3F4SA

Crystal structure of wolbachia pipientis alpha-dsba1 t172v
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
199
structure length
199
Chain Sequence
b'TSNELLLPLPNDKLLGDPKAPILMIEYASLTCYHCSLFHRNVFPKIKEKYIDTGKMLYIFRHFPLDYRGLKAAMLSHCYEKQEDYFNFNKAVFNSIDSWNYYNLSDLTLLQRIAALSNLKQDAFNQCINDKKIMDKIVNDKSLAINKLGITAVPIFFIKLNDDKSYIEHNKVKHGGYKELKYFTNVIDKLYGKAIVKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structural and Functional Characterization of the Oxidoreductase alpha-DsbA1 from Wolbachia pipientis
pubmed doi rcsb
source organism Wolbachia pipientis
molecule tags Oxidoreductase
total genus 74
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2008-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.80 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Ribonucleotide Reductase Protein R1; domain 1 3f4sA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3f4sA01
3M1GA 2D2ZA 2DIYA 2VCZA 2JADA 3M9KA 4POMA 1NHYA 2L59A 4I5QA 2QC7A 4BWQA 3L78A 5DJLA 4F9ZA 2NPBA 5ABRA 2XBIA 3Q74A 5IM9A 5IIZA 3F6FA 3CRTA 3QAGA 1JFUA 3GIXA 5KEJA 1ERTA 4DVCA 1S3AA 3H93A 2CT6A 2WB9A 2E0QA 3CMIA 1NHOA 2C4JA 3I43A 1GWCA 4J57E 4ECJA 3H4KA 4ZB8A 2PGTA 3VWWA 1A24A 1N8JA 4LL1B 2VM1A 4HQZA 2AV4A 2YANA 3K8NA 4K2DA 5B7CA 1GP1A 1SK1A 3EMXA 4Z7XA 2VL9A 2VL2C 1XVQA 4PUAA 4QL9A 1OC9B 5DJMA 4KDXA 2AUVA 4EXJA 1V2AA 2B1KA 1TP9A 2MZCA 1WIKA 2B6MA 1XW6A 1ZYQB 2IPAA 4N0ZA 2GGTA 1ZGNA 1SL0B 2I9HA 4L5OA 2H71A 2FWHA 3LYPA 4TOPA 3LJRA 4ISDA 4HUAA 2PVQA 4ZL8A 2M46A 1K3LA 3FW2A 1M99A 1FVJA 1TDIA 1X0RA 20GSA 2C3NA 3GKMA 5ECNB 1PMTA 3D21A 1T8EB 13GSA 4HU7A 1UC7A 2PVOC 3ZZXA 4CW9A 1F37A 5CRWA 4NAXA 3LG6A 3PINA 2L6DA 4KDUA 1XW9A 4X43A 4EVMA 1WWJA 11GSA 4F2IA 5D8IA 1WMJA 1X9SB 2AAWA 4K6XA 5ECSA 2MYGA 4JEDA 3NOFA 4DEJA 1UN2A 2H0IA 1QGVA 1Z6MA 3KM6A 4WF5A 4O7HA 4HOJA 3QAWA 5FHIA 2OE0A 3W6GA 3DEXA 3CTGA 4NHWA 1B48A 4MF6A 5F8BA 2WDUA 3CSIA 1HQOA 1VF2A 2HLSA 5IOXA 1AC1A 2DJKA 2PN8A 1THOA 5ECQB 3IC4A 2EC4A 4KUNA 1K3YA 2OKAA 1XOBA 4JU5A 3U5RE 1Z3EA 3BJ5A 4OWYA 2PERA 3F9UA 4HI7A 2H0GA 1DBYA 3GYKA 4KAEA 4TRXA 1V58A 3UIWA 5KN3A 1R26A 2LNTA 3PR8A 1J0FA 1O8WA 3EE2A 3D22A 2PU9C 4FYBA 3TJBA 5GZZB 3ZYWA 4RI6A 2VLTA 1SKWB 3RHCA 4ECIA 1U6TA 2C0EA 1SK2A 2LRCA 4V2LA 2LEGA 6GSSA 5JWRB 3SBCA 3DYRA 1FO5A 3LYKA 2F9SA 6GSUA 3F6DA 4PQ1A 8GSSA 5IMDA 3M9JA 2HYXA 3TKSA 2FA4A 2K18A 1AXDA 1GSDA 3GKNA 3ZRDA 1BG5A 3D6IA 2NBSA 3WGEA 4YH2A 1EEJA 4MH3A 1PX6A 1HYUA 2FGXA 1AQXA 2REMA 2VLUA 4G10A 2YWIA 2X64A 3A3TA 2LRTA 2OADA 4QL7A 4XRDA 5B8BA 2YJHA 2RLIA 4MZBA 1ZMAA 2CVDA 2J9HA 2CVKA 5F05A 3HYPA 3MDKA 2IWTA 1K0DA 3HXSA 1ST9A 1O6JA 4BVXA 4WR4A 1Y25A 4YAVA 2H01A 2H1BA 1QK8A 3DD3A 1GUKA 3LXZA 1GSUA 3GKXA 1OC8A 3LWAA 4PXOA 1U3AA 4I6XA 3G7IA 2NDOA 1GSYA 5GSSA 4OCFA 3O6TA 4P3YB 4FIWA 2P0GA 5ECIB 4FO5A 4DSQA 1KBNA 2H75A 2C8UA 1MDKA 1A8LA 3CSHA 2KP2A 3FY7A 4BA7A 3IK9A 1KTEA 4FYUA 1FHEA 1GUHA 5IOWA 2CZ3A 3QR6A 2DMLA 2FUG2 2CZ2A 1GSFA 1K0NA 4MZWA 4ZIJA 1YF0A 3UJ1A 1VGLA 3LXTA 1F2EA 4EUYA 4EE0A 3IPZA 3D4TA 4MMMA 3KJYA 3DWVA 3EC3A 1YZXA 3ZFLA 5ECKB 1GLQA 2FWFA 1SKSB 1VF3A 4NWYA 1MD4A 3ZMKA 2E2MA 5ELAA 1SKRB 5CYYA 2CA8A 2IMKA 5ELGA 1GRXA 5G1KA 1ZCPA 3WGXA 5D9XA 2DSAA 5CRGA 1O7UA 2N5BA 1U88A 4XS4B 3WT1A 1AUCA 5D73A 3Q18A 3DVWA 3TJFA 1RQMA 4MK3A 4GQFA 1XPVA 2TRXA 3LFLA 1R4WA 3IHQA 2MMOA 1GNEA 5HR3A 4YQUA 5ID2B 4XCSA 2KHPA 3TOTA 1W89A 3CRUA 4WKWA 1Z6NA 3VK9A 5G2ZA 1ACVA 1XXUA 2YJ7A 4EDZA 2FA8A 2OBKA 2DBCA 4O32A 3LORA 12GSA 1NM3A 4MDCA 3EWLA 2M72A 1EOHA 1T1VA 1SU9A 4GLTA 4MABA 3ERWA 1ERUA 4GTUA 1GSQA 1TW9A 2PBJA 1PKZA 2H8LA 2GQLA 5A5KA 1LJRA 5IO0A 3MSZA 2GZZA 4MJCA 4MJBA 1A2JA 3IAS2 4I2TA 1T00A 1K3OA 4TKYA 4WF4A 2V32A 4ECBA 22GSA 1T4YA 2HZFA 3TKSE 3EMPA 3GUSA 4GCIA 3RHBA 3KCMA 4EKZA 4IN0A 1X5DA 1SENA 2R2JA 2FNOA 2RUEA 4MJEA 4RUVA 2V2GA 2XC2A 3ISOA 2LJKA 2B7KA 4HU9A 