 1PRXA 1ERVA 5IOWA 2LTKA 4QQ7A 4FH8A 4LMVA 3C1RA 1EOGA 4LLRA 2AAWA 1RW1A 4XS4A 1YEXA 4L0UA 1LU4A 1QUWA 1XZOA 1O73A 2E0QA 4OFTA 2WFCA 4HJ2A 3APSA 2ZCTA 2RUFA 3QDNA 2I3YA 4YQUA 2VM1A 3LXZA 3UL3A 3GL3A 1FVKA 5HR2A 3P7XA 3DGQA 1EV9A 3VURA 1SK0A 4YQMA 2VCZA 1G0TA 4TKYA 2RM5A 1T4YA 5A4UA 5C04A 1UN2A 4N30A 3A3TA 2V32A 2JSZA 4JRRA 3G9BA 1B4PA 4BWSA 4G9HA 3QMXA 4EUYA 2KLXA 6GSWA 2H70A 4ECBA 3EWLA 4TN8A 3I6AA 1GNEA 1PA3A 1TK5B 2L6CA 2I9HA 4JR6A 3ZTLA 1SYRA 2R3XA 2YJ7A 1XVWA 1G7OA 3APOA 3L9SA 3IXRA 3L0HA 5J9BA 2N5BA 1M2DA 4E8EA 2O87A 4JEDA 2V41A 5KN2A 4HI7A 4OD7A 3FEUA 3GV1A 4N0ZA 4KSMA 5GSTA 1PD21 3UVTA 3U5RE 2K8VA 1MD4A 4Q5RA 1B9YC 3UBLA 4WEYA 2L4CA 22GSA 3FKFA 3N9JA 2FWFA 5HFIA 5J5NA 1VRSD 5KN3A 2GTUA 3FZAA 2KP1A 1GRXA 1F6MC 1GTAA 4DSQA 2YANA 3UAPA 2E2MA 3KH7A 2CVBA 1KNGA 3ZITA 4HU9A 2VD1A 2OACA 1O7UA 1M99A 5ID2A 1K0MA 3RPPA 3M9KA 1GH2A 4PNFA 4N10A 5G5FA 5EPFA 4L5OA 4TW5A 2B1LA 1SL2B 1ERTA 2NBSA 2YV9A 4MZCA 2PWJA 4I5QA 1A0RP 3O76A 5DJMA 2CX3A 1W4VA 3ISOA 3I69A 2IMFA 1N2AA 4KNDA 3G7JA 6GSVA 1NSWA 1R5PA 4FO5A 1V40A 2A4VA 2PUKC 2OADA 4RQRA 1A2JA 4PQ1A 3W8JA 1CQHA 1YKAA 3Q74A 1S3CA 3NZNA 2L57A 4N11A 1PN9A 4V1Ap 1T8EB 2B5YA 2GZZA 4ZB8A 2CQ9A 2X8CA 2V6OA 5IMAA 4Q5QA 4GQCA 4IJIA 5EL8A 3A2WA 3LJRA 3TOTA 1GP1A 2X8HA 1H75A 2DJ3A 2H6YA 4IQAA 4KCEA 1XVQA 4DSRA 1XPVA 1Z3EA 1IYIA 4XHMA 5JCGA 3GH9A 2IMIA 4IVFA 3DRNA 3KCMA 3MAKA 3M9JA 5D8IA 1YQ1A 1B48A 3HYPA 5ENUA 2MMAA 2H6XA 3M3MA 1ABAA 2NTOA 4I2UA 1GWCA 3S9FA 1XWCA 4PGTA 3PGTA 5FWGA 4KB3A 3G7YA 4POMA 4MK3A 5CAXA 1MDJA 5G31A 1X9WB 3HHVA 2GS3A 3SWLA 2GQLA 1THOA 3IV4A 2IN3A 4K0GA 3HCZA 4GXZA 1BQ7A 2H72A 1GSYA 4PUAA 1V57A 4BA7A 3MWHA 4BPYA 2C0DA 1QGVA 3EINA 1X9SB 1PL1A 2RM6A 3LG6A 3CSHA 4RI6A 2RLIA 5IMDA 5KN1A 4PQHA 3BOAA 2PMTA 2R2JA 3IK9A 4J2FA 1CQGA 4F82A 2JZTA 4F03A 3AY8A 2H8LA 1IYHA 2BJXA 2I81A 2LKUA 2OJLA 5ECHB 1M7TA 4IBPA 3WGDA 2JADA 2XBQA 3ZYWA 3H79A 3HA9A 1U87A 3N5OA 3L9VA 1XBSA 4KDUA 1B8XA 2YWNA 2PPTA 4TR3A 1ILOA 2AUVA 3G7IA 4N0VA 3I9V2 4ZL8A 5D93A 5ECPB 2X99A 1V58A 3LSZA 3QPMA 1AQXA 1OE7A 1TI3A 3GX0A 4LL1B 2RUEA 4ECJA 3H1NA 1TDIA 1SKWB 2WCIA 1YDKA 1O8WA 2VIMA 4L8EA 4JE1A 2B7JA 3HDCA 1R26A 2YV7A 3H93A 2M46A 2OE1A 3A2VA 4EL1A 6GSSA 4KAEA 5B8AA 3US3A 1TKDB 1AUCA 3IC4A 4FYCA 1JZRA 9GSSA 3HVVA 4XRDA 1Z5YE 4IHUA 1TRSA 1YF0A 1Z7RA 3KXOA 5DVBA 2HRFA 3D5JA 3LORA 1XFLA 2GSRA 4IKHA 1I9DA 1WPIA 5CNWA 3BCIA 5LNKe 1X5CA 4POLA 2FNOA 3EVIA 4MF6A 3KP9A 1SL1B 2VCVA 5KEJA 2PERA 1BAYA 2GSTA 3LGCA 1XWGA 3GTUA 3LEFA 1XOAA 2JL4A 3UARA 4ZBBA 1ST9A 2A2SA 5DAKB 2IWTA 2O8VB 2WDUA 2R4VA 1V98A 4TXOA 4G10A 1DUGA 1E2YA 2P5QA 2PBJA 2IMDA 3F4SA 4F0CA 4ISDA 5CRGA 5DQYA 4EE0A 1KEBA 1JZWA 3RPNA 2OE3A 1MD3A 3C71A 1OKDA 4EDYA 3HZ4A 2OBIA 4I97A 4PURA 3ZMKA 2AYTA 1OVNA 4BWQA 2R37A 2R6KA 1MDKA 3CTGA 1PSQA 1GUHA 2OA7A 2P5RA 1A2LA 4IQ1A 2JSYA 3IRAA 4MJCA 5HFKA 4HQZA 2CA8A 5DJLA 5F0GA 4PXOA 2LQQA 1A23A 3UJ1A 2HXKA 3E0UA 4NAXA 1TU7A 2LRCA 5H5QA 2FUG2 1YKCA 4AF2A 6GSXA 2PN8A 1FB0A 1VF1A 3M8NA 5F07A 3TJJA 1OC9A 2JZRA 1JLWA 3CMIA 3HD5A 2CAIA 2GGTA 3KTBA 3QFBC 3P2AA 2WZ9A 3Q6OA 4WBJA 1ML6A 1GL8A 4ML6A 3IHQA 4MF7A 4GLTA 2DC5A 4IP1A 1FO5A 3M0FA 3SBCA 3UBKA 2DJJA 1ERUA 3KTLA 3D4TA 3C73A 2XPDA 2B5EA 2HE3A 2H6ZA 2C0GA 3F0IA 3CXGA 1JZDA 4DSSB 1ZMAA 1K3OA 3F6DA 12GSA 1GUKA 1T3BA 2EIRA 2H0HA 5IQYA 3DKSA 2VLTA 3V1WA 1GSFA 2GT6A 5IPGA 4FYBA 1ZGNA 3DD3A 1UC7A 5ELAA 1SJIA 2G0FA 3BJ5A 4TR4A 5ECOB 1WWJA 3CRTA 3GKKA 3CBUA 3GIXA 4JZQA 5B6MA 2IIYA 2DIZA 4NMUA 4IW9A 4MJEA 1TU8A 2GVPA 2GSSA 3ZRDA 1XXUA 3IDVA 7GSSA 2YWOA 1T7PB 3F4RA 6GSUA 4MABA 1EEMA 4V2MA 3FK8A 3ERWA 5CO3A 4EVMA 2KOKA 3ZMLA 2A2RA 2VL9A 3TKSC 4KH7A 4TOPA 2QSIA 2YNXA 2RIIA 2F51A 4K6XA 4K1FA 1R5AA 3O3TA 2H1DA 4EXJA 3A2XA 4IS0A 2DMLA 4TXVA 3TRPA 2XC2A 3ED3A 1U3IA 4ZBDA 1XCCA 4V2NA 3ZVJD 1QMVA 2VLVA 4KCAA 2VAFA 1QFNA 2ALBA 3TJKA 4F0BA 1EZKA 3F4TA 3GKXA 1QXHA 4GF0A 1GNWA 2X8GA 1QQ2A 5INYA 4RUVA 1XOBA 2Z9SA 4XIHA 2ON7A 1R7HA 1W89A 1SU9A 4E8HA 3LYKA 4QL7A 2L4QA 4F9ZA 2DJ2A 2XPEA 3P90A 3IPZA
chains in the Genus database with same CATH superfamily
1PQNA 1I0AA 3CQFA 3J7Yb 1J3UA 5IOXA 1Q5NA 1U0LA 1PX6A 5D9WA 1GSEA 2I7DA 3L78A 2HFDA 5IPHA 5FHIA 1JZOA 4HQSA 2TIRA 4KA0A 3GNJA 2HRNA 1ZYNA 5D73A 2PTRA 4MF5A 2IFQA 3CSJA 1UVZA 1XWKA 3O6TA 3GMFA 3TJBA 4MJBA 4KGIA 4ZL7A 1SJZA 4HEA2 1BJXA 2VLUA 3D6IA 4GSSA 4ILFA 2B6MA 3VPTA 5AIVA 3IBHA 4MH2A 4OO4A 3R3EA 3VI7A 1JHBA 4HGVA 4FIWA 3HJOA 5GAPD 2LJKA 3KZQA 2JARA 5AGYA 1A8YA 2GZPA 2MMOA 5CP1A 2F3MA 3QAVA 3FZ5A 4D73A 2VL2A 1AIUA 3GSSA 4IGJA 4XS1A 3KJYA 2H0GA 2K18A 1Z9HA 1YEPA 1TRUA 5JCUA 3HVNA 3VLNA 13GSA 2K8SA 1XWAA 5B8BA 2WB9A 3BD2A 5ECSA 3GUSA 3QOUA 2PGTA 2HSYA 4GRFA 5C00A 1TJVA 1PMTA 1SENA 4HJMA 3ME8A 1EP7A 2LJAA 3EURA 5A4WA 5IMVA 4MZBA 3VK9A 1KTEA 1TJDA 1KBNA 2GQMA 1PX7A 1TXXA 4L6CA 2D28C 4MCUA 1BX9A 1PKWA 2LS5A 2H75A 2IPAA 4EDZA 5IMFA 1SJ6A 1BYEA 2FY6A 4EFCA 2H76A 2YPMA 3ERFA 1XWBA 2LRNA 2JACA 2CVKA 2B7KA 1E6BA 1GSSA 2ZUPA 2C3TA 3TRQA 1Y25A 2RCNA 2PFMA 3PH9A 1I5GA 4KUNA 5J4UA 2R0CA 2FA8A 4O32A 1X5DA 3ME7A 4TXOB 4ICYA 4APBA 3H4KA 3C1SA 4PX1A 1GLQA 1EOHA 5IM9A 2K9FA 1G6WA 1Q4JA 2N5FA 3TOUA 10GSA 2OE0A 4BVXA 2LJRA 2IMKA 2KP2A 3RHCA 2L5OA 2X75A 1MH9A 3RHBA 4MZWA 1WJKA 5A5KA 4JU5A 4RI7A 1K0NA 1WRYA 2QGVA 4PUFC 3TGZA 1AXDA 2L6DA 1WP0A 2X49A 3KH9A 1URMA 2YP6A 3RBTA 3HJMA 1VF3A 2CAQA 2N5AA 3FMWA 2LNTA 1B4QA 3OCEA 4G0LA 1FB6A 1DCNA 2IMEA 2EC4A 5GSSA 3HVXA 2CX4A 4CY6A 3A5WA 3W6GA 4YKFA 1YZXA 3CTFA 2L59A 5IO2A 4G2EA 1A2MA 1FVJA 3FZ9A 5ECKB 2J23A 3UMAA 1OE8A 1F37A 3I43A 5H5RA 2YWMA 3KMNA 4AGSA 1GTIA 1MEKA 5GZZB 1HNBA 2PVOC 1C72A 2H71A 2HLSA 2V1MA 3VFIA 4MMMA 4TR1A 1MTCA 3F63A 1FOHA 2O7KA 4NPBA 3U6VA 1SD9A 2CVDA 2C0EA 3FHKA 4EC0A 4IQJM 5AIXA 3FR6A 1O8XA 2GLRA 4IP6A 1DSBA 2P31A 4MPGA 4G0KA 4CW9A 5ECRB 1JFUA 4MWOA 3RD8A 1DBYA 4XS6A 2AV4A 2X64A 3R6QA 2MZCA 5CYYA 3IA1A 4MDCA 2EIQA 2HSHA 5ABRA 5D6BA 5BRTA 4MJAA 5B6NA 2F8AA 1OAZA 4D73B 3TKRA 1G6YA 4J56E 1AAZA 4K9ZA 5G5EA 2CV4A 2KHPA 4X43A 3K8NA 3GSTA 4ULXA 1PKZA 1GSUA 3NOFA 17GSA 3IE3A 1EGRA 1C3CA 4ACSA 3WGEA 5DALB 1B9XC 2YOIA 2WJUA 2C80A 4CHSA 1TJ7A 3QFAC 4V2LA 4P3YB 4MPFA 1J08A 3WGXA 1JSWA 2FHEA 2V6KA 1YJ6A 4K7OA 1ACVA 3FZ4A 3JCML 1Z4KA 5COHA 4PNGA 5IMZA 5D9VA 2JAOA 3DXBA 4PQIA 1Z4PX 1VF2A 4MA9A 4H86A 2B3SA 3VWVA 5KOXA 3GYKA 3ZZXA 1SKRB 5LCZA 3HXSA 1OC3A 3QAGA 4OFMA 4X0XA 4GSNA 4ZIJA 2LV3A 2KUCA 1EV4A 4XCSA 1M2BA 2VO4A 1O85A 2WGRA 2NPBA 2PU9C 3EU3A 2BMXA 1VGLA 2XHFA 5J41A 3GL5A 3DVWA 3TB2A 3ZIJA 2ES7A 3IAM2 4I2TA 1V9WA 1ZYQB 5G2ZA 4O7HA 2CZ2A 2DLXA 4BIKA 2GT5A 2WRTA 2ZNMA 1BEDA 2GDRA 2JU5A 5JWQB 3LFLA 2DJ0A 3MNGA 1SKSB 3GRXA 5FT3A 2M72A 2YWIA 3CYNA 3EU4A 1TOFA 20GSA 2AB6A 1F2EA 4NXIA 5CRDA 4G19A 4NWYA 4YH2A 2LUSA 1HQOA 4ID0A 1G7EA 1FURA 5EVOA 4WR5A 1A0FA 1O6JA 5G30A 2FWEA 2VCWA 3F9UA 2LSTA 4FYUA 3RDWA 1M2AA 2PTSA 4KX4A 1K0DA 1FUPA 1N8JA 1Z7PA 3DYRA 4K8MA 1NHOA 1F9MA 3GTDA 3KM6A 3EC3A 2ON5A 2R0GA 2QKEA 1WMJA 2E2GA 1ZYEA 1XW6A 1EWXA 3EMXA 3Q18A 2VD0A 5ECNB 2H66A 5ID2B 3F3QA 2WS2A 4OO5A 1Z6NA 6GSYA 3HY2A 5IO0A 1M0UA 1ZOFA 1M9BA 2DMMA 3OR5A 5LD0A 3NIVA 1GULA 1QK8A 4Q5FA 3TKPA 1FW1A 18GSA 4O92A 4AJ8A 1GSQA 1SK2A 3GA4A 4TR0A 4BVYA 1M3IA 1X5EA 5DAKA 4JBBA 3HZ8A 2VCXA 1Z4IA 2H1AA 4NSLA 3FYGA 4F2IA 3EE2A 5E4WA 1NM3A 2LEGA 1SK1A 4MP4A 2H19A 1FOVA 4HZ2A 1T4ZA 3QAWA 4YIHA 3PR8A 1T1VA 2FUSA 1K0BA 1U6TA 3VWWA 3TJFA 2VL2C 3TRXA 3IR4A 1SYXA 1X0RA 1S3AA 5CRWA 3DVXA 5HQPA 1ZYPA 3GKMA 2JAWA 3UVHA 2C3NA 3RAZA 3GH6A 3KP8A 3F8UA 1TP9A 5ELGA 4QL9A 1PL2A 2IL3A 5DQSA 4EIPA 4IJ3A 3LWAA 2XBIA 4Z7XA 4Z2UA 3MDKA 1GSDA 1K3LA 3DMLA 1F3AA 3WT2A 1TW9A 3LYPA 2HYXA 2H0IA 2DBCA 1NW2A 2OBKA 3L4NA 4V1Ag 4ZL9A 3GKNA 2R5GA 4TRXA 5ECLB 2YCDA 4HS1A 2A4HA 3KIJA 2VL3A 16GSA 1K3YA 3FR3A 4YQVA 2H73A 2HI7A 1Z4JA 2AHEA 4K2DA 1TRWA 3ZL5A 1UA5A 4E88A 4WETA 4K7NA 4KDXA 3ZIVA 4XS4B 1A24A 1Y6EA 3DWVA 5IIZA 3APQA 1J9BA 1VF4A 2JZSA 4L6AA 2DJ1A 2HZFA 2WULA 3BCKA 3VWXA 4WXTA 1GLPA 4ZB9A 5JWRB 3GTUB 3UOMA 5DDLA 1HNAA 3BBYA 1MDIA 3GZHA 5IMCA 1BG5A 4POBA 5D9XA 2DKHA 3TDGA 2HT9A 4YKGA 2LRTA 4Z2RA 2REMA 3KMOA 1ERWA 5HR3A 2FWHA 2NDOA 5KOWA 1ZL9A 3EYTA 4OMVA 2FLSA 3BWVA 2F8FA 2OKAA 3D4MA 1K0AA 4MLYA 3PPUA 3GHAA 5E59A 1YY7A 1GTUA 2V2GA 1AC1A 4L5LA 2O85A 4LMWA 2IFQB 4OCEA 1AQWA 3HVSA 4OCFA 2FD3A 2D27A 2GSQA 1GTBA 2VCQA 4XRAA 2VCTA 1LJRA 3QD9A 1FAAA 3MSZA 1S3RA 5HFGA 2TRCP 4NFLA 5DBQA 2C0FA 2H01A 4GCIA 1M3JA 3EMPA 1YF1A 4RQXA 4EKZA 2E7PA 3D0ZA 3GURA 5AN1A 5H5SA 1HNCA 2QC7A 1SL0B 3QR6A 1Z4QA 2AJQB 3IHGA 1RK4A 4Q5NA 4HDEA 3FRCA 2P0GA 1ON4A 4X1UA 4KDYA 3HJPA 1FHEA 5KN0A 1K62A 1U3AA 4HZ4A 2YZUA 4ECIA 1NHYA 4HU7A 3HKRA 3WT1A 4K7IA 4IN0A 3TKSA 3C8EA 1PN0A 4DVCA 4J57E 2C8UA 4ML1A 4EF0A 3LQ7A 1TK8B 4XTSA 5JCWA 4NHWA 2VUPA 1VDKA 2I4AA 4BL7A 3Q19A 2JAUA 1XG8A 3ZVJA 1TJWA 1IW7D 3FY7A 3TCOA 3VWUA 1FG4A 3IOSA 5F92A 2MBTA 5J3RA 1XIYA 