3F4SA

Crystal structure of wolbachia pipientis alpha-dsba1 t172v
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
199
structure length
199
Chain Sequence
TSNELLLPLPNDKLLGDPKAPILMIEYASLTCYHCSLFHRNVFPKIKEKYIDTGKMLYIFRHFPLDYRGLKAAMLSHCYEKQEDYFNFNKAVFNSIDSWNYYNLSDLTLLQRIAALSNLKQDAFNQCINDKKIMDKIVNDKSLAINKLGITAVPIFFIKLNDDKSYIEHNKVKHGGYKELKYFTNVIDKLYGKAIVKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structural and Functional Characterization of the Oxidoreductase alpha-DsbA1 from Wolbachia pipientis
pubmed doi rcsb
source organism Wolbachia pipientis
molecule tags Oxidoreductase
total genus 74
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2008-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.80 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Ribonucleotide Reductase Protein R1; domain 1 3f4sA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3f4sA01
5F05A 3KEBA 4MH2A 3BD2A 4TN8A 1O85A 4JR6A 3GH9A 2YN1A 1TDIA 2OBKA 1QGVA 4Z7XA 2X8CA 2H6XA 1H75A 2HRFA 3UIWA 2OE3A 3P2AA 1ERTA 3TUEA 1FW1A 4OCFA 5FWGA 3I43A 1SL1B 1GTIA 2OACA 3D0ZA 3P8WA 4ZL8A 2H6ZA 1Z9HA 3LGCA 5DALB 3I6AA 1WJKA 1ZCPA 5COHA 4PQIA 1DE1A 1M9BA 4I5QA 3Q19A 5IOXA 1HNAA 1U88A 16GSA 4EC0A 4BPYA 4HEA2 3QAGA 3G9BA 2H74A 3MWHA 4TR0A 1K3LA 4IGJA 4ECIA 4EVMA 11GSA 1I9DA 2JADA 2O8VB 3FHKA 4HJ2A 4TOPA 1S3AA 2VD1A 3HD5A 2BTOT 2EC4A 3WT2A 2B1KA 4WF4A 4YQVA 5D9TA 4K1FA 1ZOFA 2R5GA 1SL2B 1USBA 3LQ7A 1X0RA 2E2MA 5B7CA 3CRUA 2REMA 4F0CA 3PH9A 2GQLA 5GAND 4L5LA 3N5OA 3TOUA 4OD7A 2AAWA 1U3IA 4XCSA 3DWVA 4I6XA 1SJIA 2CVDA 3V1WA 5KN0A 2P0GA 2O85A 3ZFLA 3UBKA 3NOFA 2GQMA 2QKEA 3CYNA 1TXXA 5J5NA 2X8GA 4IELA 2LSTA 1OE8A 4DSSB 3VWUA 2IMDA 4N11A 2LJKA 3HZ8A 3TCOA 3CRTA 3A2WA 1PKWA 5IPHA 1A0FA 3LORA 2GZZA 4ZBAA 2DMLA 1LJRA 3WGXA 2OKAA 3US3A 5A4WA 4ULXA 2DJ1A 2FWEA 2WS2A 2JSYA 3ZMKA 4QQ7A 3UJ1A 1U3AA 4HZ4A 4TR4A 3NZNA 3I9V2 5ECOB 4PUFC 4FYUA 5HR3A 5B8BA 1KBNA 2H1AA 2IMKA 2WULA 2KUCA 1A24A 1K3YA 1ERUA 1BQ7A 3LYPA 5EY6A 5J4UA 1BJXA 3QR6A 4XRDA 3TRXA 2CVBA 5GSSA 4ILFA 2B1LA 1SJ6A 2RM5A 3QFAC 4HZ2A 3A3TA 2DJ3A 2PUKC 4MJCA 5EPFA 5ECRB 1A23A 5D73A 1YKAA 4J56E 3WYWA 3CTGA 1YQ1A 4L5OA 4J57E 1J9BA 1T8EB 2C4JA 3FEUA 5F8BA 2HI7A 1ERWA 2GQKA 2GTUA 3KTLA 4ML6A 4MF6A 2FWGA 2VOCA 3LWAA 4GXZA 1B9YC 3U6VA 1I5GA 2B3SA 1EEJA 4V2NA 4EDYA 5B6MA 4K0NA 2DJJA 2LNSA 3MSZA 5G5EA 3ERWA 2FWHA 3VFIA 3TJBA 5ECSA 2ZNMA 1YF0A 5IMFA 2XPDA 4LA1A 3IOSA 3IRAA 2C0DA 3GX8A 4GRFA 2FLSA 4KDYA 1RK4A 2YZHA 3C1SA 4HJMA 1G7EA 5KN1A 1DBYA 1JZDA 5JWQB 4OFTA 3ZIVA 5KEJA 2B7JA 4MF5A 5IPGA 17GSA 4L8EA 3GFKA 4MH3A 3LXTA 1ON4A 2P5RA 4CHSA 1SK1A 4WF5A 1AAZA 4IP6A 4MPGA 4KUNA 4HU9A 2VIMA 2LQQA 1M0UA 3UAPA 5D96A 3P90A 3TKSA 1C72A 1PL2A 2LKUA 1GSUA 5ECQB 6GSVA 4LMWA 2O87A 1DUGA 5ELAA 2PU9C 1TTZA 2F51A 2V2GA 3M8NA 2GZPA 3IAM2 4IKHA 1AUCA 1JHBA 2LNTA 1XPVA 4BA7A 5LCZA 1M7TA 3APOA 2FNOA 3FRCA 1X5CA 4ZB6A 4HI7A 1GWCA 4GTUA 2WZ9A 4CW9A 1QQ2A 5GAPD 2L5OA 5CRGA 5E4WA 3GNJA 2PVQA 4TR3A 1VF4A 2K8SA 3HVXA 1V98A 1HYUA 2MMNA 4KAEA 3UOMA 1SD8A 4TKYA 2C3NA 2GLRA 1K0CA 5DAKA 3LYKA 5HR0A 2N5FA 5JCWA 3GYKA 2H19A 3FR3A 3GRXA 4TW5A 4AF2A 4TRXA 2H6YA 3VLNA 1EV9A 2K9FA 13GSA 4G2EA 1RW1A 3H8QA 2I4AA 2L4QA 3O3TA 1OC9B 3MAKA 4ZL7A 3ERGA 3D4MA 3EURA 4NV5A 2ZCTA 1UC7A 1OE7A 3ZVJA 2PPTA 3UVTA 4NXIA 2YWMA 3IK9A 2IL3A 1F2EA 2H8LA 4PGTA 4OFMA 1DSBA 3QAWA 4MZWA 2CZ3A 1SENA 3S9FA 2GT6A 1PMTA 3BBYA 3LG6A 2MMAA 1GTBA 4TXVA 1TU7A 4J2FA 2IN3A 2LS5A 1MD4A 2OBIA 1GUHA 4IP1A 2JSZA 2VL2A 4ZBBA 6GSTA 3GMFA 3VWXA 5G30A 1VF1A 2YNXA 3GKMA 5ECIB 4JRRA 1AQXA 2YPMA 4X1UA 4V2MA 4EDZA 3QMXA 1XVQA 4FIWA 1A8YA 3E9JB 1TOFA 2V32A 3TJGA 5IMAA 4N0VA 3FY7A 1Z7PA 1E2YA 2H0IA 4IW9A 2GZYA 2V6OA 3W8JA 5B8AA 1GNEA 3KZQA 4NMUA 1FAAA 2XPEA 2MZCA 1GH2A 3R2QA 4WBRD 6GSYA 1G6WA 1TU8A 1E6BA 4X43A 2FA8A 3E0UA 2ES7A 2JZSA 5JWRB 2GSSA 2YOIA 3ZMLA 3PGTA 4AJ7A 4I2UA 1QFNA 1THOA 3DXBA 5EVOA 3TGZA 3IK7A 1N8JA 2HNLA 3U5RE 9GSSA 3IPZA 4POKA 2PERA 4CDOA 4BVYA 2M46A 3HY2A 4IVFA 1EGRA 2PMTA 5IOWA 20GSA 1TW9A 2HFDA 3GSSA 5ID2A 4F82A 1GLQA 2N5AA 1SK2A 3WGDA 3F4SA 1R5PA 3SWLA 4XTSA 2HSHA 4O5RA 1FHEA 5AISA 4MJAA 3IR4A 4JE1A 6GSUA 3FR9A 1M2AA 2PWJA 1AW9A 1M2BA 2RM6A 1NHOA 3GA4A 1A0RP 2E2GA 2GGTA 2Z9SA 4PNGA 3MDKA 2H73A 3KMOA 3IV4A 3CXGA 3GL3A 1GTAA 1R4WA 3KXOA 3VURA 3F0IA 3ISOA 3WD6A 2MBTA 3H4KA 1NSWA 3GHAA 1K3OA 1YEXA 4PXOA 2HZEB 3GKNA 1F37A 1M2DA 3ME8A 4KCAA 5DJMA 2RUEA 1HD2A 4K6XA 1YKCA 2YJ7A 1MTCA 3I69A 2DJ0A 5G31A 4KX4A 2RLIA 5CP1A 1WPIA 3F3QA 1XBSA 3F6DA 1CQGA 2PBJA 4KH7A 2HZFA 2GVPA 1TK8B 4Q5RA 3KTBA 12GSA 2DLXA 4I2TA 3M3MA 3CSJA 3KP9A 1U6TA 1GP1A 1K0NA 3RBTA 1EGOA 1R7HA 4O92A 1WRYA 3KMNA 2H0GA 3GTUA 2G2QA 1ZYEA 1F9MA 3PR8A 1GNWA 2I9HA 3TKQA 1FOVA 3EINA 2P31A 2OJLA 4ECJA 3F4RA 2ON5A 3ZVJD 4Q5FA 1ZYQB 1TRSA 3GUSA 4XHMA 4DSQA 3J7Yb 5IMVA 4DVCA 2IFQB 2VCWA 3KIJA 2VLTA 3IHQA 5GZZB 2CA8A 1Z5YE 2VM2A 2ZUPA 1O73A 2QC7A 2L6CA 4YQMA 5GSTA 3RPNA 1XW6A 2G0FA 3HKRA 4BWSA 1TI1A 5DJLA 4MLYA 5D93A 3ERFA 5CRWA 1A2MA 2L6DA 3ZRDA 2HXKA 1GUKA 4TR1A 1XWBA 1FB0A 1X5DA 1MD3A 2DSAA 1PKZA 3LSZA 2YANA 4K9ZA 3IAS2 1OAZA 2DIYA 3L4NA 1S3DA 4YH2A 4G9HA 1VF2A 3QDNA 3BJ5A 1K0MA 1ABAA 3A2VA 3KH9A 5J41A 2AV4A 1XWAA 3KJYA 6GSSA 4ACSA 3FK8A 2WB9A 1LU4A 1O7UA 2B5XA 4JBBA 2GSTA 2F3MA 1XWGA 2WRTA 2P5QA 5FT3A 4D73B 3ME7A 1V57A 3HA9A 3DD3A 1ILOA 2GS3A 5DVBA 3TOTA 3FZAA 4K7NA 2FY6A 4MDCA 4HS1A 1JFUA 3CSIA 4YAPA 1LBKA 4TXOB 4ZXGA 1NM3A 3HCZA 1IYHA 2LRNA 1W89A 2JL4A 3ZIJA 2JACA 1X5EA 3RDWA 5HR1A 4WR5A 3CTFA 3GKKA 4PQHA 1EZKA 3HXSA 1B48A 4V1Ap 1ERVA 4XS4A 5ECPB 2HLSA 1HNCA 1OVNA 2LRTA 3K8NA 2KOKA 3KP8A 3ZLPA 4IQAA 1F6MC 4EE0A 1EEMA 5AIVA 4OCEA 3HJPA 1SU9A 4KDUA 5IO0A 1FG4A 2VAFA 5D9WA 1R5AA 2EIRA 2DMMA 3EMXA 3D4TA 4L0UA 3IE3A 1BG5A 2JU5A 4RQXA 4ECBA 4BL7A 1HNBA 4AJ6A 2L5LA 4FH8A 3PINA 2L57A 3Q74A 5HFKA 1SD9A 3BOAA 1S3CA 5DALA 2DJ2A 2LTKA 4EF0A 5CRDA 2C0EA 4WR4A 3DYRA 4JU5A 4ZB9A 4YQUA 3ZITA 2H76A 3TB2A 4HQSA 3RAZA 4GQCA 2I1UA 5AGYA 4BWQA 3VPTA 1MDIA 3EVIA 3FZ5A 5HR2A 1DE2A 2B6MA 1SL0B 2FD3A 4WBJA 2LV3A 3HYPA 3QFBC 3TKSE 4N10A 3CBUA 5IO2A 1XW5A 1A8LA 5ABRA 3G7YA 4Q5QA 2WFCA 3KCMA 4HDEA 3NIVA 1VGLA 4KNDA 1UVZA 4K2DA 4GCIA 5G1LA 3QCPA 4L0WA 2O89A 2R4VA 2LUSA 2X8HA 4MMMA 5A5KA 2NTOA 4X0XA 4XS1A 2I3YA 3HZ4A 3CSHA 5D8IA 1EWXA 2YCDA 1ZZYA 1A2LA 1GSDA 5AN1A 1RQMA 1PA3A 3O6TA 4TVEA 2PVOC 2FUG2 2JZRA 3L9UA 3M1GA 4KGIA 1MDKA 1ZL9A 2LJAA 2O7KA 1EV4A 1XCCA 5FHIA 1VF3A 4MA9A 3RHCA 4RQRA 4POMA 2DIZA 3UVHA 3VWWA 2F9SA 4DSSA 1EOHA 4MZBA 1EOGA 2C0GA 5CNWA 2VL3A 4MZCA 1X9SB 4FYCA 1Z6NA 5ECNB 2MMZA 1Z6MA 2OA7A 4PQ1A 3HVSA 1R26A 5LNKe 1TP9A 4RI6A 2YZUA 3IXRA 4JEDA 4WKWA 3H1NA 3DVWA 2B5YA 2H1DA 3L0HA 2HE3A 4GSTA 1G7OA 3GH6A 1TRWA 2J9HA 1URMA 2DC5A 3DEXA 4NPBA 5CYYA 3D5JA 4GF0A 2CX3A 1K0BA 4K8MA 4TR1B 2ALBA 4KSMA 2R6KA 5IIZA 3IC4A 4EUYA 5D9XA 3ED3A 2E7PA 4LL1B 3GV1A 3APSA 3VI5A 4GLTA 2XBIA 3D22A 1MEKA 3C73A 4FYBA 2QSIA 5J3RA 2H75A 5DBQA 1XW9A 5JCUA 4NHZA 5EL8A 3P7XA 2B7KA 2K18A 2H70A 1CQHA 3D6IA 1YZXA 3FW2A 3A5WA 5JWOB 4ZB8A 1J0FA 4N30A 1K0DA 3UL3A 1XOBA 4Q5NA 1XIYA 1B8XA 2CZ2A 2VM1A 1O6JA 3TKSC 2IMFA 4ID0A 3TRQA 2PN8A 3HHVA 1WIKA 4LL4B 2IMEA 4QL9A 3L78A 4EXJA 4MPFA 8GSSA 4XIHA 3ZYWA 1GRXA 1Z3EA 2H72A 3VWVA 4OO4A 1JLWA 4OO5A 5IMCA 2WJUA 4MABA 3W6GA 4DEJA 2VCXA 3O76A 1F3AA 4HU7A 3UBLA 1T4ZA 3ZZXA 2C3TA 1EP7A 3OR5A 2CT6A 1TRUA 5L71A 5KN3A 1SYRA 2V6KA 2CV4A 4PUAA 2FGXA 3LXZA 1PQNA 5G2ZA 5IMDA 2E0QA 4E8EA 1ML6A 1SKWB 2B5EA 4G10A 4MCUA 10GSA 3GIXA 1PGTA 3HVVA 1GULA 1OC3A 1PN9A 5CAXA 3H93A 3MNGA 1PL1A 1SKSB 2L59A 2DJKA 3GL5A 1T00A 2A2SA 2HYXA 2IPAA 2I81A 2X99A 3TJJA 2H71A 1B9XC 5ECLB 5IMZA 1AQWA 1WMJA 3ZL5A 1Z7RA 1XVWA 4O7HA 4AJ8A 3EWLA 3C8EA 1G6YA 3BCIA 3FKFA 2TIRA 5DQYA 1WP0A 1PX7A 3DVXA 1AIUA 5DCGA 2YWNA 2HSYA 5CO3A 2F8AA 2R37A 1A2JA 3ZREA 1G0TA 1PRXA 3LFLA 4EL1A 1WE0A 5C04A 2H1GA 1BEDA 3EC3A 4HUAA 3EU4A 2KHPA 1SYXA 1BX9A 3TKPA 2RUFA 4OMVA 1BAYA 1TK5B 4ML1A 2F8FA 4KE3A 3GX0A 4I97A 1KEBA 2H0HA 1KTEA 1YEPA 5DAKB 2PGTA 4MP4A 2MBSA 1GL8A 2OE1A 1OKDA 4PX1A 3VI7A 2QGVA 2VL2C 2VO4A 3L9VA 4NWYA 1IYIA 1OC8A 3EMPA 2CAIA 4AGSA 3UMAA 1QK8A 1YDKA 3M0FA 4WXTA 1W4VA 2TRXA 3BCKA 5F06A 1V9WA 4V2LA 5F07A 3W8SA 3RPPA 3UARA 4F2IA 2IMIA 3C71A 1TK0B 1V40A 5H5RA 5HFIA 1T4YA 1OC9A 2LJRA 4ECCA 2WGRA 3WT1A 4P3YB 2WCIA 5H5SA 1VRSD 2VL9A 4F9ZA 1AC1A 1AXDA 1WWJA 3A2XA 1Y25A 2EIOA 2LEGA 3TJFA 4F03A 1FVJA 2AJQB 3M9KA 1WOUA 3Q18A 3QAVA 2YWOA 2VLUA 2VLVA 3QPMA 4ZIJA 4EO3A 2M80A 4LMVA 1QXHA 1GLPA 3DKSA 5G5FA 1O8WA 3IBHA 3G7IA 14GSA 1JZOA 5ECKB 1XWCA 2R3XA 2XC2A 4NV2A 1GSEA 5JCGA 1F3BA 4O32A 2K8VA 2CX4A 4K7OA 5KN2A 3TJKA 3APQA 1UA5A 5A4UA 4WETA 5ECMB 2EIQA 2NPBA 1GSYA 5J9CA 1YY7A 1V2AA 5IM9A 1PD21 2NDOA 2WDUA 3E3EA 1ACVA 2C0FA 1T7PB 4ZL9A 3ZTLA 2L4CA 1Y6EA 2KLXA 4YAVA 1ZGNA 3F4TA 3DGQA 2OE0A 3GN3A 4IS0A 3F3RA 2BMXA 2NBSA 1M99A 3F6FA 22GSA 1V58A 1NW2A 4MJEA 1SK0A 4ZILA 3KH7A 4NHWA 3ZFBA 3TRPA 3QOUA 2VCQA 1K0OA 3SBCA 3RHBA 3DMLA 5ECHB 2C1YA 2VCTA 2FWFA 5INYA 3KD0A 2XHFA 1QUWA 1FO5A 5ID2B 2N5BA 1T3BA 2KP2A 5ENUA 2YWIA 3EU3A 2DBCA 5B6NA 1YJ6A 2MMOA 5A4VA 3J7Yk 3C1RA 2J23A 19GSA 4JR4A 3LEFA 4MK3A 2CAQA 3TKRA 1TJDA 4LLRA 1GSQA 5DDLA 3G7JA 5CREA 2C8UA 2IJYA 7GSSA 4KA0A 4ZBDA 1XFLA 2V1MA 2YV7A 2GT5A 1JLVA 2VCVA 4NAXA 2H1BA 4EKZA 3FZ9A 3CMIA 4H86A 4WEYA 1FB6A 2X64A 1GUMA 3EYTA 5HFGA 2VD0A 2IIYA 3AY8A 1KNGA 1TKDB 2A4VA 4KB3A 1TRVA 2H66A 3HDCA 1AQVA 1XZOA 1GTUA 2AYTA 3FZ4A 4QL7A 3DIEA 2HZEA 5D9VA 2OADA 4RI7A 5ELGA 1B4PA 3IDVA 2H01A 1BYEA 3F9UA 1EP8A 2IWTA 5C00A 4POLA 18GSA 2XBQA 3GSTA 5HQPA 4OWYA 3L9SA 2D2ZA 1ST9A 1X9WB 4K0GA 4IJIA 4KSOA 1JZWA 4ISDA 4GWRA 1N2AA 3GTUB 3JCML 1HQOA 3HJMA 1XWKA 1M9AA 1X9MB 1U87A 3KGKA 2C3QA 2AHEA 4GSNA 2VCZA 4FO5A 4KDXA 3WGEA 2V41A 1XXUA 5CRHA 3GURA 4I8BA 1GSSA 5LD0A 4E8HA 3UEMA 2KP1A 2BJXA 4KCEA 4OFNA 4MF7A 4IHUA 4IQ1A 2LRCA 4GQFA 4XS6A 3Q6OA 3HJOA 3KM6A 4JZQA 3DRNA 2VUPA 5E59A 2JZTA 3TDGA 4RUVA 3M9JA 1J08A 1K0AA 2IFQA 3VK9A 4IJ3A 3IA1A 3F8UA 2YJHA 5H5QA 4PURA 3FYGA 2MYGA 1OKTA 4MJBA 1XOAA 5J9BA 2LQOA 3C7MA 2H30A 4XRAA 1GSFA 1B4QA 2GSQA 2YP6A 1Q98A 3GKXA 2GSRA 4IBPA 1JZRA 2ON7A 2FCHA 4N0ZA 1H4OA 5DQSA 4HQZA 4KW6A 1MDJA 3FR6A 1Q4JA 1QMVA 4DSRA 1SKRB 3N9JA 1THXA 2RIIA 3QD9A 1OYJA 2HT9A 1TI3A 1ZMAA 2AB6A 3EE2A 5AIXA 5F0GA 1O81A 1PSQA 1O8XA 2HRNA 2FHEA 6GSXA 1UN2A 2CQ9A 5G1KA 4V1Ag 4GSSA 4IN0A 5DCHA 3F63A 2NVLA 2TRCP 2M72A 5IQYA 2C80A 4K7IA 1YF1A 4F0BA 4PNFA 3VPQA 2YV9A 4HOJA 2GDRA 2A2RA 4D73A 3H79A 2K6VA 1FVKA 2CVKA 1NHYA 4BVXA 1PX6A 2R2JA 2AUVA 3LJRA 3D21A 1T1VA 4POBA 6GSWA 4TXOA 4G19A 2FA4A 1SJZA 4XS4B