4RI7A 4HJMA 4MCUA 4NXIA 3ZIJA 2LUSA 4ML6A 1GTBA 3Q19A 2G2QA 1GH2A 2DJ0A 1OKDA 2IMDA 3EINA 1VF4A 2VCTA 2BJXA 4ID0A 3QPMA 1S3DA 3KH7A 5D9VA 2NTOA 1TU7A 4K7IA 2P5QA 4I8BA 2QSIA 2HFDA 4KX4A 2VD1A 1ON4A 3F3QA 1PSQA 4LL4B 3HVXA 3VURA 14GSA 6GSXA 5DALA 1PQNA 3QAVA 3P2AA 4PNGA 1ERVA 5G1LA 3UBKA 1Q98A 3KTLA 4PUFC 1URMA 2H74A 2ON5A 4TW5A 3GRXA 1Z5YE 1QUWA 1ZZYA 1SJZA 3HD5A 3IA1A 1GULA 2A4VA 3FZ5A 1BQ7A 1HNBA 1EWXA 4N10A 1KEBA 4JR6A 2CX4A 1PKWA 1FG4A 1G6YA 4TXOA 4EC0A 4Q5NA 4PQHA 4WBJA 5HFGA 3OR5A 2E7PA 1XFLA 3M8NA 3JCML 3HJOA 1EGRA 5CRDA 4D73B 1I5GA 1Y6EA 3MNGA 4ML1A 5G5FA 1A8YA 5HFKA 3IAM2 3RAZA 3D0ZA 5DQYA 1B4QA 2GLRA 4XS1A 1PD21 1PRXA 1G6WA 3BCIA 4IJ3A 2L4CA 1OYJA 5ECMB 2ALBA 2YP6A 3CXGA 5CREA 3EU3A 3V1WA 2VCVA 2L6CA 1YKCA 1Z9HA 3FRCA 3GFKA 4EO3A 3TRPA 2AB6A 3WYWA 2C3TA 3FK8A 5LNKe 3TJKA 1EEMA 3ZFBA 5ECRB 1K0AA 2RM6A 5IQYA 1X5EA 3GTUB 2ZUPA 1F3AA 2GSSA 1XOAA 3HA9A 3GMFA 1M2BA 2V6KA 5E59A 4O5RA 2B1LA 5JWOB 1XWBA 2VIMA 1FB0A 4TR0A 3HZ4A 1YEPA 3FEUA 3O76A 4POKA 3RBTA 5J3RA 5G30A 1JHBA 2GTUA 4OCEA 9GSSA 3A2WA 3I9V2 1LBKA 3MWHA 1F6MC 5H5SA 4KSMA 1FVKA 2LSTA 2JSYA 4PX1A 3J7Yk 1R7HA 5FWGA 4ECCA 1K0MA 2P5RA 2GQMA 4DSRA 3TKSC 1OVNA 2GSTA 2G0FA 3GA4A 3FR9A 2H6XA 4AJ7A 1JZOA 5IMVA 2K8SA 5CNWA 2FHEA 2CAQA 3P90A 1TRUA 1FB6A 2O89A 1SK0A 4N30A 3PH9A 2YV9A 2H0HA 5E4WA 4N11A 5CAXA 4ZILA 3U6VA 3DIEA 2ES7A 3QFBC 5AN1A 5FT3A 3BBYA 5EVOA 2I3YA 5J9CA 4WEYA 1QQ2A 3LGCA 4GSTA 1Z7PA 2F8FA 3FZ4A 5COHA 4DSSB 3FR6A 3G7JA 5LCZA 5LD0A 4KDYA 1EZKA 3VPTA 1R5PA 3IOSA 2FLSA 2YZUA 4JR4A 3C1SA 1YDKA 3QD9A 4RQRA 2VAFA 3E9JB 4KGIA 3P7XA 4TR1A 2C0GA 2V6OA 3ZIVA 2DJ2A 4F03A 1ZOFA 2WJUA 4NHZA 4OD7A 3HVVA 3F4RA 2WGRA 2HE3A 3KGKA 2C3QA 5AIXA 1EV4A 3O3TA 4L0UA 5GAND 1E6BA 1T4ZA 2I1UA 2X8GA 4ULXA 5IMFA 2JZRA 3GX0A 1BJXA 4L8EA 3DVXA 4K7NA 2GZPA 2L4QA 3KMOA 1ILOA 2JU5A 1TI3A 1RK4A 2IFQA 1SD8A 1MEKA 4OMVA 2IL3A 3L9SA 3LQ7A 3HDCA 1BYEA 2LRNA 4GWRA 1UVZA 2GT6A 4WXTA 3VLNA 4KW6A 5G5EA 4GQCA 4IS0A 2H72A 3L9UA 3E0UA 3C7MA 2FWEA 1DE2A 1M2AA 2MMNA 4V1Ag 3TKQA 5D93A 2X99A 1SL2B 2VCQA 2HSYA 1AIUA 1ERWA 4E8HA 1YQ1A 5B8AA 1QFNA 2VO4A 3GSTA 3GL5A 1WE0A 4CHSA 1F9MA 1XWKA 2C1YA 3ERFA 3L4NA 1U3IA 3VI5A 2AYTA 3N5OA 2GQKA 3BCKA 3APQA 2CAIA 2HSHA 2R4VA 3W8SA 1PX7A 3UAPA 4WBRD 5L71A 2KOKA 2YCDA 1OE8A 2VLVA 1JZRA 2TRCP 1SD9A 4TN8A 1U87A 2BMXA 1YJ6A 1O81A 3VFIA 2HI7A 1WJKA 5C04A 1N2AA 4KA0A 4HZ2A 3GH6A 3G9BA 3FYGA 5D96A 5IPHA 1TXXA 2F3MA 1THXA 3EVIA 5C00A 3HY2A 1I9DA 1YF1A 1HNAA 4ZL9A 2FY6A 2GSQA 3ZLPA 2VCXA 3IK7A 5EY6A 1JLWA 1NSWA 1XW5A 3A2VA 4MZCA 2LV3A 3ZVJD 3F63A 5J4UA 2I4AA 3H1NA 2B5YA 5IPGA 2XPDA 4MJAA 1XZOA 2XBQA 1TI1A 2LQQA 2V1MA 4HEA2 1LU4A 4E8EA 1XCCA 2YWMA 3ERGA 3IE3A 4LLRA 3KMNA 10GSA 1YEXA 1OAZA 2E2GA 3UL3A 2VOCA 3HZ8A 3ME8A 3CBUA 4IW9A 3F8UA 3KZQA 4EDYA 5EPFA 4PURA 1XIYA 5HFIA 3VPQA 3TRQA 1YY7A 2PPTA 2AHEA 1C72A 4FYCA 2K6VA 4LMWA 2EIRA 3TUEA 2IN3A 1XWGA 1T7PB 1MD3A 2LJRA 4XTSA 4IP6A 3C71A 3F4TA 3F3RA 3DGQA 3IV4A 5HR2A 1SJ6A 3FZAA 4J56E 2YPMA 5F06A 3QDNA 1EOGA 3ZREA 4AF2A 1CQHA 2JZTA 1X9WB 1V98A 3APOA 3KP8A 2OBIA 3KEBA 5JWQB 3TKPA 4O92A 4K9ZA 4IELA 4NPBA 4I97A 5JCUA 3I69A 2MBTA 3GHAA 4QQ7A 2OACA 1TOFA 1SJIA 3DKSA 1WP0A 3SWLA 5IO2A 3TOUA 4EL1A 4IQ1A 3FKFA 4LMVA 4CDOA 4K7OA 4V2NA 6GSWA 4PGTA 2OE1A 5JCGA 2VL3A 4KNDA 3H79A 4KE3A 3QMXA 4YQMA 1XWAA 5G31A 2DMMA 1A0RP 2M80A 2R6KA 5CP1A 3ZVJA 1UA5A 3G7YA 1K0OA 2H73A 5HR0A 3E3EA 2VUPA 2XPEA 1ZL9A 2QKEA 2X8CA 1MDIA 3FHKA 2HRNA 4IP1A 2EIQA 2WZ9A 4NMUA 1S3CA 4KCAA 5DCHA 5H5QA 4IKHA 1M9BA 5JCWA 5INYA 5DCGA 1Q4JA 3NZNA 1KNGA 2CX3A 3QFAC 1H75A 4PQIA 1T3BA 1V57A 4Q5QA 2IMIA 2IMEA 4IGJA 1G0TA 3RPNA 5J9BA 3EYTA 1TRSA 4AJ6A 4H86A 1F3BA 2WRTA 2CVBA 3TKRA 4AGSA 4G2EA 4GSNA 1ZYEA 2LKUA 4BVYA 5J41A 4K1FA 3HJMA 2TIRA 1B9YC 3PGTA 6GSYA 2DLXA 2DC5A 3GX8A 5DAKA 2GDRA 2HRFA 4XS6A 4K0GA 5D9WA 3TDGA 4WR5A 4IQAA 2MBSA 