2EIOA 2MBSA 2FGXA 1LBKA 2LQOA 5ECIB 4AJ6A 1DE1A 5A4VA 1JLVA 4CDOA 3U13A 3IAS2 5ECMB 2F9SA 6GSTA 1V2AA 4NV2A 4MH3A 2L5LA 5CRHA 2C3QA 1EGOA 1R4WA 2VOCA 3TV2A 3NO9A 3GN3A 4EEIA 1K0CA 1HD2A 2TRXA 3LXTA 5G1KA 1H4OA 2C1YA 5ECQB 1Z6MA 5HR1A 5D96A 3IK7A 2DJKA 4KW6A 3H8QA 1GUMA 1Q92A 11GSA 5D9TA 4POKA 1OYJA 5CREA 2NVLA 2BTOT 3L9UA 4KE3A 1EP8A 1ZZYA 4ZB6A 5F06A 3E9JB 3WD6A 3UIWA 4GTUA 3DEXA 3KGKA 5DCHA 2J9HA 2MMZA 1WOUA 3TKQA 1O81A 1TTZA 19GSA 2IJYA 2LNSA 3KEBA 5F05A 1TI1A 2MMNA 3EPTA 3M1GA 2HSMA 1XW5A 2YJHA 4GQFA 3KD0A 1USBA 4WR4A 5AISA 3GFKA 2GQKA 2PVQA 1DE2A 2MYGA 5DALA 4ZBAA 4WF4A 1YFMA 4OWYA 4WBRD 1A8LA 2FCHA 1THXA 1J0FA 5DCGA 14GSA 4WKWA 2H1BA 1WE0A 4O5UA 4NHZA 3C7MA 5G1LA 2B1KA 2FWGA 4ADMA 2C4JA 1SD8A 2GZYA 3CSIA 3TKSE 2M80A 1U15A 2DIYA 4KSOA 1S3DA 3VPQA 2PTQA 5HR0A 2H74A 3P8WA 3TUEA 1ZCPA 3MIXA 3FR9A 4O5RA 4YAVA 4Z2TA 1K0OA 5J9CA 2FA4A 2O89A 3E3EA 2H30A 2H1GA 3R2QA 4I6XA 4JR4A 4EO3A 4HUAA 3ZLPA 3ZFLA 4KF9A 1RQMA 5EY6A 2I1UA 1PGTA 4USSA 3WYWA 5L71A 3J7Yk 1C3UA 3VI5A 4TR1B 3DIEA 4L0WA 4X4JA 4YAPA 3ZFBA 3F3RA 3GX8A 8GSSA 3F6FA 2G2QA 2HNLA 4GSTA 3R6VA 2CT6A 4TVEA 1HYUA 1TJUA 2YN1A 4OFNA 1AQVA 2YZHA 1T00A 4AJ7A 2HZEA 1F3BA 3D22A 3TJGA 3IC8A 4LL4B 4DSSA 1Q98A 1X9MB 4DEJA 1TRVA 2CZ3A 4ZILA 3QCPA 3FW2A 4ECCA 1EEJA 4NV5A 4BVYB 1OKTA 2DSAA 3CRUA 1M9AA 2B5XA 1TK0B 4LA1A 1OC8A 4ZXGA 1RE5A 4WF5A 2D2ZA 2HZEB 5GAND 3ERGA 4EIQA 3PINA 3W8SA 4I8BA 2VM2A 3UEMA 3D21A 2K6VA 3ZREA 5F8BA 4HOJA 1AW9A 5B7CA 1WIKA 4MNNA 1OC9B 4GWRA 5JWOB 4K0NA 1XW9A 1U88A 4IELA 1PRXA 3C8TA 1ERVA 5IOWA 2LTKA 4QQ7A 4FH8A 4LMVA 3C1RA 1EOGA 4LLRA 2AAWA 1RW1A 4XS4A 1YEXA 4L0UA 1LU4A 5BMUA 1QUWA 1XZOA 1O73A 2E0QA 1XWOA 4OFTA 4A5PA 2WFCA 4HJ2A 3APSA 2ZCTA 2RUFA 3QDNA 2I3YA 4YQUA 2VM1A 3LXZA 3UL3A 3GL3A 1FVKA 5HR2A 3P7XA 3DGQA 1EV9A 3VURA 1SK0A 4YQMA 2VCZA 1G0TA 4TKYA 2RM5A 1T4YA 5A4UA 5C04A 1UN2A 4N30A 3A3TA 2V32A 2JSZA 4JRRA 4K5SA 3G9BA 1B4PA 4BWSA 4G9HA 3QMXA 4EUYA 2KLXA 6GSWA 2H70A 4ECBA 3EWLA 2E9FA 4TN8A 3I6AA 1GNEA 1PA3A 1TK5B 2L6CA 2I9HA 4JR6A 3ZTLA 1SYRA 2R3XA 2YJ7A 1XVWA 2HRKA 1G7OA 3APOA 3L9SA 3IXRA 3L0HA 5J9BA 2N5BA 1M2DA 4E8EA 2O87A 4JEDA 2V41A 5KN2A 4HI7A 4OD7A 3FEUA 3GV1A 4N0ZA 1FUQA 4KSMA 5GSTA 1PD21 3UVTA 3U5RE 2K8VA 1MD4A 3CI0K 4Q5RA 1B9YC 3UBLA 4WEYA 1KQ7A 2L4CA 22GSA 3FKFA 3N9JA 2FWFA 5HFIA 5J5NA 1VRSD 5KN3A 2GTUA 3FZAA 2KP1A 1GRXA 1F6MC 1GTAA 4DSQA 2YANA 3UAPA 2E2MA 3KH7A 2CVBA 1KNGA 3ZITA 4HU9A 2VD1A 2OACA 1O7UA 4K5RA 1M99A 5ID2A 1K0MA 3RPPA 3M9KA 1GH2A 1Q91A 4PNFA 4N10A 5G5FA 5EPFA 4L5OA 4TW5A 2B1LA 1SL2B 1ERTA 2NBSA 2YV9A 4HSCX 5F91A 4MZCA 2PWJA 4CY8A 4I5QA 1A0RP 3O76A 5DJMA 2CX3A 1W4VA 3ISOA 4BL7B 3I69A 2IMFA 3A5IA 1N2AA 4KNDA 3G7JA 6GSVA 1NSWA 1R5PA 4FO5A 1V40A 2A4VA 2PUKC 2OADA 4RQRA 1Z4LA 1A2JA 4PQ1A 3W8JA 1CQHA 1YKAA 3Q74A 1S3CA 3NZNA 2L57A 4N11A 1PN9A 4V1Ap 1T8EB 2B5YA 2GZZA 4ZB8A 2CQ9A 2X8CA 2V6OA 5IMAA 3RRPA 4Q5QA 4GQCA 4IJIA 5EL8A 3A2WA 3LJRA 3TOTA 1GP1A 2X8HA 1H75A 2DJ3A 2H6YA 4IQAA 4KCEA 1XVQA 1DOFA 4DSRA 1XPVA 1Z3EA 1IYIA 4XHMA 5JCGA 3GH9A 2IMIA 4IVFA 3DRNA 3KCMA 3MAKA 3M9JA 5D8IA 1YQ1A 1B48A 3HYPA 5ENUA 2MMAA 4G0IA 2H6XA 4BVXB 3M3MA 1ABAA 4I2UA 2NTOA 1GWCA 3S9FA 1XWCA 4PGTA 3PGTA 5FWGA 4KB3A 3G7YA 4POMA 4MK3A 5CAXA 1MDJA 5G31A 1X9WB 3HHVA 2GS3A 3SWLA 2GQLA 1THOA 3IV4A 2IN3A 4K0GA 3HCZA 4GXZA 1BQ7A 2H72A 1GSYA 4PUAA 1V57A 4BA7A 3MWHA 4BPYA 2C0DA 1K7WA 1QGVA 3EINA 1X9SB 1PL1A 2RM6A 3LG6A 1YFEA 3CSHA 4RI6A 2RLIA 5IMDA 5KN1A 4PQHA 3BOAA 2PMTA 2R2JA 3IK9A 4J2FA 1CQGA 4F82A 2JZTA 4F03A 3AY8A 2H8LA 4MX2A 1IYHA 2BJXA 2I81A 2LKUA 2OJLA 5ECHB 1M7TA 4IBPA 3LW9A 3WGDA 2JADA 2XBQA 3ZYWA 3BHGA 3H79A 3HA9A 2R0PA 1U87A 3N5OA 3L9VA 4APAA 1XBSA 4KDUA 1B8XA 2YWNA 2PPTA 4TR3A 1ILOA 2AUVA 3G7IA 4N0VA 3I9V2 5D93A 4ZL8A 3QBPA 5ECPB 2X99A 1V58A 3LSZA 3QPMA 1AQXA 1OE7A 1TI3A 3GX0A 4LL1B 2RUEA 4ECJA 3H1NA 1TDIA 1SKWB 2WCIA 1YDKA 1O8WA 2VIMA 4L8EA 4JE1A 2DKIA 2B7JA 3HDCA 1R26A 2YV7A 3H93A 2A2PA 2M46A 3MYDA 2OE1A 3A2VA 4EL1A 1FUOA 6GSSA 4KAEA 5B8AA 3US3A 1TKDB 1AUCA 3IC4A 4FYCA 1JZRA 3E04A 3HVVA 9GSSA 4XRDA 1Z5YE 4IHUA 1AUWA 3U19A 1TRSA 1YF0A 1Z7RA 3KXOA 5DVBA 2HRFA 1HY0A 3D5JA 3LORA 1XFLA 2GSRA 4IKHA 1I9DA 1WPIA 5CNWA 3BCIA 5LNKe 1X5CA 3OCFA 4POLA 2FNOA 3EVIA 2UZ8A 4YIKA 4MF6A 3KP9A 1SL1B 2VCVA 5KEJA 2PERA 1BAYA 2GSTA 3LGCA 1XWGA 3GTUA 3LEFA 1XOAA 2JL4A 3UARA 4K2XA 4ZBBA 4ADLA 1ST9A 2A2SA 5DAKB 2IWTA 2O8VB 2WDUA 2R4VA 1V98A 4TXOA 4G10A 1DUGA 1E2YA 2P5QA 2PBJA 2IMDA 3F4SA 4F0CA 4ISDA 5CRGA 5DQYA 4EE0A 1KEBA 1JZWA 3RPNA 2OE3A 1MD3A 3C71A 1OKDA 4EDYA 3HZ4A 2OBIA 4I97A 4PURA 3ZMKA 2AYTA 1OVNA 4BWQA 2R37A 4NLEA 2R6KA 1MDKA 3CTGA 1PSQA 1GUHA 2OA7A 2P5RA 1A2LA 4IQ1A 2JSYA 3IRAA 4MJCA 5HFKA 4HQZA 2CA8A 5DJLA 5F0GA 1PFOA 4PXOA 4MUMA 2LQQA 1A23A 4O5QA 3UJ1A 2HXKA 3E0UA 4NAXA 1TU7A 2LRCA 5H5QA 2FUG2 1YKCA 4AF2A 6GSXA 2PN8A 1FB0A 1VF1A 3M8NA 5F07A 2X4AA 3TJJA 1OC9A 2JZRA 1JLWA 3CMIA 3HD5A 2CAIA 2GGTA 3KTBA 3QFBC 3P2AA 2WZ9A 3Q6OA 4WBJA 1ML6A 1GL8A 4ML6A 3IHQA 4MF7A 4GLTA 2DC5A 4IP1A 1FO5A 3M0FA 2QA2A 3SBCA 3UBKA 2DJJA 1ERUA 4PTSA 3KTLA 3D4TA 3C73A 2XPDA 2B5EA 2HE3A 2H6ZA 2C0GA 3F0IA 3CXGA 1JZDA 4DSSB 1ZMAA 1K3OA 3F6DA 12GSA 1GUKA 1T3BA 2EIRA 2H0HA 5IQYA 3DKSA 2VLTA 3V1WA 1GSFA 2GT6A 5IPGA 4FYBA 1ZGNA 3DD3A 1UC7A 5ELAA 1SJIA 2G0FA 3BJ5A 4TR4A 5ECOB 1WWJA 3CRTA 3GKKA 3CBUA 3GIXA 4JZQA 5B6MA 2IIYA 2DIZA 4NMUA 4IW9A 4MJEA 1TU8A 2GVPA 2GSSA 2HVGA 3ZRDA 1XXUA 3IDVA 7GSSA 2YWOA 4L57A 1T7PB 3F4RA 6GSUA 4MABA 1EEMA 2YV5A 4V2MA 3FK8A 3ERWA 5CO3A 2HRAA 4EVMA 2KOKA 3ZMLA 2A2RA 2VL9A 3TKSC 4KH7A 4TOPA 2QSIA 2YNXA 2RIIA 2F51A 4K6XA 4K1FA 1Z4MA 1R5AA 3O3TA 2H1DA 4EXJA 3A2XA 4IS0A 2DMLA 4TXVA 3TRPA 2XC2A 1HY1A 1U3IA 3ED3A 4ZBDA 1XCCA 4V2NA 3ZVJD 1QMVA 2VLVA 4KCAA 2VAFA 1QFNA 2QA1A 2ALBA 3TJKA 4F0BA 1EZKA 3F4TA 3GKXA 1QXHA 4GF0A 1T9HA 1GNWA 2X8GA 1U16A 1QQ2A 2QGAB 5INYA 4RUVA 1XOBA 2Z9SA 4XIHA 2ON7A 1R7HA 1W89A 4FQUA 1SU9A 4E8HA 3LYKA 4QL7A 2L4QA 4F9ZA 5HW2A 2DJ2A 2XPEA 3P90A 3IPZA
chains in the Genus database with same CATH topology
1PQNA 3J7Yb 5IOXA 1PX6A 5D9WA 1GSEA 3L78A 2HFDA 5IPHA 5FHIA 1JZOA 4HQSA 2TIRA 4KA0A 3GNJA 2HRNA 1ZYNA 5D73A 4MF5A 2IFQA 3CSJA 1UVZA 1XWKA 3O6TA 3GMFA 3TJBA 4MJBA 4KGIA 4ZL7A 1SJZA 4HEA2 1BJXA 2VLUA 3D6IA 4GSSA 4ILFA 2B6MA 3VPTA 5AIVA 3IBHA 4MH2A 4OO4A 3R3EA 3VI7A 1JHBA 4FIWA 3HJOA 5GAPD 2LJKA 3KZQA 5AGYA 1A8YA 2GZPA 2MMOA 5CP1A 2F3MA 3QAVA 3FZ5A 4D73A 2VL2A 1AIUA 3GSSA 4IGJA 4XS1A 3KJYA 2H0GA 2K18A 1Z9HA 1YEPA 1TRUA 5JCUA 3VLNA 13GSA 2K8SA 1XWAA 5B8BA 2WB9A 3BD2A 5ECSA 3GUSA 3QOUA 2PGTA 2HSYA 4GRFA 5C00A 1PMTA 1SENA 4HJMA 3ME8A 1EP7A 2LJAA 3EURA 5A4WA 5IMVA 4MZBA 3VK9A 1KTEA 1TJDA 1KBNA 2GQMA 1PX7A 1TXXA 2D28C 4MCUA 1BX9A 1PKWA 2LS5A 2H75A 2IPAA 4EDZA 5IMFA 1SJ6A 1BYEA 2FY6A 2H76A 2YPMA 3ERFA 1XWBA 2LRNA 2JACA 2CVKA 2B7KA 1E6BA 1GSSA 2ZUPA 2C3TA 3TRQA 1Y25A 3PH9A 1I5GA 4KUNA 5J4UA 2R0CA 2FA8A 4O32A 1X5DA 3ME7A 4TXOB 4ICYA 3H4KA 3C1SA 4PX1A 1GLQA 1EOHA 5IM9A 2K9FA 1G6WA 1Q4JA 2N5FA 3TOUA 10GSA 2OE0A 4BVXA 2LJRA 2IMKA 2KP2A 3RHCA 2L5OA 3RHBA 4MZWA 1WJKA 5A5KA 4JU5A 4RI7A 1K0NA 1WRYA 2QGVA 4PUFC 3TGZA 1AXDA 2L6DA 1WP0A 2X49A 3KH9A 1URMA 2YP6A 3RBTA 3HJMA 1VF3A 2CAQA 2N5AA 3FMWA 2LNTA 1B4QA 4G0LA 1FB6A 2IMEA 2EC4A 5GSSA 3HVXA 2CX4A 4CY6A 3A5WA 3W6GA 4YKFA 1YZXA 3CTFA 2L59A 5IO2A 4G2EA 1A2MA 1FVJA 3FZ9A 5ECKB 2J23A 3UMAA 1OE8A 1F37A 3I43A 5H5RA 2YWMA 3KMNA 4AGSA 1GTIA 1MEKA 5GZZB 1HNBA 2PVOC 1C72A 2H71A 2HLSA 2V1MA 3VFIA 4MMMA 4TR1A 1MTCA 3F63A 1FOHA 2O7KA 4NPBA 3U6VA 1SD9A 2CVDA 2C0EA 3FHKA 4EC0A 4IQJM 5AIXA 3FR6A 1O8XA 2GLRA 4IP6A 1DSBA 2P31A 4MPGA 4G0KA 4CW9A 5ECRB 1JFUA 1DBYA 4XS6A 2AV4A 2X64A 2MZCA 5CYYA 3IA1A 4MDCA 2EIQA 2HSHA 5ABRA 5BRTA 4MJAA 5B6NA 2F8AA 1OAZA 4D73B 3TKRA 1G6YA 4J56E 1AAZA 4K9ZA 5G5EA 2CV4A 2KHPA 4X43A 3K8NA 3GSTA 4ULXA 1PKZA 1GSUA 3NOFA 17GSA 3IE3A 1EGRA 4ACSA 3WGEA 5DALB 1B9XC 2YOIA 2WJUA 2C80A 4CHSA 3QFAC 4V2LA 4P3YB 4MPFA 1J08A 3WGXA 2FHEA 2V6KA 1YJ6A 4K7OA 1ACVA 3FZ4A 3JCML 5COHA 4PNGA 5IMZA 5D9VA 3DXBA 4PQIA 1VF2A 4MA9A 4H86A 2B3SA 3VWVA 5KOXA 3GYKA 3ZZXA 1SKRB 5LCZA 3HXSA 1OC3A 3QAGA 4OFMA 4X0XA 4GSNA 4ZIJA 2LV3A 2KUCA 1EV4A 4XCSA 1M2BA 2VO4A 1O85A 2WGRA 2NPBA 2PU9C 3EU3A 2BMXA 1VGLA 2XHFA 5J41A 3GL5A 3DVWA 3TB2A 3ZIJA 2ES7A 3IAM2 4I2TA 1V9WA 1ZYQB 5G2ZA 4O7HA 2CZ2A 2DLXA 2GT5A 2WRTA 2ZNMA 1BEDA 2GDRA 2JU5A 5JWQB 3LFLA 2DJ0A 3MNGA 1SKSB 3GRXA 5FT3A 2M72A 2YWIA 3CYNA 3EU4A 1TOFA 20GSA 2AB6A 1F2EA 4NXIA 5CRDA 4G19A 4NWYA 4YH2A 2LUSA 1HQOA 4ID0A 1G7EA 5EVOA 4WR5A 1A0FA 1O6JA 5G30A 2FWEA 2VCWA 3F9UA 2LSTA 4FYUA 3RDWA 1M2AA 4KX4A 1K0DA 1N8JA 1Z7PA 3DYRA 4K8MA 1NHOA 1F9MA 3KM6A 3EC3A 2ON5A 2R0GA 2QKEA 1WMJA 2E2GA 1ZYEA 1XW6A 1EWXA 3EMXA 3Q18A 2VD0A 5ECNB 2H66A 5ID2B 3F3QA 2WS2A 4OO5A 1Z6NA 6GSYA 3HY2A 5IO0A 1M0UA 1ZOFA 1M9BA 2DMMA 3OR5A 5LD0A 3NIVA 1GULA 1QK8A 4Q5FA 3TKPA 