chains in the Genus database with same CATH superfamily
5F05A 5KOXA 3KEBA 4MH2A 3BD2A 4TN8A 1O85A 4JR6A 3GH9A 4KF9A 2YN1A 4L6AA 1TDIA 4NLEA 2OBKA 1QGVA 4Z7XA 4G0KA 2X8CA 2H6XA 1H75A 2HRFA 3UIWA 2OE3A 4BL7B 3P2AA 1ERTA 3TUEA 1FW1A 4OCFA 5FWGA 3I43A 1SL1B 1GTIA 2OACA 3D0ZA 3P8WA 4ZL8A 2H6ZA 1Z9HA 3LGCA 5DALB 3I6AA 1WJKA 1ZCPA 5COHA 4PQIA 1DE1A 1M9BA 4I5QA 3Q19A 5IOXA 1HNAA 1U88A 16GSA 4EC0A 4BPYA 4HEA2 3QAGA 3G9BA 2H74A 3MWHA 4TR0A 1K3LA 4IGJA 4ECIA 4EVMA 11GSA 1I9DA 2JADA 2O8VB 3FHKA 4HJ2A 4TOPA 1S3AA 1T9HA 2VD1A 3HD5A 2BTOT 2EC4A 3WT2A 1MH9A 2B1KA 4WF4A 4YQVA 5D9TA 4K1FA 1ZOFA 2R5GA 1SL2B 1USBA 3LQ7A 1X0RA 2E2MA 5B7CA 3CRUA 4L6CA 2REMA 4F0CA 3PH9A 2GQLA 5GAND 4L5LA 3N5OA 3TOUA 1PN0A 4OD7A 1DCNA 2AAWA 1U3IA 4XCSA 3DWVA 4I6XA 1SJIA 2CVDA 2UZ8A 3V1WA 5KN0A 2P0GA 2O85A 3ZFLA 3UBKA 3NOFA 2GQMA 2QKEA 1U16A 1XG8A 3CYNA 1TXXA 2DKHA 5J5NA 4X4JA 2X8GA 4IELA 2LSTA 1OE8A 4DSSB 4EFCA 3VWUA 2IMDA 4N11A 2LJKA 3HZ8A 3TCOA 3CRTA 3A2WA 1PKWA 5IPHA 1A0FA 3LORA 2GZZA 4ZBAA 2DMLA 1LJRA 3WGXA 2OKAA 3US3A 5A4WA 4ULXA 2DJ1A 2FWEA 2WS2A 2JSYA 3ZMKA 4QQ7A 3UJ1A 1U3AA 4HZ4A 3R6VA 4TR4A 3NZNA 3I9V2 5ECOB 4PUFC 4FYUA 5HR3A 5B8BA 1KBNA 2H1AA 2IMKA 2WULA 2KUCA 1A24A 1K3YA 1ERUA 1BQ7A 3LYPA 5EY6A 5J4UA 1BJXA 3QR6A 4XRDA 3TRXA 2CVBA 5GSSA 4ILFA 2B1LA 1SJ6A 2RM5A 3QFAC 4HZ2A 3A3TA 1TJ7A 1TJWA 2DJ3A 2PUKC 4MJCA 5EPFA 5ECRB 1A23A 5D73A 1YKAA 4J56E 3WYWA 3CTGA 1YQ1A 4L5OA 4J57E 1J9BA 1T8EB 2C4JA 3FEUA 5F8BA 2HI7A 1ERWA 2GQKA 2GTUA 3KTLA 4ML6A 1Q92A 4MF6A 2FWGA 2VOCA 3LWAA 4GXZA 1B9YC 4EEIA 3U6VA 3BHGA 1I5GA 3QBPA 2B3SA 1EEJA 1IW7D 4V2NA 4EDYA 5B6MA 4K0NA 4HGVA 2DJJA 2LNSA 3MSZA 5G5EA 4PTSA 3ERWA 1Q91A 2FWHA 3VFIA 3TJBA 5ECSA 2ZNMA 1YF0A 5IMFA 2XPDA 4LA1A 3IOSA 3IRAA 2C0DA 3GX8A 4GRFA 2FLSA 4KDYA 1RK4A 2YZHA 3C1SA 4HJMA 1G7EA 5KN1A 1DBYA 1JZDA 1Z4LA 4OFTA 5JWQB 3ZIVA 5KEJA 2B7JA 4MF5A 5IPGA 17GSA 4L8EA 3GFKA 4MH3A 3LXTA 1ON4A 2P5RA 4CHSA 1SK1A 4WF5A 1AAZA 4IP6A 4MPGA 4KUNA 4HU9A 2VIMA 2LQQA 1M0UA 3UAPA 5D96A 3P90A 2D28C 3TKSA 2JARA 1C72A 1PL2A 2LKUA 1GSUA 5ECQB 6GSVA 4LMWA 2O87A 1DUGA 5ELAA 2PU9C 2HVGA 1TTZA 2F51A 2V2GA 3M8NA 2GZPA 3IAM2 4O5UA 4IKHA 1AUCA 1JHBA 2LNTA 1XPVA 4BA7A 5LCZA 1M7TA 3APOA 2FNOA 3FRCA 1X5CA 4ZB6A 4HI7A 1GWCA 4GTUA 2WZ9A 4CW9A 1QQ2A 1FURA 5GAPD 2L5OA 5CRGA 5E4WA 3GNJA 2PVQA 4TR3A 1VF4A 2K8SA 3HVXA 1V98A 1HYUA 2MMNA 4KAEA 3UOMA 1SD8A 4TKYA 2C3NA 2GLRA 3IHGA 1K0CA 5DAKA 3LYKA 5HR0A 2N5FA 5JCWA 3GYKA 2H19A 3FR3A 3GRXA 4TW5A 4AF2A 4TRXA 2H6YA 3VLNA 1EV9A 2K9FA 13GSA 4G2EA 5D6BA 1RW1A 4BIKA 3H8QA 1YFEA 3PPUA 2I4AA 2L4QA 3O3TA 1OC9B 3MAKA 4ZL7A 3ERGA 2R0PA 3D4MA 3EURA 4NV5A 2ZCTA 1UC7A 1OE7A 3ZVJA 2PPTA 3UVTA 4NXIA 2YWMA 2HRAA 3IK9A 2IL3A 1F2EA 2H8LA 4PGTA 4OFMA 1DSBA 3QAWA 4MZWA 2CZ3A 1HY0A 1SENA 3S9FA 2GT6A 1PMTA 3BBYA 3LG6A 2MMAA 4YKFA 1GTBA 3U19A 4TXVA 1TU7A 4J2FA 2IN3A 2LS5A 1MD4A 2OBIA 1GUHA 4IP1A 2JSZA 2VL2A 4ZBBA 6GSTA 3GMFA 3VWXA 5G30A 1VF1A 2YNXA 3GKMA 5ECIB 4JRRA 4APBA 1AQXA 2YPMA 4X1UA 4V2MA 4EDZA 3QMXA 1XVQA 4FIWA 1A8YA 3E9JB 1TOFA 2V32A 3TJGA 5IMAA 4N0VA 3FY7A 1Z7PA 1E2YA 2H0IA 4IW9A 2GZYA 1FUOA 2V6OA 3W8JA 5B8AA 1GNEA 3KZQA 4NMUA 1FAAA 2X49A 2XPEA 2MZCA 1GH2A 3R2QA 4WBRD 6GSYA 1G6WA 1TU8A 1E6BA 4X43A 2FA8A 3E0UA 2ES7A 2JZSA 5JWRB 2GSSA 2YOIA 3ZMLA 3PGTA 3RRPA 4AJ7A 4I2UA 5BMUA 1QFNA 4USSA 1THOA 3DXBA 2QA2A 5EVOA 3TGZA 2PTRA 3IK7A 1N8JA 2HNLA 3U5RE 2RCNA 9GSSA 3IPZA 4POKA 2PERA 4CDOA 4BVYA 2M46A 3HY2A 4IVFA 1EGRA 4ADLA 2PMTA 2FUSA 1TJUA 5IOWA 20GSA 1TW9A 2HFDA 3GSSA 5ID2A 4F82A 2R0GA 1GLQA 2N5AA 1SK2A 3WGDA 3F4SA 1R5PA 3SWLA 4XTSA 2HSHA 4O5RA 1FHEA 5AISA 4MJAA 3IR4A 4JE1A 6GSUA 3FR9A 1M2AA 2PWJA 1AW9A 1K7WA 1M2BA 1NHOA 2RM6A 3GA4A 1A0RP 2E2GA 2GGTA 2Z9SA 4PNGA 5KOWA 4ADMA 3MDKA 2H73A 3KMOA 3IV4A 3CXGA 3GL3A 1GTAA 1R4WA 3KXOA 3VURA 3F0IA 3ISOA 3WD6A 2MBTA 3H4KA 1NSWA 3GHAA 1K3OA 1YEXA 4PXOA 2HZEB 3GKNA 1F37A 1M2DA 3ME8A 4KCAA 5DJMA 4EIQA 2RUEA 1JSWA 1HD2A 4K6XA 1YKCA 2YJ7A 1MTCA 3I69A 2DJ0A 5G31A 4KX4A 2RLIA 5CP1A 1WPIA 3F3QA 1XBSA 3F6DA 1CQGA 2PBJA 4KH7A 2HZFA 2JAWA 2GVPA 3NO9A 1TK8B 4Q5RA 3KTBA 12GSA 2DLXA 4I2TA 3M3MA 3CSJA 3KP9A 1U6TA 1GP1A 1K0NA 3RBTA 1EGOA 1R7HA 4O92A 1U0LA 1WRYA 3KMNA 2H0GA 3GTUA 2G2QA 1ZYEA 1F9MA 3PR8A 1GNWA 2I9HA 1K62A 3TKQA 1FOVA 3EINA 2P31A 3HVNA 2OJLA 4ECJA 4Z2UA 3F4RA 2ON5A 3ZVJD 2X4AA 4Q5FA 1ZYQB 1TRSA 3GUSA 4XHMA 4DSQA 3J7Yb 5IMVA 4DVCA 2IFQB 2VCWA 3KIJA 2VLTA 3IHQA 5GZZB 2CA8A 1Z5YE 2VM2A 2ZUPA 1O73A 2QC7A 2L6CA 4YQMA 5GSTA 3RPNA 1XW6A 2G0FA 3HKRA 4BWSA 2PTSA 1TI1A 3BWVA 5DJLA 4MLYA 5D93A 3ERFA 5CRWA 1A2MA 4MX2A 2L6DA 3ZRDA 2HXKA 1GUKA 4TR1A 1XWBA 1FB0A 1X5DA 1MD3A 2DSAA 1PKZA 3LSZA 2YANA 4K9ZA 3IAS2 1OAZA 2DIYA 3L4NA 4K2XA 1S3DA 3GTDA 4YH2A 4G9HA 1HY1A 1VF2A 3QDNA 3BJ5A 1K0MA 1ABAA 3A2VA 5HW2A 3KH9A 5J41A 2AV4A 1XWAA 3KJYA 6GSSA 4ACSA 3FK8A 2WB9A 1LU4A 1O7UA 2B5XA 4JBBA 2GSTA 4NFLA 1XWGA 2F3MA 2WRTA 2P5QA 5FT3A 4D73B 3ME7A 1V57A 3HA9A 3DD3A 1ILOA 2GS3A 5DVBA 3TOTA 3FZAA 4K7NA 2FY6A 4MDCA 4HS1A 4BVXB 1U15A 1JFUA 3CSIA 4YAPA 1LBKA 4TXOB 4ZXGA 1NM3A 3HCZA 1IYHA 1TJVA 2LRNA 1W89A 2JL4A 3ZIJA 2JACA 1FUPA 1X5EA 3RDWA 3MYDA 5HR1A 4WR5A 4HSCX 3CTFA 3GKKA 4PQHA 1EZKA 3HXSA 1B48A 4V1Ap 2I7DA 1ERVA 4XS4A 5ECPB 2HLSA 1HNCA 1OVNA 2LRTA 3K8NA 2KOKA 3KP8A 3ZLPA 4BVYB 4IQAA 1F6MC 2YV5A 4EE0A 1EEMA 5AIVA 4OCEA 3HJPA 1SU9A 4KDUA 3RD8A 5IO0A 3R3EA 1FG4A 2VAFA 5D9WA 1R5AA 4G0IA 2EIRA 2DMMA 5F91A 3FMWA 3EMXA 3D4TA 4L0UA 3IE3A 1BG5A 2JU5A 4RQXA 4ECBA 4BL7A 2PFMA 1HNBA 4AJ6A 2L5LA 4FH8A 3PINA 2L57A 3Q74A 5HFKA 1SD9A 3BOAA 1S3CA 5DALA 2DJ2A 2LTKA 4EF0A 5CRDA 4CY8A 2C0EA 4WR4A 3DYRA 4JU5A 4ZB9A 4YQUA 3ZITA 2H76A 3TB2A 4HQSA 3RAZA 4YKGA 4GQCA 2I1UA 5AGYA 4BWQA 3VPTA 1ZYPA 1MDIA 3EVIA 3FZ5A 5HR2A 1DE2A 2B6MA 1SL0B 2FD3A 1M3IA 4WBJA 2LV3A 3HYPA 3QFBC 3TKSE 4N10A 3CBUA 5IO2A 1XW5A 1A8LA 1C3CA 5ABRA 3G7YA 4Q5QA 2WFCA 3KCMA 4HDEA 2X75A 1M3JA 4O5QA 1Z4PX 3NIVA 4A5PA 1VGLA 4KNDA 1UVZA 4K2DA 4GCIA 5G1LA 3QCPA 4L0WA 4NSLA 2O89A 2R4VA 2LUSA 2X8HA 4MMMA 5A5KA 2NTOA 4X0XA 4XS1A 2I3YA 3HZ4A 3CSHA 5D8IA 1EWXA 2YCDA 1ZZYA 3A5IA 1A2LA 1GSDA 5AN1A 1RQMA 1PA3A 3O6TA 4TVEA 2PVOC 2FUG2 2JZRA 3L9UA 3M1GA 4KGIA 1MDKA 1ZL9A 2LJAA 2O7KA 1EV4A 1XCCA 5FHIA 1VF3A 4MA9A 3RHCA 4RQRA 4POMA 2DIZA 3UVHA 3VWWA 2F9SA 4DSSA 1EOHA 4MZBA 1Z4QA 1EOGA 4MNNA 2C0GA 5CNWA 2VL3A 4MZCA 1X9SB 4FYCA 1Z6NA 5ECNB 2MMZA 1Z6MA 2OA7A 1Z4KA 4PQ1A 3HVSA 1R26A 5LNKe 1TP9A 4RI6A 2YZUA 3IXRA 4JEDA 4WKWA 3H1NA 3DVWA 2B5YA 2H1DA 3L0HA 4K5SA 2HE3A 4GSTA 1G7OA 3GH6A 1TRWA 2J9HA 1URMA 2DC5A 3DEXA 4NPBA 5CYYA 3D5JA 4GF0A 2CX3A 1K0BA 4K8MA 4TR1B 2ALBA 4KSMA 2R6KA 5IIZA 3IC4A 1YFMA 4EUYA 5D9XA 3ED3A 2E7PA 4LL1B 3GV1A 3APSA 3VI5A 4GLTA 2XBIA 3D22A 3CI0K 1MEKA 3C73A 4FYBA 2QSIA 5J3RA 2H75A 5DBQA 1XW9A 5JCUA 4NHZA 5EL8A 3P7XA 2B7KA 2K18A 2H70A 1CQHA 3D6IA 1YZXA 3FW2A 3A5WA 5JWOB 4ZB8A 1J0FA 4N30A 1K0DA 3UL3A 1XOBA 4Q5NA 1XIYA 1B8XA 2CZ2A 2VM1A 1O6JA 3TKSC 2IMFA 4ID0A 3TRQA 2PN8A 3HHVA 1WIKA 4LL4B 2IMEA 4QL9A 3L78A 4EXJA 4MPFA 8GSSA 4XIHA 3ZYWA 1GRXA 1Z3EA 2H72A 3VWVA 3OCEA 4OO4A 1JLWA 4OO5A 2JAOA 5IMCA 1I0AA 2WJUA 4MABA 3W6GA 4DEJA 2VCXA 3O76A 1F3AA 4HU7A 3UBLA 1C3UA 1T4ZA 3ZZXA 2C3TA 1EP7A 3OR5A 2CT6A 1TRUA 4G0LA 5L71A 3EPTA 5KN3A 3MIXA 1SYRA 2V6KA 2CV4A 4PUAA 2FGXA 3LXZA 1PQNA 3TV2A 5G2ZA 5IMDA 2E0QA 4E8EA 1ML6A 1SKWB 2B5EA 4G10A 4MCUA 10GSA 3GIXA 1PGTA 3HVVA 1GULA 1OC3A 1PN9A 1PFOA 5CAXA 3H93A 3MNGA 1PL1A 1SKSB 2L59A 2DJKA 3GL5A 1T00A 2A2SA 2HYXA 2IPAA 2DKIA 2I81A 2X99A 3TJJA 2H71A 1B9XC 5ECLB 5IMZA 1AQWA 1WMJA 3ZL5A 1Z7RA 1RE5A 1XVWA 4O7HA 4AJ8A 3EWLA 1AUWA 3OCFA 3C8EA 1G6YA 3FKFA 3BCIA 2TIRA 5DQYA 1WP0A 2A2PA 1PX7A 3DVXA 1AIUA 5DCGA 2YWNA 2HSYA 2E9FA 5CO3A 2F8AA 2R37A 1A2JA 3ZREA 1G0TA 1KQ7A 3C8TA 1PRXA 3LFLA 1XWOA 4EL1A 1WE0A 5C04A 2H1GA 1BEDA 4IQJM 3EC3A 4HUAA 3EU4A 2KHPA 1SYXA 1BX9A 3TKPA 2RUFA 4OMVA 1BAYA 1TK5B 4ML1A 2F8FA 4KE3A 3GX0A 4I97A 1KEBA 2H0HA 1KTEA 4E88A 4K5RA 1YEPA 5DAKB 2PGTA 4MP4A 2MBSA 1GL8A 2OE1A 1OKDA 4PX1A 3VI7A 2QGVA 2VL2C 2VO4A 3L9VA 4NWYA 1IYIA 1OC8A 3EMPA 3IC8A 2CAIA 4AGSA 3UMAA 1QK8A 1YDKA 3M0FA 4WXTA 1W4VA 3E04A 2TRXA 3BCKA 5F06A 1V9WA 4V2LA 5F07A 3W8SA 3RPPA 3UARA 4F2IA 2IMIA 1Z4JA 3C71A 1TK0B 1V40A 5H5RA 5HFIA 1T4YA 1OC9A 2LJRA 4ECCA 2WGRA 3WT1A 4P3YB 2WCIA 1ZYNA 5H5SA 1VRSD 2VL9A 4F9ZA 1AC1A 1AXDA 1WWJA 3A2XA 1Y25A 2EIOA 2LEGA 3TJFA 4F03A 1FVJA 2AJQB 3M9KA 1WOUA 3Q18A 3QAVA 2YWOA 2VLUA 2VLVA 3QPMA 4ZIJA 4EO3A 2M80A 4MWOA 4LMVA 2HRKA 1QXHA 1GLPA 3DKSA 5G5FA 1O8WA 3IBHA 3G7IA 14GSA 1JZOA 5ECKB 1XWCA 3GZHA 2R3XA 1FUQA 2XC2A 4NV2A 1GSEA 5JCGA 1F3BA 4O32A 2K8VA 2CX4A 5BRTA 4K7OA 3LW9A 5KN2A 3TJKA 3APQA 1UA5A 5A4UA 4WETA 5ECMB 2EIQA 2NPBA 1GSYA 5J9CA 1YY7A 1V2AA 5IM9A 1PD21 1VDKA 2NDOA 2WDUA 3E3EA 3CQFA 