2I81A 6GSVA 4NV2A 3BD2A 1O8XA 2OJLA 1B9XC 5ECPB 1NW2A 4J2FA 2H30A 1X5CA 2PMTA 4MP4A 1FW1A 2LNSA 3IR4A 1TU8A 2P31A 4PNFA 2FWGA 3RDWA 2LTKA 2YOIA 1GNWA 17GSA 4IHUA 2CQ9A 4F0BA 2F51A 3HHVA 1EGOA 2R3XA 1B8XA 3KP9A 1DSBA 2YV7A 2N5FA 2VL2A 4OFNA 1IYIA 1QXHA 2L5LA 1A2LA 1OC3A 4GF0A 3TCOA 2JL4A 2Z9SA 1Z7RA 3UBLA 2RIIA 1SL1B 3KXOA 3GL3A 3UMAA 5HR1A 3GV1A 4X0XA 1ML6A 7GSSA 1K0CA 3WT2A 3D5JA 1M7TA 4XS4A 1WPIA 4BWSA 2YZHA 3LSZA 4G9HA 2K9FA 2OE3A 2RM5A 3KH9A 2CV4A 5HQPA 2JZSA 4ZBAA 4HDEA 5IMZA 1H4OA 3WGDA 3GKKA 1J9BA 1PL2A 2OA7A 4ILFA 2C0FA 3FR3A 2L5OA 4ZL7A 4YQVA 2O8VB 1EP8A 4XIHA 3APSA 5ID2A 2AJQB 4JBBA 3KTBA 4KCEA 5GSTA 2PUKC 3QOUA 1A2MA 5KN0A 2C0DA 5J5NA 1XBSA 5H5RA 1ABAA 3ED3A 4RQXA 1VF1A 4N0VA 3US3A 3VI7A 1GUMA 2B5EA 1GSEA 3D4MA 3AY8A 2IJYA 3CYNA 2H6YA 1TRWA 1XWCA 2HZEA 1GTUA 3C1RA 2LJAA 3QCPA 5CO3A 5AGYA 4F0CA 3F0IA 4MA9A 5B6NA 5EL8A 2A2RA 5DQSA 4L5LA 5ENUA 4TR3A 5AISA 4GXZA 4HJ2A 3A2XA 4K8MA 2ZCTA 3HJPA 2H70A 3CTFA 2R5GA 1TRVA 3IXRA 4ZXGA 2FD3A 1HD2A 1FOVA 4Q5RA 2HNLA 4POBA 3RPPA 3NIVA 1WOUA 4JRRA 1OKTA 1G7EA 2L57A 2VM2A 5DALB 3HKRA 3LEFA 3N9JA 5ECOB 5KN1A 4MH2A 5DVBA 4LA1A 3MAKA 3ZL5A 1YKAA 5DBQA 2H19A 4POLA 3GSSA 4EF0A 2DJ3A 3Q6OA 1AQWA 2LS5A 1USBA 1GTAA 2GVPA 4MPFA 4XHMA 1MDJA 1AAZA 2H1GA 4KH7A 1GLPA 3I6AA 4MF7A 4JE1A 5F07A 2DJJA 4IJIA 3UVHA 4TXOB 1JZWA 1JZDA 4NV5A 2B3SA 1GTIA 3A5WA 1CQGA 5A4VA 2PWJA 3ZITA 3S9FA 2GSRA 3VWXA 4JZQA 2N5AA 3C73A 2EIOA 2K8VA 2HXKA 1M9AA 2H6ZA 1HNCA 1A0FA 2JSZA 5ECLB 5CRHA 1K0BA 1J08A 4OFMA 1AQVA 3R2QA 5DAKB 2GT5A 2HT9A 3TJJA 2VCWA 5A4WA 1G7OA 2V41A 3UEMA 3KIJA 1M0UA 3UOMA 4Q5FA 1EP7A 18GSA 3GURA 1OC9A 2GS3A 5F0GA 2WULA 3H8QA 1W4VA 4KB3A 2YWOA 3L0HA 2IIYA 4D73A 2GZYA 1AW9A 4HZ4A 1BEDA 4GSSA 3L9VA 1TK8B 1GSSA 2H1AA 1IYHA 1PL1A 4MF5A 2RUFA 3HVSA 1TJDA 2B7JA 3EURA 1BX9A 3BOAA 2BTOT 1PGTA 2VD0A 1EV9A 6GSTA 2J23A 2KLXA 2KP1A 4K0NA 4ZB9A 1TTZA 1PN9A 2DIZA 4ACSA 3TJGA 4F82A 4TR4A 3ZMLA 4OO4A 4WETA 2QGVA 1TKDB 4G19A 19GSA 5ECHB 4X1UA 2IMFA 2X8HA 1V40A 3DRNA 2ZNMA 2WFCA 3GTUA 2NVLA 2LQOA 3UVTA 1SYXA 1R5AA 4V2MA 4MPGA 2O85A 4ZB6A 2O87A 3M3MA 4AJ8A 3J7Yb 4TXVA 2DJ1A 3CSJA 3P8WA 3GNJA 1JLVA 1TK5B 1B4PA 4FH8A 3HCZA 3DXBA 5DDLA 1TK0B 5B6MA 2B5XA 1DE1A 2H1DA 1MTCA 1E2YA 1BAYA 2WS2A 3TRXA 2HZEB 2R37A 4OFTA 3VWVA 1XVWA 4OO5A 3F4SA 2YNXA 1FAAA 3KD0A 5D9TA 2JACA 3VWUA 16GSA 2ON7A 5A4UA 4HS1A 2KUCA 4IBPA 5GAPD 4MLYA 4BL7A 4TR1B 4IVFA 3EU4A 2YWNA 2FCHA 4I2UA 4YAPA 2WCIA 5KN2A 3IDVA 3ME7A 5AIVA 4V1Ap 2YN1A 1VRSD 1DUGA 4GRFA 3IBHA 1X9MB 2MMAA 5IMCA 3TB2A 1SYRA 4TVEA 5IMAA 3ZTLA 1PA3A 3IRAA 4HQSA 3GN3A 4DSSA 4BPYA 1O85A 2H76A 2F8AA 1OE7A 1RW1A 3M0FA 3C8EA 3TGZA 3GH9A 1V9WA 2A2SA 1A23A 1WRYA 4ZBBA 2IFQB 4XRAA 2C80A 2H66A 4KSOA 3DMLA 1GL8A 2XHFA 1O73A 1M2DA 2MMZA 3W8JA 4L0WA 3UARA 1QMVA 3FZ9A 4ZBDA 3WD6A 2O7KA
chains in the Genus database with same CATH superfamily
3M1GA 2D2ZA 2DIYA 2VCZA 2JADA 2X4AA 3M9KA 4POMA 1NHYA 2L59A 4I5QA 2QC7A 4BWQA 3L78A 5DJLA 4F9ZA 2NPBA 5ABRA 2XBIA 3Q74A 5IM9A 5IIZA 1Z4JA 3F6FA 3CRTA 3QAGA 1JFUA 3GIXA 5KEJA 1ERTA 4DVCA 1S3AA 3H93A 2CT6A 2WB9A 2E0QA 3CMIA 1NHOA 3EPTA 2C4JA 4NFLA 3I43A 1GWCA 4J57E 4ECJA 3H4KA 4ZB8A 2PGTA 3VWWA 1A24A 1N8JA 4LL1B 2VM1A 3BWVA 4HQZA 1Z4MA 2AV4A 2YANA 3QBPA 3K8NA 4K2DA 5B7CA 1GP1A 1SK1A 3EMXA 4Z7XA 3U19A 1U16A 2VL9A 2VL2C 1XVQA 4PUAA 1DCNA 4QL9A 1OC9B 5DJMA 4KDXA 2AUVA 4EXJA 1V2AA 2B1KA 1TP9A 2MZCA 4YKFA 1WIKA 2B6MA 1XW6A 1ZYQB 2IPAA 4N0ZA 2GGTA 1AUWA 1ZGNA 1SL0B 2I9HA 4L5OA 2H71A 2FWHA 3LYPA 4TOPA 3LJRA 4ISDA 4HUAA 2PVQA 4ZL8A 2M46A 1K3LA 3FW2A 1M99A 1FVJA 1TDIA 1X0RA 20GSA 2C3NA 3GKMA 5ECNB 1PMTA 3D21A 1T8EB 13GSA 4HU7A 1UC7A 2PVOC 4YKGA 3ZZXA 4CW9A 1F37A 5CRWA 4NAXA 3LG6A 3PINA 2L6DA 4KDUA 1XW9A 4X43A 4EVMA 1WWJA 11GSA 4F2IA 5D8IA 1WMJA 1X9SB 2AAWA 4K6XA 5ECSA 2MYGA 4JEDA 3NOFA 4X4JA 4DEJA 1UN2A 2H0IA 1QGVA 3MIXA 