1FW1A 18GSA 4O92A 4AJ8A 1GSQA 1SK2A 3GA4A 4TR0A 4BVYA 1X5EA 5DAKA 4JBBA 3HZ8A 2VCXA 2H1AA 3FYGA 4F2IA 3EE2A 5E4WA 1NM3A 2LEGA 1SK1A 4MP4A 2H19A 1FOVA 4HZ2A 1T4ZA 3QAWA 3PR8A 1T1VA 1K0BA 1U6TA 3VWWA 3TJFA 2VL2C 3TRXA 3IR4A 1SYXA 1X0RA 1S3AA 5CRWA 3DVXA 5HQPA 1ZYPA 3GKMA 3UVHA 2C3NA 3RAZA 3GH6A 3KP8A 3F8UA 1TP9A 5ELGA 4QL9A 1PL2A 2IL3A 5DQSA 4EIPA 4IJ3A 3LWAA 2XBIA 4Z7XA 4Z2UA 3MDKA 1GSDA 1K3LA 3DMLA 1F3AA 3WT2A 1TW9A 3LYPA 2HYXA 2H0IA 2DBCA 1NW2A 2OBKA 3L4NA 4V1Ag 4ZL9A 3GKNA 2R5GA 4TRXA 5ECLB 2YCDA 4HS1A 2A4HA 3KIJA 2VL3A 16GSA 1K3YA 3FR3A 4YQVA 2H73A 2HI7A 2AHEA 4K2DA 1TRWA 3ZL5A 1UA5A 4WETA 4K7NA 4KDXA 3ZIVA 4XS4B 1A24A 1Y6EA 3DWVA 5IIZA 3APQA 1J9BA 1VF4A 2JZSA 2DJ1A 2HZFA 2WULA 3BCKA 3VWXA 4WXTA 1GLPA 4ZB9A 5JWRB 3GTUB 3UOMA 5DDLA 1HNAA 3BBYA 1MDIA 5IMCA 1BG5A 4POBA 5D9XA 2DKHA 3TDGA 2HT9A 4YKGA 2LRTA 4Z2RA 2REMA 3KMOA 1ERWA 5HR3A 2FWHA 2NDOA 5KOWA 1ZL9A 3EYTA 4OMVA 2FLSA 2F8FA 2OKAA 3D4MA 1K0AA 4MLYA 3PPUA 3GHAA 5E59A 1YY7A 1GTUA 2V2GA 1AC1A 4L5LA 2O85A 4LMWA 2IFQB 4OCEA 1AQWA 3HVSA 4OCFA 2FD3A 2D27A 2GSQA 1GTBA 2VCQA 4XRAA 2VCTA 1LJRA 3QD9A 1FAAA 3MSZA 5HFGA 2TRCP 5DBQA 2C0FA 2H01A 4GCIA 3EMPA 1YF1A 4RQXA 4EKZA 2E7PA 3D0ZA 3GURA 5AN1A 5H5SA 1HNCA 2QC7A 1SL0B 3QR6A 2AJQB 3IHGA 1RK4A 4Q5NA 4HDEA 3FRCA 2P0GA 1ON4A 4X1UA 4KDYA 3HJPA 1FHEA 5KN0A 1U3AA 4HZ4A 2YZUA 4ECIA 1NHYA 4HU7A 3HKRA 3WT1A 4K7IA 4IN0A 3TKSA 3C8EA 1PN0A 4DVCA 4J57E 2C8UA 4ML1A 4EF0A 3LQ7A 1TK8B 4XTSA 5JCWA 4NHWA 2VUPA 2I4AA 4BL7A 3Q19A 3ZVJA 1IW7D 3FY7A 3TCOA 3VWUA 1FG4A 3IOSA 2MBTA 5J3RA 1XIYA 2EIOA 2MBSA 2FGXA 1LBKA 2LQOA 5ECIB 4AJ6A 1DE1A 5A4VA 1JLVA 4CDOA 3IAS2 5ECMB 2F9SA 6GSTA 1V2AA 4NV2A 4MH3A 2L5LA 5CRHA 2C3QA 1EGOA 1R4WA 2VOCA 3GN3A 1K0CA 1HD2A 2TRXA 3LXTA 5G1KA 1H4OA 2C1YA 5ECQB 1Z6MA 5HR1A 5D96A 3IK7A 2DJKA 4KW6A 3H8QA 1GUMA 11GSA 5D9TA 4POKA 1OYJA 5CREA 2NVLA 2BTOT 3L9UA 4KE3A 1EP8A 1ZZYA 4ZB6A 5F06A 3E9JB 3WD6A 3UIWA 4GTUA 3DEXA 3KGKA 5DCHA 2J9HA 2MMZA 1WOUA 3TKQA 1O81A 1TTZA 19GSA 2IJYA 2LNSA 3KEBA 5F05A 1TI1A 2MMNA 3EPTA 3M1GA 2HSMA 1XW5A 2YJHA 4GQFA 3KD0A 1USBA 4WR4A 5AISA 3GFKA 2GQKA 2PVQA 1DE2A 2MYGA 5DALA 4ZBAA 4WF4A 4OWYA 4WBRD 1A8LA 2FCHA 1THXA 1J0FA 5DCGA 14GSA 4WKWA 2H1BA 1WE0A 4O5UA 4NHZA 3C7MA 5G1LA 2B1KA 2FWGA 2C4JA 1SD8A 2GZYA 3CSIA 3TKSE 2M80A 2DIYA 4KSOA 1S3DA 3VPQA 5HR0A 2H74A 3P8WA 3TUEA 1ZCPA 3MIXA 3FR9A 4O5RA 4YAVA 4Z2TA 1K0OA 5J9CA 2FA4A 2O89A 3E3EA 2H30A 2H1GA 3R2QA 4I6XA 4JR4A 4EO3A 4HUAA 3ZLPA 3ZFLA 4KF9A 1RQMA 5EY6A 2I1UA 1PGTA 4USSA 3WYWA 5L71A 3J7Yk 3VI5A 4TR1B 3DIEA 4L0WA 4X4JA 4YAPA 3ZFBA 3F3RA 3GX8A 8GSSA 3F6FA 2G2QA 2HNLA 4GSTA 2CT6A 4TVEA 1HYUA 2YN1A 4OFNA 1AQVA 2YZHA 1T00A 4AJ7A 2HZEA 1F3BA 3D22A 3TJGA 3IC8A 4LL4B 4DSSA 1Q98A 1X9MB 4DEJA 1TRVA 2CZ3A 4ZILA 3QCPA 3FW2A 4ECCA 1EEJA 4NV5A 4BVYB 1OKTA 2DSAA 3CRUA 1M9AA 2B5XA 1TK0B 4LA1A 1OC8A 4ZXGA 4WF5A 2D2ZA 2HZEB 5GAND 3ERGA 4EIQA 3PINA 3W8SA 4I8BA 2VM2A 3UEMA 3D21A 2K6VA 3ZREA 5F8BA 4HOJA 1AW9A 5B7CA 1WIKA 4MNNA 1OC9B 4GWRA 5JWOB 4K0NA 1XW9A 1U88A 4IELA 1PRXA 1ERVA 5IOWA 2LTKA 4QQ7A 4FH8A 4LMVA 3C1RA 1EOGA 4LLRA 2AAWA 1RW1A 4XS4A 1YEXA 4L0UA 1LU4A 5BMUA 1QUWA 1XZOA 1O73A 2E0QA 4OFTA 4A5PA 2WFCA 4HJ2A 3APSA 2ZCTA 2RUFA 3QDNA 2I3YA 4YQUA 2VM1A 3LXZA 3UL3A 3GL3A 1FVKA 5HR2A 3P7XA 3DGQA 1EV9A 3VURA 1SK0A 4YQMA 2VCZA 1G0TA 4TKYA 2RM5A 1T4YA 5A4UA 5C04A 1UN2A 4N30A 3A3TA 2V32A 2JSZA 4JRRA 4K5SA 3G9BA 1B4PA 4BWSA 4G9HA 3QMXA 4EUYA 2KLXA 6GSWA 2H70A 4ECBA 3EWLA 4TN8A 3I6AA 1GNEA 1PA3A 1TK5B 2L6CA 2I9HA 4JR6A 3ZTLA 1SYRA 2R3XA 2YJ7A 1XVWA 2HRKA 1G7OA 3APOA 3L9SA 3IXRA 3L0HA 5J9BA 2N5BA 1M2DA 4E8EA 2O87A 4JEDA 2V41A 5KN2A 4HI7A 4OD7A 3FEUA 3GV1A 4N0ZA 4KSMA 5GSTA 1PD21 3UVTA 3U5RE 2K8VA 1MD4A 4Q5RA 1B9YC 3UBLA 4WEYA 2L4CA 22GSA 3FKFA 3N9JA 2FWFA 5HFIA 5J5NA 1VRSD 5KN3A 2GTUA 3FZAA 2KP1A 1GRXA 1F6MC 1GTAA 4DSQA 2YANA 3UAPA 2E2MA 3KH7A 2CVBA 1KNGA 3ZITA 4HU9A 2VD1A 2OACA 1O7UA 4K5RA 1M99A 5ID2A 1K0MA 3RPPA 3M9KA 1GH2A 4PNFA 4N10A 5G5FA 5EPFA 4L5OA 4TW5A 2B1LA 1SL2B 1ERTA 2NBSA 2YV9A 4MZCA 2PWJA 4CY8A 4I5QA 1A0RP 3O76A 5DJMA 2CX3A 1W4VA 3ISOA 4BL7B 3I69A 2IMFA 3A5IA 1N2AA 4KNDA 3G7JA 6GSVA 1NSWA 1R5PA 4FO5A 1V40A 2A4VA 2PUKC 2OADA 4RQRA 1A2JA 4PQ1A 3W8JA 1CQHA 1YKAA 3Q74A 1S3CA 3NZNA 2L57A 4N11A 1PN9A 4V1Ap 1T8EB 2B5YA 2GZZA 4ZB8A 2CQ9A 2X8CA 2V6OA 5IMAA 4Q5QA 4GQCA 4IJIA 5EL8A 3A2WA 3LJRA 3TOTA 1GP1A 2X8HA 1H75A 2DJ3A 2H6YA 4IQAA 4KCEA 1XVQA 4DSRA 1XPVA 1Z3EA 1IYIA 4XHMA 5JCGA 3GH9A 2IMIA 4IVFA 3DRNA 3KCMA 3MAKA 3M9JA 5D8IA 1YQ1A 1B48A 3HYPA 5ENUA 2MMAA 4G0IA 2H6XA 4BVXB 3M3MA 1ABAA 2NTOA 4I2UA 1GWCA 3S9FA 1XWCA 4PGTA 3PGTA 5FWGA 4KB3A 3G7YA 4POMA 4MK3A 5CAXA 1MDJA 5G31A 1X9WB 3HHVA 2GS3A 3SWLA 2GQLA 1THOA 3IV4A 2IN3A 4K0GA 3HCZA 4GXZA 1BQ7A 2H72A 1GSYA 4PUAA 1V57A 4BA7A 3MWHA 4BPYA 2C0DA 1QGVA 3EINA 1X9SB 1PL1A 2RM6A 3LG6A 3CSHA 4RI6A 2RLIA 5IMDA 5KN1A 4PQHA 3BOAA 2PMTA 2R2JA 3IK9A 4J2FA 1CQGA 4F82A 2JZTA 4F03A 3AY8A 2H8LA 1IYHA 2BJXA 2I81A 2LKUA 2OJLA 5ECHB 1M7TA 4IBPA 3LW9A 3WGDA 2JADA 2XBQA 3ZYWA 3H79A 3HA9A 2R0PA 1U87A 3N5OA 3L9VA 1XBSA 4KDUA 1B8XA 2YWNA 2PPTA 4TR3A 1ILOA 2AUVA 3G7IA 4N0VA 3I9V2 4ZL8A 5D93A 5ECPB 2X99A 1V58A 3LSZA 3QPMA 1AQXA 1OE7A 1TI3A 3GX0A 4LL1B 2RUEA 4ECJA 3H1NA 1TDIA 1SKWB 2WCIA 1YDKA 1O8WA 2VIMA 4L8EA 4JE1A 2DKIA 2B7JA 3HDCA 1R26A 2YV7A 3H93A 2A2PA 2M46A 3MYDA 2OE1A 3A2VA 4EL1A 6GSSA 4KAEA 5B8AA 3US3A 1TKDB 1AUCA 3IC4A 4FYCA 1JZRA 9GSSA 3HVVA 4XRDA 1Z5YE 4IHUA 1TRSA 1YF0A 1Z7RA 3KXOA 5DVBA 2HRFA 3D5JA 3LORA 1XFLA 2GSRA 4IKHA 1I9DA 1WPIA 5CNWA 3BCIA 5LNKe 1X5CA 4POLA 2FNOA 3EVIA 2UZ8A 4MF6A 3KP9A 1SL1B 2VCVA 5KEJA 2PERA 1BAYA 2GSTA 3LGCA 1XWGA 3GTUA 3LEFA 1XOAA 2JL4A 3UARA 4K2XA 4ZBBA 1ST9A 2A2SA 5DAKB 2IWTA 2O8VB 2WDUA 2R4VA 1V98A 4TXOA 4G10A 1DUGA 1E2YA 2P5QA 2PBJA 2IMDA 3F4SA 4F0CA 4ISDA 5CRGA 5DQYA 4EE0A 1KEBA 1JZWA 3RPNA 2OE3A 1MD3A 3C71A 1OKDA 4EDYA 3HZ4A 2OBIA 4I97A 4PURA 3ZMKA 2AYTA 1OVNA 4BWQA 2R37A 2R6KA 1MDKA 3CTGA 1PSQA 1GUHA 2OA7A 2P5RA 1A2LA 4IQ1A 2JSYA 3IRAA 4MJCA 5HFKA 4HQZA 2CA8A 5DJLA 5F0GA 4PXOA 2LQQA 1A23A 4O5QA 3UJ1A 2HXKA 3E0UA 4NAXA 1TU7A 2LRCA 5H5QA 2FUG2 1YKCA 4AF2A 6GSXA 2PN8A 1FB0A 1VF1A 3M8NA 5F07A 2X4AA 3TJJA 1OC9A 2JZRA 1JLWA 3CMIA 3HD5A 2CAIA 2GGTA 3KTBA 3QFBC 3P2AA 2WZ9A 3Q6OA 4WBJA 1ML6A 1GL8A 4ML6A 3IHQA 4MF7A 4GLTA 2DC5A 4IP1A 1FO5A 3M0FA 2QA2A 3SBCA 3UBKA 2DJJA 1ERUA 4PTSA 3KTLA 3D4TA 3C73A 2XPDA 2B5EA 2HE3A 2H6ZA 2C0GA 3F0IA 3CXGA 1JZDA 4DSSB 1ZMAA 1K3OA 3F6DA 12GSA 1GUKA 1T3BA 2EIRA 2H0HA 5IQYA 3DKSA 2VLTA 3V1WA 1GSFA 2GT6A 5IPGA 4FYBA 1ZGNA 3DD3A 1UC7A 5ELAA 1SJIA 2G0FA 3BJ5A 4TR4A 5ECOB 1WWJA 3CRTA 3GKKA 3CBUA 3GIXA 4JZQA 5B6MA 2IIYA 2DIZA 4NMUA 4IW9A 4MJEA 1TU8A 2GVPA 2GSSA 3ZRDA 1XXUA 3IDVA 7GSSA 2YWOA 1T7PB 3F4RA 6GSUA 4MABA 1EEMA 4V2MA 3FK8A 3ERWA 5CO3A 2HRAA 4EVMA 2KOKA 3ZMLA 2A2RA 2VL9A 3TKSC 4KH7A 4TOPA 2QSIA 2YNXA 2RIIA 2F51A 4K6XA 4K1FA 1R5AA 3O3TA 2H1DA 4EXJA 3A2XA 4IS0A 2DMLA 4TXVA 3TRPA 2XC2A 3ED3A 1U3IA 4ZBDA 1XCCA 4V2NA 3ZVJD 1QMVA 2VLVA 4KCAA 2VAFA 1QFNA 2QA1A 2ALBA 3TJKA 4F0BA 1EZKA 3F4TA 3GKXA 1QXHA 4GF0A 1GNWA 2X8GA 1QQ2A 5INYA 4RUVA 1XOBA 2Z9SA 4XIHA 2ON7A 1R7HA 1W89A 4FQUA 1SU9A 4E8HA 3LYKA 4QL7A 2L4QA 4F9ZA 2DJ2A 2XPEA 3P90A 3IPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PQN A;  3J7Y b;  5IOX A;  1PX6 A;  5D9W A;  1GSE A;  3L78 A;  2HFD A;  5IPH A;  5FHI A;  1JZO A;  4HQS A;  2TIR A;  4KA0 A;  3GNJ A;  2HRN A;  5D73 A;  4MF5 A;  2IFQ A;  3CSJ A;  1UVZ A;  1XWK A;  3O6T A;  3GMF A;  3TJB A;  4MJB A;  4KGI A;  4ZL7 A;  1SJZ A;  4HEA 2;  1BJX A;  2VLU A;  3D6I A;  4GSS A;  4ILF A;  2B6M A;  3VPT A;  5AIV A;  3IBH A;  4MH2 A;  4OO4 A;  3VI7 A;  1JHB A;  4FIW A;  3HJO A;  5GAP D;  2LJK A;  3KZQ A;  5AGY A;  1A8Y A;  2GZP A;  2MMO A;  5CP1 A;  2F3M A;  3QAV A;  3FZ5 A;  4D73 A;  2VL2 A;  1AIU A;  3GSS A;  4IGJ A;  4XS1 A;  3KJY A;  2H0G A;  2K18 A;  1Z9H A;  1YEP A;  1TRU A;  5JCU A;  3VLN A;  13GS A;  2K8S A;  1XWA A;  5B8B A;  2WB9 A;  3BD2 A;  5ECS A;  3GUS A;  3QOU A;  2PGT A;  2HSY A;  4GRF A;  5C00 A;  1PMT A;  1SEN A;  4HJM A;  3ME8 A;  1EP7 A;  2LJA A;  3EUR A;  5A4W A;  5IMV A;  4MZB A;  3VK9 A;  1KTE A;  1TJD A;  1KBN A;  2GQM A;  1PX7 A;  1TXX A;  4MCU A;  1BX9 A;  1PKW A;  2LS5 A;  2H75 A;  2IPA A;  4EDZ A;  5IMF A;  1SJ6 A;  1BYE A;  2FY6 A;  2H76 A;  2YPM A;  3ERF A;  1XWB A;  2LRN A;  2JAC A;  2CVK A;  2B7K A;  1E6B A;  1GSS A;  2ZUP A;  2C3T A;  3TRQ A;  1Y25 A;  3PH9 A;  1I5G A;  4KUN A;  5J4U A;  2FA8 A;  4O32 A;  1X5D A;  3ME7 A;  4TXO B;  3H4K A;  3C1S A;  4PX1 A;  1GLQ A;  1EOH A;  5IM9 A;  2K9F A;  1G6W A;  1Q4J A;  2N5F A;  3TOU A;  10GS A;  2OE0 A;  4BVX A;  2LJR A;  2IMK A;  2KP2 A;  3RHC A;  2L5O A;  3RHB A;  4MZW A;  1WJK A;  5A5K A;  4JU5 A;  4RI7 A;  1K0N A;  1WRY A;  2QGV A;  4PUF