1ACVA 2C0FA 1T7PB 4ZL9A 1DOFA 3ZTLA 2L4CA 1Y6EA 2KLXA 4YAVA 1ZGNA 3F4TA 2PTQA 3DGQA 2OE0A 3GN3A 4IS0A 3F3RA 2BMXA 2NBSA 1Z4MA 1M99A 3F6FA 22GSA 1V58A 1NW2A 4MJEA 1SK0A 4ZILA 3KH7A 1FOHA 4NHWA 3ZFBA 3TRPA 3QOUA 2VCQA 1K0OA 3SBCA 3RHBA 3DMLA 5ECHB 2C1YA 2VCTA 2FWFA 5INYA 3KD0A 2XHFA 1QUWA 1FO5A 1J3UA 5ID2B 2N5BA 1T3BA 2KP2A 5ENUA 2YWIA 3EU3A 2DBCA 5B6NA 1YJ6A 2MMOA 5A4VA 3J7Yk 3C1RA 2J23A 19GSA 4JR4A 3LEFA 4MK3A 2CAQA 3TKRA 3R6QA 1TJDA 4LLRA 1GSQA 5DDLA 3G7JA 5CREA 2C8UA 2IJYA 7GSSA 4KA0A 4ZBDA 3U13A 1XFLA 2V1MA 2YV7A 2GT5A 1JLVA 2VCVA 4NAXA 2H1BA 4EKZA 3FZ9A 3CMIA 4H86A 4WEYA 1FB6A 2X64A 1GUMA 3EYTA 5HFGA 2VD0A 2IIYA 3AY8A 1KNGA 1TKDB 2A4VA 4KB3A 1TRVA 2H66A 3HDCA 1AQVA 1XZOA 1GTUA 2AYTA 3FZ4A 4QL7A 3DIEA 2HZEA 4APAA 2OADA 5D9VA 4RI7A 5ELGA 1B4PA 3IDVA 2H01A 1BYEA 3F9UA 1EP8A 2IWTA 5C00A 4POLA 18GSA 2XBQA 3GSTA 5HQPA 4OWYA 3L9SA 2D2ZA 1ST9A 1X9WB 4K0GA 4ICYA 4IJIA 4YIKA 4KSOA 4Z2RA 1JZWA 4ISDA 4FQUA 4GWRA 1N2AA 3GTUB 3JCML 1HQOA 3HJMA 1XWKA 1M9AA 1X9MB 1U87A 3KGKA 2C3QA 2AHEA 4Z2TA 4GSNA 2VCZA 1S3RA 4FO5A 4KDXA 3WGEA 2V41A 1XXUA 5CRHA 3GURA 4YIHA 4I8BA 1GSSA 5LD0A 2A4HA 4E8HA 3UEMA 2KP1A 2BJXA 4KCEA 4OFNA 4MF7A 4IHUA 4IQ1A 2LRCA 4GQFA 4XS6A 3Q6OA 3HJOA 3KM6A 4JZQA 3DRNA 2VUPA 5E59A 2JZTA 3TDGA 4RUVA 3M9JA 1J08A 1K0AA 2IFQA 3VK9A 4IJ3A 3IA1A 3F8UA 2YJHA 5H5QA 4PURA 3FYGA 2MYGA 1OKTA 4MJBA 1XOAA 2QGAB 5J9BA 2LQOA 3C7MA 2H30A 4XRAA 1GSFA 1B4QA 2GSQA 4CY6A 2YP6A 1Q98A 3GKXA 2GSRA 4IBPA 1JZRA 2ON7A 1Z4IA 2FCHA 4N0ZA 1H4OA 5DQSA 4HQZA 4KW6A 1MDJA 3FR6A 1Q4JA 1QMVA 4DSRA 1SKRB 3N9JA 1THXA 4MUMA 2RIIA 3QD9A 1OYJA 2HT9A 1TI3A 1ZMAA 2AB6A 4L57A 3EE2A 5AIXA 5F0GA 1O81A 1PSQA 1O8XA 2JAUA 2HRNA 5F92A 2D27A 2FHEA 6GSXA 1UN2A 2CQ9A 5G1KA 4V1Ag 1Q5NA 4GSSA 4IN0A 5DCHA 3F63A 2NVLA 2TRCP 2M72A 2R0CA 5IQYA 2C80A 4K7IA 1YF1A 2HSMA 4PNFA 4F0BA 3VPQA 2YV9A 4HOJA 2GDRA 2A2RA 4D73A 3H79A 2K6VA 1FVKA 4EIPA 2CVKA 1NHYA 4BVXA 1PX6A 2R2JA 2AUVA 3LJRA 3D21A 2QA1A 1T1VA 4POBA 6GSWA 4TXOA 4G19A 2FA4A 1SJZA 4XS4B
chains in the Genus database with same CATH topology
5F05A 5KOXA 3KEBA 4MH2A 3BD2A 4TN8A 1O85A 4JR6A 3GH9A 4KF9A 2YN1A 1TDIA 2OBKA 1QGVA 4Z7XA 4G0KA 2X8CA 2H6XA 1H75A 2HRFA 3UIWA 2OE3A 4BL7B 3P2AA 1ERTA 3TUEA 1FW1A 4OCFA 5FWGA 3I43A 1SL1B 1GTIA 2OACA 3D0ZA 3P8WA 4ZL8A 2H6ZA 1Z9HA 3LGCA 5DALB 3I6AA 1WJKA 1ZCPA 5COHA 4PQIA 1DE1A 1M9BA 4I5QA 3Q19A 5IOXA 1HNAA 1U88A 16GSA 4EC0A 4BPYA 4HEA2 3QAGA 3G9BA 2H74A 3MWHA 4TR0A 1K3LA 4IGJA 4ECIA 4EVMA 11GSA 1I9DA 2JADA 2O8VB 3FHKA 4HJ2A 4TOPA 1S3AA 2VD1A 3HD5A 2BTOT 2EC4A 3WT2A 2B1KA 4WF4A 4YQVA 5D9TA 4K1FA 1ZOFA 2R5GA 1SL2B 1USBA 3LQ7A 1X0RA 2E2MA 5B7CA 3CRUA 2REMA 4F0CA 3PH9A 2GQLA 5GAND 4L5LA 3N5OA 3TOUA 1PN0A 4OD7A 2AAWA 1U3IA 4XCSA 3DWVA 4I6XA 1SJIA 2CVDA 2UZ8A 3V1WA 5KN0A 2P0GA 2O85A 3ZFLA 3UBKA 3NOFA 2GQMA 2QKEA 3CYNA 1TXXA 2DKHA 5J5NA 4X4JA 2X8GA 4IELA 2LSTA 1OE8A 4DSSB 3VWUA 2IMDA 4N11A 2LJKA 3HZ8A 3TCOA 3CRTA 3A2WA 1PKWA 5IPHA 1A0FA 3LORA 2GZZA 4ZBAA 2DMLA 1LJRA 3WGXA 2OKAA 3US3A 5A4WA 4ULXA 2DJ1A 2FWEA 2WS2A 2JSYA 3ZMKA 4QQ7A 3UJ1A 1U3AA 4HZ4A 4TR4A 3NZNA 3I9V2 5ECOB 4PUFC 4FYUA 5HR3A 5B8BA 1KBNA 2H1AA 2IMKA 2WULA 2KUCA 1A24A 1K3YA 1ERUA 1BQ7A 3LYPA 5EY6A 5J4UA 1BJXA 3QR6A 4XRDA 3TRXA 2CVBA 5GSSA 4ILFA 2B1LA 1SJ6A 2RM5A 3QFAC 4HZ2A 3A3TA 2DJ3A 2PUKC 4MJCA 5EPFA 5ECRB 1A23A 5D73A 1YKAA 4J56E 3WYWA 3CTGA 1YQ1A 4L5OA 4J57E 1J9BA 1T8EB 2C4JA 3FEUA 5F8BA 2HI7A 1ERWA 2GQKA 2GTUA 3KTLA 4ML6A 4MF6A 2FWGA 2VOCA 3LWAA 4GXZA 1B9YC 3U6VA 1I5GA 2B3SA 1EEJA 1IW7D 4V2NA 4EDYA 5B6MA 4K0NA 2DJJA 2LNSA 3MSZA 5G5EA 4PTSA 3ERWA 2FWHA 3VFIA 3TJBA 5ECSA 2ZNMA 1YF0A 5IMFA 2XPDA 4LA1A 3IOSA 3IRAA 2C0DA 3GX8A 4GRFA 2FLSA 4KDYA 1RK4A 2YZHA 3C1SA 4HJMA 1G7EA 5KN1A 1DBYA 1JZDA 5JWQB 4OFTA 3ZIVA 5KEJA 2B7JA 4MF5A 5IPGA 17GSA 4L8EA 3GFKA 4MH3A 3LXTA 1ON4A 2P5RA 4CHSA 1SK1A 4WF5A 1AAZA 4IP6A 4MPGA 4KUNA 4HU9A 2VIMA 2LQQA 1M0UA 3UAPA 5D96A 3P90A 2D28C 3TKSA 1C72A 1PL2A 2LKUA 1GSUA 5ECQB 6GSVA 4LMWA 2O87A 1DUGA 5ELAA 2PU9C 1TTZA 2F51A 2V2GA 3M8NA 2GZPA 3IAM2 4O5UA 4IKHA 1AUCA 1JHBA 2LNTA 1XPVA 4BA7A 5LCZA 1M7TA 3APOA 2FNOA 3FRCA 1X5CA 4ZB6A 4HI7A 1GWCA 4GTUA 2WZ9A 4CW9A 1QQ2A 5GAPD 2L5OA 5CRGA 5E4WA 3GNJA 2PVQA 4TR3A 1VF4A 2K8SA 3HVXA 1V98A 1HYUA 2MMNA 4KAEA 3UOMA 1SD8A 4TKYA 2C3NA 2GLRA 3IHGA 1K0CA 5DAKA 3LYKA 5HR0A 2N5FA 5JCWA 3GYKA 2H19A 3FR3A 3GRXA 4TW5A 4AF2A 4TRXA 2H6YA 3VLNA 1EV9A 2K9FA 13GSA 4G2EA 1RW1A 3H8QA 3PPUA 2I4AA 2L4QA 3O3TA 1OC9B 3MAKA 4ZL7A 3ERGA 2R0PA 3D4MA 3EURA 4NV5A 2ZCTA 1UC7A 1OE7A 3ZVJA 2PPTA 3UVTA 4NXIA 2YWMA 2HRAA 3IK9A 2IL3A 1F2EA 2H8LA 4PGTA 4OFMA 1DSBA 3QAWA 4MZWA 2CZ3A 1SENA 3S9FA 2GT6A 1PMTA 3BBYA 3LG6A 2MMAA 4YKFA 1GTBA 4TXVA 1TU7A 4J2FA 2IN3A 2LS5A 1MD4A 2OBIA 1GUHA 4IP1A 2JSZA 2VL2A 4ZBBA 6GSTA 3GMFA 3VWXA 5G30A 1VF1A 2YNXA 3GKMA 5ECIB 4JRRA 1AQXA 2YPMA 4X1UA 4V2MA 4EDZA 3QMXA 1XVQA 4FIWA 1A8YA 3E9JB 1TOFA 2V32A 3TJGA 5IMAA 4N0VA 3FY7A 1Z7PA 1E2YA 2H0IA 4IW9A 2GZYA 2V6OA 3W8JA 5B8AA 1GNEA 3KZQA 4NMUA 1FAAA 2X49A 2XPEA 2MZCA 1GH2A 3R2QA 4WBRD 6GSYA 1G6WA 1TU8A 1E6BA 4X43A 2FA8A 3E0UA 2ES7A 2JZSA 5JWRB 2GSSA 2YOIA 3ZMLA 3PGTA 4AJ7A 4I2UA 5BMUA 1QFNA 4USSA 1THOA 3DXBA 2QA2A 5EVOA 3TGZA 3IK7A 1N8JA 2HNLA 3U5RE 9GSSA 3IPZA 4POKA 2PERA 4CDOA 4BVYA 2M46A 3HY2A 4IVFA 1EGRA 2PMTA 5IOWA 20GSA 1TW9A 2HFDA 3GSSA 5ID2A 4F82A 2R0GA 1GLQA 2N5AA 1SK2A 3WGDA 3F4SA 1R5PA 3SWLA 4XTSA 2HSHA 4O5RA 1FHEA 5AISA 4MJAA 3IR4A 4JE1A 6GSUA 3FR9A 1M2AA 2PWJA 1AW9A 1M2BA 2RM6A 1NHOA 3GA4A 1A0RP 2E2GA 2GGTA 2Z9SA 4PNGA 5KOWA 3MDKA 2H73A 3KMOA 3IV4A 3CXGA 3GL3A 1GTAA 1R4WA 3KXOA 3VURA 3F0IA 3ISOA 3WD6A 2MBTA 3H4KA 1NSWA 3GHAA 1K3OA 1YEXA 4PXOA 2HZEB 3GKNA 1F37A 1M2DA 3ME8A 4KCAA 5DJMA 4EIQA 2RUEA 1HD2A 4K6XA 1YKCA 2YJ7A 1MTCA 3I69A 2DJ0A 5G31A 4KX4A 2RLIA 5CP1A 1WPIA 3F3QA 1XBSA 3F6DA 1CQGA 2PBJA 4KH7A 2HZFA 2GVPA 1TK8B 4Q5RA 3KTBA 12GSA 2DLXA 4I2TA 3M3MA 3CSJA 3KP9A 1U6TA 1GP1A 1K0NA 3RBTA 1EGOA 1R7HA 4O92A 1WRYA 3KMNA 2H0GA 3GTUA 2G2QA 1ZYEA 1F9MA 3PR8A 1GNWA 2I9HA 3TKQA 1FOVA 3EINA 2P31A 2OJLA 4ECJA 4Z2UA 3F4RA 2ON5A 3ZVJD 2X4AA 4Q5FA 1ZYQB 1TRSA 3GUSA 4XHMA 4DSQA 3J7Yb 5IMVA 4DVCA 2IFQB 2VCWA 3KIJA 2VLTA 3IHQA 5GZZB 2CA8A 1Z5YE 2VM2A 2ZUPA 1O73A 2QC7A 2L6CA 4YQMA 5GSTA 3RPNA 1XW6A 2G0FA 3HKRA 4BWSA 1TI1A 5DJLA 4MLYA 5D93A 3ERFA 5CRWA 1A2MA 2L6DA 3ZRDA 2HXKA 1GUKA 4TR1A 1XWBA 1FB0A 1X5DA 1MD3A 2DSAA 1PKZA 3LSZA 2YANA 4K9ZA 3IAS2 1OAZA 2DIYA 3L4NA 4K2XA 1S3DA 4YH2A 4G9HA 1VF2A 3QDNA 3BJ5A 1K0MA 1ABAA 3A2VA 3KH9A 5J41A 2AV4A 1XWAA 3KJYA 6GSSA 4ACSA 3FK8A 2WB9A 1LU4A 1O7UA 2B5XA 4JBBA 2GSTA 2F3MA 1XWGA 2WRTA 2P5QA 5FT3A 4D73B 3ME7A 1V57A 3HA9A 3DD3A 1ILOA 2GS3A 5DVBA 3TOTA 3FZAA 4K7NA 2FY6A 4MDCA 4HS1A 4BVXB 1JFUA 3CSIA 4YAPA 1LBKA 4TXOB 4ZXGA 1NM3A 3HCZA 1IYHA 2LRNA 1W89A 2JL4A 3ZIJA 2JACA 1X5EA 3RDWA 3MYDA 5HR1A 4WR5A 3CTFA 3GKKA 4PQHA 1EZKA 3HXSA 1B48A 4V1Ap 1ERVA 4XS4A 5ECPB 2HLSA 1HNCA 1OVNA 2LRTA 3K8NA 2KOKA 3KP8A 3ZLPA 4BVYB 4IQAA 1F6MC 4EE0A 1EEMA 5AIVA 4OCEA 3HJPA 1SU9A 4KDUA 5IO0A 3R3EA 1FG4A 2VAFA 5D9WA 1R5AA 4G0IA 2EIRA 2DMMA 3FMWA 3EMXA 3D4TA 4L0UA 3IE3A 1BG5A 2JU5A 4RQXA 4ECBA 4BL7A 1HNBA 4AJ6A 2L5LA 4FH8A 3PINA 2L57A 3Q74A 5HFKA 1SD9A 3BOAA 1S3CA 5DALA 2DJ2A 2LTKA 4EF0A 5CRDA 4CY8A 2C0EA 4WR4A 3DYRA 4JU5A 4ZB9A 4YQUA 3ZITA 2H76A 3TB2A 4HQSA 3RAZA 4YKGA 4GQCA 2I1UA 5AGYA 4BWQA 3VPTA 1ZYPA 1MDIA 3EVIA 3FZ5A 5HR2A 1DE2A 2B6MA 1SL0B 2FD3A 4WBJA 2LV3A 3HYPA 3QFBC 3TKSE 4N10A 3CBUA 5IO2A 1XW5A 1A8LA 5ABRA 3G7YA 4Q5QA 2WFCA 3KCMA 4HDEA 4O5QA 3NIVA 4A5PA 1VGLA 4KNDA 1UVZA 4K2DA 4GCIA 5G1LA 3QCPA 4L0WA 2O89A 2R4VA 2LUSA 2X8HA 4MMMA 5A5KA 2NTOA 4X0XA 4XS1A 2I3YA 3HZ4A 3CSHA 5D8IA 1EWXA 2YCDA 1ZZYA 3A5IA 1A2LA 1GSDA 5AN1A 1RQMA 1PA3A 3O6TA 4TVEA 2PVOC 2FUG2 2JZRA 3L9UA 3M1GA 4KGIA 1MDKA 1ZL9A 2LJAA 2O7KA 1EV4A 1XCCA 5FHIA 1VF3A 4MA9A 3RHCA 4RQRA 4POMA 2DIZA 3UVHA 3VWWA 2F9SA 4DSSA 1EOHA 4MZBA 1EOGA 4MNNA 2C0GA 5CNWA 2VL3A 4MZCA 1X9SB 4FYCA 1Z6NA 5ECNB 2MMZA 1Z6MA 2OA7A 4PQ1A 3HVSA 1R26A 5LNKe 1TP9A 4RI6A 2YZUA 3IXRA 4JEDA 4WKWA 3H1NA 3DVWA 2B5YA 2H1DA 3L0HA 4K5SA 2HE3A 4GSTA 1G7OA 3GH6A 1TRWA 2J9HA 1URMA 2DC5A 3DEXA 4NPBA 5CYYA 3D5JA 4GF0A 2CX3A 1K0BA 4K8MA 4TR1B 2ALBA 4KSMA 2R6KA 5IIZA 3IC4A 4EUYA 5D9XA 3ED3A 2E7PA 4LL1B 3GV1A 3APSA 3VI5A 4GLTA 2XBIA 3D22A 1MEKA 3C73A 4FYBA 2QSIA 5J3RA 2H75A 5DBQA 1XW9A 5JCUA 4NHZA 5EL8A 3P7XA 2B7KA 2K18A 2H70A 1CQHA 3D6IA 1YZXA 3FW2A 3A5WA 5JWOB 4ZB8A 1J0FA 4N30A 1K0DA 3UL3A 1XOBA 4Q5NA 1XIYA 1B8XA 2CZ2A 2VM1A 1O6JA 3TKSC 2IMFA 4ID0A 3TRQA 2PN8A 3HHVA 1WIKA 4LL4B 2IMEA 4QL9A 3L78A 4EXJA 4MPFA 8GSSA 4XIHA 3ZYWA 1GRXA 1Z3EA 2H72A 3VWVA 4OO4A 1JLWA 4OO5A 5IMCA 2WJUA 4MABA 3W6GA 4DEJA 2VCXA 3O76A 1F3AA 4HU7A 3UBLA 1T4ZA 3ZZXA 2C3TA 1EP7A 3OR5A 2CT6A 1TRUA 4G0LA 5L71A 3EPTA 5KN3A 3MIXA 1SYRA 2V6KA 2CV4A 4PUAA 2FGXA 3LXZA 1PQNA 5G2ZA 5IMDA 2E0QA 4E8EA 1ML6A 1SKWB 2B5EA 4G10A 4MCUA 10GSA 3GIXA 1PGTA 3HVVA 1GULA 1OC3A 1PN9A 5CAXA 3H93A 3MNGA 1PL1A 1SKSB 2L59A 2DJKA 3GL5A 1T00A 2A2SA 2HYXA 2IPAA 2DKIA 2I81A 2X99A 3TJJA 2H71A 1B9XC 5ECLB 5IMZA 1AQWA 1WMJA 3ZL5A 1Z7RA 1XVWA 4O7HA 4AJ8A 3EWLA 3C8EA 1G6YA 3BCIA 3FKFA 2TIRA 5DQYA 1WP0A 2A2PA 1PX7A 3DVXA 1AIUA 5DCGA 2YWNA 2HSYA 5CO3A 2F8AA 2R37A 1A2JA 3ZREA 1G0TA 1PRXA 3LFLA 4EL1A 1WE0A 5C04A 2H1GA 1BEDA 4IQJM 3EC3A 4HUAA 3EU4A 2KHPA 1SYXA 1BX9A 3TKPA 2RUFA 4OMVA 1BAYA 1TK5B 4ML1A 2F8FA 4KE3A 3GX0A 4I97A 1KEBA 2H0HA 1KTEA 4K5RA 1YEPA 5DAKB 2PGTA 4MP4A 2MBSA 1GL8A 2OE1A 1OKDA 4PX1A 3VI7A 2QGVA 2VL2C 2VO4A 3L9VA 4NWYA 1IYIA 1OC8A 3EMPA 3IC8A 2CAIA 4AGSA 3UMAA 1QK8A 1YDKA 3M0FA 4WXTA 1W4VA 2TRXA 3BCKA 5F06A 1V9WA 4V2LA 5F07A 3W8SA 3RPPA 