1Z6MA 3KM6A 4WF5A 4O7HA 4HOJA 2FUSA 3QAWA 5FHIA 2OE0A 3W6GA 3DEXA 3CTGA 4NHWA 1B48A 4MF6A 5F8BA 2WDUA 3CSIA 1HQOA 1VF2A 2HLSA 5IOXA 1AC1A 2DJKA 2PN8A 1THOA 4Z2TA 5ECQB 3IC4A 2EC4A 4KUNA 1K3YA 2OKAA 1XOBA 4JU5A 3U5RE 2HVGA 1Z3EA 3BJ5A 2PERA 3F9UA 4OWYA 1Q5NA 2H0GA 4HI7A 1DBYA 3GYKA 4KAEA 4TRXA 4BL7B 1V58A 4ICYA 3UIWA 5KN3A 1R26A 2LNTA 3PR8A 1J0FA 3IC8A 1O8WA 3EE2A 3D22A 2PU9C 1HY0A 4FYBA 3TJBA 5GZZB 3ZYWA 4RI6A 2VLTA 1SKWB 3RHCA 4ECIA 3GZHA 1U6TA 3U13A 2QGAB 2C0EA 1SK2A 2LRCA 4V2LA 2A4HA 2LEGA 6GSSA 5JWRB 3SBCA 3DYRA 1FO5A 3LYKA 2F9SA 6GSUA 3F6DA 4PQ1A 8GSSA 5IMDA 2QA1A 5KOWA 3M9JA 2HYXA 3TKSA 2FA4A 2K18A 1AXDA 1GSDA 3GKNA 3ZRDA 1BG5A 3D6IA 2NBSA 3WGEA 4YH2A 1EEJA 4MH3A 1PX6A 1HYUA 2FGXA 1AQXA 2REMA 2VLUA 4G10A 2YWIA 2X64A 3A3TA 2LRTA 2OADA 4QL7A 4XRDA 1J3UA 3IHGA 4G0LA 5B8BA 2YJHA 2RLIA 4MZBA 1ZMAA 2CVDA 2J9HA 2CVKA 5F05A 3GTDA 3HYPA 3MDKA 2IWTA 1K0DA 3HXSA 1ST9A 1O6JA 4BVXA 4WR4A 1Y25A 4YAVA 2H01A 2H1BA 1QK8A 3DD3A 2PTQA 1GUKA 3LXZA 2E9FA 1TJUA 1GSUA 3GKXA 1OC8A 3LWAA 4PXOA 1U3AA 4I6XA 3G7IA 2NDOA 1GSYA 5GSSA 4OCFA 4BVYB 3O6TA 4P3YB 4FIWA 2P0GA 5ECIB 4FO5A 4DSQA 1KBNA 2H75A 2C8UA 1MDKA 1A8LA 3CSHA 2KP2A 3FY7A 4BA7A 3IK9A 1KTEA 4FYUA 1FHEA 1GUHA 5IOWA 2CZ3A 1PN0A 3QR6A 2DMLA 2FUG2 2CZ2A 1GSFA 1K0NA 4MZWA 4ZIJA 2JARA 1YF0A 3UJ1A 1VGLA 3LXTA 1F2EA 4EUYA 4EE0A 3IPZA 3D4TA 3CQFA 4MMMA 3KJYA 3DWVA 3EC3A 1YZXA 3ZFLA 5ECKB 1GLQA 2FWFA 1SKSB 1VF3A 4NWYA 1JSWA 1MD4A 3ZMKA 2E2MA 5ELAA 1SKRB 5CYYA 2CA8A 2IMKA 5ELGA 1GRXA 5G1KA 1ZCPA 3WGXA 1IW7D 5D9XA 2DSAA 5CRGA 1O7UA 2N5BA 3TV2A 1U88A 2R0GA 4XS4B 3WT1A 1AUCA 5D73A 3Q18A 3DVWA 3TJFA 1RQMA 4MK3A 4GQFA 1XPVA 2TRXA 3LFLA 1R4WA 3IHQA 2MMOA 1GNEA 5HR3A 4YQUA 5ID2B 4XCSA 2KHPA 1Z4PX 3TOTA 1W89A 3CRUA 4WKWA 1Z6NA 3VK9A 4CY8A 5G2ZA 1ACVA 1XXUA 2YJ7A 4EDZA 2FA8A 2OBKA 2DBCA 4O32A 3LORA 12GSA 1NM3A 4MDCA 3EWLA 2M72A 1EOHA 1T1VA 4MABA 1SU9A 4GLTA 3ERWA 3OCEA 1ERUA 4GTUA 1GSQA 1TW9A 2PBJA 1PKZA 2H8LA 2GQLA 5A5KA 1LJRA 5IO0A 3MSZA 2GZZA 4MJCA 4MJBA 2D27A 1A2JA 4MX2A 4K2XA 3FMWA 3IAS2 4KF9A 4I2TA 1T00A 1K3OA 4TKYA 4WF4A 2V32A 4ECBA 22GSA 1T4YA 2HZFA 3TKSE 3EMPA 3GUSA 4GCIA 3RHBA 3KCMA 4EKZA 4IN0A 1X5DA 1SENA 2R2JA 2FNOA 2RUEA 4MJEA 4RUVA 4YIHA 2V2GA 2XC2A 3ISOA 2LJKA 2B7KA 4HU9A 4RI7A 4HJMA 4MCUA 4NXIA 3ZIJA 2LUSA 4ML6A 3BHGA 1GTBA 3Q19A 2G2QA 1GH2A 2DJ0A 1OKDA 2IMDA 3EINA 1VF4A 2VCTA 2BJXA 4ID0A 4APBA 3QPMA 4BVXB 1S3DA 3KH7A 4YIKA 5D9VA 2NTOA 1TU7A 4K7IA 4ADMA 2P5QA 4I8BA 2QSIA 2HFDA 4KX4A 2VD1A 1ON4A 3F3QA 1PSQA 4LL4B 5F91A 3HVXA 3VURA 14GSA 6GSXA 2HRKA 5DALA 2R0PA 1PQNA 3QAVA 3P2AA 4PNGA 1ERVA 5G1LA 3UBKA 1Q98A 3KTLA 5HW2A 1URMA 2H74A 4PUFC 2ON5A 4TW5A 3GRXA 1Z5YE 1QUWA 1ZZYA 1SJZA 3HD5A 3IA1A 1GULA 2A4VA 3FZ5A 1BQ7A 1HNBA 1EWXA 4N10A 1KEBA 4JR6A 4HGVA 2CX4A 1PKWA 5BMUA 1FG4A 1G6YA 4TXOA 4EC0A 4Q5NA 4PQHA 4WBJA 5HFGA 3OR5A 2E7PA 1XFLA 3M8NA 3JCML 3HJOA 1EGRA 5CRDA 4D73B 1I5GA 4APAA 1Y6EA 3MNGA 4ML1A 5G5FA 1A8YA 5HFKA 3IAM2 3RAZA 3D0ZA 5DQYA 1B4QA 2GLRA 4XS1A 1PD21 1PRXA 1G6WA 3BCIA 4IJ3A 3RD8A 2L4CA 1OYJA 5ECMB 2ALBA 2YP6A 3CXGA 5CREA 3EU3A 3V1WA 2VCVA 2L6CA 1YKCA 1Z9HA 3FRCA 3GFKA 4EO3A 3TRPA 2AB6A 3WYWA 2C3TA 5D6BA 3FK8A 5LNKe 1M3IA 3TJKA 1EEMA 3ZFBA 5ECRB 1K0AA 2RM6A 5IQYA 1X5EA 3GTUB 2ZUPA 1F3AA 2GSSA 1XOAA 3HA9A 4PTSA 3GMFA 1M2BA 2V6KA 5E59A 4O5RA 2B1LA 5JWOB 1XWBA 2VIMA 1FB0A 4BIKA 4TR0A 1FUQA 3HZ4A 1YEPA 3FEUA 3O76A 4POKA 3RBTA 5J3RA 5G30A 1JHBA 2GTUA 4OCEA 9GSSA 3A2WA 3I9V2 1LBKA 3MWHA 1F6MC 5H5SA 4KSMA 1FVKA 2LSTA 2JSYA 4PX1A 3J7Yk 1R7HA 5FWGA 4ECCA 5BRTA 1K0MA 2P5RA 2GQMA 2DKIA 4DSRA 3TKSC 3OCFA 1OVNA 2GSTA 2G0FA 3GA4A 3FR9A 2H6XA 4AJ7A 1JZOA 5IMVA 2K8SA 5CNWA 2FHEA 2CAQA 3P90A 1TRUA 4O5UA 1FB6A 1HY1A 2O89A 1SK0A 4N30A 3PH9A 2YV9A 2H0HA 5E4WA 4N11A 5CAXA 4ZILA 3U6VA 4Z2RA 3DIEA 2ES7A 3QFBC 5AN1A 5FT3A 3BBYA 5EVOA 2I3YA 5J9CA 4WEYA 1QQ2A 