C;  3TGZ A;  1AXD A;  2L6D A;  1WP0 A;  3KH9 A;  1URM A;  2YP6 A;  3RBT A;  3HJM A;  1VF3 A;  2CAQ A;  2N5A A;  2LNT A;  1B4Q A;  1FB6 A;  2IME A;  2EC4 A;  5GSS A;  3HVX A;  2CX4 A;  3A5W A;  3W6G A;  1YZX A;  3CTF A;  2L59 A;  5IO2 A;  4G2E A;  1A2M A;  1FVJ A;  3FZ9 A;  5ECK B;  2J23 A;  3UMA A;  1OE8 A;  1F37 A;  3I43 A;  5H5R A;  2YWM A;  3KMN A;  4AGS A;  1GTI A;  1MEK A;  5GZZ B;  1HNB A;  2PVO C;  1C72 A;  2H71 A;  2HLS A;  2V1M A;  3VFI A;  4MMM A;  4TR1 A;  1MTC A;  3F63 A;  2O7K A;  4NPB A;  3U6V A;  1SD9 A;  2CVD A;  2C0E A;  3FHK A;  4EC0 A;  5AIX A;  3FR6 A;  1O8X A;  2GLR A;  4IP6 A;  1DSB A;  2P31 A;  4MPG A;  4CW9 A;  5ECR B;  1JFU A;  1DBY A;  4XS6 A;  2AV4 A;  2X64 A;  2MZC A;  5CYY A;  3IA1 A;  4MDC A;  2EIQ A;  2HSH A;  5ABR A;  4MJA A;  5B6N A;  2F8A A;  1OAZ A;  4D73 B;  3TKR A;  1G6Y A;  4J56 E;  1AAZ A;  4K9Z A;  5G5E A;  2CV4 A;  2KHP A;  4X43 A;  3K8N A;  3GST A;  4ULX A;  1PKZ A;  1GSU A;  3NOF A;  17GS A;  3IE3 A;  1EGR A;  4ACS A;  3WGE A;  5DAL B;  1B9X C;  2YOI A;  2WJU A;  2C80 A;  4CHS A;  3QFA C;  4V2L A;  4P3Y B;  4MPF A;  1J08 A;  3WGX A;  2FHE A;  2V6K A;  1YJ6 A;  4K7O A;  1ACV A;  3FZ4 A;  3JCM L;  5COH A;  4PNG A;  5IMZ A;  5D9V A;  3DXB A;  4PQI A;  1VF2 A;  4MA9 A;  4H86 A;  2B3S A;  3VWV A;  3GYK A;  3ZZX A;  1SKR B;  5LCZ A;  3HXS A;  1OC3 A;  3QAG A;  4OFM A;  4X0X A;  4GSN A;  4ZIJ A;  2LV3 A;  2KUC A;  1EV4 A;  4XCS A;  1M2B A;  2VO4 A;  1O85 A;  2WGR A;  2NPB A;  2PU9 C;  3EU3 A;  2BMX A;  1VGL A;  2XHF A;  5J41 A;  3GL5 A;  3DVW A;  3TB2 A;  3ZIJ A;  2ES7 A;  3IAM 2;  4I2T A;  1V9W A;  1ZYQ B;  5G2Z A;  4O7H A;  2CZ2 A;  2DLX A;  2GT5 A;  2WRT A;  2ZNM A;  1BED A;  2GDR A;  2JU5 A;  5JWQ B;  3LFL A;  2DJ0 A;  3MNG A;  1SKS B;  3GRX A;  5FT3 A;  2M72 A;  2YWI A;  3CYN A;  3EU4 A;  1TOF A;  20GS A;  2AB6 A;  1F2E A;  4NXI A;  5CRD A;  4G19 A;  4NWY A;  4YH2 A;  2LUS A;  1HQO A;  4ID0 A;  1G7E A;  5EVO A;  4WR5 A;  1A0F A;  1O6J A;  5G30 A;  2FWE A;  2VCW A;  3F9U A;  2LST A;  4FYU A;  3RDW A;  1M2A A;  4KX4 A;  1K0D A;  1N8J A;  1Z7P A;  3DYR A;  4K8M A;  1NHO A;  1F9M A;  3KM6 A;  3EC3 A;  2ON5 A;  2QKE A;  1WMJ A;  2E2G A;  1ZYE A;  1XW6 A;  1EWX A;  3EMX A;  3Q18 A;  2VD0 A;  5ECN B;  2H66 A;  5ID2 B;  3F3Q A;  2WS2 A;  4OO5 A;  1Z6N A;  6GSY A;  3HY2 A;  5IO0 A;  1M0U A;  1ZOF A;  1M9B A;  2DMM A;  3OR5 A;  5LD0 A;  3NIV A;  1GUL A;  1QK8 A;  4Q5F A;  3TKP A;  1FW1 A;  18GS A;  4O92 A;  4AJ8 A;  1GSQ A;  1SK2 A;  3GA4 A;  4TR0 A;  4BVY A;  1X5E A;  5DAK A;  4JBB A;  3HZ8 A;  2VCX A;  2H1A A;  3FYG A;  4F2I A;  3EE2 A;  5E4W A;  1NM3 A;  2LEG A;  1SK1 A;  4MP4 A;  2H19 A;  1FOV A;  4HZ2 A;  1T4Z A;  3QAW A;  3PR8 A;  1T1V A;  1K0B A;  1U6T A;  3VWW A;  3TJF A;  2VL2 C;  3TRX A;  3IR4 A;  1SYX A;  1X0R A;  1S3A A;  5CRW A;  3DVX A;  5HQP A;  3GKM A;  3UVH A;  2C3N A;  3RAZ A;  3GH6 A;  3KP8 A;  3F8U A;  1TP9 A;  5ELG A;  4QL9 A;  1PL2 A;  2IL3 A;  5DQS A;  4IJ3 A;  3LWA A;  2XBI A;  4Z7X A;  3MDK A;  1GSD A;  1K3L A;  3DML A;  1F3A A;  3WT2 A;  1TW9 A;  3LYP A;  2HYX A;  2H0I A;  2DBC A;  1NW2 A;  2OBK A;  3L4N A;  4V1A g;  4ZL9 A;  3GKN A;  2R5G A;  4TRX A;  5ECL B;  2YCD A;  4HS1 A;  3KIJ A;  2VL3 A;  16GS A;  1K3Y A;  3FR3 A;  4YQV A;  2H73 A;  2HI7 A;  2AHE A;  4K2D A;  1TRW A;  3ZL5 A;  1UA5 A;  4WET A;  4K7N A;  4KDX A;  3ZIV A;  4XS4 B;  1A24 A;  1Y6E A;  3DWV A;  5IIZ A;  3APQ A;  1J9B A;  1VF4 A;  2JZS A;  2DJ1 A;  2HZF A;  2WUL A;  3BCK A;  3VWX A;  4WXT A;  1GLP A;  4ZB9 A;  5JWR B;  3GTU B;  3UOM A;  5DDL A;  1HNA A;  3BBY A;  1MDI A;  5IMC A;  1BG5 A;  4POB A;  5D9X A;  3TDG A;  2HT9 A;  2LRT A;  2REM A;  3KMO A;  1ERW A;  5HR3 A;  2FWH A;  2NDO A;  1ZL9 A;  3EYT A;  4OMV A;  2FLS A;  2F8F A;  2OKA A;  3D4M A;  1K0A A;  4MLY A;  3GHA A;  5E59 A;  1YY7 A;  1GTU A;  2V2G A;  1AC1 A;  4L5L A;  2O85 A;  4LMW A;  2IFQ B;  4OCE A;  1AQW A;  3HVS A;  4OCF A;  2FD3 A;  2GSQ A;  1GTB A;  2VCQ A;  4XRA A;  2VCT A;  1LJR A;  3QD9 A;  1FAA A;  3MSZ A;  5HFG A;  2TRC P;  5DBQ A;  2C0F A;  2H01 A;  4GCI A;  3EMP A;  1YF1 A;  4RQX A;  4EKZ A;  2E7P A;  3D0Z A;  3GUR A;  5AN1 A;  5H5S A;  1HNC A;  2QC7 A;  1SL0 B;  3QR6 A;  2AJQ B;  1RK4 A;  4Q5N A;  4HDE A;  3FRC A;  2P0G A;  1ON4 A;  4X1U A;  4KDY A;  3HJP A;  1FHE A;  5KN0 A;  1U3A A;  4HZ4 A;  2YZU A;  4ECI A;  1NHY A;  4HU7 A;  3HKR A;  3WT1 A;  4K7I A;  4IN0 A;  3TKS A;  3C8E A;  4DVC A;  4J57 E;  2C8U A;  4ML1 A;  4EF0 A;  3LQ7 A;  1TK8 B;  4XTS A;  5JCW A;  4NHW A;  2VUP A;  2I4A A;  4BL7 A;  3Q19 A;  3ZVJ A;  3FY7 A;  3TCO A;  3VWU A;  1FG4 A;  3IOS A;  2MBT A;  5J3R A;  1XIY A;  2EIO A;  2MBS A;  2FGX A;  1LBK A;  2LQO A;  5ECI B;  4AJ6 A;  1DE1 A;  5A4V A;  1JLV A;  4CDO A;  3IAS 2;  5ECM B;  2F9S A;  6GST A;  1V2A A;  4NV2 A;  4MH3 A;  2L5L A;  5CRH A;  2C3Q A;  1EGO A;  1R4W A;  2VOC A;  3GN3 A;  1K0C A;  1HD2 A;  2TRX A;  3LXT A;  5G1K A;  1H4O A;  2C1Y A;  5ECQ B;  1Z6M A;  5HR1 A;  5D96 A;  3IK7 A;  2DJK A;  4KW6 A;  3H8Q A;  1GUM A;  11GS A;  5D9T A;  4POK A;  1OYJ A;  5CRE A;  2NVL A;  2BTO T;  3L9U A;  4KE3 A;  1EP8 A;  1ZZY A;  4ZB6 A;  5F06 A;  3E9J B;  3WD6 A;  3UIW A;  4GTU A;  3DEX A;  3KGK A;  5DCH A;  2J9H A;  2MMZ A;  1WOU A;  3TKQ A;  1O81 A;  1TTZ A;  19GS A;  2IJY A;  2LNS A;  3KEB A;  5F05 A;  1TI1 A;  2MMN A;  3M1G A;  1XW5 A;  2YJH A;  4GQF A;  3KD0 A;  1USB A;  4WR4 A;  5AIS A;  3GFK A;  2GQK A;  2PVQ A;  1DE2 A;  2MYG A;  5DAL A;  4ZBA A;  4WF4 A;  4OWY A;  4WBR D;  1A8L A;  2FCH A;  1THX A;  1J0F A;  5DCG A;  14GS A;  4WKW A;  2H1B A;  1WE0 A;  4NHZ A;  3C7M A;  5G1L A;  2B1K A;  2FWG A;  2C4J A;  1SD8 A;  2GZY A;  3CSI A;  3TKS E;  2M80 A;  2DIY A;  4KSO A;  1S3D A;  3VPQ A;  5HR0 A;  2H74 A;  3P8W A;  3TUE A;  1ZCP A;  3FR9 A;  4O5R A;  4YAV A;  1K0O A;  5J9C A;  2FA4 A;  2O89 A;  3E3E A;  2H30 A;  2H1G A;  3R2Q A;  4I6X A;  4JR4 A;  4EO3 A;  4HUA A;  3ZLP A;  3ZFL A;  1RQM A;  5EY6 A;  2I1U A;  1PGT A;  3WYW A;  5L71 A;  3J7Y k;  3VI5 A;  4TR1 B;  3DIE A;  4L0W A;  4YAP A;  3ZFB A;  3F3R A;  3GX8 A;  8GSS A;  3F6F A;  2G2Q A;  2HNL A;  4GST A;  2CT6 A;  4TVE A;  1HYU A;  2YN1 A;  4OFN A;  1AQV A;  2YZH A;  1T00 A;  4AJ7 A;  2HZE A;  1F3B A;  3D22 A;  3TJG A;  4LL4 B;  4DSS A;  1Q98 A;  1X9M B;  4DEJ A;  1TRV A;  2CZ3 A;  4ZIL A;  3QCP A;  3FW2 A;  4ECC A;  1EEJ A;  4NV5 A;  1OKT A;  2DSA A;  3CRU A;  1M9A A;  2B5X A;  1TK0 B;  4LA1 A;  1OC8 A;  4ZXG A;  4WF5 A;  2D2Z A;  2HZE B;  5GAN D;  3ERG A;  3PIN A;  3W8S A;  4I8B A;  2VM2 A;  3UEM A;  3D21 A;  2K6V A;  3ZRE A;  5F8B A;  4HOJ A;  1AW9 A;  5B7C A;  1WIK A;  1OC9 B;  4GWR A;  5JWO B;  4K0N A;  1XW9 A;  1U88 A;  4IEL A;  1PRX A;  1ERV A;  5IOW A;  2LTK A;  4QQ7 A;  4FH8 A;  4LMV A;  3C1R A;  1EOG A;  4LLR A;  2AAW A;  1RW1 A;  4XS4 A;  1YEX A;  4L0U A;  1LU4 A;  1QUW A;  1XZO A;  1O73 A;  2E0Q A;  4OFT A;  2WFC A;  4HJ2 A;  3APS A;  2ZCT A;  2RUF A;  3QDN A;  2I3Y A;  4YQU A;  2VM1 A;  3LXZ A;  3UL3 A;  3GL3 A;  1FVK A;  5HR2 A;  3P7X A;  3DGQ A;  1EV9 A;  3VUR A;  1SK0 A;  4YQM A;  2VCZ A;  1G0T A;  4TKY A;  2RM5 A;  1T4Y A;  5A4U A;  5C04 A;  1UN2 A;  4N30 A;  3A3T A;  2V32 A;  2JSZ A;  4JRR A;  3G9B A;  1B4P A;  4BWS A;  4G9H A;  3QMX A;  4EUY A;  2KLX A;  6GSW A;  2H70 A;  4ECB A;  3EWL A;  4TN8 A;  3I6A A;  1GNE A;  1PA3 A;  1TK5 B;  2L6C A;  2I9H A;  4JR6 A;  3ZTL A;  1SYR A;  2R3X A;  2YJ7 A;  1XVW A;  1G7O A;  3APO A;  3L9S A;  3IXR A;  3L0H A;  5J9B A;  2N5B A;  1M2D A;  4E8E A;  2O87 A;  4JED A;  2V41 A;  5KN2 A;  4HI7 A;  4OD7 A;  3FEU A;  3GV1 A;  4N0Z A;  4KSM A;  5GST A;  1PD2 1;  3UVT A;  3U5R E;  2K8V A;  1MD4 A;  4Q5R A;  1B9Y C;  3UBL A;  4WEY A;  2L4C A;  22GS A;  3FKF A;  3N9J A;  2FWF A;  5HFI A;  5J5N A;  1VRS D;  5KN3 A;  2GTU A;  3FZA A;  2KP1 A;  1GRX A;  1F6M C;  1GTA A;  4DSQ A;  2YAN A;  3UAP A;  2E2M A;  3KH7 A;  2CVB A;  1KNG A;  3ZIT A;  4HU9 A;  2VD1 A;  2OAC A;  1O7U A;  1M99 A;  5ID2 A;  1K0M A;  3RPP A;  3M9K A;  1GH2 A;  4PNF A;  4N10 A;  5G5F A;  5EPF A;  4L5O A;  4TW5 A;  2B1L A;  1SL2 B;  1ERT A;  2NBS A;  2YV9 A;  4MZC A;  2PWJ A;  4I5Q A;  1A0R P;  3O76 A;  5DJM A;  2CX3 A;  1W4V A;  3ISO A;  3I69 A;  2IMF A;  1N2A A;  4KND A;  3G7J A;  6GSV A;  1NSW A;  1R5P A;  4FO5 A;  1V40 A;  2A4V A;  2PUK C;  2OAD A;  4RQR A;  1A2J A;  4PQ1 A;  3W8J A;  1CQH A;  1YKA A;  3Q74 A;  1S3C A;  3NZN A;  2L57 A;  4N11 A;  1PN9 A;  4V1A p;  1T8E B;  2B5Y A;  2GZZ A;  4ZB8 A;  2CQ9 A;  2X8C A;  2V6O A;  5IMA A;  4Q5Q A;  4GQC A;  4IJI A;  5EL8 A;  3A2W A;  3LJR A;  3TOT A;  1GP1 A;  2X8H A;  1H75 A;  2DJ3 A;  2H6Y A;  4IQA A;  4KCE A;  1XVQ A;  