3UARA 4F2IA 2IMIA 3C71A 1TK0B 1V40A 5H5RA 5HFIA 1T4YA 1OC9A 2LJRA 4ECCA 2WGRA 3WT1A 4P3YB 2WCIA 1ZYNA 5H5SA 1VRSD 2VL9A 4F9ZA 1AC1A 1AXDA 1WWJA 3A2XA 1Y25A 2EIOA 2LEGA 3TJFA 4F03A 1FVJA 2AJQB 3M9KA 1WOUA 3Q18A 3QAVA 2YWOA 2VLUA 2VLVA 3QPMA 4ZIJA 4EO3A 2M80A 4LMVA 2HRKA 1QXHA 1GLPA 3DKSA 5G5FA 1O8WA 3IBHA 3G7IA 14GSA 1JZOA 5ECKB 1XWCA 2R3XA 2XC2A 4NV2A 1GSEA 5JCGA 1F3BA 4O32A 2K8VA 2CX4A 5BRTA 4K7OA 3LW9A 5KN2A 3TJKA 3APQA 1UA5A 5A4UA 4WETA 5ECMB 2EIQA 2NPBA 1GSYA 5J9CA 1YY7A 1V2AA 5IM9A 1PD21 2NDOA 2WDUA 3E3EA 1ACVA 2C0FA 1T7PB 4ZL9A 3ZTLA 2L4CA 1Y6EA 2KLXA 4YAVA 1ZGNA 3F4TA 3DGQA 2OE0A 3GN3A 4IS0A 3F3RA 2BMXA 2NBSA 1M99A 3F6FA 22GSA 1V58A 1NW2A 4MJEA 1SK0A 4ZILA 3KH7A 1FOHA 4NHWA 3ZFBA 3TRPA 3QOUA 2VCQA 1K0OA 3SBCA 3RHBA 3DMLA 5ECHB 2C1YA 2VCTA 2FWFA 5INYA 3KD0A 2XHFA 1QUWA 1FO5A 5ID2B 2N5BA 1T3BA 2KP2A 5ENUA 2YWIA 3EU3A 2DBCA 5B6NA 1YJ6A 2MMOA 5A4VA 3J7Yk 3C1RA 2J23A 19GSA 4JR4A 3LEFA 4MK3A 2CAQA 3TKRA 1TJDA 4LLRA 1GSQA 5DDLA 3G7JA 5CREA 2C8UA 2IJYA 7GSSA 4KA0A 4ZBDA 1XFLA 2V1MA 2YV7A 2GT5A 1JLVA 2VCVA 4NAXA 2H1BA 4EKZA 3FZ9A 3CMIA 4H86A 4WEYA 1FB6A 2X64A 1GUMA 3EYTA 5HFGA 2VD0A 2IIYA 3AY8A 1KNGA 1TKDB 2A4VA 4KB3A 1TRVA 2H66A 3HDCA 1AQVA 1XZOA 1GTUA 2AYTA 3FZ4A 4QL7A 3DIEA 2HZEA 5D9VA 2OADA 4RI7A 5ELGA 1B4PA 3IDVA 2H01A 1BYEA 3F9UA 1EP8A 2IWTA 5C00A 4POLA 18GSA 2XBQA 3GSTA 5HQPA 4OWYA 3L9SA 2D2ZA 1ST9A 1X9WB 4K0GA 4ICYA 4IJIA 4KSOA 4Z2RA 1JZWA 4ISDA 4FQUA 4GWRA 1N2AA 3GTUB 3JCML 1HQOA 3HJMA 1XWKA 1M9AA 1X9MB 1U87A 3KGKA 2C3QA 2AHEA 4Z2TA 4GSNA 2VCZA 4FO5A 4KDXA 3WGEA 2V41A 1XXUA 5CRHA 3GURA 4I8BA 1GSSA 5LD0A 2A4HA 4E8HA 3UEMA 2KP1A 2BJXA 4KCEA 4OFNA 4MF7A 4IHUA 4IQ1A 2LRCA 4GQFA 4XS6A 3Q6OA 3HJOA 3KM6A 4JZQA 3DRNA 2VUPA 5E59A 2JZTA 3TDGA 4RUVA 3M9JA 1J08A 1K0AA 2IFQA 3VK9A 4IJ3A 3IA1A 3F8UA 2YJHA 5H5QA 4PURA 3FYGA 2MYGA 1OKTA 4MJBA 1XOAA 5J9BA 2LQOA 3C7MA 2H30A 4XRAA 1GSFA 1B4QA 2GSQA 4CY6A 2YP6A 1Q98A 3GKXA 2GSRA 4IBPA 1JZRA 2ON7A 2FCHA 4N0ZA 1H4OA 5DQSA 4HQZA 4KW6A 1MDJA 3FR6A 1Q4JA 1QMVA 4DSRA 1SKRB 3N9JA 1THXA 2RIIA 3QD9A 1OYJA 2HT9A 1TI3A 1ZMAA 2AB6A 3EE2A 5AIXA 5F0GA 1O81A 1PSQA 1O8XA 2HRNA 2D27A 2FHEA 6GSXA 1UN2A 2CQ9A 5G1KA 4V1Ag 4GSSA 4IN0A 5DCHA 3F63A 2NVLA 2TRCP 2M72A 2R0CA 5IQYA 2C80A 4K7IA 1YF1A 2HSMA 4PNFA 4F0BA 3VPQA 2YV9A 4HOJA 2GDRA 2A2RA 4D73A 3H79A 2K6VA 1FVKA 4EIPA 2CVKA 1NHYA 4BVXA 1PX6A 2R2JA 2AUVA 3LJRA 3D21A 2QA1A 1T1VA 4POBA 6GSWA 4TXOA 4G19A 2FA4A 1SJZA 4XS4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F05 A;  3KEB A;  4MH2 A;  3BD2 A;  4TN8 A;  1O85 A;  4JR6 A;  3GH9 A;  2YN1 A;  1TDI A;  2OBK A;  1QGV A;  4Z7X A;  2X8C A;  2H6X A;  1H75 A;  2HRF A;  3UIW A;  2OE3 A;  3P2A A;  1ERT A;  3TUE A;  1FW1 A;  4OCF A;  5FWG A;  3I43 A;  1SL1 B;  1GTI A;  2OAC A;  3D0Z A;  3P8W A;  4ZL8 A;  2H6Z A;  1Z9H A;  3LGC A;  5DAL B;  3I6A A;  1WJK A;  1ZCP A;  5COH A;  4PQI A;  1DE1 A;  1M9B A;  4I5Q A;  3Q19 A;  5IOX A;  1HNA A;  1U88 A;  16GS A;  4EC0 A;  4BPY A;  4HEA 2;  3QAG A;  3G9B A;  2H74 A;  3MWH A;  4TR0 A;  1K3L A;  4IGJ A;  4ECI A;  4EVM A;  11GS A;  1I9D A;  2JAD A;  2O8V B;  3FHK A;  4HJ2 A;  4TOP A;  1S3A A;  2VD1 A;  3HD5 A;  2BTO T;  2EC4 A;  3WT2 A;  2B1K A;  4WF4 A;  4YQV A;  5D9T A;  4K1F A;  1ZOF A;  2R5G A;  1SL2 B;  1USB A;  3LQ7 A;  1X0R A;  2E2M A;  5B7C A;  3CRU A;  2REM A;  4F0C A;  3PH9 A;  2GQL A;  5GAN D;  4L5L A;  3N5O A;  3TOU A;  4OD7 A;  2AAW A;  1U3I A;  4XCS A;  3DWV A;  4I6X A;  1SJI A;  2CVD A;  3V1W A;  5KN0 A;  2P0G A;  2O85 A;  3ZFL A;  3UBK A;  3NOF A;  2GQM A;  2QKE A;  3CYN A;  1TXX A;  5J5N A;  2X8G A;  4IEL A;  2LST A;  1OE8 A;  4DSS B;  3VWU A;  2IMD A;  4N11 A;  2LJK A;  3HZ8 A;  3TCO A;  3CRT A;  3A2W A;  1PKW A;  5IPH A;  1A0F A;  3LOR A;  2GZZ A;  4ZBA A;  2DML A;  1LJR A;  3WGX A;  2OKA A;  3US3 A;  5A4W A;  4ULX A;  2DJ1 A;  2FWE A;  2WS2 A;  2JSY A;  3ZMK A;  4QQ7 A;  3UJ1 A;  1U3A A;  4HZ4 A;  4TR4 A;  3NZN A;  3I9V 2;  5ECO B;  4PUF C;  4FYU A;  5HR3 A;  5B8B A;  1KBN A;  2H1A A;  2IMK A;  2WUL A;  2KUC A;  1A24 A;  1K3Y A;  1ERU A;  1BQ7 A;  3LYP A;  5EY6 A;  5J4U A;  1BJX A;  3QR6 A;  4XRD A;  3TRX A;  2CVB A;  5GSS A;  4ILF A;  2B1L A;  1SJ6 A;  2RM5 A;  3QFA C;  4HZ2 A;  3A3T A;  2DJ3 A;  2PUK C;  4MJC A;  5EPF A;  5ECR B;  1A23 A;  5D73 A;  1YKA A;  4J56 E;  3WYW A;  3CTG A;  1YQ1 A;  4L5O A;  4J57 E;  1J9B A;  1T8E B;  2C4J A;  3FEU A;  5F8B A;  2HI7 A;  1ERW A;  2GQK A;  2GTU A;  3KTL A;  4ML6 A;  4MF6 A;  2FWG A;  2VOC A;  3LWA A;  4GXZ A;  1B9Y C;  3U6V A;  1I5G A;  2B3S A;  1EEJ A;  4V2N A;  4EDY A;  5B6M A;  4K0N A;  2DJJ A;  2LNS A;  3MSZ A;  5G5E A;  3ERW A;  2FWH A;  3VFI A;  3TJB A;  5ECS A;  2ZNM A;  1YF0 A;  5IMF A;  2XPD A;  4LA1 A;  3IOS A;  3IRA A;  2C0D A;  3GX8 A;  4GRF A;  2FLS A;  4KDY A;  1RK4 A;  2YZH A;  3C1S A;  4HJM A;  1G7E A;  5KN1 A;  1DBY A;  1JZD A;  5JWQ B;  4OFT A;  3ZIV A;  5KEJ A;  2B7J A;  4MF5 A;  5IPG A;  17GS A;  4L8E A;  3GFK A;  4MH3 A;  3LXT A;  1ON4 A;  2P5R A;  4CHS A;  1SK1 A;  4WF5 A;  1AAZ A;  4IP6 A;  4MPG A;  4KUN A;  4HU9 A;  2VIM A;  2LQQ A;  1M0U A;  3UAP A;  5D96 A;  3P90 A;  3TKS A;  1C72 A;  1PL2 A;  2LKU A;  1GSU A;  5ECQ B;  6GSV A;  4LMW A;  2O87 A;  1DUG A;  5ELA A;  2PU9 C;  1TTZ A;  2F51 A;  2V2G A;  3M8N A;  2GZP A;  3IAM 2;  4IKH A;  1AUC A;  1JHB A;  2LNT A;  1XPV A;  4BA7 A;  5LCZ A;  1M7T A;  3APO A;  2FNO A;  3FRC A;  1X5C A;  4ZB6 A;  4HI7 A;  1GWC A;  4GTU A;  2WZ9 A;  4CW9 A;  1QQ2 A;  5GAP D;  2L5O A;  5CRG A;  5E4W A;  3GNJ A;  2PVQ A;  4TR3 A;  1VF4 A;  2K8S A;  3HVX A;  1V98 A;  1HYU A;  2MMN A;  4KAE A;  3UOM A;  1SD8 A;  4TKY A;  2C3N A;  2GLR A;  1K0C A;  5DAK A;  3LYK A;  5HR0 A;  2N5F A;  5JCW A;  3GYK A;  2H19 A;  3FR3 A;  3GRX A;  4TW5 A;  4AF2 A;  4TRX A;  2H6Y A;  3VLN A;  1EV9 A;  2K9F A;  13GS A;  4G2E A;  1RW1 A;  3H8Q A;  2I4A A;  2L4Q A;  3O3T A;  1OC9 B;  3MAK A;  4ZL7 A;  3ERG A;  3D4M A;  3EUR A;  4NV5 A;  2ZCT A;  1UC7 A;  1OE7 A;  3ZVJ A;  2PPT A;  3UVT A;  4NXI A;  2YWM A;  3IK9 A;  2IL3 A;  1F2E A;  2H8L A;  4PGT A;  4OFM A;  1DSB A;  3QAW A;  4MZW A;  2CZ3 A;  1SEN A;  3S9F A;  2GT6 A;  1PMT A;  3BBY A;  3LG6 A;  2MMA A;  1GTB A;  4TXV A;  1TU7 A;  4J2F A;  2IN3 A;  2LS5 A;  1MD4 A;  2OBI A;  1GUH A;  4IP1 A;  2JSZ A;  2VL2 A;  4ZBB A;  6GST A;  3GMF A;  3VWX A;  5G30 A;  1VF1 A;  2YNX A;  3GKM A;  5ECI B;  4JRR A;  1AQX A;  2YPM A;  4X1U A;  4V2M A;  4EDZ A;  3QMX A;  1XVQ A;  4FIW A;  1A8Y A;  3E9J B;  1TOF A;  2V32 A;  3TJG A;  5IMA A;  4N0V A;  3FY7 A;  1Z7P A;  1E2Y A;  2H0I A;  4IW9 A;  2GZY A;  2V6O A;  3W8J A;  5B8A A;  1GNE A;  3KZQ A;  4NMU A;  1FAA A;  2XPE A;  2MZC A;  1GH2 A;  3R2Q A;  4WBR D;  6GSY A;  1G6W A;  1TU8 A;  1E6B A;  4X43 A;  2FA8 A;  3E0U A;  2ES7 A;  2JZS A;  5JWR B;  2GSS A;  2YOI A;  3ZML A;  3PGT A;  4AJ7 A;  4I2U A;  1QFN A;  1THO A;  3DXB A;  5EVO A;  3TGZ A;  3IK7 A;  1N8J A;  2HNL A;  3U5R E;  9GSS A;  3IPZ A;  4POK A;  2PER A;  4CDO A;  4BVY A;  2M46 A;  3HY2 A;  4IVF A;  1EGR A;  2PMT A;  5IOW A;  20GS A;  1TW9 A;  2HFD A;  3GSS A;  5ID2 A;  4F82 A;  1GLQ A;  2N5A A;  1SK2 A;  3WGD A;  3F4S A;  1R5P A;  3SWL A;  4XTS A;  2HSH A;  4O5R A;  1FHE A;  5AIS A;  4MJA A;  3IR4 A;  4JE1 A;  6GSU A;  3FR9 A;  1M2A A;  2PWJ A;  1AW9 A;  1M2B A;  2RM6 A;  1NHO A;  3GA4 A;  1A0R P;  2E2G A;  2GGT A;  2Z9S A;  4PNG A;  3MDK A;  2H73 A;  3KMO A;  3IV4 A;  3CXG A;  3GL3 A;  1GTA A;  1R4W A;  3KXO A;  3VUR A;  3F0I A;  3ISO A;  3WD6 A;  2MBT A;  3H4K A;  1NSW A;  3GHA A;  1K3O A;  1YEX A;  4PXO A;  2HZE B;  3GKN A;  1F37 A;  1M2D A;  3ME8 A;  4KCA A;  5DJM A;  2RUE A;  1HD2 A;  4K6X A;  1YKC A;  2YJ7 A;  1MTC A;  3I69 A;  2DJ0 A;  5G31 A;  4KX4 A;  2RLI A;  5CP1 A;  1WPI A;  3F3Q A;  1XBS A;  3F6D A;  1CQG A;  2PBJ A;  4KH7 A;  2HZF A;  2GVP A;  1TK8 B;  4Q5R A;  3KTB A;  12GS A;  2DLX A;  4I2T A;  3M3M A;  3CSJ A;  3KP9 A;  1U6T A;  1GP1 A;  1K0N A;  3RBT A;  1EGO A;  1R7H A;  4O92 A;  1WRY A;  3KMN A;  2H0G A;  3GTU A;  2G2Q A;  1ZYE A;  1F9M A;  3PR8 A;  1GNW A;  2I9H A;  3TKQ A;  1FOV A;  3EIN A;  2P31 A;  2OJL A;  4ECJ A;  3F4R A;  2ON5 A;  3ZVJ D;  4Q5F A;  1ZYQ B;  1TRS A;  3GUS A;  4XHM A;  4DSQ A;  3J7Y b;  5IMV A;  4DVC A;  2IFQ B;  2VCW A;  3KIJ A;  2VLT A;  3IHQ A;  5GZZ B;  2CA8 A;  1Z5Y E;  2VM2 A;  2ZUP A;  1O73 A;  2QC7 A;  2L6C A;  4YQM A;  5GST A;  3RPN A;  1XW6 A;  2G0F A;  3HKR A;  4BWS A;  1TI1 A;  5DJL A;  4MLY A;  5D93 A;  3ERF A;  5CRW A;  1A2M A;  2L6D A;  3ZRD A;  2HXK A;  1GUK A;  4TR1 A;  1XWB A;  1FB0 A;  1X5D A;  1MD3 A;  2DSA A;  1PKZ A;  3LSZ A;  2YAN A;  4K9Z A;  3IAS 2;  1OAZ A;  2DIY A;  3L4N A;  1S3D A;  4YH2 A;  4G9H A;  1VF2 A;  3QDN A;  3BJ5 A;  1K0M A;  1ABA A;  3A2V A;  3KH9 A;  5J41 A;  2AV4 A;  1XWA A;  3KJY A;  6GSS A;  4ACS A;  3FK8 A;  2WB9 A;  1LU4 A;  1O7U A;  2B5X A;  4JBB A;  2GST A;  2F3M A;  1XWG A;  2WRT A;  2P5Q A;  5FT3 A;  4D73 B;  3ME7 A;  1V57 A;  3HA9 A;  3DD3 A;  1ILO A;  2GS3 A;  5DVB A;  3TOT A;  3FZA A;  4K7N A;  2FY6 A;  4MDC A;  4HS1 A;  1JFU A;  3CSI A;  4YAP A;  1LBK A;  4TXO B;  4ZXG A;  1NM3 A;  3HCZ A;  1IYH A;  2LRN A;  1W89 A;  2JL4 A;  3ZIJ A;  2JAC A;  1X5E A;  3RDW A;  5HR1 A;  4WR5 A;  3CTF A;  3GKK A;  4PQH A;  1EZK A;  3HXS A;  1B48 A;  4V1A p;  1ERV A;  4XS4 A;  5ECP B;  2HLS A;  1HNC A;  1OVN A;  2LRT A;  3K8N A;  2KOK A;  3KP8 A;  3ZLP A;  4IQA A;  1F6M C;  4EE0 A;  1EEM A;  5AIV A;  4OCE A;  3HJP A;  1SU9 A;  4KDU A;  5IO0 A;  