3LGCA 4GSTA 1Z7PA 2F8FA 3FZ4A 5COHA 4DSSB 3FR6A 3G7JA 5LCZA 5LD0A 1Q92A 4KDYA 1EZKA 3VPTA 1R5PA 3IOSA 2FLSA 2YZUA 4JR4A 3C1SA 1YDKA 3QD9A 4RQRA 2VAFA 3E9JB 4KGIA 3P7XA 4TR1A 2C0GA 2V6OA 3ZIVA 2DJ2A 4F03A 1ZOFA 2WJUA 4NHZA 4OD7A 3HVVA 3F4RA 2WGRA 2HE3A 3KGKA 2C3QA 5AIXA 1EV4A 4EEIA 3O3TA 4L0UA 5GAND 2QA2A 1E6BA 1T4ZA 2I1UA 2X8GA 4ULXA 2HRAA 5IMFA 2JZRA 2PTSA 3GX0A 2I7DA 1BJXA 4L8EA 3DVXA 5F92A 2DKHA 4K7NA 2GZPA 3NO9A 2L4QA 3KMOA 1ILOA 2JU5A 1TI3A 2JAWA 1RK4A 2IFQA 1SD8A 1MEKA 4OMVA 2IL3A 3L9SA 3LQ7A 3HDCA 1BYEA 2LRNA 4GWRA 1UVZA 2GT6A 4WXTA 3VLNA 4KW6A 5G5EA 1S3RA 4GQCA 4IS0A 2H72A 4O5QA 3L9UA 3E0UA 3C7MA 2FWEA 1DE2A 1M2AA 2MMNA 4V1Ag 3TKQA 5D93A 2X99A 1SL2B 2VCQA 2HSYA 1AIUA 1ERWA 4E8HA 1YQ1A 5B8AA 1QFNA 4MNNA 2VO4A 3GSTA 3GL5A 1WE0A 4CHSA 1F9MA 1XWKA 2C1YA 3ERFA 1U0LA 3L4NA 1U3IA 3VI5A 2AYTA 3N5OA 2GQKA 4EIQA 3BCKA 3APQA 2CAIA 2HSHA 2R4VA 3W8SA 1PX7A 3UAPA 4WBRD 5L71A 2KOKA 2YCDA 1OE8A 3PPUA 2VLVA 1JZRA 2TRCP 1SD9A 4TN8A 1U87A 2BMXA 1YJ6A 1O81A 3VFIA 2HI7A 1WJKA 5C04A 4ADLA 1N2AA 4KA0A 4HZ2A 2X49A 3G9BA 3FYGA 3GH6A 5D96A 5IPHA 2X75A 1TXXA 2F3MA 4FQUA 1THXA 3EVIA 5C00A 3HY2A 1I9DA 1YF1A 1HNAA 4ZL9A 2FY6A 2GSQA 3ZLPA 2VCXA 4A5PA 3IK7A 3MYDA 5EY6A 3A5IA 1JLWA 3R3EA 1NSWA 1XW5A 3A2VA 4MZCA 2LV3A 3ZVJD 3F63A 5J4UA 2I4AA 3H1NA 4L6CA 2R0CA 2B5YA 5IPGA 2XPDA 4MJAA 1XZOA 1Q91A 2XBQA 1TI1A 4K5RA 2LQQA 2V1MA 1T9HA 4HEA2 1LU4A 4E8EA 1XCCA 2YWMA 3ERGA 3IE3A 4LLRA 3KMNA 10GSA 1YEXA 1OAZA 2E2GA 3UL3A 2YV5A 2VOCA 3HZ8A 3ME8A 3CBUA 4IW9A 3F8UA 1PFOA 3KZQA 4EDYA 5EPFA 4PURA 1XIYA 5HFIA 3VPQA 3TRQA 3HVNA 1YY7A 2PPTA 2AHEA 1C72A 4FYCA 2K6VA 4LMWA 2EIRA 3TUEA 2IN3A 1XWGA 1T7PB 1MD3A 2LJRA 4XTSA 4IP6A 3C71A 3F4TA 3F3RA 3DGQA 3IV4A 3RRPA 5HR2A 1M3JA 4EFCA 1SJ6A 3FZAA 4J56E 2YPMA 5F06A 3QDNA 1EOGA 3ZREA 4AF2A 1CQHA 2JZTA 1X9WB 1V98A 3APOA 3KP8A 2OBIA 3KEBA 5JWQB 3TKPA 4O92A 4K9ZA 4IELA 4NPBA 4I97A 5JCUA 3I69A 2MBTA 3GHAA 4QQ7A 2OACA 1TOFA 1SJIA 3DKSA 1WP0A 3SWLA 5IO2A 3TOUA 4IQJM 4EL1A 4IQ1A 3FKFA 4LMVA 4CDOA 4K7OA 4E88A 4V2NA 1KQ7A 6GSWA 4PGTA 2OE1A 5JCGA 2VL3A 4KNDA 4L57A 3H79A 4KE3A 3QMXA 4YQMA 1XWAA 5G31A 2DMMA 1A0RP 2M80A 2R6KA 5CP1A 3ZVJA 1UA5A 3G7YA 1K0OA 2H73A 5HR0A 3E3EA 2VUPA 2XPEA 1ZL9A 2QKEA 2X8CA 1MDIA 3FHKA 2HRNA 4IP1A 2EIQA 2WZ9A 4NMUA 1S3CA 4KCAA 5DCHA 5H5QA 4IKHA 2A2PA 1M9BA 5JCWA 5INYA 5DCGA 1Q4JA 3NZNA 1KNGA 2CX3A 4G0IA 3QFAC 1H75A 4PQIA 1T3BA 4NLEA 1V57A 2IMIA 4Q5QA 2IMEA 4IGJA 1G0TA 3RPNA 5J9BA 3EYTA 1TRSA 4AJ6A 4H86A 1U15A 1F3BA 2WRTA 2CVBA 3TKRA 3E04A 4AGSA 4G2EA 4GSNA 1ZYEA 2LKUA 4BVYA 5J41A 4K1FA 3HJMA 2TIRA 1B9YC 3PGTA 6GSYA 2DLXA 2DC5A 3GX8A 5DAKA 2GDRA 2HRFA 4XS6A 4K0GA 5D9WA 1Z4KA 4WR5A 3TDGA 4IQAA 2MBSA 2I81A 6GSVA 4G0KA 4NV2A 3BD2A 1Z4LA 1O8XA 2OJLA 1B9XC 5ECPB 1NW2A 4J2FA 2H30A 1X5CA 2PMTA 4MP4A 1FW1A 2LNSA 3IR4A 1TU8A 2P31A 2JAOA 4PNFA 2FWGA 1XG8A 3RDWA 2LTKA 2YOIA 1GNWA 17GSA 1FOHA 4IHUA 2CQ9A 4F0BA 2F51A 3HHVA 1EGOA 2R3XA 1B8XA 3KP9A 1DSBA 2YV7A 2N5FA 2VL2A 4OFNA 1IYIA 3R6QA 1TJVA 1QXHA 2L5LA 1A2LA 1OC3A 4GF0A 3TCOA 2JL4A 2Z9SA 1Z7RA 3UBLA 2RIIA 1SL1B 3KXOA 3GL3A 3UMAA 5HR1A 3GV1A 4X0XA 1ML6A 7GSSA 2D28C 1RE5A 1K0CA 3WT2A 3D5JA 1M7TA 4XS4A 1WPIA 4BWSA 2YZHA 3LSZA 4G9HA 2K9FA 2OE3A 2RM5A 3KH9A 2CV4A 5HQPA 2JZSA 4ZBAA 4HDEA 5IMZA 1H4OA 3WGDA 3GKKA 1J9BA 1PL2A 2OA7A 4ILFA 2C0FA 3FR3A 2L5OA 4ZL7A 4YQVA 2O8VB 1EP8A 4XIHA 3APSA 5ID2A 2AJQB 4JBBA 3KTBA 4KCEA 5GSTA 2PUKC 3QOUA 1A2MA 3C8TA 5KN0A 2C0DA 5J5NA 1XBSA 5H5RA 1ABAA 3ED3A 4RQXA 1VF1A 4N0VA 3US3A 3VI7A 1GUMA 2B5EA 1GSEA 3D4MA 3AY8A 2IJYA 3CYNA 2H6YA 1TRWA 1XWCA 2HZEA 1GTUA 3C1RA 2LJAA 3QCPA 5CO3A 5AGYA 4F0CA 3F0IA 4MA9A 5B6NA 5EL8A 2A2RA 5DQSA 4L5LA 4MWOA 5ENUA 1K7WA 4TR3A 5AISA 4EIPA 3LW9A 4GXZA 1XWOA 4HJ2A 3A2XA 4K8MA 1Z4IA 2ZCTA 3HJPA 2H70A 3CTFA 2R5GA 1TRVA 3IXRA 4ZXGA 2FD3A 1ZYNA 1HD2A 1FOVA 4Q5RA 1FUPA 2HNLA 