4DSR A;  1XPV A;  1Z3E A;  1IYI A;  4XHM A;  5JCG A;  3GH9 A;  2IMI A;  4IVF A;  3DRN A;  3KCM A;  3MAK A;  3M9J A;  5D8I A;  1YQ1 A;  1B48 A;  3HYP A;  5ENU A;  2MMA A;  2H6X A;  3M3M A;  1ABA A;  2NTO A;  4I2U A;  1GWC A;  3S9F A;  1XWC A;  4PGT A;  3PGT A;  5FWG A;  4KB3 A;  3G7Y A;  4POM A;  4MK3 A;  5CAX A;  1MDJ A;  5G31 A;  1X9W B;  3HHV A;  2GS3 A;  3SWL A;  2GQL A;  1THO A;  3IV4 A;  2IN3 A;  4K0G A;  3HCZ A;  4GXZ A;  1BQ7 A;  2H72 A;  1GSY A;  4PUA A;  1V57 A;  4BA7 A;  3MWH A;  4BPY A;  2C0D A;  1QGV A;  3EIN A;  1X9S B;  1PL1 A;  2RM6 A;  3LG6 A;  3CSH A;  4RI6 A;  2RLI A;  5IMD A;  5KN1 A;  4PQH A;  3BOA A;  2PMT A;  2R2J A;  3IK9 A;  4J2F A;  1CQG A;  4F82 A;  2JZT A;  4F03 A;  3AY8 A;  2H8L A;  1IYH A;  2BJX A;  2I81 A;  2LKU A;  2OJL A;  5ECH B;  1M7T A;  4IBP A;  3WGD A;  2JAD A;  2XBQ A;  3ZYW A;  3H79 A;  3HA9 A;  1U87 A;  3N5O A;  3L9V A;  1XBS A;  4KDU A;  1B8X A;  2YWN A;  2PPT A;  4TR3 A;  1ILO A;  2AUV A;  3G7I A;  4N0V A;  3I9V 2;  4ZL8 A;  5D93 A;  5ECP B;  2X99 A;  1V58 A;  3LSZ A;  3QPM A;  1AQX A;  1OE7 A;  1TI3 A;  3GX0 A;  4LL1 B;  2RUE A;  4ECJ A;  3H1N A;  1TDI A;  1SKW B;  2WCI A;  1YDK A;  1O8W A;  2VIM A;  4L8E A;  4JE1 A;  2B7J A;  3HDC A;  1R26 A;  2YV7 A;  3H93 A;  2M46 A;  2OE1 A;  3A2V A;  4EL1 A;  6GSS A;  4KAE A;  5B8A A;  3US3 A;  1TKD B;  1AUC A;  3IC4 A;  4FYC A;  1JZR A;  9GSS A;  3HVV A;  4XRD A;  1Z5Y E;  4IHU A;  1TRS A;  1YF0 A;  1Z7R A;  3KXO A;  5DVB A;  2HRF A;  3D5J A;  3LOR A;  1XFL A;  2GSR A;  4IKH A;  1I9D A;  1WPI A;  5CNW A;  3BCI A;  5LNK e;  1X5C A;  4POL A;  2FNO A;  3EVI A;  4MF6 A;  3KP9 A;  1SL1 B;  2VCV A;  5KEJ A;  2PER A;  1BAY A;  2GST A;  3LGC A;  1XWG A;  3GTU A;  3LEF A;  1XOA A;  2JL4 A;  3UAR A;  4ZBB A;  1ST9 A;  2A2S A;  5DAK B;  2IWT A;  2O8V B;  2WDU A;  2R4V A;  1V98 A;  4TXO A;  4G10 A;  1DUG A;  1E2Y A;  2P5Q A;  2PBJ A;  2IMD A;  3F4S A;  4F0C A;  4ISD A;  5CRG A;  5DQY A;  4EE0 A;  1KEB A;  1JZW A;  3RPN A;  2OE3 A;  1MD3 A;  3C71 A;  1OKD A;  4EDY A;  3HZ4 A;  2OBI A;  4I97 A;  4PUR A;  3ZMK A;  2AYT A;  1OVN A;  4BWQ A;  2R37 A;  2R6K A;  1MDK A;  3CTG A;  1PSQ A;  1GUH A;  2OA7 A;  2P5R A;  1A2L A;  4IQ1 A;  2JSY A;  3IRA A;  4MJC A;  5HFK A;  4HQZ A;  2CA8 A;  5DJL A;  5F0G A;  4PXO A;  2LQQ A;  1A23 A;  3UJ1 A;  2HXK A;  3E0U A;  4NAX A;  1TU7 A;  2LRC A;  5H5Q A;  2FUG 2;  1YKC A;  4AF2 A;  6GSX A;  2PN8 A;  1FB0 A;  1VF1 A;  3M8N A;  5F07 A;  3TJJ A;  1OC9 A;  2JZR A;  1JLW A;  3CMI A;  3HD5 A;  2CAI A;  2GGT A;  3KTB A;  3QFB C;  3P2A A;  2WZ9 A;  3Q6O A;  4WBJ A;  1ML6 A;  1GL8 A;  4ML6 A;  3IHQ A;  4MF7 A;  4GLT A;  2DC5 A;  4IP1 A;  1FO5 A;  3M0F A;  3SBC A;  3UBK A;  2DJJ A;  1ERU A;  3KTL A;  3D4T A;  3C73 A;  2XPD A;  2B5E A;  2HE3 A;  2H6Z A;  2C0G A;  3F0I A;  3CXG A;  1JZD A;  4DSS B;  1ZMA A;  1K3O A;  3F6D A;  12GS A;  1GUK A;  1T3B A;  2EIR A;  2H0H A;  5IQY A;  3DKS A;  2VLT A;  3V1W A;  1GSF A;  2GT6 A;  5IPG A;  4FYB A;  1ZGN A;  3DD3 A;  1UC7 A;  5ELA A;  1SJI A;  2G0F A;  3BJ5 A;  4TR4 A;  5ECO B;  1WWJ A;  3CRT A;  3GKK A;  3CBU A;  3GIX A;  4JZQ A;  5B6M A;  2IIY A;  2DIZ A;  4NMU A;  4IW9 A;  4MJE A;  1TU8 A;  2GVP A;  2GSS A;  3ZRD A;  1XXU A;  3IDV A;  7GSS A;  2YWO A;  1T7P B;  3F4R A;  6GSU A;  4MAB A;  1EEM A;  4V2M A;  3FK8 A;  3ERW A;  5CO3 A;  4EVM A;  2KOK A;  3ZML A;  2A2R A;  2VL9 A;  3TKS C;  4KH7 A;  4TOP A;  2QSI A;  2YNX A;  2RII A;  2F51 A;  4K6X A;  4K1F A;  1R5A A;  3O3T A;  2H1D A;  4EXJ A;  3A2X A;  4IS0 A;  2DML A;  4TXV A;  3TRP A;  2XC2 A;  3ED3 A;  1U3I A;  4ZBD A;  1XCC A;  4V2N A;  3ZVJ D;  1QMV A;  2VLV A;  4KCA A;  2VAF A;  1QFN A;  2ALB A;  3TJK A;  4F0B A;  1EZK A;  3F4T A;  3GKX A;  1QXH A;  4GF0 A;  1GNW A;  2X8G A;  1QQ2 A;  5INY A;  4RUV A;  1XOB A;  2Z9S A;  4XIH A;  2ON7 A;  1R7H A;  1W89 A;  1SU9 A;  4E8H A;  3LYK A;  4QL7 A;  2L4Q A;  4F9Z A;  2DJ2 A;  2XPE A;  3P90 A;  3IPZ A; 
#chains in the Genus database with same CATH topology
 1PQN A;  1I0A A;  3CQF A;  3J7Y b;  1J3U A;  5IOX A;  1Q5N A;  1U0L A;  1PX6 A;  5D9W A;  1GSE A;  2I7D A;  3L78 A;  2HFD A;  5IPH A;  5FHI A;  1JZO A;  4HQS A;  2TIR A;  4KA0 A;  3GNJ A;  2HRN A;  1ZYN A;  5D73 A;  2PTR A;  4MF5 A;  2IFQ A;  3CSJ A;  1UVZ A;  1XWK A;  3O6T A;  3GMF A;  3TJB A;  4MJB A;  4KGI A;  4ZL7 A;  1SJZ A;  4HEA 2;  1BJX A;  2VLU A;  3D6I A;  4GSS A;  4ILF A;  2B6M A;  3VPT A;  5AIV A;  3IBH A;  4MH2 A;  4OO4 A;  3R3E A;  3VI7 A;  1JHB A;  4HGV A;  4FIW A;  3HJO A;  5GAP D;  2LJK A;  3KZQ A;  2JAR A;  5AGY A;  1A8Y A;  2GZP A;  2MMO A;  5CP1 A;  2F3M A;  3QAV A;  3FZ5 A;  4D73 A;  2VL2 A;  1AIU A;  3GSS A;  4IGJ A;  4XS1 A;  3KJY A;  2H0G A;  2K18 A;  1Z9H A;  1YEP A;  1TRU A;  5JCU A;  3HVN A;  3VLN A;  13GS A;  2K8S A;  1XWA A;  5B8B A;  2WB9 A;  3BD2 A;  5ECS A;  3GUS A;  3QOU A;  2PGT A;  2HSY A;  4GRF A;  5C00 A;  1TJV A;  1PMT A;  1SEN A;  4HJM A;  3ME8 A;  1EP7 A;  2LJA A;  3EUR A;  5A4W A;  5IMV A;  4MZB A;  3VK9 A;  1KTE A;  1TJD A;  1KBN A;  2GQM A;  1PX7 A;  1TXX A;  4L6C A;  2D28 C;  4MCU A;  1BX9 A;  1PKW A;  2LS5 A;  2H75 A;  2IPA A;  4EDZ A;  5IMF A;  1SJ6 A;  1BYE A;  2FY6 A;  4EFC A;  2H76 A;  2YPM A;  3ERF A;  1XWB A;  2LRN A;  2JAC A;  2CVK A;  2B7K A;  1E6B A;  1GSS A;  2ZUP A;  2C3T A;  3TRQ A;  1Y25 A;  2RCN A;  2PFM A;  3PH9 A;  1I5G A;  4KUN A;  5J4U A;  2R0C A;  2FA8 A;  4O32 A;  1X5D A;  3ME7 A;  4TXO B;  4ICY A;  4APB A;  3H4K A;  3C1S A;  4PX1 A;  1GLQ A;  1EOH A;  5IM9 A;  2K9F A;  1G6W A;  1Q4J A;  2N5F A;  3TOU A;  10GS A;  2OE0 A;  4BVX A;  2LJR A;  2IMK A;  2KP2 A;  3RHC A;  2L5O A;  2X75 A;  1MH9 A;  3RHB A;  4MZW A;  1WJK A;  5A5K A;  4JU5 A;  4RI7 A;  1K0N A;  1WRY A;  2QGV A;  4PUF C;  3TGZ A;  1AXD A;  2L6D A;  1WP0 A;  2X49 A;  3KH9 A;  1URM A;  2YP6 A;  3RBT A;  3HJM A;  1VF3 A;  2CAQ A;  2N5A A;  3FMW A;  2LNT A;  1B4Q A;  3OCE A;  4G0L A;  1FB6 A;  1DCN A;  2IME A;  2EC4 A;  5GSS A;  3HVX A;  2CX4 A;  4CY6 A;  3A5W A;  3W6G A;  4YKF A;  1YZX A;  3CTF A;  2L59 A;  5IO2 A;  4G2E A;  1A2M A;  1FVJ A;  3FZ9 A;  5ECK B;  2J23 A;  3UMA A;  1OE8 A;  1F37 A;  3I43 A;  5H5R A;  2YWM A;  3KMN A;  4AGS A;  1GTI A;  1MEK A;  5GZZ B;  1HNB A;  2PVO C;  1C72 A;  2H71 A;  2HLS A;  2V1M A;  3VFI A;  4MMM A;  4TR1 A;  1MTC A;  3F63 A;  1FOH A;  2O7K A;  4NPB A;  3U6V A;  1SD9 A;  2CVD A;  2C0E A;  3FHK A;  4EC0 A;  4IQJ M;  5AIX A;  3FR6 A;  1O8X A;  2GLR A;  4IP6 A;  1DSB A;  2P31 A;  4MPG A;  4G0K A;  4CW9 A;  5ECR B;  1JFU A;  4MWO A;  3RD8 A;  1DBY A;  4XS6 A;  2AV4 A;  2X64 A;  3R6Q A;  2MZC A;  5CYY A;  3IA1 A;  4MDC A;  2EIQ A;  2HSH A;  5ABR A;  5D6B A;  5BRT A;  4MJA A;  5B6N A;  2F8A A;  1OAZ A;  4D73 B;  3TKR A;  1G6Y A;  4J56 E;  1AAZ A;  4K9Z A;  5G5E A;  2CV4 A;  2KHP A;  4X43 A;  3K8N A;  3GST A;  4ULX A;  1PKZ A;  1GSU A;  3NOF A;  17GS A;  3IE3 A;  1EGR A;  1C3C A;  4ACS A;  3WGE A;  5DAL B;  1B9X C;  2YOI A;  2WJU A;  2C80 A;  4CHS A;  1TJ7 A;  3QFA C;  4V2L A;  4P3Y B;  4MPF A;  1J08 A;  3WGX A;  1JSW A;  2FHE A;  2V6K A;  1YJ6 A;  4K7O A;  1ACV A;  3FZ4 A;  3JCM L;  1Z4K A;  5COH A;  4PNG A;  5IMZ A;  5D9V A;  2JAO A;  3DXB A;  4PQI A;  1Z4P X;  1VF2 A;  4MA9 A;  4H86 A;  2B3S A;  3VWV A;  5KOX A;  3GYK A;  3ZZX A;  1SKR B;  5LCZ A;  3HXS A;  1OC3 A;  3QAG A;  4OFM A;  4X0X A;  4GSN A;  4ZIJ A;  2LV3 A;  2KUC A;  1EV4 A;  4XCS A;  1M2B A;  2VO4 A;  1O85 A;  2WGR A;  2NPB A;  2PU9 C;  3EU3 A;  2BMX A;  1VGL A;  2XHF A;  5J41 A;  3GL5 A;  3DVW A;  3TB2 A;  3ZIJ A;  2ES7 A;  3IAM 2;  4I2T A;  1V9W A;  1ZYQ B;  5G2Z A;  4O7H A;  2CZ2 A;  2DLX A;  4BIK A;  2GT5 A;  2WRT A;  2ZNM A;  1BED A;  2GDR A;  2JU5 A;  5JWQ B;  3LFL A;  2DJ0 A;  3MNG A;  1SKS B;  3GRX A;  5FT3 A;  2M72 A;  2YWI A;  3CYN A;  3EU4 A;  1TOF A;  20GS A;  2AB6 A;  1F2E A;  4NXI A;  5CRD A;  4G19 A;  4NWY A;  4YH2 A;  2LUS A;  1HQO A;  4ID0 A;  1G7E A;  1FUR A;  5EVO A;  4WR5 A;  1A0F A;  1O6J A;  5G30 A;  2FWE A;  2VCW A;  3F9U A;  2LST A;  4FYU A;  3RDW A;  1M2A A;  2PTS A;  4KX4 A;  1K0D A;  1FUP A;  1N8J A;  1Z7P A;  3DYR A;  4K8M A;  1NHO A;  1F9M A;  3GTD A;  3KM6 A;  3EC3 A;  2ON5 A;  2R0G A;  2QKE A;  1WMJ A;  2E2G A;  1ZYE A;  1XW6 A;  1EWX A;  3EMX A;  3Q18 A;  2VD0 A;  5ECN B;  2H66 A;  5ID2 B;  3F3Q A;  2WS2 A;  4OO5 A;  1Z6N A;  6GSY A;  3HY2 A;  5IO0 A;  1M0U A;  1ZOF A;  1M9B A;  2DMM A;  3OR5 A;  5LD0 A;  3NIV A;  1GUL A;  1QK8 A;  4Q5F A;  3TKP A;  1FW1 A;  18GS A;  4O92 A;  4AJ8 A;  1GSQ A;  1SK2 A;  3GA4 A;  4TR0 A;  4BVY A;  1M3I A;  1X5E A;  5DAK A;  4JBB A;  3HZ8 A;  2VCX A;  1Z4I A;  2H1A A;  4NSL A;  3FYG A;  4F2I A;  