1FG4 A;  2VAF A;  5D9W A;  1R5A A;  2EIR A;  2DMM A;  3EMX A;  3D4T A;  4L0U A;  3IE3 A;  1BG5 A;  2JU5 A;  4RQX A;  4ECB A;  4BL7 A;  1HNB A;  4AJ6 A;  2L5L A;  4FH8 A;  3PIN A;  2L57 A;  3Q74 A;  5HFK A;  1SD9 A;  3BOA A;  1S3C A;  5DAL A;  2DJ2 A;  2LTK A;  4EF0 A;  5CRD A;  2C0E A;  4WR4 A;  3DYR A;  4JU5 A;  4ZB9 A;  4YQU A;  3ZIT A;  2H76 A;  3TB2 A;  4HQS A;  3RAZ A;  4GQC A;  2I1U A;  5AGY A;  4BWQ A;  3VPT A;  1MDI A;  3EVI A;  3FZ5 A;  5HR2 A;  1DE2 A;  2B6M A;  1SL0 B;  2FD3 A;  4WBJ A;  2LV3 A;  3HYP A;  3QFB C;  3TKS E;  4N10 A;  3CBU A;  5IO2 A;  1XW5 A;  1A8L A;  5ABR A;  3G7Y A;  4Q5Q A;  2WFC A;  3KCM A;  4HDE A;  3NIV A;  1VGL A;  4KND A;  1UVZ A;  4K2D A;  4GCI A;  5G1L A;  3QCP A;  4L0W A;  2O89 A;  2R4V A;  2LUS A;  2X8H A;  4MMM A;  5A5K A;  2NTO A;  4X0X A;  4XS1 A;  2I3Y A;  3HZ4 A;  3CSH A;  5D8I A;  1EWX A;  2YCD A;  1ZZY A;  1A2L A;  1GSD A;  5AN1 A;  1RQM A;  1PA3 A;  3O6T A;  4TVE A;  2PVO C;  2FUG 2;  2JZR A;  3L9U A;  3M1G A;  4KGI A;  1MDK A;  1ZL9 A;  2LJA A;  2O7K A;  1EV4 A;  1XCC A;  5FHI A;  1VF3 A;  4MA9 A;  3RHC A;  4RQR A;  4POM A;  2DIZ A;  3UVH A;  3VWW A;  2F9S A;  4DSS A;  1EOH A;  4MZB A;  1EOG A;  2C0G A;  5CNW A;  2VL3 A;  4MZC A;  1X9S B;  4FYC A;  1Z6N A;  5ECN B;  2MMZ A;  1Z6M A;  2OA7 A;  4PQ1 A;  3HVS A;  1R26 A;  5LNK e;  1TP9 A;  4RI6 A;  2YZU A;  3IXR A;  4JED A;  4WKW A;  3H1N A;  3DVW A;  2B5Y A;  2H1D A;  3L0H A;  2HE3 A;  4GST A;  1G7O A;  3GH6 A;  1TRW A;  2J9H A;  1URM A;  2DC5 A;  3DEX A;  4NPB A;  5CYY A;  3D5J A;  4GF0 A;  2CX3 A;  1K0B A;  4K8M A;  4TR1 B;  2ALB A;  4KSM A;  2R6K A;  5IIZ A;  3IC4 A;  4EUY A;  5D9X A;  3ED3 A;  2E7P A;  4LL1 B;  3GV1 A;  3APS A;  3VI5 A;  4GLT A;  2XBI A;  3D22 A;  1MEK A;  3C73 A;  4FYB A;  2QSI A;  5J3R A;  2H75 A;  5DBQ A;  1XW9 A;  5JCU A;  4NHZ A;  5EL8 A;  3P7X A;  2B7K A;  2K18 A;  2H70 A;  1CQH A;  3D6I A;  1YZX A;  3FW2 A;  3A5W A;  5JWO B;  4ZB8 A;  1J0F A;  4N30 A;  1K0D A;  3UL3 A;  1XOB A;  4Q5N A;  1XIY A;  1B8X A;  2CZ2 A;  2VM1 A;  1O6J A;  3TKS C;  2IMF A;  4ID0 A;  3TRQ A;  2PN8 A;  3HHV A;  1WIK A;  4LL4 B;  2IME A;  4QL9 A;  3L78 A;  4EXJ A;  4MPF A;  8GSS A;  4XIH A;  3ZYW A;  1GRX A;  1Z3E A;  2H72 A;  3VWV A;  4OO4 A;  1JLW A;  4OO5 A;  5IMC A;  2WJU A;  4MAB A;  3W6G A;  4DEJ A;  2VCX A;  3O76 A;  1F3A A;  4HU7 A;  3UBL A;  1T4Z A;  3ZZX A;  2C3T A;  1EP7 A;  3OR5 A;  2CT6 A;  1TRU A;  5L71 A;  5KN3 A;  1SYR A;  2V6K A;  2CV4 A;  4PUA A;  2FGX A;  3LXZ A;  1PQN A;  5G2Z A;  5IMD A;  2E0Q A;  4E8E A;  1ML6 A;  1SKW B;  2B5E A;  4G10 A;  4MCU A;  10GS A;  3GIX A;  1PGT A;  3HVV A;  1GUL A;  1OC3 A;  1PN9 A;  5CAX A;  3H93 A;  3MNG A;  1PL1 A;  1SKS B;  2L59 A;  2DJK A;  3GL5 A;  1T00 A;  2A2S A;  2HYX A;  2IPA A;  2I81 A;  2X99 A;  3TJJ A;  2H71 A;  1B9X C;  5ECL B;  5IMZ A;  1AQW A;  1WMJ A;  3ZL5 A;  1Z7R A;  1XVW A;  4O7H A;  4AJ8 A;  3EWL A;  3C8E A;  1G6Y A;  3BCI A;  3FKF A;  2TIR A;  5DQY A;  1WP0 A;  1PX7 A;  3DVX A;  1AIU A;  5DCG A;  2YWN A;  2HSY A;  5CO3 A;  2F8A A;  2R37 A;  1A2J A;  3ZRE A;  1G0T A;  1PRX A;  3LFL A;  4EL1 A;  1WE0 A;  5C04 A;  2H1G A;  1BED A;  3EC3 A;  4HUA A;  3EU4 A;  2KHP A;  1SYX A;  1BX9 A;  3TKP A;  2RUF A;  4OMV A;  1BAY A;  1TK5 B;  4ML1 A;  2F8F A;  4KE3 A;  3GX0 A;  4I97 A;  1KEB A;  2H0H A;  1KTE A;  1YEP A;  5DAK B;  2PGT A;  4MP4 A;  2MBS A;  1GL8 A;  2OE1 A;  1OKD A;  4PX1 A;  3VI7 A;  2QGV A;  2VL2 C;  2VO4 A;  3L9V A;  4NWY A;  1IYI A;  1OC8 A;  3EMP A;  2CAI A;  4AGS A;  3UMA A;  1QK8 A;  1YDK A;  3M0F A;  4WXT A;  1W4V A;  2TRX A;  3BCK A;  5F06 A;  1V9W A;  4V2L A;  5F07 A;  3W8S A;  3RPP A;  3UAR A;  4F2I A;  2IMI A;  3C71 A;  1TK0 B;  1V40 A;  5H5R A;  5HFI A;  1T4Y A;  1OC9 A;  2LJR A;  4ECC A;  2WGR A;  3WT1 A;  4P3Y B;  2WCI A;  5H5S A;  1VRS D;  2VL9 A;  4F9Z A;  1AC1 A;  1AXD A;  1WWJ A;  3A2X A;  1Y25 A;  2EIO A;  2LEG A;  3TJF A;  4F03 A;  1FVJ A;  2AJQ B;  3M9K A;  1WOU A;  3Q18 A;  3QAV A;  2YWO A;  2VLU A;  2VLV A;  3QPM A;  4ZIJ A;  4EO3 A;  2M80 A;  4LMV A;  1QXH A;  1GLP A;  3DKS A;  5G5F A;  1O8W A;  3IBH A;  3G7I A;  14GS A;  1JZO A;  5ECK B;  1XWC A;  2R3X A;  2XC2 A;  4NV2 A;  1GSE A;  5JCG A;  1F3B A;  4O32 A;  2K8V A;  2CX4 A;  4K7O A;  5KN2 A;  3TJK A;  3APQ A;  1UA5 A;  5A4U A;  4WET A;  5ECM B;  2EIQ A;  2NPB A;  1GSY A;  5J9C A;  1YY7 A;  1V2A A;  5IM9 A;  1PD2 1;  2NDO A;  2WDU A;  3E3E A;  1ACV A;  2C0F A;  1T7P B;  4ZL9 A;  3ZTL A;  2L4C A;  1Y6E A;  2KLX A;  4YAV A;  1ZGN A;  3F4T A;  3DGQ A;  2OE0 A;  3GN3 A;  4IS0 A;  3F3R A;  2BMX A;  2NBS A;  1M99 A;  3F6F A;  22GS A;  1V58 A;  1NW2 A;  4MJE A;  1SK0 A;  4ZIL A;  3KH7 A;  4NHW A;  3ZFB A;  3TRP A;  3QOU A;  2VCQ A;  1K0O A;  3SBC A;  3RHB A;  3DML A;  5ECH B;  2C1Y A;  2VCT A;  2FWF A;  5INY A;  3KD0 A;  2XHF A;  1QUW A;  1FO5 A;  5ID2 B;  2N5B A;  1T3B A;  2KP2 A;  5ENU A;  2YWI A;  3EU3 A;  2DBC A;  5B6N A;  1YJ6 A;  2MMO A;  5A4V A;  3J7Y k;  3C1R A;  2J23 A;  19GS A;  4JR4 A;  3LEF A;  4MK3 A;  2CAQ A;  3TKR A;  1TJD A;  4LLR A;  1GSQ A;  5DDL A;  3G7J A;  5CRE A;  2C8U A;  2IJY A;  7GSS A;  4KA0 A;  4ZBD A;  1XFL A;  2V1M A;  2YV7 A;  2GT5 A;  1JLV A;  2VCV A;  4NAX A;  2H1B A;  4EKZ A;  3FZ9 A;  3CMI A;  4H86 A;  4WEY A;  1FB6 A;  2X64 A;  1GUM A;  3EYT A;  5HFG A;  2VD0 A;  2IIY A;  3AY8 A;  1KNG A;  1TKD B;  2A4V A;  4KB3 A;  1TRV A;  2H66 A;  3HDC A;  1AQV A;  1XZO A;  1GTU A;  2AYT A;  3FZ4 A;  4QL7 A;  3DIE A;  2HZE A;  5D9V A;  2OAD A;  4RI7 A;  5ELG A;  1B4P A;  3IDV A;  2H01 A;  1BYE A;  3F9U A;  1EP8 A;  2IWT A;  5C00 A;  4POL A;  18GS A;  2XBQ A;  3GST A;  5HQP A;  4OWY A;  3L9S A;  2D2Z A;  1ST9 A;  1X9W B;  4K0G A;  4IJI A;  4KSO A;  1JZW A;  4ISD A;  4GWR A;  1N2A A;  3GTU B;  3JCM L;  1HQO A;  3HJM A;  1XWK A;  1M9A A;  1X9M B;  1U87 A;  3KGK A;  2C3Q A;  2AHE A;  4GSN A;  2VCZ A;  4FO5 A;  4KDX A;  3WGE A;  2V41 A;  1XXU A;  5CRH A;  3GUR A;  4I8B A;  1GSS A;  5LD0 A;  4E8H A;  3UEM A;  2KP1 A;  2BJX A;  4KCE A;  4OFN A;  4MF7 A;  4IHU A;  4IQ1 A;  2LRC A;  4GQF A;  4XS6 A;  3Q6O A;  3HJO A;  3KM6 A;  4JZQ A;  3DRN A;  2VUP A;  5E59 A;  2JZT A;  3TDG A;  4RUV A;  3M9J A;  1J08 A;  1K0A A;  2IFQ A;  3VK9 A;  4IJ3 A;  3IA1 A;  3F8U A;  2YJH A;  5H5Q A;  4PUR A;  3FYG A;  2MYG A;  1OKT A;  4MJB A;  1XOA A;  5J9B A;  2LQO A;  3C7M A;  2H30 A;  4XRA A;  1GSF A;  1B4Q A;  2GSQ A;  2YP6 A;  1Q98 A;  3GKX A;  2GSR A;  4IBP A;  1JZR A;  2ON7 A;  2FCH A;  4N0Z A;  1H4O A;  5DQS A;  4HQZ A;  4KW6 A;  1MDJ A;  3FR6 A;  1Q4J A;  1QMV A;  4DSR A;  1SKR B;  3N9J A;  1THX A;  2RII A;  3QD9 A;  1OYJ A;  2HT9 A;  1TI3 A;  1ZMA A;  2AB6 A;  3EE2 A;  5AIX A;  5F0G A;  1O81 A;  1PSQ A;  1O8X A;  2HRN A;  2FHE A;  6GSX A;  1UN2 A;  2CQ9 A;  5G1K A;  4V1A g;  4GSS A;  4IN0 A;  5DCH A;  3F63 A;  2NVL A;  2TRC P;  2M72 A;  5IQY A;  2C80 A;  4K7I A;  1YF1 A;  4F0B A;  4PNF A;  3VPQ A;  2YV9 A;  4HOJ A;  2GDR A;  2A2R A;  4D73 A;  3H79 A;  2K6V A;  1FVK A;  2CVK A;  1NHY A;  4BVX A;  1PX6 A;  2R2J A;  2AUV A;  3LJR A;  3D21 A;  1T1V A;  4POB A;  6GSW A;  4TXO A;  4G19 A;  2FA4 A;  1SJZ A;  4XS4 B; 
#chains in the Genus database with same CATH topology
 5F05 A;  5KOX A;  3KEB A;  4MH2 A;  3BD2 A;  4TN8 A;  1O85 A;  4JR6 A;  3GH9 A;  4KF9 A;  2YN1 A;  4L6A A;  1TDI A;  4NLE A;  2OBK A;  1QGV A;  4Z7X A;  4G0K A;  2X8C A;  2H6X A;  1H75 A;  2HRF A;  3UIW A;  2OE3 A;  4BL7 B;  3P2A A;  1ERT A;  3TUE A;  1FW1 A;  4OCF A;  5FWG A;  3I43 A;  1SL1 B;  1GTI A;  2OAC A;  3D0Z A;  3P8W A;  4ZL8 A;  2H6Z A;  1Z9H A;  3LGC A;  5DAL B;  3I6A A;  1WJK A;  1ZCP A;  5COH A;  4PQI A;  1DE1 A;  1M9B A;  4I5Q A;  3Q19 A;  5IOX A;  1HNA A;  1U88 A;  16GS A;  4EC0 A;  4BPY A;  4HEA 2;  3QAG A;  3G9B A;  2H74 A;  3MWH A;  4TR0 A;  1K3L A;  4IGJ A;  4ECI A;  4EVM A;  11GS A;  1I9D A;  2JAD A;  2O8V B;  3FHK A;  4HJ2 A;  4TOP A;  1S3A A;  1T9H A;  2VD1 A;  3HD5 A;  2BTO T;  2EC4 A;  3WT2 A;  1MH9 A;  2B1K A;  4WF4 A;  4YQV A;  5D9T A;  4K1F A;  1ZOF A;  2R5G A;  1SL2 B;  1USB A;  3LQ7 A;  1X0R A;  2E2M A;  5B7C A;  3CRU A;  4L6C A;  2REM A;  4F0C A;  3PH9 A;  2GQL A;  5GAN D;  4L5L A;  3N5O A;  3TOU A;  1PN0 A;  4OD7 A;  1DCN A;  2AAW A;  1U3I A;  4XCS A;  3DWV A;  4I6X A;  1SJI A;  2CVD A;  2UZ8 A;  3V1W A;  5KN0 A;  2P0G A;  2O85 A;  3ZFL A;  3UBK A;  3NOF A;  2GQM A;  2QKE A;  1U16 A;  1XG8 A;  3CYN A;  1TXX A;  2DKH A;  5J5N A;  4X4J A;  2X8G A;  4IEL A;  2LST A;  1OE8 A;  4DSS B;  4EFC A;  3VWU A;  2IMD A;  4N11 A;  2LJK A;  3HZ8 A;  3TCO A;  3CRT A;  3A2W A;  1PKW A;  5IPH A;  1A0F A;  3LOR A;  2GZZ A;  4ZBA A;  2DML A;  1LJR A;  3WGX A;  2OKA A;  3US3 A;  5A4W A;  4ULX A;  2DJ1 A;  2FWE A;  2WS2 A;  2JSY A;  3ZMK A;  4QQ7 A;  3UJ1 A;  1U3A A;  4HZ4 A;  3R6V A;  4TR4 A;  3NZN A;  3I9V 2;  5ECO B;  4PUF C;  4FYU A;  5HR3 A;  5B8B A;  1KBN A;  2H1A A;  2IMK A;  2WUL A;  2KUC A;  1A24 A;  1K3Y A;  1ERU A;  1BQ7 A;  3LYP A;  5EY6 A;  5J4U A;  1BJX A;  3QR6 A;  4XRD A;  3TRX A;  2CVB A;  5GSS A;  4ILF A;  2B1L A;  1SJ6 A;  2RM5 A;  3QFA C;  4HZ2 A;  3A3T A;  1TJ7 A;  1TJW A;  2DJ3 A;  2PUK C;  4MJC A;  5EPF A;  5ECR B;  1A23 A;  5D73 A;  1YKA A;  4J56 E;  3WYW A;  3CTG A;  1YQ1 A;  4L5O A;  4J57 E;  1J9B A;  1T8E B;  2C4J A;  3FEU A;  5F8B A;  2HI7 A;  1ERW A;  2GQK A;  2GTU A;  3KTL A;  4ML6 A;  1Q92 A;  4MF6 A;  2FWG A;  2VOC A;  3LWA A;  4GXZ A;  1B9Y C;  4EEI A;  3U6V A;  3BHG A;  