4POBA 3RPPA 3NIVA 1WOUA 4JRRA 1OKTA 1G7EA 2L57A 2VM2A 5DALB 2HSMA 3HKRA 3LEFA 3N9JA 5ECOB 5KN1A 1TJWA 4MH2A 5DVBA 4LA1A 3MAKA 3ZL5A 1YKAA 5DBQA 2H19A 4POLA 3GSSA 4EF0A 2DJ3A 3Q6OA 1AQWA 2LS5A 1FUOA 1YFMA 1USBA 3CI0K 1GTAA 2GVPA 4MPFA 4XHMA 1MDJA 1AAZA 2H1GA 4KH7A 1GLPA 3I6AA 1C3UA 4MF7A 4JE1A 5F07A 2DJJA 4IJIA 3UVHA 4TXOB 1JZWA 1JZDA 4NV5A 1C3CA 2B3SA 1GTIA 3A5WA 1CQGA 5A4VA 2PWJA 3ZITA 3S9FA 2GSRA 3VWXA 4JZQA 2N5AA 3C73A 2EIOA 2K8VA 2HXKA 1M9AA 2H6ZA 1HNCA 1A0FA 2JSZA 1K62A 5ECLB 5CRHA 1K0BA 1J08A 4OFMA 1AQVA 3R2QA 5DAKB 2PTRA 4USSA 2GT5A 1FURA 2HT9A 3TJJA 2VCWA 5A4WA 1G7OA 2V41A 3UEMA 3KIJA 1M0UA 3UOMA 4Q5FA 1I0AA 1DOFA 1EP7A 18GSA 3GURA 1OC9A 2GS3A 5F0GA 2WULA 3H8QA 1W4VA 3R6VA 4KB3A 2YWOA 4HSCX 3L0HA 2IIYA 4D73A 2GZYA 1AW9A 4HZ4A 1BEDA 4GSSA 3L9VA 1TK8B 1GSSA 2H1AA 4Z2UA 4CY6A 1IYHA 1PL1A 4MF5A 2RUFA 3HVSA 1TJDA 2B7JA 3EURA 1BX9A 3BOAA 1ZYPA 2BTOT 1TJ7A 1PGTA 2VD0A 1EV9A 6GSTA 2J23A 2KLXA 2KP1A 4K0NA 4ZB9A 1TTZA 1PN9A 2DIZA 4ACSA 3TJGA 4F82A 4TR4A 3ZMLA 4OO4A 4WETA 2QGVA 1TKDB 4G19A 19GSA 5ECHB 4X1UA 2IMFA 2X8HA 1V40A 3DRNA 2ZNMA 1MH9A 2WFCA 3GTUA 2NVLA 2LQOA 3UVTA 1SYXA 1R5AA 4V2MA 4MPGA 2O85A 4ZB6A 2O87A 3M3MA 4AJ8A 3J7Yb 4TXVA 2DJ1A 3CSJA 3P8WA 3GNJA 1JLVA 1TK5B 1B4PA 4K5SA 2JAUA 4FH8A 3HCZA 3DXBA 5DDLA 1TK0B 5B6MA 2B5XA 1DE1A 2H1DA 1MTCA 4NSLA 1E2YA 1BAYA 2WS2A 1YFEA 3TRXA 2HZEB 2R37A 4OFTA 3VWVA 1XVWA 4OO5A 3F4SA 2YNXA 1FAAA 3KD0A 5D9TA 2JACA 3VWUA 16GSA 2ON7A 5A4UA 4HS1A 2KUCA 4IBPA 2PFMA 5GAPD 4MLYA 4BL7A 4TR1B 4IVFA 3EU4A 2YWNA 2FCHA 4I2UA 4YAPA 2WCIA 5KN2A 3IDVA 3ME7A 5AIVA 4V1Ap 2YN1A 1VRSD 1DUGA 4GRFA 5KOXA 3IBHA 1X9MB 2UZ8A 2RCNA 2MMAA 5IMCA 4MUMA 1SYRA 3TB2A 4TVEA 5IMAA 3ZTLA 1PA3A 3IRAA 4HQSA 3GN3A 4DSSA 4BPYA 1O85A 1VDKA 2H76A 2F8AA 4L6AA 1OE7A 1RW1A 1Z4QA 3M0FA 3C8EA 3TGZA 3GH9A 1V9WA 2A2SA 1A23A 1WRYA 4ZBBA 2IFQB 4XRAA 2C80A 2H66A 4KSOA 3DMLA 1GL8A 2XHFA 1O73A 1M2DA 2MMZA 3W8JA 4L0WA 3UARA 1QMVA 3FZ9A 4ZBDA 3WD6A 2O7KA
chains in the Genus database with same CATH topology
3M1GA 2D2ZA 2DIYA 2VCZA 2JADA 2X4AA 3M9KA 4POMA 1NHYA 2L59A 4I5QA 2QC7A 4BWQA 3L78A 5DJLA 4F9ZA 2NPBA 5ABRA 2XBIA 3Q74A 5IM9A 5IIZA 3F6FA 3CRTA 3QAGA 1JFUA 3GIXA 5KEJA 1ERTA 4DVCA 1S3AA 3H93A 2CT6A 2WB9A 2E0QA 3CMIA 1NHOA 3EPTA 2C4JA 3I43A 1GWCA 4J57E 4ECJA 3H4KA 4ZB8A 2PGTA 3VWWA 1A24A 1N8JA 4LL1B 2VM1A 4HQZA 2AV4A 2YANA 3K8NA 4K2DA 5B7CA 1GP1A 1SK1A 3EMXA 4Z7XA 2VL9A 2VL2C 1XVQA 4PUAA 4QL9A 1OC9B 5DJMA 4KDXA 2AUVA 4EXJA 1V2AA 2B1KA 1TP9A 2MZCA 4YKFA 1WIKA 2B6MA 1XW6A 1ZYQB 2IPAA 4N0ZA 2GGTA 1ZGNA 1SL0B 2I9HA 4L5OA 2H71A 2FWHA 3LYPA 4TOPA 3LJRA 4ISDA 4HUAA 2PVQA 4ZL8A 2M46A 1K3LA 3FW2A 1M99A 1FVJA 1TDIA 1X0RA 20GSA 2C3NA 3GKMA 5ECNB 1PMTA 3D21A 1T8EB 13GSA 4HU7A 1UC7A 2PVOC 4YKGA 3ZZXA 4CW9A 1F37A 5CRWA 4NAXA 3LG6A 3PINA 2L6DA 4KDUA 1XW9A 4X43A 4EVMA 1WWJA 11GSA 4F2IA 5D8IA 1WMJA 1X9SB 2AAWA 4K6XA 5ECSA 2MYGA 4JEDA 3NOFA 4X4JA 4DEJA 1UN2A 2H0IA 1QGVA 3MIXA 1Z6MA 3KM6A 4WF5A 4O7HA 4HOJA 3QAWA 5FHIA 2OE0A 3W6GA 3DEXA 3CTGA 4NHWA 1B48A 4MF6A 5F8BA 2WDUA 3CSIA 1HQOA 1VF2A 2HLSA 5IOXA 1AC1A 2DJKA 2PN8A 1THOA 4Z2TA 5ECQB 3IC4A 2EC4A 4KUNA 1K3YA 2OKAA 1XOBA 4JU5A 3U5RE 1Z3EA 3BJ5A 4OWYA 2PERA 3F9UA 4HI7A 2H0GA 1DBYA 3GYKA 4KAEA 4TRXA 4BL7B 1V58A 4ICYA 3UIWA 5KN3A 1R26A 2LNTA 3PR8A 1J0FA 3IC8A 1O8WA 3EE2A 3D22A 2PU9C 4FYBA 3TJBA 5GZZB 3ZYWA 4RI6A 2VLTA 1SKWB 3RHCA 4ECIA 1U6TA 2C0EA 1SK2A 2LRCA 4V2LA 2A4HA 2LEGA 6GSSA 5JWRB 3SBCA 3DYRA 1FO5A 3LYKA 2F9SA 6GSUA 3F6DA 4PQ1A 8GSSA 5IMDA 2QA1A 5KOWA 3M9JA 2HYXA 3TKSA 2FA4A 2K18A 1AXDA 1GSDA 3GKNA 3ZRDA 1BG5A 3D6IA 2NBSA 3WGEA 4YH2A 1EEJA 4MH3A 1PX6A 1HYUA 2FGXA 1AQXA 2REMA 2VLUA 4G10A 2YWIA 2X64A 3A3TA 2LRTA 2OADA 4QL7A 4XRDA 3IHGA 4G0LA 5B8BA 2YJHA 2RLIA 4MZBA 1ZMAA 2CVDA 2J9HA 2CVKA 5F05A 3HYPA 3MDKA 2IWTA 1K0DA 3HXSA 1ST9A 1O6JA 4BVXA 4WR4A 