3EE2 A;  5E4W A;  1NM3 A;  2LEG A;  1SK1 A;  4MP4 A;  2H19 A;  1FOV A;  4HZ2 A;  1T4Z A;  3QAW A;  4YIH A;  3PR8 A;  1T1V A;  2FUS A;  1K0B A;  1U6T A;  3VWW A;  3TJF A;  2VL2 C;  3TRX A;  3IR4 A;  1SYX A;  1X0R A;  1S3A A;  5CRW A;  3DVX A;  5HQP A;  1ZYP A;  3GKM A;  2JAW A;  3UVH A;  2C3N A;  3RAZ A;  3GH6 A;  3KP8 A;  3F8U A;  1TP9 A;  5ELG A;  4QL9 A;  1PL2 A;  2IL3 A;  5DQS A;  4EIP A;  4IJ3 A;  3LWA A;  2XBI A;  4Z7X A;  4Z2U A;  3MDK A;  1GSD A;  1K3L A;  3DML A;  1F3A A;  3WT2 A;  1TW9 A;  3LYP A;  2HYX A;  2H0I A;  2DBC A;  1NW2 A;  2OBK A;  3L4N A;  4V1A g;  4ZL9 A;  3GKN A;  2R5G A;  4TRX A;  5ECL B;  2YCD A;  4HS1 A;  2A4H A;  3KIJ A;  2VL3 A;  16GS A;  1K3Y A;  3FR3 A;  4YQV A;  2H73 A;  2HI7 A;  1Z4J A;  2AHE A;  4K2D A;  1TRW A;  3ZL5 A;  1UA5 A;  4E88 A;  4WET A;  4K7N A;  4KDX A;  3ZIV A;  4XS4 B;  1A24 A;  1Y6E A;  3DWV A;  5IIZ A;  3APQ A;  1J9B A;  1VF4 A;  2JZS A;  4L6A A;  2DJ1 A;  2HZF A;  2WUL A;  3BCK A;  3VWX A;  4WXT A;  1GLP A;  4ZB9 A;  5JWR B;  3GTU B;  3UOM A;  5DDL A;  1HNA A;  3BBY A;  1MDI A;  3GZH A;  5IMC A;  1BG5 A;  4POB A;  5D9X A;  2DKH A;  3TDG A;  2HT9 A;  4YKG A;  2LRT A;  4Z2R A;  2REM A;  3KMO A;  1ERW A;  5HR3 A;  2FWH A;  2NDO A;  5KOW A;  1ZL9 A;  3EYT A;  4OMV A;  2FLS A;  3BWV A;  2F8F A;  2OKA A;  3D4M A;  1K0A A;  4MLY A;  3PPU A;  3GHA A;  5E59 A;  1YY7 A;  1GTU A;  2V2G A;  1AC1 A;  4L5L A;  2O85 A;  4LMW A;  2IFQ B;  4OCE A;  1AQW A;  3HVS A;  4OCF A;  2FD3 A;  2D27 A;  2GSQ A;  1GTB A;  2VCQ A;  4XRA A;  2VCT A;  1LJR A;  3QD9 A;  1FAA A;  3MSZ A;  1S3R A;  5HFG A;  2TRC P;  4NFL A;  5DBQ A;  2C0F A;  2H01 A;  4GCI A;  1M3J A;  3EMP A;  1YF1 A;  4RQX A;  4EKZ A;  2E7P A;  3D0Z A;  3GUR A;  5AN1 A;  5H5S A;  1HNC A;  2QC7 A;  1SL0 B;  3QR6 A;  1Z4Q A;  2AJQ B;  3IHG A;  1RK4 A;  4Q5N A;  4HDE A;  3FRC A;  2P0G A;  1ON4 A;  4X1U A;  4KDY A;  3HJP A;  1FHE A;  5KN0 A;  1K62 A;  1U3A A;  4HZ4 A;  2YZU A;  4ECI A;  1NHY A;  4HU7 A;  3HKR A;  3WT1 A;  4K7I A;  4IN0 A;  3TKS A;  3C8E A;  1PN0 A;  4DVC A;  4J57 E;  2C8U A;  4ML1 A;  4EF0 A;  3LQ7 A;  1TK8 B;  4XTS A;  5JCW A;  4NHW A;  2VUP A;  1VDK A;  2I4A A;  4BL7 A;  3Q19 A;  2JAU A;  1XG8 A;  3ZVJ A;  1TJW A;  1IW7 D;  3FY7 A;  3TCO A;  3VWU A;  1FG4 A;  3IOS A;  5F92 A;  2MBT A;  5J3R A;  1XIY A;  2EIO A;  2MBS A;  2FGX A;  1LBK A;  2LQO A;  5ECI B;  4AJ6 A;  1DE1 A;  5A4V A;  1JLV A;  4CDO A;  3U13 A;  3IAS 2;  5ECM B;  2F9S A;  6GST A;  1V2A A;  4NV2 A;  4MH3 A;  2L5L A;  5CRH A;  2C3Q A;  1EGO A;  1R4W A;  2VOC A;  3TV2 A;  3NO9 A;  3GN3 A;  4EEI A;  1K0C A;  1HD2 A;  2TRX A;  3LXT A;  5G1K A;  1H4O A;  2C1Y A;  5ECQ B;  1Z6M A;  5HR1 A;  5D96 A;  3IK7 A;  2DJK A;  4KW6 A;  3H8Q A;  1GUM A;  1Q92 A;  11GS A;  5D9T A;  4POK A;  1OYJ A;  5CRE A;  2NVL A;  2BTO T;  3L9U A;  4KE3 A;  1EP8 A;  1ZZY A;  4ZB6 A;  5F06 A;  3E9J B;  3WD6 A;  3UIW A;  4GTU A;  3DEX A;  3KGK A;  5DCH A;  2J9H A;  2MMZ A;  1WOU A;  3TKQ A;  1O81 A;  1TTZ A;  19GS A;  2IJY A;  2LNS A;  3KEB A;  5F05 A;  1TI1 A;  2MMN A;  3EPT A;  3M1G A;  2HSM A;  1XW5 A;  2YJH A;  4GQF A;  3KD0 A;  1USB A;  4WR4 A;  5AIS A;  3GFK A;  2GQK A;  2PVQ A;  1DE2 A;  2MYG A;  5DAL A;  4ZBA A;  4WF4 A;  1YFM A;  4OWY A;  4WBR D;  1A8L A;  2FCH A;  1THX A;  1J0F A;  5DCG A;  14GS A;  4WKW A;  2H1B A;  1WE0 A;  4O5U A;  4NHZ A;  3C7M A;  5G1L A;  2B1K A;  2FWG A;  4ADM A;  2C4J A;  1SD8 A;  2GZY A;  3CSI A;  3TKS E;  2M80 A;  1U15 A;  2DIY A;  4KSO A;  1S3D A;  3VPQ A;  2PTQ A;  5HR0 A;  2H74 A;  3P8W A;  3TUE A;  1ZCP A;  3MIX A;  3FR9 A;  4O5R A;  4YAV A;  4Z2T A;  1K0O A;  5J9C A;  2FA4 A;  2O89 A;  3E3E A;  2H30 A;  2H1G A;  3R2Q A;  4I6X A;  4JR4 A;  4EO3 A;  4HUA A;  3ZLP A;  3ZFL A;  4KF9 A;  1RQM A;  5EY6 A;  2I1U A;  1PGT A;  4USS A;  3WYW A;  5L71 A;  3J7Y k;  1C3U A;  3VI5 A;  4TR1 B;  3DIE A;  4L0W A;  4X4J A;  4YAP A;  3ZFB A;  3F3R A;  3GX8 A;  8GSS A;  3F6F A;  2G2Q A;  2HNL A;  4GST A;  3R6V A;  2CT6 A;  4TVE A;  1HYU A;  1TJU A;  2YN1 A;  4OFN A;  1AQV A;  2YZH A;  1T00 A;  4AJ7 A;  2HZE A;  1F3B A;  3D22 A;  3TJG A;  3IC8 A;  4LL4 B;  4DSS A;  1Q98 A;  1X9M B;  4DEJ A;  1TRV A;  2CZ3 A;  4ZIL A;  3QCP A;  3FW2 A;  4ECC A;  1EEJ A;  4NV5 A;  4BVY B;  1OKT A;  2DSA A;  3CRU A;  1M9A A;  2B5X A;  1TK0 B;  4LA1 A;  1OC8 A;  4ZXG A;  1RE5 A;  4WF5 A;  2D2Z A;  2HZE B;  5GAN D;  3ERG A;  4EIQ A;  3PIN A;  3W8S A;  4I8B A;  2VM2 A;  3UEM A;  3D21 A;  2K6V A;  3ZRE A;  5F8B A;  4HOJ A;  1AW9 A;  5B7C A;  1WIK A;  4MNN A;  1OC9 B;  4GWR A;  5JWO B;  4K0N A;  1XW9 A;  1U88 A;  4IEL A;  1PRX A;  3C8T A;  1ERV A;  5IOW A;  2LTK A;  4QQ7 A;  4FH8 A;  4LMV A;  3C1R A;  1EOG A;  4LLR A;  2AAW A;  1RW1 A;  4XS4 A;  1YEX A;  4L0U A;  1LU4 A;  5BMU A;  1QUW A;  1XZO A;  1O73 A;  2E0Q A;  1XWO A;  4OFT A;  4A5P A;  2WFC A;  4HJ2 A;  3APS A;  2ZCT A;  2RUF A;  3QDN A;  2I3Y A;  4YQU A;  2VM1 A;  3LXZ A;  3UL3 A;  3GL3 A;  1FVK A;  5HR2 A;  3P7X A;  3DGQ A;  1EV9 A;  3VUR A;  1SK0 A;  4YQM A;  2VCZ A;  1G0T A;  4TKY A;  2RM5 A;  1T4Y A;  5A4U A;  5C04 A;  1UN2 A;  4N30 A;  3A3T A;  2V32 A;  2JSZ A;  4JRR A;  4K5S A;  3G9B A;  1B4P A;  4BWS A;  4G9H A;  3QMX A;  4EUY A;  2KLX A;  6GSW A;  2H70 A;  4ECB A;  3EWL A;  2E9F A;  4TN8 A;  3I6A A;  1GNE A;  1PA3 A;  1TK5 B;  2L6C A;  2I9H A;  4JR6 A;  3ZTL A;  1SYR A;  2R3X A;  2YJ7 A;  1XVW A;  2HRK A;  1G7O A;  3APO A;  3L9S A;  3IXR A;  3L0H A;  5J9B A;  2N5B A;  1M2D A;  4E8E A;  2O87 A;  4JED A;  2V41 A;  5KN2 A;  4HI7 A;  4OD7 A;  3FEU A;  3GV1 A;  4N0Z A;  1FUQ A;  4KSM A;  5GST A;  1PD2 1;  3UVT A;  3U5R E;  2K8V A;  1MD4 A;  3CI0 K;  4Q5R A;  1B9Y C;  3UBL A;  4WEY A;  1KQ7 A;  2L4C A;  22GS A;  3FKF A;  3N9J A;  2FWF A;  5HFI A;  5J5N A;  1VRS D;  5KN3 A;  2GTU A;  3FZA A;  2KP1 A;  1GRX A;  1F6M C;  1GTA A;  4DSQ A;  2YAN A;  3UAP A;  2E2M A;  3KH7 A;  2CVB A;  1KNG A;  3ZIT A;  4HU9 A;  2VD1 A;  2OAC A;  1O7U A;  4K5R A;  1M99 A;  5ID2 A;  1K0M A;  3RPP A;  3M9K A;  1GH2 A;  1Q91 A;  4PNF A;  4N10 A;  5G5F A;  5EPF A;  4L5O A;  4TW5 A;  2B1L A;  1SL2 B;  1ERT A;  2NBS A;  2YV9 A;  4HSC X;  5F91 A;  4MZC A;  2PWJ A;  4CY8 A;  4I5Q A;  1A0R P;  3O76 A;  5DJM A;  2CX3 A;  1W4V A;  3ISO A;  4BL7 B;  3I69 A;  2IMF A;  3A5I A;  1N2A A;  4KND A;  3G7J A;  6GSV A;  1NSW A;  1R5P A;  4FO5 A;  1V40 A;  2A4V A;  2PUK C;  2OAD A;  4RQR A;  1Z4L A;  1A2J A;  4PQ1 A;  3W8J A;  1CQH A;  1YKA A;  3Q74 A;  1S3C A;  3NZN A;  2L57 A;  4N11 A;  1PN9 A;  4V1A p;  1T8E B;  2B5Y A;  2GZZ A;  4ZB8 A;  2CQ9 A;  2X8C A;  2V6O A;  5IMA A;  3RRP A;  4Q5Q A;  4GQC A;  4IJI A;  5EL8 A;  3A2W A;  3LJR A;  3TOT A;  1GP1 A;  2X8H A;  1H75 A;  2DJ3 A;  2H6Y A;  4IQA A;  4KCE A;  1XVQ A;  1DOF A;  4DSR A;  1XPV A;  1Z3E A;  1IYI A;  4XHM A;  5JCG A;  3GH9 A;  2IMI A;  4IVF A;  3DRN A;  3KCM A;  3MAK A;  3M9J A;  5D8I A;  1YQ1 A;  1B48 A;  3HYP A;  5ENU A;  2MMA A;  4G0I A;  2H6X A;  4BVX B;  3M3M A;  1ABA A;  4I2U A;  2NTO A;  1GWC A;  3S9F A;  1XWC A;  4PGT A;  3PGT A;  5FWG A;  4KB3 A;  3G7Y A;  4POM A;  4MK3 A;  5CAX A;  1MDJ A;  5G31 A;  1X9W B;  3HHV A;  2GS3 A;  3SWL A;  2GQL A;  1THO A;  3IV4 A;  2IN3 A;  4K0G A;  3HCZ A;  4GXZ A;  1BQ7 A;  2H72 A;  1GSY A;  4PUA A;  1V57 A;  4BA7 A;  3MWH A;  4BPY A;  2C0D A;  1K7W A;  1QGV A;  3EIN A;  1X9S B;  1PL1 A;  2RM6 A;  3LG6 A;  1YFE A;  3CSH A;  4RI6 A;  2RLI A;  5IMD A;  5KN1 A;  4PQH A;  3BOA A;  2PMT A;  2R2J A;  3IK9 A;  4J2F A;  1CQG A;  4F82 A;  2JZT A;  4F03 A;  3AY8 A;  2H8L A;  4MX2 A;  1IYH A;  2BJX A;  2I81 A;  2LKU A;  2OJL A;  5ECH B;  1M7T A;  4IBP A;  3LW9 A;  3WGD A;  2JAD A;  2XBQ A;  3ZYW A;  3BHG A;  3H79 A;  3HA9 A;  2R0P A;  1U87 A;  3N5O A;  3L9V A;  4APA A;  1XBS A;  4KDU A;  1B8X A;  2YWN A;  2PPT A;  4TR3 A;  1ILO A;  2AUV A;  3G7I A;  4N0V A;  3I9V 2;  5D93 A;  4ZL8 A;  3QBP A;  5ECP B;  2X99 A;  1V58 A;  3LSZ A;  3QPM A;  1AQX A;  1OE7 A;  1TI3 A;  3GX0 A;  4LL1 B;  2RUE A;  4ECJ A;  3H1N A;  1TDI A;  1SKW B;  2WCI A;  1YDK A;  1O8W A;  2VIM A;  4L8E A;  4JE1 A;  2DKI A;  2B7J A;  3HDC A;  1R26 A;  2YV7 A;  3H93 A;  2A2P A;  2M46 A;  3MYD A;  2OE1 A;  3A2V A;  4EL1 A;  1FUO A;  6GSS A;  4KAE A;  5B8A A;  3US3 A;  1TKD B;  1AUC A;  3IC4 A;  4FYC A;  1JZR A;  3E04 A;  3HVV A;  9GSS A;  4XRD A;  1Z5Y E;  4IHU A;  1AUW A;  3U19 A;  1TRS A;  1YF0 A;  1Z7R A;  3KXO A;  5DVB A;  2HRF A;  1HY0 A;  3D5J A;  3LOR A;  1XFL A;  2GSR A;  4IKH A;  1I9D A;  1WPI A;  5CNW A;  3BCI A;  5LNK e;  1X5C A;  3OCF A;  4POL A;  2FNO A;  3EVI A;  2UZ8 A;  4YIK A;  4MF6 A;  3KP9 A;  1SL1 B;  2VCV A;  5KEJ A;  2PER A;  1BAY A;  