1I5G A;  3QBP A;  2B3S A;  1EEJ A;  1IW7 D;  4V2N A;  4EDY A;  5B6M A;  4K0N A;  4HGV A;  2DJJ A;  2LNS A;  3MSZ A;  5G5E A;  4PTS A;  3ERW A;  1Q91 A;  2FWH A;  3VFI A;  3TJB A;  5ECS A;  2ZNM A;  1YF0 A;  5IMF A;  2XPD A;  4LA1 A;  3IOS A;  3IRA A;  2C0D A;  3GX8 A;  4GRF A;  2FLS A;  4KDY A;  1RK4 A;  2YZH A;  3C1S A;  4HJM A;  1G7E A;  5KN1 A;  1DBY A;  1JZD A;  1Z4L A;  4OFT A;  5JWQ B;  3ZIV A;  5KEJ A;  2B7J A;  4MF5 A;  5IPG A;  17GS A;  4L8E A;  3GFK A;  4MH3 A;  3LXT A;  1ON4 A;  2P5R A;  4CHS A;  1SK1 A;  4WF5 A;  1AAZ A;  4IP6 A;  4MPG A;  4KUN A;  4HU9 A;  2VIM A;  2LQQ A;  1M0U A;  3UAP A;  5D96 A;  3P90 A;  2D28 C;  3TKS A;  2JAR A;  1C72 A;  1PL2 A;  2LKU A;  1GSU A;  5ECQ B;  6GSV A;  4LMW A;  2O87 A;  1DUG A;  5ELA A;  2PU9 C;  2HVG A;  1TTZ A;  2F51 A;  2V2G A;  3M8N A;  2GZP A;  3IAM 2;  4O5U A;  4IKH A;  1AUC A;  1JHB A;  2LNT A;  1XPV A;  4BA7 A;  5LCZ A;  1M7T A;  3APO A;  2FNO A;  3FRC A;  1X5C A;  4ZB6 A;  4HI7 A;  1GWC A;  4GTU A;  2WZ9 A;  4CW9 A;  1QQ2 A;  1FUR A;  5GAP D;  2L5O A;  5CRG A;  5E4W A;  3GNJ A;  2PVQ A;  4TR3 A;  1VF4 A;  2K8S A;  3HVX A;  1V98 A;  1HYU A;  2MMN A;  4KAE A;  3UOM A;  1SD8 A;  4TKY A;  2C3N A;  2GLR A;  3IHG A;  1K0C A;  5DAK A;  3LYK A;  5HR0 A;  2N5F A;  5JCW A;  3GYK A;  2H19 A;  3FR3 A;  3GRX A;  4TW5 A;  4AF2 A;  4TRX A;  2H6Y A;  3VLN A;  1EV9 A;  2K9F A;  13GS A;  4G2E A;  5D6B A;  1RW1 A;  4BIK A;  3H8Q A;  1YFE A;  3PPU A;  2I4A A;  2L4Q A;  3O3T A;  1OC9 B;  3MAK A;  4ZL7 A;  3ERG A;  2R0P A;  3D4M A;  3EUR A;  4NV5 A;  2ZCT A;  1UC7 A;  1OE7 A;  3ZVJ A;  2PPT A;  3UVT A;  4NXI A;  2YWM A;  2HRA A;  3IK9 A;  2IL3 A;  1F2E A;  2H8L A;  4PGT A;  4OFM A;  1DSB A;  3QAW A;  4MZW A;  2CZ3 A;  1HY0 A;  1SEN A;  3S9F A;  2GT6 A;  1PMT A;  3BBY A;  3LG6 A;  2MMA A;  4YKF A;  1GTB A;  3U19 A;  4TXV A;  1TU7 A;  4J2F A;  2IN3 A;  2LS5 A;  1MD4 A;  2OBI A;  1GUH A;  4IP1 A;  2JSZ A;  2VL2 A;  4ZBB A;  6GST A;  3GMF A;  3VWX A;  5G30 A;  1VF1 A;  2YNX A;  3GKM A;  5ECI B;  4JRR A;  4APB A;  1AQX A;  2YPM A;  4X1U A;  4V2M A;  4EDZ A;  3QMX A;  1XVQ A;  4FIW A;  1A8Y A;  3E9J B;  1TOF A;  2V32 A;  3TJG A;  5IMA A;  4N0V A;  3FY7 A;  1Z7P A;  1E2Y A;  2H0I A;  4IW9 A;  2GZY A;  1FUO A;  2V6O A;  3W8J A;  5B8A A;  1GNE A;  3KZQ A;  4NMU A;  1FAA A;  2X49 A;  2XPE A;  2MZC A;  1GH2 A;  3R2Q A;  4WBR D;  6GSY A;  1G6W A;  1TU8 A;  1E6B A;  4X43 A;  2FA8 A;  3E0U A;  2ES7 A;  2JZS A;  5JWR B;  2GSS A;  2YOI A;  3ZML A;  3PGT A;  3RRP A;  4AJ7 A;  4I2U A;  5BMU A;  1QFN A;  4USS A;  1THO A;  3DXB A;  2QA2 A;  5EVO A;  3TGZ A;  2PTR A;  3IK7 A;  1N8J A;  2HNL A;  3U5R E;  2RCN A;  9GSS A;  3IPZ A;  4POK A;  2PER A;  4CDO A;  4BVY A;  2M46 A;  3HY2 A;  4IVF A;  1EGR A;  4ADL A;  2PMT A;  2FUS A;  1TJU A;  5IOW A;  20GS A;  1TW9 A;  2HFD A;  3GSS A;  5ID2 A;  4F82 A;  2R0G A;  1GLQ A;  2N5A A;  1SK2 A;  3WGD A;  3F4S A;  1R5P A;  3SWL A;  4XTS A;  2HSH A;  4O5R A;  1FHE A;  5AIS A;  4MJA A;  3IR4 A;  4JE1 A;  6GSU A;  3FR9 A;  1M2A A;  2PWJ A;  1AW9 A;  1K7W A;  1M2B A;  1NHO A;  2RM6 A;  3GA4 A;  1A0R P;  2E2G A;  2GGT A;  2Z9S A;  4PNG A;  5KOW A;  4ADM A;  3MDK A;  2H73 A;  3KMO A;  3IV4 A;  3CXG A;  3GL3 A;  1GTA A;  1R4W A;  3KXO A;  3VUR A;  3F0I A;  3ISO A;  3WD6 A;  2MBT A;  3H4K A;  1NSW A;  3GHA A;  1K3O A;  1YEX A;  4PXO A;  2HZE B;  3GKN A;  1F37 A;  1M2D A;  3ME8 A;  4KCA A;  5DJM A;  4EIQ A;  2RUE A;  1JSW A;  1HD2 A;  4K6X A;  1YKC A;  2YJ7 A;  1MTC A;  3I69 A;  2DJ0 A;  5G31 A;  4KX4 A;  2RLI A;  5CP1 A;  1WPI A;  3F3Q A;  1XBS A;  3F6D A;  1CQG A;  2PBJ A;  4KH7 A;  2HZF A;  2JAW A;  2GVP A;  3NO9 A;  1TK8 B;  4Q5R A;  3KTB A;  12GS A;  2DLX A;  4I2T A;  3M3M A;  3CSJ A;  3KP9 A;  1U6T A;  1GP1 A;  1K0N A;  3RBT A;  1EGO A;  1R7H A;  4O92 A;  1U0L A;  1WRY A;  3KMN A;  2H0G A;  3GTU A;  2G2Q A;  1ZYE A;  1F9M A;  3PR8 A;  1GNW A;  2I9H A;  1K62 A;  3TKQ A;  1FOV A;  3EIN A;  2P31 A;  3HVN A;  2OJL A;  4ECJ A;  4Z2U A;  3F4R A;  2ON5 A;  3ZVJ D;  2X4A A;  4Q5F A;  1ZYQ B;  1TRS A;  3GUS A;  4XHM A;  4DSQ A;  3J7Y b;  5IMV A;  4DVC A;  2IFQ B;  2VCW A;  3KIJ A;  2VLT A;  3IHQ A;  5GZZ B;  2CA8 A;  1Z5Y E;  2VM2 A;  2ZUP A;  1O73 A;  2QC7 A;  2L6C A;  4YQM A;  5GST A;  3RPN A;  1XW6 A;  2G0F A;  3HKR A;  4BWS A;  2PTS A;  1TI1 A;  3BWV A;  5DJL A;  4MLY A;  5D93 A;  3ERF A;  5CRW A;  1A2M A;  4MX2 A;  2L6D A;  3ZRD A;  2HXK A;  1GUK A;  4TR1 A;  1XWB A;  1FB0 A;  1X5D A;  1MD3 A;  2DSA A;  1PKZ A;  3LSZ A;  2YAN A;  4K9Z A;  3IAS 2;  1OAZ A;  2DIY A;  3L4N A;  4K2X A;  1S3D A;  3GTD A;  4YH2 A;  4G9H A;  1HY1 A;  1VF2 A;  3QDN A;  3BJ5 A;  1K0M A;  1ABA A;  3A2V A;  5HW2 A;  3KH9 A;  5J41 A;  2AV4 A;  1XWA A;  3KJY A;  6GSS A;  4ACS A;  3FK8 A;  2WB9 A;  1LU4 A;  1O7U A;  2B5X A;  4JBB A;  2GST A;  4NFL A;  1XWG A;  2F3M A;  2WRT A;  2P5Q A;  5FT3 A;  4D73 B;  3ME7 A;  1V57 A;  3HA9 A;  3DD3 A;  1ILO A;  2GS3 A;  5DVB A;  3TOT A;  3FZA A;  4K7N A;  2FY6 A;  4MDC A;  4HS1 A;  4BVX B;  1U15 A;  1JFU A;  3CSI A;  4YAP A;  1LBK A;  4TXO B;  4ZXG A;  1NM3 A;  3HCZ A;  1IYH A;  1TJV A;  2LRN A;  1W89 A;  2JL4 A;  3ZIJ A;  2JAC A;  1FUP A;  1X5E A;  3RDW A;  3MYD A;  5HR1 A;  4WR5 A;  4HSC X;  3CTF A;  3GKK A;  4PQH A;  1EZK A;  3HXS A;  1B48 A;  4V1A p;  2I7D A;  1ERV A;  4XS4 A;  5ECP B;  2HLS A;  1HNC A;  1OVN A;  2LRT A;  3K8N A;  2KOK A;  3KP8 A;  3ZLP A;  4BVY B;  4IQA A;  1F6M C;  2YV5 A;  4EE0 A;  1EEM A;  5AIV A;  4OCE A;  3HJP A;  1SU9 A;  4KDU A;  3RD8 A;  5IO0 A;  3R3E A;  1FG4 A;  2VAF A;  5D9W A;  1R5A A;  4G0I A;  2EIR A;  2DMM A;  5F91 A;  3FMW A;  3EMX A;  3D4T A;  4L0U A;  3IE3 A;  1BG5 A;  2JU5 A;  4RQX A;  4ECB A;  4BL7 A;  2PFM A;  1HNB A;  4AJ6 A;  2L5L A;  4FH8 A;  3PIN A;  2L57 A;  3Q74 A;  5HFK A;  1SD9 A;  3BOA A;  1S3C A;  5DAL A;  2DJ2 A;  2LTK A;  4EF0 A;  5CRD A;  4CY8 A;  2C0E A;  4WR4 A;  3DYR A;  4JU5 A;  4ZB9 A;  4YQU A;  3ZIT A;  2H76 A;  3TB2 A;  4HQS A;  3RAZ A;  4YKG A;  4GQC A;  2I1U A;  5AGY A;  4BWQ A;  3VPT A;  1ZYP A;  1MDI A;  3EVI A;  3FZ5 A;  5HR2 A;  1DE2 A;  2B6M A;  1SL0 B;  2FD3 A;  1M3I A;  4WBJ A;  2LV3 A;  3HYP A;  3QFB C;  3TKS E;  4N10 A;  3CBU A;  5IO2 A;  1XW5 A;  1A8L A;  1C3C A;  5ABR A;  3G7Y A;  4Q5Q A;  2WFC A;  3KCM A;  4HDE A;  2X75 A;  1M3J A;  4O5Q A;  1Z4P X;  3NIV A;  4A5P A;  1VGL A;  4KND A;  1UVZ A;  4K2D A;  4GCI A;  5G1L A;  3QCP A;  4L0W A;  4NSL A;  2O89 A;  2R4V A;  2LUS A;  2X8H A;  4MMM A;  5A5K A;  2NTO A;  4X0X A;  4XS1 A;  2I3Y A;  3HZ4 A;  3CSH A;  5D8I A;  1EWX A;  2YCD A;  1ZZY A;  3A5I A;  1A2L A;  1GSD A;  5AN1 A;  1RQM A;  1PA3 A;  3O6T A;  4TVE A;  2PVO C;  2FUG 2;  2JZR A;  3L9U A;  3M1G A;  4KGI A;  1MDK A;  1ZL9 A;  2LJA A;  2O7K A;  1EV4 A;  1XCC A;  5FHI A;  1VF3 A;  4MA9 A;  3RHC A;  4RQR A;  4POM A;  2DIZ A;  3UVH A;  3VWW A;  2F9S A;  4DSS A;  1EOH A;  4MZB A;  1Z4Q A;  1EOG A;  4MNN A;  2C0G A;  5CNW A;  2VL3 A;  4MZC A;  1X9S B;  4FYC A;  1Z6N A;  5ECN B;  2MMZ A;  1Z6M A;  2OA7 A;  1Z4K A;  4PQ1 A;  3HVS A;  1R26 A;  5LNK e;  1TP9 A;  4RI6 A;  2YZU A;  3IXR A;  4JED A;  4WKW A;  3H1N A;  3DVW A;  2B5Y A;  2H1D A;  3L0H A;  4K5S A;  2HE3 A;  4GST A;  1G7O A;  3GH6 A;  1TRW A;  2J9H A;  1URM A;  2DC5 A;  3DEX A;  4NPB A;  5CYY A;  3D5J A;  4GF0 A;  2CX3 A;  1K0B A;  4K8M A;  4TR1 B;  2ALB A;  4KSM A;  2R6K A;  5IIZ A;  3IC4 A;  1YFM A;  4EUY A;  5D9X A;  3ED3 A;  2E7P A;  4LL1 B;  3GV1 A;  3APS A;  3VI5 A;  4GLT A;  2XBI A;  3D22 A;  3CI0 K;  1MEK A;  3C73 A;  4FYB A;  2QSI A;  5J3R A;  2H75 A;  5DBQ A;  1XW9 A;  5JCU A;  4NHZ A;  5EL8 A;  3P7X A;  2B7K A;  2K18 A;  2H70 A;  1CQH A;  3D6I A;  1YZX A;  3FW2 A;  3A5W A;  5JWO B;  4ZB8 A;  1J0F A;  4N30 A;  1K0D A;  3UL3 A;  1XOB A;  4Q5N A;  1XIY A;  1B8X A;  2CZ2 A;  2VM1 A;  1O6J A;  3TKS C;  2IMF A;  4ID0 A;  3TRQ A;  2PN8 A;  3HHV A;  1WIK A;  4LL4 B;  2IME A;  4QL9 A;  3L78 A;  4EXJ A;  4MPF A;  8GSS A;  4XIH A;  3ZYW A;  1GRX A;  1Z3E A;  2H72 A;  3VWV A;  3OCE A;  4OO4 A;  1JLW A;  4OO5 A;  2JAO A;  5IMC A;  1I0A A;  2WJU A;  4MAB A;  3W6G A;  4DEJ A;  2VCX A;  3O76 A;  1F3A A;  4HU7 A;  3UBL A;  1C3U A;  1T4Z A;  3ZZX A;  2C3T A;  1EP7 A;  3OR5 A;  2CT6 A;  1TRU A;  4G0L A;  5L71 A;  3EPT A;  5KN3 A;  3MIX A;  1SYR A;  2V6K A;  2CV4 A;  4PUA A;  2FGX A;  3LXZ A;  1PQN A;  3TV2 A;  5G2Z A;  5IMD A;  2E0Q A;  4E8E A;  1ML6 A;  1SKW B;  2B5E A;  4G10 A;  4MCU A;  10GS A;  3GIX A;  1PGT A;  3HVV A;  1GUL A;  1OC3 A;  1PN9 A;  1PFO A;  5CAX A;  3H93 A;  3MNG A;  1PL1 A;  1SKS B;  2L59 A;  2DJK A;  3GL5 A;  1T00 A;  2A2S A;  2HYX A;  2IPA A;  2DKI A;  2I81 A;  2X99 A;  3TJJ A;  2H71 A;  1B9X C;  5ECL B;  5IMZ A;  1AQW A;  1WMJ A;  3ZL5 A;  1Z7R A;  1RE5 A;  1XVW A;  4O7H A;  4AJ8 A;  3EWL A;  1AUW A;  3OCF A;  3C8E A;  1G6Y A;  3FKF A;  3BCI A;  2TIR A;  5DQY A;  1WP0 A;  2A2P A;  1PX7 A;  3DVX A;  1AIU A;  5DCG A;  2YWN A;  2HSY A;  2E9F A;  5CO3 A;  2F8A A;  2R37 A;  1A2J A;  3ZRE A;  1G0T A;  1KQ7 A;  3C8T A;  1PRX A;  3LFL A;  1XWO A;  4EL1 A;  1WE0 A;  5C04 A;  2H1G A;  1BED A;  4IQJ M;  3EC3 A;  4HUA A;  3EU4 A;  2KHP A;  1SYX A;  1BX9 A;  3TKP A;  2RUF A;  4OMV A;  1BAY A;  1TK5 B;  4ML1 A;  2F8F A;  4KE3 A;  3GX0 A;  4I97 A;  1KEB A;  2H0H A;  1KTE A;  4E88 A;  4K5R A;  1YEP A;  5DAK B;  2PGT A;  4MP4 A;  2MBS A;  1GL8 A;  2OE1 A;  1OKD A;  4PX1 A;  3VI7 A;  2QGV A;  2VL2 C;  2VO4 A;  3L9V A;  4NWY