1Y25A 4YAVA 2H01A 2H1BA 1QK8A 3DD3A 1GUKA 3LXZA 1GSUA 3GKXA 1OC8A 3LWAA 4PXOA 1U3AA 4I6XA 3G7IA 2NDOA 1GSYA 5GSSA 4OCFA 4BVYB 3O6TA 4P3YB 4FIWA 2P0GA 5ECIB 4FO5A 4DSQA 1KBNA 2H75A 2C8UA 1MDKA 1A8LA 3CSHA 2KP2A 3FY7A 4BA7A 3IK9A 1KTEA 4FYUA 1FHEA 1GUHA 5IOWA 2CZ3A 1PN0A 3QR6A 2DMLA 2FUG2 2CZ2A 1GSFA 1K0NA 4MZWA 4ZIJA 1YF0A 3UJ1A 1VGLA 3LXTA 1F2EA 4EUYA 4EE0A 3IPZA 3D4TA 4MMMA 3KJYA 3DWVA 3EC3A 1YZXA 3ZFLA 5ECKB 1GLQA 2FWFA 1SKSB 1VF3A 4NWYA 1MD4A 3ZMKA 2E2MA 5ELAA 1SKRB 5CYYA 2CA8A 2IMKA 5ELGA 1GRXA 5G1KA 1ZCPA 3WGXA 1IW7D 5D9XA 2DSAA 5CRGA 1O7UA 2N5BA 1U88A 2R0GA 4XS4B 3WT1A 1AUCA 5D73A 3Q18A 3DVWA 3TJFA 1RQMA 4MK3A 4GQFA 1XPVA 2TRXA 3LFLA 1R4WA 3IHQA 2MMOA 1GNEA 5HR3A 4YQUA 5ID2B 4XCSA 2KHPA 3TOTA 1W89A 3CRUA 4WKWA 1Z6NA 3VK9A 4CY8A 5G2ZA 1ACVA 1XXUA 2YJ7A 4EDZA 2FA8A 2OBKA 2DBCA 4O32A 3LORA 12GSA 1NM3A 4MDCA 3EWLA 2M72A 1EOHA 1T1VA 1SU9A 4GLTA 4MABA 3ERWA 1ERUA 4GTUA 1GSQA 1TW9A 2PBJA 1PKZA 2H8LA 2GQLA 5A5KA 1LJRA 5IO0A 3MSZA 2GZZA 4MJCA 4MJBA 2D27A 1A2JA 4K2XA 3FMWA 3IAS2 4KF9A 4I2TA 1T00A 1K3OA 4TKYA 4WF4A 2V32A 4ECBA 22GSA 1T4YA 2HZFA 3TKSE 3EMPA 3GUSA 4GCIA 3RHBA 3KCMA 4EKZA 4IN0A 1X5DA 1SENA 2R2JA 2FNOA 2RUEA 4MJEA 4RUVA 2V2GA 2XC2A 3ISOA 2LJKA 2B7KA 4HU9A 4RI7A 4HJMA 4MCUA 4NXIA 3ZIJA 2LUSA 4ML6A 1GTBA 3Q19A 2G2QA 1GH2A 2DJ0A 1OKDA 2IMDA 3EINA 1VF4A 2VCTA 2BJXA 4ID0A 3QPMA 4BVXB 1S3DA 3KH7A 5D9VA 2NTOA 1TU7A 4K7IA 2P5QA 4I8BA 2QSIA 2HFDA 4KX4A 2VD1A 1ON4A 3F3QA 1PSQA 4LL4B 3HVXA 3VURA 14GSA 6GSXA 2HRKA 5DALA 2R0PA 1PQNA 3QAVA 3P2AA 4PNGA 1ERVA 5G1LA 3UBKA 1Q98A 3KTLA 4PUFC 1URMA 2H74A 2ON5A 4TW5A 3GRXA 1Z5YE 1QUWA 1ZZYA 1SJZA 3HD5A 3IA1A 1GULA 2A4VA 3FZ5A 1BQ7A 1HNBA 1EWXA 4N10A 1KEBA 4JR6A 2CX4A 1PKWA 5BMUA 1FG4A 1G6YA 4TXOA 4EC0A 4Q5NA 4PQHA 4WBJA 5HFGA 3OR5A 2E7PA 1XFLA 3M8NA 3JCML 3HJOA 1EGRA 5CRDA 4D73B 1I5GA 1Y6EA 3MNGA 4ML1A 5G5FA 1A8YA 5HFKA 3IAM2 3RAZA 3D0ZA 5DQYA 1B4QA 2GLRA 4XS1A 1PD21 1PRXA 1G6WA 3BCIA 4IJ3A 2L4CA 1OYJA 5ECMB 2ALBA 2YP6A 3CXGA 5CREA 3EU3A 3V1WA 2VCVA 2L6CA 1YKCA 1Z9HA 3FRCA 3GFKA 4EO3A 3TRPA 2AB6A 3WYWA 2C3TA 3FK8A 5LNKe 3TJKA 1EEMA 3ZFBA 5ECRB 1K0AA 2RM6A 5IQYA 1X5EA 3GTUB 2ZUPA 1F3AA 2GSSA 1XOAA 3HA9A 4PTSA 3GMFA 1M2BA 2V6KA 5E59A 4O5RA 2B1LA 5JWOB 1XWBA 2VIMA 1FB0A 4TR0A 3HZ4A 1YEPA 3FEUA 3O76A 4POKA 3RBTA 5J3RA 5G30A 1JHBA 2GTUA 4OCEA 9GSSA 3A2WA 3I9V2 1LBKA 3MWHA 1F6MC 5H5SA 4KSMA 1FVKA 2LSTA 2JSYA 4PX1A 3J7Yk 1R7HA 5FWGA 4ECCA 5BRTA 1K0MA 2P5RA 2GQMA 2DKIA 4DSRA 3TKSC 1OVNA 2GSTA 2G0FA 3GA4A 3FR9A 2H6XA 4AJ7A 1JZOA 5IMVA 2K8SA 5CNWA 2FHEA 2CAQA 3P90A 1TRUA 4O5UA 1FB6A 2O89A 1SK0A 4N30A 3PH9A 2YV9A 2H0HA 5E4WA 4N11A 5CAXA 4ZILA 3U6VA 4Z2RA 3DIEA 2ES7A 3QFBC 5AN1A 5FT3A 3BBYA 5EVOA 2I3YA 5J9CA 4WEYA 1QQ2A 3LGCA 4GSTA 1Z7PA 2F8FA 3FZ4A 5COHA 4DSSB 3FR6A 3G7JA 5LCZA 5LD0A 4KDYA 1EZKA 3VPTA 1R5PA 3IOSA 2FLSA 2YZUA 4JR4A 3C1SA 1YDKA 3QD9A 4RQRA 2VAFA 3E9JB 4KGIA 3P7XA 4TR1A 2C0GA 2V6OA 3ZIVA 2DJ2A 4F03A 1ZOFA 2WJUA 4NHZA 4OD7A 3HVVA 3F4RA 2WGRA 2HE3A 3KGKA 2C3QA 5AIXA 1EV4A 3O3TA 4L0UA 5GAND 2QA2A 1E6BA 1T4ZA 2I1UA 2X8GA 4ULXA 2HRAA 5IMFA 2JZRA 3GX0A 1BJXA 4L8EA 3DVXA 2DKHA 4K7NA 2GZPA 2L4QA 3KMOA 1ILOA 2JU5A 1TI3A 1RK4A 2IFQA 1SD8A 1MEKA 4OMVA 2IL3A 3L9SA 3LQ7A 3HDCA 1BYEA 2LRNA 4GWRA 1UVZA 2GT6A 4WXTA 3VLNA 4KW6A 5G5EA 4GQCA 4IS0A 2H72A 4O5QA 3L9UA 3E0UA 3C7MA 2FWEA 1DE2A 1M2AA 2MMNA 4V1Ag 3TKQA 5D93A 2X99A 1SL2B 2VCQA 2HSYA 1AIUA 1ERWA 4E8HA 1YQ1A 5B8AA 1QFNA 4MNNA 2VO4A 3GSTA 3GL5A 1WE0A 4CHSA 1F9MA 1XWKA 2C1YA 3ERFA 3L4NA 1U3IA 3VI5A 2AYTA 3N5OA 2GQKA 4EIQA 3BCKA 3APQA 2CAIA 2HSHA 2R4VA 3W8SA 1PX7A 3UAPA 4WBRD 5L71A 2KOKA 2YCDA 1OE8A 3PPUA 2VLVA 1JZRA 2TRCP 1SD9A 4TN8A 1U87A 2BMXA 1YJ6A 1O81A 3VFIA 2HI7A 1WJKA 5C04A 1N2AA 4KA0A 4HZ2A 2X49A 3G9BA 3FYGA 3GH6A 5D96A 5IPHA 1TXXA 2F3MA 4FQUA 1THXA 3EVIA 5C00A 3HY2A 1I9DA 1YF1A 1HNAA 4ZL9A 