2GST A;  3LGC A;  1XWG A;  3GTU A;  3LEF A;  1XOA A;  2JL4 A;  3UAR A;  4K2X A;  4ZBB A;  4ADL A;  1ST9 A;  2A2S A;  5DAK B;  2IWT A;  2O8V B;  2WDU A;  2R4V A;  1V98 A;  4TXO A;  4G10 A;  1DUG A;  1E2Y A;  2P5Q A;  2PBJ A;  2IMD A;  3F4S A;  4F0C A;  4ISD A;  5CRG A;  5DQY A;  4EE0 A;  1KEB A;  1JZW A;  3RPN A;  2OE3 A;  1MD3 A;  3C71 A;  1OKD A;  4EDY A;  3HZ4 A;  2OBI A;  4I97 A;  4PUR A;  3ZMK A;  2AYT A;  1OVN A;  4BWQ A;  2R37 A;  4NLE A;  2R6K A;  1MDK A;  3CTG A;  1PSQ A;  1GUH A;  2OA7 A;  2P5R A;  1A2L A;  4IQ1 A;  2JSY A;  3IRA A;  4MJC A;  5HFK A;  4HQZ A;  2CA8 A;  5DJL A;  5F0G A;  1PFO A;  4PXO A;  4MUM A;  2LQQ A;  1A23 A;  4O5Q A;  3UJ1 A;  2HXK A;  3E0U A;  4NAX A;  1TU7 A;  2LRC A;  5H5Q A;  2FUG 2;  1YKC A;  4AF2 A;  6GSX A;  2PN8 A;  1FB0 A;  1VF1 A;  3M8N A;  5F07 A;  2X4A A;  3TJJ A;  1OC9 A;  2JZR A;  1JLW A;  3CMI A;  3HD5 A;  2CAI A;  2GGT A;  3KTB A;  3QFB C;  3P2A A;  2WZ9 A;  3Q6O A;  4WBJ A;  1ML6 A;  1GL8 A;  4ML6 A;  3IHQ A;  4MF7 A;  4GLT A;  2DC5 A;  4IP1 A;  1FO5 A;  3M0F A;  2QA2 A;  3SBC A;  3UBK A;  2DJJ A;  1ERU A;  4PTS A;  3KTL A;  3D4T A;  3C73 A;  2XPD A;  2B5E A;  2HE3 A;  2H6Z A;  2C0G A;  3F0I A;  3CXG A;  1JZD A;  4DSS B;  1ZMA A;  1K3O A;  3F6D A;  12GS A;  1GUK A;  1T3B A;  2EIR A;  2H0H A;  5IQY A;  3DKS A;  2VLT A;  3V1W A;  1GSF A;  2GT6 A;  5IPG A;  4FYB A;  1ZGN A;  3DD3 A;  1UC7 A;  5ELA A;  1SJI A;  2G0F A;  3BJ5 A;  4TR4 A;  5ECO B;  1WWJ A;  3CRT A;  3GKK A;  3CBU A;  3GIX A;  4JZQ A;  5B6M A;  2IIY A;  2DIZ A;  4NMU A;  4IW9 A;  4MJE A;  1TU8 A;  2GVP A;  2GSS A;  2HVG A;  3ZRD A;  1XXU A;  3IDV A;  7GSS A;  2YWO A;  4L57 A;  1T7P B;  3F4R A;  6GSU A;  4MAB A;  1EEM A;  2YV5 A;  4V2M A;  3FK8 A;  3ERW A;  5CO3 A;  2HRA A;  4EVM A;  2KOK A;  3ZML A;  2A2R A;  2VL9 A;  3TKS C;  4KH7 A;  4TOP A;  2QSI A;  2YNX A;  2RII A;  2F51 A;  4K6X A;  4K1F A;  1Z4M A;  1R5A A;  3O3T A;  2H1D A;  4EXJ A;  3A2X A;  4IS0 A;  2DML A;  4TXV A;  3TRP A;  2XC2 A;  1HY1 A;  1U3I A;  3ED3 A;  4ZBD A;  1XCC A;  4V2N A;  3ZVJ D;  1QMV A;  2VLV A;  4KCA A;  2VAF A;  1QFN A;  2QA1 A;  2ALB A;  3TJK A;  4F0B A;  1EZK A;  3F4T A;  3GKX A;  1QXH A;  4GF0 A;  1T9H A;  1GNW A;  2X8G A;  1U16 A;  1QQ2 A;  2QGA B;  5INY A;  4RUV A;  1XOB A;  2Z9S A;  4XIH A;  2ON7 A;  1R7H A;  1W89 A;  4FQU A;  1SU9 A;  4E8H A;  3LYK A;  4QL7 A;  2L4Q A;  4F9Z A;  5HW2 A;  2DJ2 A;  2XPE A;  3P90 A;  3IPZ A; 
#chains in the Genus database with same CATH homology
 1PQN A;  3J7Y b;  5IOX A;  1PX6 A;  5D9W A;  1GSE A;  3L78 A;  2HFD A;  5IPH A;  5FHI A;  1JZO A;  4HQS A;  2TIR A;  4KA0 A;  3GNJ A;  2HRN A;  1ZYN A;  5D73 A;  4MF5 A;  2IFQ A;  3CSJ A;  1UVZ A;  1XWK A;  3O6T A;  3GMF A;  3TJB A;  4MJB A;  4KGI A;  4ZL7 A;  1SJZ A;  4HEA 2;  1BJX A;  2VLU A;  3D6I A;  4GSS A;  4ILF A;  2B6M A;  3VPT A;  5AIV A;  3IBH A;  4MH2 A;  4OO4 A;  3R3E A;  3VI7 A;  1JHB A;  4FIW A;  3HJO A;  5GAP D;  2LJK A;  3KZQ A;  5AGY A;  1A8Y A;  2GZP A;  2MMO A;  5CP1 A;  2F3M A;  3QAV A;  3FZ5 A;  4D73 A;  2VL2 A;  1AIU A;  3GSS A;  4IGJ A;  4XS1 A;  3KJY A;  2H0G A;  2K18 A;  1Z9H A;  1YEP A;  1TRU A;  5JCU A;  3VLN A;  13GS A;  2K8S A;  1XWA A;  5B8B A;  2WB9 A;  3BD2 A;  5ECS A;  3GUS A;  3QOU A;  2PGT A;  2HSY A;  4GRF A;  5C00 A;  1PMT A;  1SEN A;  4HJM A;  3ME8 A;  1EP7 A;  2LJA A;  3EUR A;  5A4W A;  5IMV A;  4MZB A;  3VK9 A;  1KTE A;  1TJD A;  1KBN A;  2GQM A;  1PX7 A;  1TXX A;  2D28 C;  4MCU A;  1BX9 A;  1PKW A;  2LS5 A;  2H75 A;  2IPA A;  4EDZ A;  5IMF A;  1SJ6 A;  1BYE A;  2FY6 A;  2H76 A;  2YPM A;  3ERF A;  1XWB A;  2LRN A;  2JAC A;  2CVK A;  2B7K A;  1E6B A;  1GSS A;  2ZUP A;  2C3T A;  3TRQ A;  1Y25 A;  3PH9 A;  1I5G A;  4KUN A;  5J4U A;  2R0C A;  2FA8 A;  4O32 A;  1X5D A;  3ME7 A;  4TXO B;  4ICY A;  3H4K A;  3C1S A;  4PX1 A;  1GLQ A;  1EOH A;  5IM9 A;  2K9F A;  1G6W A;  1Q4J A;  2N5F A;  3TOU A;  10GS A;  2OE0 A;  4BVX A;  2LJR A;  2IMK A;  2KP2 A;  3RHC A;  2L5O A;  3RHB A;  4MZW A;  1WJK A;  5A5K A;  4JU5 A;  4RI7 A;  1K0N A;  1WRY A;  2QGV A;  4PUF C;  3TGZ A;  1AXD A;  2L6D A;  1WP0 A;  2X49 A;  3KH9 A;  1URM A;  2YP6 A;  3RBT A;  3HJM A;  1VF3 A;  2CAQ A;  2N5A A;  3FMW A;  2LNT A;  1B4Q A;  4G0L A;  1FB6 A;  2IME A;  2EC4 A;  5GSS A;  3HVX A;  2CX4 A;  4CY6 A;  3A5W A;  3W6G A;  4YKF A;  1YZX A;  3CTF A;  2L59 A;  5IO2 A;  4G2E A;  1A2M A;  1FVJ A;  3FZ9 A;  5ECK B;  2J23 A;  3UMA A;  1OE8 A;  1F37 A;  3I43 A;  5H5R A;  2YWM A;  3KMN A;  4AGS A;  1GTI A;  1MEK A;  5GZZ B;  1HNB A;  2PVO C;  1C72 A;  2H71 A;  2HLS A;  2V1M A;  3VFI A;  4MMM A;  4TR1 A;  1MTC A;  3F63 A;  1FOH A;  2O7K A;  4NPB A;  3U6V A;  1SD9 A;  2CVD A;  2C0E A;  3FHK A;  4EC0 A;  4IQJ M;  5AIX A;  3FR6 A;  1O8X A;  2GLR A;  4IP6 A;  1DSB A;  2P31 A;  4MPG A;  4G0K A;  4CW9 A;  5ECR B;  1JFU A;  1DBY A;  4XS6 A;  2AV4 A;  2X64 A;  2MZC A;  5CYY A;  3IA1 A;  4MDC A;  2EIQ A;  2HSH A;  5ABR A;  5BRT A;  4MJA A;  5B6N A;  2F8A A;  1OAZ A;  4D73 B;  3TKR A;  1G6Y A;  4J56 E;  1AAZ A;  4K9Z A;  5G5E A;  2CV4 A;  2KHP A;  4X43 A;  3K8N A;  3GST A;  4ULX A;  1PKZ A;  1GSU A;  3NOF A;  17GS A;  3IE3 A;  1EGR A;  4ACS A;  3WGE A;  5DAL B;  1B9X C;  2YOI A;  2WJU A;  2C80 A;  4CHS A;  3QFA C;  4V2L A;  4P3Y B;  4MPF A;  1J08 A;  3WGX A;  2FHE A;  2V6K A;  1YJ6 A;  4K7O A;  1ACV A;  3FZ4 A;  3JCM L;  5COH A;  4PNG A;  5IMZ A;  5D9V A;  3DXB A;  4PQI A;  1VF2 A;  4MA9 A;  4H86 A;  2B3S A;  3VWV A;  5KOX A;  3GYK A;  3ZZX A;  1SKR B;  5LCZ A;  3HXS A;  1OC3 A;  3QAG A;  4OFM A;  4X0X A;  4GSN A;  4ZIJ A;  2LV3 A;  2KUC A;  1EV4 A;  4XCS A;  1M2B A;  2VO4 A;  1O85 A;  2WGR A;  2NPB A;  2PU9 C;  3EU3 A;  2BMX A;  1VGL A;  2XHF A;  5J41 A;  3GL5 A;  3DVW A;  3TB2 A;  3ZIJ A;  2ES7 A;  3IAM 2;  4I2T A;  1V9W A;  1ZYQ B;  5G2Z A;  4O7H A;  2CZ2 A;  2DLX A;  2GT5 A;  2WRT A;  2ZNM A;  1BED A;  2GDR A;  2JU5 A;  5JWQ B;  3LFL A;  2DJ0 A;  3MNG A;  1SKS B;  3GRX A;  5FT3 A;  2M72 A;  2YWI A;  3CYN A;  3EU4 A;  1TOF A;  20GS A;  2AB6 A;  1F2E A;  4NXI A;  5CRD A;  4G19 A;  4NWY A;  4YH2 A;  2LUS A;  1HQO A;  4ID0 A;  1G7E A;  5EVO A;  4WR5 A;  1A0F A;  1O6J A;  5G30 A;  2FWE A;  2VCW A;  3F9U A;  2LST A;  4FYU A;  3RDW A;  1M2A A;  4KX4 A;  1K0D A;  1N8J A;  1Z7P A;  3DYR A;  4K8M A;  1NHO A;  1F9M A;  3KM6 A;  3EC3 A;  2ON5 A;  2R0G A;  2QKE A;  1WMJ A;  2E2G A;  1ZYE A;  1XW6 A;  1EWX A;  3EMX A;  3Q18 A;  2VD0 A;  5ECN B;  2H66 A;  5ID2 B;  3F3Q A;  2WS2 A;  4OO5 A;  1Z6N A;  6GSY A;  3HY2 A;  5IO0 A;  1M0U A;  1ZOF A;  1M9B A;  2DMM A;  3OR5 A;  5LD0 A;  3NIV A;  1GUL A;  1QK8 A;  4Q5F A;  3TKP A;  1FW1 A;  18GS A;  4O92 A;  4AJ8 A;  1GSQ A;  1SK2 A;  3GA4 A;  4TR0 A;  4BVY A;  1X5E A;  5DAK A;  4JBB A;  3HZ8 A;  2VCX A;  2H1A A;  3FYG A;  4F2I A;  3EE2 A;  5E4W A;  1NM3 A;  2LEG A;  1SK1 A;  4MP4 A;  2H19 A;  1FOV A;  4HZ2 A;  1T4Z A;  3QAW A;  3PR8 A;  1T1V A;  1K0B A;  1U6T A;  3VWW A;  3TJF A;  2VL2 C;  3TRX A;  3IR4 A;  1SYX A;  1X0R A;  1S3A A;  5CRW A;  3DVX A;  5HQP A;  1ZYP A;  3GKM A;  3UVH A;  2C3N A;  3RAZ A;  3GH6 A;  3KP8 A;  3F8U A;  1TP9 A;  5ELG A;  4QL9 A;  1PL2 A;  2IL3 A;  5DQS A;  4EIP A;  4IJ3 A;  3LWA A;  2XBI A;  4Z7X A;  4Z2U A;  3MDK A;  1GSD A;  1K3L A;  3DML A;  1F3A A;  3WT2 A;  1TW9 A;  3LYP A;  2HYX A;  2H0I A;  2DBC A;  1NW2 A;  2OBK A;  3L4N A;  4V1A g;  4ZL9 A;  3GKN A;  2R5G A;  4TRX A;  5ECL B;  2YCD A;  4HS1 A;  2A4H A;  3KIJ A;  2VL3 A;  16GS A;  1K3Y A;  3FR3 A;  4YQV A;  2H73 A;  2HI7 A;  2AHE A;  4K2D A;  1TRW A;  3ZL5 A;  1UA5 A;  4WET A;  4K7N A;  4KDX A;  3ZIV A;  4XS4 B;  1A24 A;  1Y6E A;  3DWV A;  5IIZ A;  3APQ A;  1J9B A;  1VF4 A;  2JZS A;  2DJ1 A;  2HZF A;  2WUL A;  3BCK A;  3VWX A;  4WXT A;  1GLP A;  4ZB9 A;  5JWR B;  3GTU B;  3UOM A;  5DDL A;  1HNA A;  3BBY A;  1MDI A;  5IMC A;  1BG5 A;  4POB A;  5D9X A;  2DKH A;  3TDG A;  2HT9 A;  4YKG A;  2LRT A;  4Z2R A;  2REM A;  3KMO A;  1ERW A;  5HR3 A;  2FWH A;  2NDO A;  5KOW A;  1ZL9 A;  3EYT A;  4OMV A;  2FLS A;  2F8F A;  2OKA A;  3D4M A;  1K0A A;  4MLY A;  3PPU A;  3GHA A;  5E59 A;  1YY7 A;  1GTU A;  2V2G A;  1AC1 A;  4L5L A;  2O85 A;  4LMW A;  2IFQ B;  4OCE A;  1AQW A;  3HVS A;  4OCF A;  2FD3 A;  2D27 A;  2GSQ A;  1GTB A;  2VCQ A;  4XRA A;  2VCT A;  1LJR A;  3QD9 A;  1FAA A;  3MSZ A;  5HFG A;  2TRC P;  5DBQ A;  2C0F A;  2H01 A;  4GCI A;  3EMP A;  1YF1 A;  4RQX A;  4EKZ A;  2E7P A;  3D0Z A;  3GUR A;  5AN1 A;  5H5S A;  1HNC A;  2QC7 A;  1SL0 B;  3QR6 A;  2AJQ B;  3IHG A;  1RK4 A;  4Q5N A;  4HDE A;  3FRC A;  2P0G A;  1ON4 A;  4X1U A;  4KDY A;  3HJP A;  1FHE A;  5KN0 A;  1U3A A;  4HZ4 A;  2YZU A;  4ECI A;  1NHY