A;  1IYI A;  1OC8 A;  3EMP A;  3IC8 A;  2CAI A;  4AGS A;  3UMA A;  1QK8 A;  1YDK A;  3M0F A;  4WXT A;  1W4V A;  3E04 A;  2TRX A;  3BCK A;  5F06 A;  1V9W A;  4V2L A;  5F07 A;  3W8S A;  3RPP A;  3UAR A;  4F2I A;  2IMI A;  1Z4J A;  3C71 A;  1TK0 B;  1V40 A;  5H5R A;  5HFI A;  1T4Y A;  1OC9 A;  2LJR A;  4ECC A;  2WGR A;  3WT1 A;  4P3Y B;  2WCI A;  1ZYN A;  5H5S A;  1VRS D;  2VL9 A;  4F9Z A;  1AC1 A;  1AXD A;  1WWJ A;  3A2X A;  1Y25 A;  2EIO A;  2LEG A;  3TJF A;  4F03 A;  1FVJ A;  2AJQ B;  3M9K A;  1WOU A;  3Q18 A;  3QAV A;  2YWO A;  2VLU A;  2VLV A;  3QPM A;  4ZIJ A;  4EO3 A;  2M80 A;  4MWO A;  4LMV A;  2HRK A;  1QXH A;  1GLP A;  3DKS A;  5G5F A;  1O8W A;  3IBH A;  3G7I A;  14GS A;  1JZO A;  5ECK B;  1XWC A;  3GZH A;  2R3X A;  1FUQ A;  2XC2 A;  4NV2 A;  1GSE A;  5JCG A;  1F3B A;  4O32 A;  2K8V A;  2CX4 A;  5BRT A;  4K7O A;  3LW9 A;  5KN2 A;  3TJK A;  3APQ A;  1UA5 A;  5A4U A;  4WET A;  5ECM B;  2EIQ A;  2NPB A;  1GSY A;  5J9C A;  1YY7 A;  1V2A A;  5IM9 A;  1PD2 1;  1VDK A;  2NDO A;  2WDU A;  3E3E A;  3CQF A;  1ACV A;  2C0F A;  1T7P B;  4ZL9 A;  1DOF A;  3ZTL A;  2L4C A;  1Y6E A;  2KLX A;  4YAV A;  1ZGN A;  3F4T A;  2PTQ A;  3DGQ A;  2OE0 A;  3GN3 A;  4IS0 A;  3F3R A;  2BMX A;  2NBS A;  1Z4M A;  1M99 A;  3F6F A;  22GS A;  1V58 A;  1NW2 A;  4MJE A;  1SK0 A;  4ZIL A;  3KH7 A;  1FOH A;  4NHW A;  3ZFB A;  3TRP A;  3QOU A;  2VCQ A;  1K0O A;  3SBC A;  3RHB A;  3DML A;  5ECH B;  2C1Y A;  2VCT A;  2FWF A;  5INY A;  3KD0 A;  2XHF A;  1QUW A;  1FO5 A;  1J3U A;  5ID2 B;  2N5B A;  1T3B A;  2KP2 A;  5ENU A;  2YWI A;  3EU3 A;  2DBC A;  5B6N A;  1YJ6 A;  2MMO A;  5A4V A;  3J7Y k;  3C1R A;  2J23 A;  19GS A;  4JR4 A;  3LEF A;  4MK3 A;  2CAQ A;  3TKR A;  3R6Q A;  1TJD A;  4LLR A;  1GSQ A;  5DDL A;  3G7J A;  5CRE A;  2C8U A;  2IJY A;  7GSS A;  4KA0 A;  4ZBD A;  3U13 A;  1XFL A;  2V1M A;  2YV7 A;  2GT5 A;  1JLV A;  2VCV A;  4NAX A;  2H1B A;  4EKZ A;  3FZ9 A;  3CMI A;  4H86 A;  4WEY A;  1FB6 A;  2X64 A;  1GUM A;  3EYT A;  5HFG A;  2VD0 A;  2IIY A;  3AY8 A;  1KNG A;  1TKD B;  2A4V A;  4KB3 A;  1TRV A;  2H66 A;  3HDC A;  1AQV A;  1XZO A;  1GTU A;  2AYT A;  3FZ4 A;  4QL7 A;  3DIE A;  2HZE A;  4APA A;  2OAD A;  5D9V A;  4RI7 A;  5ELG A;  1B4P A;  3IDV A;  2H01 A;  1BYE A;  3F9U A;  1EP8 A;  2IWT A;  5C00 A;  4POL A;  18GS A;  2XBQ A;  3GST A;  5HQP A;  4OWY A;  3L9S A;  2D2Z A;  1ST9 A;  1X9W B;  4K0G A;  4ICY A;  4IJI A;  4YIK A;  4KSO A;  4Z2R A;  1JZW A;  4ISD A;  4FQU A;  4GWR A;  1N2A A;  3GTU B;  3JCM L;  1HQO A;  3HJM A;  1XWK A;  1M9A A;  1X9M B;  1U87 A;  3KGK A;  2C3Q A;  2AHE A;  4Z2T A;  4GSN A;  2VCZ A;  1S3R A;  4FO5 A;  4KDX A;  3WGE A;  2V41 A;  1XXU A;  5CRH A;  3GUR A;  4YIH A;  4I8B A;  1GSS A;  5LD0 A;  2A4H A;  4E8H A;  3UEM A;  2KP1 A;  2BJX A;  4KCE A;  4OFN A;  4MF7 A;  4IHU A;  4IQ1 A;  2LRC A;  4GQF A;  4XS6 A;  3Q6O A;  3HJO A;  3KM6 A;  4JZQ A;  3DRN A;  2VUP A;  5E59 A;  2JZT A;  3TDG A;  4RUV A;  3M9J A;  1J08 A;  1K0A A;  2IFQ A;  3VK9 A;  4IJ3 A;  3IA1 A;  3F8U A;  2YJH A;  5H5Q A;  4PUR A;  3FYG A;  2MYG A;  1OKT A;  4MJB A;  1XOA A;  2QGA B;  5J9B A;  2LQO A;  3C7M A;  2H30 A;  4XRA A;  1GSF A;  1B4Q A;  2GSQ A;  4CY6 A;  2YP6 A;  1Q98 A;  3GKX A;  2GSR A;  4IBP A;  1JZR A;  2ON7 A;  1Z4I A;  2FCH A;  4N0Z A;  1H4O A;  5DQS A;  4HQZ A;  4KW6 A;  1MDJ A;  3FR6 A;  1Q4J A;  1QMV A;  4DSR A;  1SKR B;  3N9J A;  1THX A;  4MUM A;  2RII A;  3QD9 A;  1OYJ A;  2HT9 A;  1TI3 A;  1ZMA A;  2AB6 A;  4L57 A;  3EE2 A;  5AIX A;  5F0G A;  1O81 A;  1PSQ A;  1O8X A;  2JAU A;  2HRN A;  5F92 A;  2D27 A;  2FHE A;  6GSX A;  1UN2 A;  2CQ9 A;  5G1K A;  4V1A g;  1Q5N A;  4GSS A;  4IN0 A;  5DCH A;  3F63 A;  2NVL A;  2TRC P;  2M72 A;  2R0C A;  5IQY A;  2C80 A;  4K7I A;  1YF1 A;  2HSM A;  4PNF A;  4F0B A;  3VPQ A;  2YV9 A;  4HOJ A;  2GDR A;  2A2R A;  4D73 A;  3H79 A;  2K6V A;  1FVK A;  4EIP A;  2CVK A;  1NHY A;  4BVX A;  1PX6 A;  2R2J A;  2AUV A;  3LJR A;  3D21 A;  2QA1 A;  1T1V A;  4POB A;  6GSW A;  4TXO A;  4G19 A;  2FA4 A;  1SJZ A;  4XS4 B; 
#chains in the Genus database with same CATH homology
 5F05 A;  5KOX A;  3KEB A;  4MH2 A;  3BD2 A;  4TN8 A;  1O85 A;  4JR6 A;  3GH9 A;  4KF9 A;  2YN1 A;  1TDI A;  2OBK A;  1QGV A;  4Z7X A;  4G0K A;  2X8C A;  2H6X A;  1H75 A;  2HRF A;  3UIW A;  2OE3 A;  4BL7 B;  3P2A A;  1ERT A;  3TUE A;  1FW1 A;  4OCF A;  5FWG A;  3I43 A;  1SL1 B;  1GTI A;  2OAC A;  3D0Z A;  3P8W A;  4ZL8 A;  2H6Z A;  1Z9H A;  3LGC A;  5DAL B;  3I6A A;  1WJK A;  1ZCP A;  5COH A;  4PQI A;  1DE1 A;  1M9B A;  4I5Q A;  3Q19 A;  5IOX A;  1HNA A;  1U88 A;  16GS A;  4EC0 A;  4BPY A;  4HEA 2;  3QAG A;  3G9B A;  2H74 A;  3MWH A;  4TR0 A;  1K3L A;  4IGJ A;  4ECI A;  4EVM A;  11GS A;  1I9D A;  2JAD A;  2O8V B;  3FHK A;  4HJ2 A;  4TOP A;  1S3A A;  2VD1 A;  3HD5 A;  2BTO T;  2EC4 A;  3WT2 A;  2B1K A;  4WF4 A;  4YQV A;  5D9T A;  4K1F A;  1ZOF A;  2R5G A;  1SL2 B;  1USB A;  3LQ7 A;  1X0R A;  2E2M A;  5B7C A;  3CRU A;  2REM A;  4F0C A;  3PH9 A;  2GQL A;  5GAN D;  4L5L A;  3N5O A;  3TOU A;  1PN0 A;  4OD7 A;  2AAW A;  1U3I A;  4XCS A;  3DWV A;  4I6X A;  1SJI A;  2CVD A;  2UZ8 A;  3V1W A;  5KN0 A;  2P0G A;  2O85 A;  3ZFL A;  3UBK A;  3NOF A;  2GQM A;  2QKE A;  3CYN A;  1TXX A;  2DKH A;  5J5N A;  4X4J A;  2X8G A;  4IEL A;  2LST A;  1OE8 A;  4DSS B;  3VWU A;  2IMD A;  4N11 A;  2LJK A;  3HZ8 A;  3TCO A;  3CRT A;  3A2W A;  1PKW A;  5IPH A;  1A0F A;  3LOR A;  2GZZ A;  4ZBA A;  2DML A;  1LJR A;  3WGX A;  2OKA A;  3US3 A;  5A4W A;  4ULX A;  2DJ1 A;  2FWE A;  2WS2 A;  2JSY A;  3ZMK A;  4QQ7 A;  3UJ1 A;  1U3A A;  4HZ4 A;  4TR4 A;  3NZN A;  3I9V 2;  5ECO B;  4PUF C;  4FYU A;  5HR3 A;  5B8B A;  1KBN A;  2H1A A;  2IMK A;  2WUL A;  2KUC A;  1A24 A;  1K3Y A;  1ERU A;  1BQ7 A;  3LYP A;  5EY6 A;  5J4U A;  1BJX A;  3QR6 A;  4XRD A;  3TRX A;  2CVB A;  5GSS A;  4ILF A;  2B1L A;  1SJ6 A;  2RM5 A;  3QFA C;  4HZ2 A;  3A3T A;  2DJ3 A;  2PUK C;  4MJC A;  5EPF A;  5ECR B;  1A23 A;  5D73 A;  1YKA A;  4J56 E;  3WYW A;  3CTG A;  1YQ1 A;  4L5O A;  4J57 E;  1J9B A;  1T8E B;  2C4J A;  3FEU A;  5F8B A;  2HI7 A;  1ERW A;  2GQK A;  2GTU A;  3KTL A;  4ML6 A;  4MF6 A;  2FWG A;  2VOC A;  3LWA A;  4GXZ A;  1B9Y C;  3U6V A;  1I5G A;  2B3S A;  1EEJ A;  1IW7 D;  4V2N A;  4EDY A;  5B6M A;  4K0N A;  2DJJ A;  2LNS A;  3MSZ A;  5G5E A;  4PTS A;  3ERW A;  2FWH A;  3VFI A;  3TJB A;  5ECS A;  2ZNM A;  1YF0 A;  5IMF A;  2XPD A;  4LA1 A;  3IOS A;  3IRA A;  2C0D A;  3GX8 A;  4GRF A;  2FLS A;  4KDY A;  1RK4 A;  2YZH A;  3C1S A;  4HJM A;  1G7E A;  5KN1 A;  1DBY A;  1JZD A;  5JWQ B;  4OFT A;  3ZIV A;  5KEJ A;  2B7J A;  4MF5 A;  5IPG A;  17GS A;  4L8E A;  3GFK A;  4MH3 A;  3LXT A;  1ON4 A;  2P5R A;  4CHS A;  1SK1 A;  4WF5 A;  1AAZ A;  4IP6 A;  4MPG A;  4KUN A;  4HU9 A;  2VIM A;  2LQQ A;  1M0U A;  3UAP A;  5D96 A;  3P90 A;  2D28 C;  3TKS A;  1C72 A;  1PL2 A;  2LKU A;  1GSU A;  5ECQ B;  6GSV A;  4LMW A;  2O87 A;  1DUG A;  5ELA A;  2PU9 C;  1TTZ A;  2F51 A;  2V2G A;  3M8N A;  2GZP A;  3IAM 2;  4O5U A;  4IKH A;  1AUC A;  1JHB A;  2LNT A;  1XPV A;  4BA7 A;  5LCZ A;  1M7T A;  3APO A;  2FNO A;  3FRC A;  1X5C A;  4ZB6 A;  4HI7 A;  1GWC A;  4GTU A;  2WZ9 A;  4CW9 A;  1QQ2 A;  5GAP D;  2L5O A;  5CRG A;  5E4W A;  3GNJ A;  2PVQ A;  4TR3 A;  1VF4 A;  2K8S A;  3HVX A;  1V98 A;  1HYU A;  2MMN A;  4KAE A;  3UOM A;  1SD8 A;  4TKY A;  2C3N A;  2GLR A;  3IHG A;  1K0C A;  5DAK A;  3LYK A;  5HR0 A;  2N5F A;  5JCW A;  3GYK A;  2H19 A;  3FR3 A;  3GRX A;  4TW5 A;  4AF2 A;  4TRX A;  2H6Y A;  3VLN A;  1EV9 A;  2K9F A;  13GS A;  4G2E A;  1RW1 A;  3H8Q A;  3PPU A;  2I4A A;  2L4Q A;  3O3T A;  1OC9 B;  3MAK A;  4ZL7 A;  3ERG A;  2R0P A;  3D4M A;  3EUR A;  4NV5 A;  2ZCT A;  1UC7 A;  1OE7 A;  3ZVJ A;  2PPT A;  3UVT A;  4NXI A;  2YWM A;  2HRA A;  3IK9 A;  2IL3 A;  1F2E A;  2H8L A;  4PGT A;  4OFM A;  1DSB A;  3QAW A;  4MZW A;  2CZ3 A;  1SEN A;  3S9F A;  2GT6 A;  1PMT A;  3BBY A;  3LG6 A;  2MMA A;  4YKF A;  1GTB A;  4TXV A;  1TU7 A;  4J2F A;  2IN3 A;  2LS5 A;  1MD4 A;  2OBI A;  1GUH A;  4IP1 A;  2JSZ A;  2VL2 A;  4ZBB A;  6GST A;  3GMF A;  3VWX A;  5G30 A;  1VF1 A;  2YNX A;  3GKM A;  5ECI B;  4JRR A;  1AQX A;  2YPM A;  4X1U A;  4V2M A;  4EDZ A;  3QMX A;  1XVQ A;  4FIW A;  1A8Y A;  3E9J B;  1TOF A;  2V32 A;  3TJG A;  5IMA A;  4N0V A;  3FY7 A;  1Z7P A;  1E2Y A;  2H0I A;  4IW9 A;  2GZY A;  2V6O A;  3W8J A;  5B8A A;  1GNE A;  3KZQ A;  4NMU A;  1FAA A;  2X49 A;  2XPE A;  2MZC A;  1GH2 A;  3R2Q A;  4WBR D;  6GSY A;  1G6W A;  1TU8 A;  1E6B A;  4X43 A;  2FA8 A;  3E0U A;  2ES7 A;  2JZS A;  5JWR B;  2GSS A;  2YOI A;  3ZML A;  3PGT A;  4AJ7 A;  4I2U A;  5BMU A;  1QFN A;  4USS A;  1THO A;  3DXB A;  2QA2 A;  5EVO A;  3TGZ A;  3IK7 A;  1N8J A;  2HNL A;  3U5R E;  9GSS A;  3IPZ A;  4POK A;  2PER A;  4CDO A;  4BVY A;  2M46 A;  3HY2 A;  4IVF A;  1EGR A;  2PMT A;  5IOW A;  20GS A;  1TW9 A;  2HFD A;  3GSS A;  5ID2 A;  4F82 A;  2R0G A;  1GLQ A;  2N5A A;  1SK2 A;  3WGD A;  3F4S A;  1R5P A;  3SWL A;  4XTS A;  2HSH A;  4O5R A;  1FHE A;  5AIS A;  4MJA A;  3IR4 A;  4JE1 A;  6GSU A;  3FR9 A;  1M2A A;  2PWJ A;  1AW9 A;  1M2B A;  2RM6 A;  1NHO A;  3GA4 A;  1A0R P;  2E2G A;  2GGT A;  2Z9S A;  4PNG A;  5KOW A;  3MDK A;  2H73 A;  3KMO A;  3IV4 A;  3CXG A;  3GL3 A;  1GTA A;  1R4W A;  3KXO A;  3VUR A;  3F0I A;  3ISO A;  3WD6 A;  2MBT A;  3H4K A;  1NSW A;  3GHA A;  1K3O A;  1YEX A;  4PXO A;  2HZE B;  3GKN A;  1F37 A;  1M2D A;  3ME8 A;  4KCA A;  5DJM A;  4EIQ A;  2RUE A;  1HD2 A;  4K6X A;  1YKC A;  2YJ7 A;  1MTC A;  3I69 A;  2DJ0 A;  5G31 A;  4KX4 A;  2RLI A;  5CP1 A;  1WPI A;  3F3Q A;  1XBS A;  3F6D A;  1CQG A;  2PBJ A;  4KH7 A;  2HZF A;  2GVP A;  1TK8 B;  4Q5R A;  3KTB A;  12GS A;  2DLX A;  4I2T A;  3M3M A;  3CSJ A;  3KP9 A;  1U6T A;  1GP1 A;  1K0N A;  3RBT A;  1EGO A;  1R7H A;  4O92 A;  1WRY A;  3KMN A;  2H0G A;  3GTU A;  2G2Q A;  1ZYE A;  1F9M A;  3PR8 A;  1GNW A;  2I9H A;  3TKQ A;  1FOV A;  3EIN A;  2P31 A;  2OJL A;  4ECJ A;  4Z2U A;  3F4R A;  2ON5 A;  3ZVJ D;  2X4A A;  4Q5F A;  1ZYQ B;  1TRS A;  3GUS A;  4XHM A;  4DSQ A;  3J7Y b;  5IMV A;  4DVC A;  2IFQ B;  2VCW A;  3KIJ A;  2VLT A;  3IHQ A;  5GZZ B;  2CA8 A;  1Z5Y E;  2VM2 A;  2ZUP A;  1O73 A;  2QC7 A;  2L6C A;  4YQM A;  5GST A;  3RPN A;  1XW6 A;  2G0F A;  3HKR A;  4BWS A;  1TI1 A;  5DJL A;  4MLY A;  5D93 A;  3ERF A;  5CRW A;  1A2M A;  2L6D A;  3ZRD A;  2HXK A;  1GUK A;  4TR1 A;  1XWB A;  1FB0 A;  1X5D A;  1MD3 A;  2DSA A;  1PKZ A;  3LSZ A;  2YAN A;  4K9Z A;  3IAS 2;  1OAZ A;  2DIY A;  3L4N A;  4K2X A;  1S3D A;  4YH2 A;  4G9H A;  1VF2 A;  3QDN A;  3BJ5 A;  1K0M A;  1ABA A;  3A2V A;  3KH9 A;  5J41 A;  2AV4 A;  1XWA A;  3KJY A;  6GSS A;  4ACS A;  3FK8 A;  2WB9 A;  1LU4 A;  1O7U A;  2B5X A;  4JBB A;  2GST A;  2F3M A;  1XWG A;  2WRT A;  2P5Q A;  5FT3 A;  4D73 B;  3ME7 A;  1V57 A;  3HA9 A;  3DD3 A;  1ILO A;  2GS3 A;  5DVB A;  3TOT A;  3FZA A;  4K7N A;  2FY6 A;  4MDC A;  4HS1 A;  4BVX B;  1JFU A;  3CSI A;  4YAP A;  1LBK A;  4TXO B;  4ZXG A;  1NM3 A;  3HCZ A;  1IYH A;  2LRN A;  1W89 A;  2JL4 A;  3ZIJ A;  2JAC A;  1X5E A;  3RDW A;  3MYD A;  5HR1 A;  4WR5 A;  3CTF A;  3GKK A;  4PQH A;  1EZK A;  3HXS A;  1B48 A;  4V1A p;  1ERV A;  4XS4 A;  5ECP B;  2HLS A;  1HNC A;  1OVN A;  2LRT A;  3K8N A;  2KOK A;  3KP8 A;  3ZLP A;  4BVY B;  4IQA A;  1F6M C;  4EE0 A;  1EEM A;  5AIV A;  4OCE A;  3HJP A;  1SU9 A;  4KDU A;  5IO0 A;  3R3E A;  1FG4 A;  2VAF A;  5D9W A;  1R5A A;  4G0I A;  2EIR A;  2DMM A;  3FMW A;  3EMX A;  3D4T A;  4L0U A;  3IE3 A;  1BG5 A;  2JU5 A;  4RQX A;  4ECB A;  4BL7 A;  1HNB A;  4AJ6 A;  2L5L A;  4FH8 A;  3PIN A;  2L57 A;  3Q74 A;  5HFK A;  1SD9 A;  3BOA A;  1S3C A;  5DAL A;  2DJ2 A;  2LTK A;  4EF0 A;  5CRD A;  4CY8 A;  2C0E A;  4WR4 A;  3DYR A;  4JU5 A;  4ZB9 A;  4YQU A;  3ZIT A;  2H76 A;  3TB2 A;  4HQS A;  3RAZ A;  4YKG A;  4GQC A;  2I1U A;  5AGY A;  4BWQ A;  3VPT A;  1ZYP A;  1MDI A;  3EVI A;  3FZ5 A;  5HR2 A;  1DE2 A;  2B6M A;  1SL0 B;  2FD3 A;  4WBJ A;  2LV3 A;  3HYP A;  3QFB C;  3TKS E;  4N10 A;  3CBU A;  5IO2 A;  1XW5 A;  1A8L A;  5ABR A;  3G7Y A;  4Q5Q A;  2WFC A;  3KCM A;  4HDE A;  4O5Q A;  3NIV A;  4A5P A;  1VGL A;  4KND A;  1UVZ A;  4K2D A;  4GCI A;  5G1L A;  3QCP A;  4L0W A;  2O89 A;  2R4V A;  2LUS A;  2X8H A;  4MMM A;  5A5K A;  2NTO A;  4X0X A;  4XS1 A;  2I3Y A;  3HZ4 A;  3CSH A;  5D8I A;  1EWX A;  2YCD A;  1ZZY A;  3A5I A;  1A2L A;  1GSD A;  5AN1 A;  1RQM A;  1PA3 A;  3O6T A;  4TVE A;  2PVO C;  2FUG 2;  2JZR A;  3L9U A;  3M1G A;  4KGI A;  1MDK A;  1ZL9 A;  2LJA A;  2O7K A;  1EV4 A;  1XCC A;  5FHI A;  1VF3 A;  4MA9 A;  3RHC A;  4RQR A;  4POM A;  2DIZ A;  3UVH A;  3VWW A;  2F9S A;  4DSS A;  1EOH A;  4MZB A;  1EOG A;  4MNN A;  2C0G A;  5CNW A;  2VL3 A;  4MZC A;  1X9S B;  4FYC A;  1Z6N A;  5ECN B;  2MMZ A;  1Z6M A;  2OA7 A;  4PQ1 A;  3HVS A;  1R26 A;  5LNK e;  1TP9 A;  4RI6 A;  2YZU A;  3IXR A;  4JED A;  4WKW A;  3H1N A;  3DVW A;  2B5Y A;  2H1D A;  3L0H A;  4K5S A;  2HE3 A;  4GST A;  1G7O A;  3GH6 A;  1TRW A;  2J9H A;  1URM A;  2DC5 A;  3DEX A;  4NPB A;  5CYY A;  3D5J A;  4GF0 A;  2CX3 A;  1K0B A;  4K8M A;  4TR1 B;  2ALB A;  4KSM A;  2R6K A;  5IIZ A;  3IC4 A;  4EUY A;  5D9X A;  3ED3 A;  2E7P A;  4LL1 B;  3GV1 A;  3APS A;  3VI5 A;  4GLT A;  2XBI A;  3D22 A;  1MEK A;  3C73 A;  4FYB A;  2QSI A;  5J3R A;  2H75 A;  5DBQ A;  1XW9 A;  5JCU A;  4NHZ A;  5EL8 A;  3P7X A;  2B7K A;  2K18 A;  2H70 A;  1CQH A;  3D6I A;  1YZX A;  3FW2 A;  3A5W A;  5JWO B;  4ZB8 A;  1J0F A;  4N30 A;  1K0D A;  3UL3 A;  1XOB A;  4Q5N A;  1XIY A;  1B8X A;  2CZ2 A;  2VM1 A;  1O6J A;  3TKS C;  2IMF A;  4ID0 A;  3TRQ A;  2PN8 A;  3HHV A;  1WIK A;  4LL4 B;  2IME A;  4QL9 A;  3L78 A;  4EXJ A;  4MPF A;  8GSS A;  4XIH A;  3ZYW A;  1GRX A;  1Z3E A;  2H72 A;  3VWV A;  4OO4 A;  1JLW A;  4OO5 A;  5IMC A;  2WJU A;  4MAB A;  3W6G A;  4DEJ A;  2VCX A;  3O76 A;  1F3A A;  4HU7 A;  3UBL A;  1T4Z A;  3ZZX A;  2C3T A;  1EP7 A;  3OR5 A;  2CT6 A;  1TRU A;  4G0L A;  5L71 A;  3EPT A;  5KN3 A;  3MIX A;  1SYR A;  2V6K A;  2CV4 A;  4PUA A;  2FGX A;  3LXZ A;  1PQN A;  5G2Z A;  5IMD A;  2E0Q A;  4E8E A;  1ML6 A;  1SKW B;  2B5E A;  4G10 A;  4MCU A;  10GS A;  3GIX A;  1PGT A;  3HVV A;  1GUL A;  1OC3 A;  1PN9 A;  5CAX A;  3H93 A;  3MNG A;  1PL1 A;  1SKS B;  2L59 A;  2DJK A;  3GL5 A;  1T00 A;  2A2S A;  2HYX A;  2IPA A;  2DKI A;  2I81 A;  2X99 A;  3TJJ A;  2H71 A;  1B9X C;  5ECL B;  5IMZ A;  1AQW A;  1WMJ A;  3ZL5 A;  1Z7R A;  1XVW A;  4O7H A;  4AJ8 A;  3EWL A;  3C8E A;  1G6Y A;  3BCI A;  3FKF A;  2TIR A;  5DQY A;  1WP0 A;  2A2P A;  1PX7 A;  3DVX A;  1AIU A;  5DCG A;  2YWN A;  2HSY A;  5CO3 A;  2F8A A;  2R37 A;  1A2J A;  3ZRE A;  1G0T A;  1PRX A;  3LFL A;  4EL1 A;  1WE0 A;  5C04 A;  2H1G A;  1BED A;  4IQJ M;  3EC3 A;  4HUA A;  3EU4 A;  2KHP A;  1SYX A;  1BX9 A;  3TKP A;  2RUF A;  4OMV A;  1BAY A;  1TK5 B;  4ML1 A;  2F8F A;  4KE3 A;  3GX0 A;  4I97 A;  1KEB A;  2H0H A;  1KTE A;  4K5R A;  1YEP A;  5DAK B;  2PGT A;  4MP4 A;  2MBS A;  1GL8 A;  2OE1 A;  1OKD A;  4PX1 A;  3VI7 A;  2QGV A;  2VL2 C;  2VO4 A;  3L9V A;  4NWY A;  1IYI A;  1OC8 A;  3EMP A;  3IC8 A;  2CAI A;  4AGS A;  3UMA A;  1QK8 A;  1YDK A;  3M0F A;  4WXT A;  1W4V A;  2TRX A;  3BCK A;  5F06 A;  1V9W A;  4V2L A;  5F07 A;  3W8S A;  3RPP A;  3UAR A;  4F2I A;  2IMI A;  3C71 A;  1TK0 B;  1V40 A;  5H5R A;  5HFI A;  1T4Y A;  1OC9 A;  2LJR A;  4ECC A;  2WGR A;  3WT1 A;  4P3Y B;  2WCI A;  1ZYN A;  5H5S A;  1VRS D;  2VL9 A;  4F9Z A;  1AC1 A;  1AXD A;  1WWJ A;  3A2X A;  1Y25 A;  2EIO A;  2LEG A;  3TJF A;  4F03 A;  1FVJ A;  2AJQ B;  3M9K A;  1WOU A;  3Q18 A;  3QAV A;  2YWO A;  2VLU A;  2VLV A;  3QPM A;  4ZIJ A;  4EO3 A;  2M80 A;  4LMV A;  2HRK A;  1QXH A;  1GLP A;  3DKS A;  5G5F A;  1O8W A;  3IBH A;  3G7I A;  14GS A;  1JZO A;  5ECK B;  1XWC A;  2R3X A;  2XC2 A;  4NV2 A;  1GSE A;  5JCG A;  1F3B A;  4O32 A;  2K8V A;  2CX4 A;  5BRT A;  4K7O A;  3LW9 A;  5KN2 A;  3TJK A;  3APQ A;  1UA5 A;  5A4U A;  4WET A;  5ECM B;  2EIQ A;  2NPB A;  1GSY A;  5J9C A;  1YY7 A;  1V2A A;  5IM9 A;  1PD2 1;  2NDO A;  2WDU A;  3E3E A;  1ACV A;  2C0F A;  1T7P B;  4ZL9 A;  3ZTL A;  2L4C A;  1Y6E A;  2KLX A;  4YAV A;  1ZGN A;  3F4T A;  3DGQ A;  2OE0 A;  3GN3 A;  4IS0 A;  3F3R A;  2BMX A;  2NBS A;  1M99 A;  3F6F A;  22GS A;  1V58 A;  1NW2 A;  4MJE A;  1SK0 A;  4ZIL A;  3KH7 A;  1FOH A;  4NHW A;  3ZFB A;  3TRP A;  3QOU A;  2VCQ A;  1K0O A;  3SBC A;  3RHB A;  3DML A;  5ECH B;  2C1Y A;  2VCT A;  2FWF A;  5INY A;  3KD0 A;  2XHF A;  1QUW A;  1FO5 A;  5ID2 B;  2N5B A;  1T3B A;  2KP2 A;  5ENU A;  2YWI A;  3EU3 A;  2DBC A;  5B6N A;  1YJ6 A;  2MMO A;  5A4V A;  3J7Y k;  3C1R A;  2J23 A;  19GS A;  4JR4 A;  3LEF A;  4MK3 A;  2CAQ A;  3TKR A;  1TJD A;  4LLR A;  1GSQ A;  5DDL A;  3G7J A;  5CRE A;  2C8U A;  2IJY A;  7GSS A;  4KA0 A;  4ZBD A;  1XFL A;  2V1M A;  2YV7 A;  2GT5 A;  1JLV A;  2VCV A;  4NAX A;  2H1B A;  4EKZ A;  3FZ9 A;  3CMI A;  4H86 A;  4WEY A;  1FB6 A;  2X64 A;  1GUM A;  3EYT A;  5HFG A;  2VD0 A;  2IIY A;  3AY8 A;  1KNG A;  1TKD B;  2A4V A;  4KB3 A;  1TRV A;  2H66 A;  3HDC A;  1AQV A;  1XZO A;  1GTU A;  2AYT A;  3FZ4 A;  4QL7 A;  3DIE A;  2HZE A;  5D9V A;  2OAD A;  4RI7 A;  5ELG A;  1B4P A;  3IDV A;  2H01 A;  1BYE A;  3F9U A;  1EP8 A;  2IWT A;  5C00 A;  4POL A;  18GS A;  2XBQ A;  3GST A;  5HQP A;  4OWY A;  3L9S A;  2D2Z A;  1ST9 A;  1X9W B;  4K0G A;  4ICY A;  4IJI A;  4KSO A;  4Z2R A;  1JZW A;  4ISD A;  4FQU A;  4GWR A;  1N2A A;  3GTU B;  3JCM L;  1HQO A;  3HJM A;  1XWK A;  1M9A A;  1X9M B;  1U87 A;  3KGK A;  2C3Q A;  2AHE A;  4Z2T A;  4GSN A;  2VCZ A;  4FO5 A;  4KDX A;  3WGE A;  2V41 A;  1XXU A;  5CRH A;  3GUR A;  4I8B A;  1GSS A;  5LD0 A;  2A4H A;  4E8H A;  3UEM A;  2KP1 A;  2BJX A;  4KCE A;  4OFN A;  4MF7 A;  4IHU A;  4IQ1 A;  2LRC A;  4GQF A;  4XS6 A;  3Q6O A;  3HJO A;  3KM6 A;  4JZQ A;  3DRN A;  2VUP A;  5E59 A;  2JZT A;  3TDG A;  4RUV A;  3M9J A;  1J08 A;  1K0A A;  2IFQ A;  3VK9 A;  4IJ3 A;  3IA1 A;  3F8U A;  2YJH A;  5H5Q A;  4PUR A;  3FYG A;  2MYG A;  1OKT A;  4MJB A;  1XOA A;  5J9B A;  2LQO A;  3C7M A;  2H30 A;  4XRA A;  1GSF A;  1B4Q A;  2GSQ A;  4CY6 A;  2YP6 A;  1Q98 A;  3GKX A;  2GSR A;  4IBP A;  1JZR A;  2ON7 A;  2FCH A;  4N0Z A;  1H4O A;  5DQS A;  4HQZ A;  4KW6 A;  1MDJ A;  3FR6 A;  1Q4J A;  1QMV A;  4DSR A;  1SKR B;  3N9J A;  1THX A;  2RII A;  3QD9 A;  1OYJ A;  2HT9 A;  1TI3 A;  1ZMA A;  2AB6 A;  3EE2 A;  5AIX A;  5F0G A;  1O81 A;  1PSQ A;  1O8X A;  2HRN A;  2D27 A;  2FHE A;  6GSX A;  1UN2 A;  2CQ9 A;  5G1K A;  4V1A g;  4GSS A;  4IN0 A;  5DCH A;  3F63 A;  2NVL A;  2TRC P;  2M72 A;  2R0C A;  5IQY A;  2C80 A;  4K7I A;  1YF1 A;  2HSM A;  4PNF A;  4F0B A;  3VPQ A;  2YV9 A;  4HOJ A;  2GDR A;  2A2R A;  4D73 A;  3H79 A;  2K6V A;  1FVK A;  4EIP A;  2CVK A;  1NHY A;  4BVX A;  1PX6 A;  2R2J A;  2AUV A;  3LJR A;  3D21 A;  2QA1 A;  1T1V A;  4POB A;  6GSW A;  4TXO A;  4G19 A;  2FA4 A;  1SJZ A;  4XS4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...