A;  4HU7 A;  3HKR A;  3WT1 A;  4K7I A;  4IN0 A;  3TKS A;  3C8E A;  1PN0 A;  4DVC A;  4J57 E;  2C8U A;  4ML1 A;  4EF0 A;  3LQ7 A;  1TK8 B;  4XTS A;  5JCW A;  4NHW A;  2VUP A;  2I4A A;  4BL7 A;  3Q19 A;  3ZVJ A;  1IW7 D;  3FY7 A;  3TCO A;  3VWU A;  1FG4 A;  3IOS A;  2MBT A;  5J3R A;  1XIY A;  2EIO A;  2MBS A;  2FGX A;  1LBK A;  2LQO A;  5ECI B;  4AJ6 A;  1DE1 A;  5A4V A;  1JLV A;  4CDO A;  3IAS 2;  5ECM B;  2F9S A;  6GST A;  1V2A A;  4NV2 A;  4MH3 A;  2L5L A;  5CRH A;  2C3Q A;  1EGO A;  1R4W A;  2VOC A;  3GN3 A;  1K0C A;  1HD2 A;  2TRX A;  3LXT A;  5G1K A;  1H4O A;  2C1Y A;  5ECQ B;  1Z6M A;  5HR1 A;  5D96 A;  3IK7 A;  2DJK A;  4KW6 A;  3H8Q A;  1GUM A;  11GS A;  5D9T A;  4POK A;  1OYJ A;  5CRE A;  2NVL A;  2BTO T;  3L9U A;  4KE3 A;  1EP8 A;  1ZZY A;  4ZB6 A;  5F06 A;  3E9J B;  3WD6 A;  3UIW A;  4GTU A;  3DEX A;  3KGK A;  5DCH A;  2J9H A;  2MMZ A;  1WOU A;  3TKQ A;  1O81 A;  1TTZ A;  19GS A;  2IJY A;  2LNS A;  3KEB A;  5F05 A;  1TI1 A;  2MMN A;  3EPT A;  3M1G A;  2HSM A;  1XW5 A;  2YJH A;  4GQF A;  3KD0 A;  1USB A;  4WR4 A;  5AIS A;  3GFK A;  2GQK A;  2PVQ A;  1DE2 A;  2MYG A;  5DAL A;  4ZBA A;  4WF4 A;  4OWY A;  4WBR D;  1A8L A;  2FCH A;  1THX A;  1J0F A;  5DCG A;  14GS A;  4WKW A;  2H1B A;  1WE0 A;  4O5U A;  4NHZ A;  3C7M A;  5G1L A;  2B1K A;  2FWG A;  2C4J A;  1SD8 A;  2GZY A;  3CSI A;  3TKS E;  2M80 A;  2DIY A;  4KSO A;  1S3D A;  3VPQ A;  5HR0 A;  2H74 A;  3P8W A;  3TUE A;  1ZCP A;  3MIX A;  3FR9 A;  4O5R A;  4YAV A;  4Z2T A;  1K0O A;  5J9C A;  2FA4 A;  2O89 A;  3E3E A;  2H30 A;  2H1G A;  3R2Q A;  4I6X A;  4JR4 A;  4EO3 A;  4HUA A;  3ZLP A;  3ZFL A;  4KF9 A;  1RQM A;  5EY6 A;  2I1U A;  1PGT A;  4USS A;  3WYW A;  5L71 A;  3J7Y k;  3VI5 A;  4TR1 B;  3DIE A;  4L0W A;  4X4J A;  4YAP A;  3ZFB A;  3F3R A;  3GX8 A;  8GSS A;  3F6F A;  2G2Q A;  2HNL A;  4GST A;  2CT6 A;  4TVE A;  1HYU A;  2YN1 A;  4OFN A;  1AQV A;  2YZH A;  1T00 A;  4AJ7 A;  2HZE A;  1F3B A;  3D22 A;  3TJG A;  3IC8 A;  4LL4 B;  4DSS A;  1Q98 A;  1X9M B;  4DEJ A;  1TRV A;  2CZ3 A;  4ZIL A;  3QCP A;  3FW2 A;  4ECC A;  1EEJ A;  4NV5 A;  4BVY B;  1OKT A;  2DSA A;  3CRU A;  1M9A A;  2B5X A;  1TK0 B;  4LA1 A;  1OC8 A;  4ZXG A;  4WF5 A;  2D2Z A;  2HZE B;  5GAN D;  3ERG A;  4EIQ A;  3PIN A;  3W8S A;  4I8B A;  2VM2 A;  3UEM A;  3D21 A;  2K6V A;  3ZRE A;  5F8B A;  4HOJ A;  1AW9 A;  5B7C A;  1WIK A;  4MNN A;  1OC9 B;  4GWR A;  5JWO B;  4K0N A;  1XW9 A;  1U88 A;  4IEL A;  1PRX A;  1ERV A;  5IOW A;  2LTK A;  4QQ7 A;  4FH8 A;  4LMV A;  3C1R A;  1EOG A;  4LLR A;  2AAW A;  1RW1 A;  4XS4 A;  1YEX A;  4L0U A;  1LU4 A;  5BMU A;  1QUW A;  1XZO A;  1O73 A;  2E0Q A;  4OFT A;  4A5P A;  2WFC A;  4HJ2 A;  3APS A;  2ZCT A;  2RUF A;  3QDN A;  2I3Y A;  4YQU A;  2VM1 A;  3LXZ A;  3UL3 A;  3GL3 A;  1FVK A;  5HR2 A;  3P7X A;  3DGQ A;  1EV9 A;  3VUR A;  1SK0 A;  4YQM A;  2VCZ A;  1G0T A;  4TKY A;  2RM5 A;  1T4Y A;  5A4U A;  5C04 A;  1UN2 A;  4N30 A;  3A3T A;  2V32 A;  2JSZ A;  4JRR A;  4K5S A;  3G9B A;  1B4P A;  4BWS A;  4G9H A;  3QMX A;  4EUY A;  2KLX A;  6GSW A;  2H70 A;  4ECB A;  3EWL A;  4TN8 A;  3I6A A;  1GNE A;  1PA3 A;  1TK5 B;  2L6C A;  2I9H A;  4JR6 A;  3ZTL A;  1SYR A;  2R3X A;  2YJ7 A;  1XVW A;  2HRK A;  1G7O A;  3APO A;  3L9S A;  3IXR A;  3L0H A;  5J9B A;  2N5B A;  1M2D A;  4E8E A;  2O87 A;  4JED A;  2V41 A;  5KN2 A;  4HI7 A;  4OD7 A;  3FEU A;  3GV1 A;  4N0Z A;  4KSM A;  5GST A;  1PD2 1;  3UVT A;  3U5R E;  2K8V A;  1MD4 A;  4Q5R A;  1B9Y C;  3UBL A;  4WEY A;  2L4C A;  22GS A;  3FKF A;  3N9J A;  2FWF A;  5HFI A;  5J5N A;  1VRS D;  5KN3 A;  2GTU A;  3FZA A;  2KP1 A;  1GRX A;  1F6M C;  1GTA A;  4DSQ A;  2YAN A;  3UAP A;  2E2M A;  3KH7 A;  2CVB A;  1KNG A;  3ZIT A;  4HU9 A;  2VD1 A;  2OAC A;  1O7U A;  4K5R A;  1M99 A;  5ID2 A;  1K0M A;  3RPP A;  3M9K A;  1GH2 A;  4PNF A;  4N10 A;  5G5F A;  5EPF A;  4L5O A;  4TW5 A;  2B1L A;  1SL2 B;  1ERT A;  2NBS A;  2YV9 A;  4MZC A;  2PWJ A;  4CY8 A;  4I5Q A;  1A0R P;  3O76 A;  5DJM A;  2CX3 A;  1W4V A;  3ISO A;  4BL7 B;  3I69 A;  2IMF A;  3A5I A;  1N2A A;  4KND A;  3G7J A;  6GSV A;  1NSW A;  1R5P A;  4FO5 A;  1V40 A;  2A4V A;  2PUK C;  2OAD A;  4RQR A;  1A2J A;  4PQ1 A;  3W8J A;  1CQH A;  1YKA A;  3Q74 A;  1S3C A;  3NZN A;  2L57 A;  4N11 A;  1PN9 A;  4V1A p;  1T8E B;  2B5Y A;  2GZZ A;  4ZB8 A;  2CQ9 A;  2X8C A;  2V6O A;  5IMA A;  4Q5Q A;  4GQC A;  4IJI A;  5EL8 A;  3A2W A;  3LJR A;  3TOT A;  1GP1 A;  2X8H A;  1H75 A;  2DJ3 A;  2H6Y A;  4IQA A;  4KCE A;  1XVQ A;  4DSR A;  1XPV A;  1Z3E A;  1IYI A;  4XHM A;  5JCG A;  3GH9 A;  2IMI A;  4IVF A;  3DRN A;  3KCM A;  3MAK A;  3M9J A;  5D8I A;  1YQ1 A;  1B48 A;  3HYP A;  5ENU A;  2MMA A;  4G0I A;  2H6X A;  4BVX B;  3M3M A;  1ABA A;  2NTO A;  4I2U A;  1GWC A;  3S9F A;  1XWC A;  4PGT A;  3PGT A;  5FWG A;  4KB3 A;  3G7Y A;  4POM A;  4MK3 A;  5CAX A;  1MDJ A;  5G31 A;  1X9W B;  3HHV A;  2GS3 A;  3SWL A;  2GQL A;  1THO A;  3IV4 A;  2IN3 A;  4K0G A;  3HCZ A;  4GXZ A;  1BQ7 A;  2H72 A;  1GSY A;  4PUA A;  1V57 A;  4BA7 A;  3MWH A;  4BPY A;  2C0D A;  1QGV A;  3EIN A;  1X9S B;  1PL1 A;  2RM6 A;  3LG6 A;  3CSH A;  4RI6 A;  2RLI A;  5IMD A;  5KN1 A;  4PQH A;  3BOA A;  2PMT A;  2R2J A;  3IK9 A;  4J2F A;  1CQG A;  4F82 A;  2JZT A;  4F03 A;  3AY8 A;  2H8L A;  1IYH A;  2BJX A;  2I81 A;  2LKU A;  2OJL A;  5ECH B;  1M7T A;  4IBP A;  3LW9 A;  3WGD A;  2JAD A;  2XBQ A;  3ZYW A;  3H79 A;  3HA9 A;  2R0P A;  1U87 A;  3N5O A;  3L9V A;  1XBS A;  4KDU A;  1B8X A;  2YWN A;  2PPT A;  4TR3 A;  1ILO A;  2AUV A;  3G7I A;  4N0V A;  3I9V 2;  4ZL8 A;  5D93 A;  5ECP B;  2X99 A;  1V58 A;  3LSZ A;  3QPM A;  1AQX A;  1OE7 A;  1TI3 A;  3GX0 A;  4LL1 B;  2RUE A;  4ECJ A;  3H1N A;  1TDI A;  1SKW B;  2WCI A;  1YDK A;  1O8W A;  2VIM A;  4L8E A;  4JE1 A;  2DKI A;  2B7J A;  3HDC A;  1R26 A;  2YV7 A;  3H93 A;  2A2P A;  2M46 A;  3MYD A;  2OE1 A;  3A2V A;  4EL1 A;  6GSS A;  4KAE A;  5B8A A;  3US3 A;  1TKD B;  1AUC A;  3IC4 A;  4FYC A;  1JZR A;  9GSS A;  3HVV A;  4XRD A;  1Z5Y E;  4IHU A;  1TRS A;  1YF0 A;  1Z7R A;  3KXO A;  5DVB A;  2HRF A;  3D5J A;  3LOR A;  1XFL A;  2GSR A;  4IKH A;  1I9D A;  1WPI A;  5CNW A;  3BCI A;  5LNK e;  1X5C A;  4POL A;  2FNO A;  3EVI A;  2UZ8 A;  4MF6 A;  3KP9 A;  1SL1 B;  2VCV A;  5KEJ A;  2PER A;  1BAY A;  2GST A;  3LGC A;  1XWG A;  3GTU A;  3LEF A;  1XOA A;  2JL4 A;  3UAR A;  4K2X A;  4ZBB A;  1ST9 A;  2A2S A;  5DAK B;  2IWT A;  2O8V B;  2WDU A;  2R4V A;  1V98 A;  4TXO A;  4G10 A;  1DUG A;  1E2Y A;  2P5Q A;  2PBJ A;  2IMD A;  3F4S A;  4F0C A;  4ISD A;  5CRG A;  5DQY A;  4EE0 A;  1KEB A;  1JZW A;  3RPN A;  2OE3 A;  1MD3 A;  3C71 A;  1OKD A;  4EDY A;  3HZ4 A;  2OBI A;  4I97 A;  4PUR A;  3ZMK A;  2AYT A;  1OVN A;  4BWQ A;  2R37 A;  2R6K A;  1MDK A;  3CTG A;  1PSQ A;  1GUH A;  2OA7 A;  2P5R A;  1A2L A;  4IQ1 A;  2JSY A;  3IRA A;  4MJC A;  5HFK A;  4HQZ A;  2CA8 A;  5DJL A;  5F0G A;  4PXO A;  2LQQ A;  1A23 A;  4O5Q A;  3UJ1 A;  2HXK A;  3E0U A;  4NAX A;  1TU7 A;  2LRC A;  5H5Q A;  2FUG 2;  1YKC A;  4AF2 A;  6GSX A;  2PN8 A;  1FB0 A;  1VF1 A;  3M8N A;  5F07 A;  2X4A A;  3TJJ A;  1OC9 A;  2JZR A;  1JLW A;  3CMI A;  3HD5 A;  2CAI A;  2GGT A;  3KTB A;  3QFB C;  3P2A A;  2WZ9 A;  3Q6O A;  4WBJ A;  1ML6 A;  1GL8 A;  4ML6 A;  3IHQ A;  4MF7 A;  4GLT A;  2DC5 A;  4IP1 A;  1FO5 A;  3M0F A;  2QA2 A;  3SBC A;  3UBK A;  2DJJ A;  1ERU A;  4PTS A;  3KTL A;  3D4T A;  3C73 A;  2XPD A;  2B5E A;  2HE3 A;  2H6Z A;  2C0G A;  3F0I A;  3CXG A;  1JZD A;  4DSS B;  1ZMA A;  1K3O A;  3F6D A;  12GS A;  1GUK A;  1T3B A;  2EIR A;  2H0H A;  5IQY A;  3DKS A;  2VLT A;  3V1W A;  1GSF A;  2GT6 A;  5IPG A;  4FYB A;  1ZGN A;  3DD3 A;  1UC7 A;  5ELA A;  1SJI A;  2G0F A;  3BJ5 A;  4TR4 A;  5ECO B;  1WWJ A;  3CRT A;  3GKK A;  3CBU A;  3GIX A;  4JZQ A;  5B6M A;  2IIY A;  2DIZ A;  4NMU A;  4IW9 A;  4MJE A;  1TU8 A;  2GVP A;  2GSS A;  3ZRD A;  1XXU A;  3IDV A;  7GSS A;  2YWO A;  1T7P B;  3F4R A;  6GSU A;  4MAB A;  1EEM A;  4V2M A;  3FK8 A;  3ERW A;  5CO3 A;  2HRA A;  4EVM A;  2KOK A;  3ZML A;  2A2R A;  2VL9 A;  3TKS C;  4KH7 A;  4TOP A;  2QSI A;  2YNX A;  2RII A;  2F51 A;  4K6X A;  4K1F A;  1R5A A;  3O3T A;  2H1D A;  4EXJ A;  3A2X A;  4IS0 A;  2DML A;  4TXV A;  3TRP A;  2XC2 A;  3ED3 A;  1U3I A;  4ZBD A;  1XCC A;  4V2N A;  3ZVJ D;  1QMV A;  2VLV A;  4KCA A;  2VAF A;  1QFN A;  2QA1 A;  2ALB A;  3TJK A;  4F0B A;  1EZK A;  3F4T A;  3GKX A;  1QXH A;  4GF0 A;  1GNW A;  2X8G A;  1QQ2 A;  5INY A;  4RUV A;  1XOB A;  2Z9S A;  4XIH A;  2ON7 A;  1R7H A;  1W89 A;  4FQU A;  1SU9 A;  4E8H A;  3LYK A;  4QL7 A;  2L4Q A;  4F9Z A;  2DJ2 A;  2XPE A;  3P90 A;  3IPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...