2FY6A 2GSQA 3ZLPA 2VCXA 4A5PA 3IK7A 3MYDA 5EY6A 3A5IA 1JLWA 3R3EA 1NSWA 1XW5A 3A2VA 4MZCA 2LV3A 3ZVJD 3F63A 5J4UA 2I4AA 3H1NA 2R0CA 2B5YA 5IPGA 2XPDA 4MJAA 1XZOA 2XBQA 1TI1A 4K5RA 2LQQA 2V1MA 4HEA2 1LU4A 4E8EA 1XCCA 2YWMA 3ERGA 3IE3A 4LLRA 3KMNA 10GSA 1YEXA 1OAZA 2E2GA 3UL3A 2VOCA 3HZ8A 3ME8A 3CBUA 4IW9A 3F8UA 3KZQA 4EDYA 5EPFA 4PURA 1XIYA 5HFIA 3VPQA 3TRQA 1YY7A 2PPTA 2AHEA 1C72A 4FYCA 2K6VA 4LMWA 2EIRA 3TUEA 2IN3A 1XWGA 1T7PB 1MD3A 2LJRA 4XTSA 4IP6A 3C71A 3F4TA 3F3RA 3DGQA 3IV4A 5HR2A 1SJ6A 3FZAA 4J56E 2YPMA 5F06A 3QDNA 1EOGA 3ZREA 4AF2A 1CQHA 2JZTA 1X9WB 1V98A 3APOA 3KP8A 2OBIA 3KEBA 5JWQB 3TKPA 4O92A 4K9ZA 4IELA 4NPBA 4I97A 5JCUA 3I69A 2MBTA 3GHAA 4QQ7A 2OACA 1TOFA 1SJIA 3DKSA 1WP0A 3SWLA 5IO2A 3TOUA 4IQJM 4EL1A 4IQ1A 3FKFA 4LMVA 4CDOA 4K7OA 4V2NA 6GSWA 4PGTA 2OE1A 5JCGA 2VL3A 4KNDA 3H79A 4KE3A 3QMXA 4YQMA 1XWAA 5G31A 2DMMA 1A0RP 2M80A 2R6KA 5CP1A 3ZVJA 1UA5A 3G7YA 1K0OA 2H73A 5HR0A 3E3EA 2VUPA 2XPEA 1ZL9A 2QKEA 2X8CA 1MDIA 3FHKA 2HRNA 4IP1A 2EIQA 2WZ9A 4NMUA 1S3CA 4KCAA 5DCHA 5H5QA 4IKHA 2A2PA 1M9BA 5JCWA 5INYA 5DCGA 1Q4JA 3NZNA 1KNGA 2CX3A 4G0IA 3QFAC 1H75A 4PQIA 1T3BA 1V57A 4Q5QA 2IMIA 2IMEA 4IGJA 1G0TA 3RPNA 5J9BA 3EYTA 1TRSA 4AJ6A 4H86A 1F3BA 2WRTA 2CVBA 3TKRA 4AGSA 4G2EA 4GSNA 1ZYEA 2LKUA 4BVYA 5J41A 4K1FA 3HJMA 2TIRA 1B9YC 3PGTA 6GSYA 2DLXA 2DC5A 3GX8A 5DAKA 2GDRA 2HRFA 4XS6A 4K0GA 5D9WA 3TDGA 4WR5A 4IQAA 2MBSA 2I81A 6GSVA 4G0KA 4NV2A 3BD2A 1O8XA 2OJLA 1B9XC 5ECPB 1NW2A 4J2FA 2H30A 1X5CA 2PMTA 4MP4A 1FW1A 2LNSA 3IR4A 1TU8A 2P31A 4PNFA 2FWGA 3RDWA 2LTKA 2YOIA 1GNWA 17GSA 1FOHA 4IHUA 2CQ9A 4F0BA 2F51A 3HHVA 1EGOA 2R3XA 1B8XA 3KP9A 1DSBA 2YV7A 2N5FA 2VL2A 4OFNA 1IYIA 1QXHA 2L5LA 1A2LA 1OC3A 4GF0A 3TCOA 2JL4A 2Z9SA 1Z7RA 3UBLA 2RIIA 1SL1B 3KXOA 3GL3A 3UMAA 5HR1A 3GV1A 4X0XA 1ML6A 7GSSA 2D28C 1K0CA 3WT2A 3D5JA 1M7TA 4XS4A 1WPIA 4BWSA 2YZHA 3LSZA 4G9HA 2K9FA 2OE3A 2RM5A 3KH9A 2CV4A 5HQPA 2JZSA 4ZBAA 4HDEA 5IMZA 1H4OA 3WGDA 3GKKA 1J9BA 1PL2A 2OA7A 4ILFA 2C0FA 3FR3A 2L5OA 4ZL7A 4YQVA 2O8VB 1EP8A 4XIHA 3APSA 5ID2A 2AJQB 4JBBA 3KTBA 4KCEA 5GSTA 2PUKC 3QOUA 1A2MA 5KN0A 2C0DA 5J5NA 1XBSA 5H5RA 1ABAA 3ED3A 4RQXA 1VF1A 4N0VA 3US3A 3VI7A 1GUMA 2B5EA 1GSEA 3D4MA 3AY8A 2IJYA 3CYNA 2H6YA 1TRWA 1XWCA 2HZEA 1GTUA 3C1RA 2LJAA 3QCPA 5CO3A 5AGYA 4F0CA 3F0IA 4MA9A 5B6NA 5EL8A 2A2RA 5DQSA 4L5LA 5ENUA 4TR3A 5AISA 4EIPA 3LW9A 4GXZA 4HJ2A 3A2XA 4K8MA 2ZCTA 3HJPA 2H70A 3CTFA 2R5GA 1TRVA 3IXRA 4ZXGA 2FD3A 1ZYNA 1HD2A 1FOVA 4Q5RA 2HNLA 4POBA 3RPPA 3NIVA 1WOUA 4JRRA 1OKTA 1G7EA 2L57A 2VM2A 5DALB 2HSMA 3HKRA 3LEFA 3N9JA 5ECOB 5KN1A 4MH2A 5DVBA 4LA1A 3MAKA 3ZL5A 1YKAA 5DBQA 2H19A 4POLA 3GSSA 4EF0A 2DJ3A 3Q6OA 1AQWA 2LS5A 1USBA 1GTAA 2GVPA 4MPFA 4XHMA 1MDJA 1AAZA 2H1GA 4KH7A 1GLPA 3I6AA 4MF7A 4JE1A 5F07A 2DJJA 4IJIA 3UVHA 4TXOB 1JZWA 1JZDA 4NV5A 2B3SA 1GTIA 3A5WA 1CQGA 5A4VA 2PWJA 3ZITA 3S9FA 2GSRA 3VWXA 4JZQA 2N5AA 3C73A 2EIOA 2K8VA 2HXKA 1M9AA 2H6ZA 1HNCA 1A0FA 2JSZA 5ECLB 5CRHA 1K0BA 1J08A 4OFMA 1AQVA 3R2QA 5DAKB 4USSA 2GT5A 2HT9A 3TJJA 2VCWA 5A4WA 1G7OA 2V41A 3UEMA 3KIJA 1M0UA 3UOMA 4Q5FA 1EP7A 18GSA 3GURA 1OC9A 2GS3A 5F0GA 2WULA 3H8QA 1W4VA 4KB3A 2YWOA 3L0HA 2IIYA 4D73A 2GZYA 1AW9A 4HZ4A 1BEDA 4GSSA 3L9VA 1TK8B 1GSSA 2H1AA 4Z2UA 4CY6A 1IYHA 1PL1A 4MF5A 2RUFA 3HVSA 1TJDA 2B7JA 3EURA 1BX9A 3BOAA 1ZYPA 2BTOT 1PGTA 2VD0A 1EV9A 6GSTA 2J23A 2KLXA 2KP1A 4K0NA 4ZB9A 1TTZA 1PN9A 2DIZA 4ACSA 3TJGA 4F82A 4TR4A 3ZMLA 4OO4A 4WETA 2QGVA 1TKDB 4G19A 19GSA 5ECHB 4X1UA 2IMFA 2X8HA 1V40A 3DRNA 2ZNMA 2WFCA 3GTUA 2NVLA 2LQOA 3UVTA 1SYXA 1R5AA 4V2MA 4MPGA 2O85A 4ZB6A 2O87A 3M3MA 4AJ8A 3J7Yb 4TXVA 2DJ1A 3CSJA 3P8WA 3GNJA 1JLVA 1TK5B 1B4PA 4K5SA 4FH8A 3HCZA 3DXBA 5DDLA 1TK0B 5B6MA 2B5XA 1DE1A 2H1DA 1MTCA 1E2YA 1BAYA 2WS2A 3TRXA 2HZEB 2R37A 4OFTA 3VWVA 1XVWA 4OO5A 3F4SA 2YNXA 1FAAA 3KD0A 5D9TA 2JACA 3VWUA 16GSA 2ON7A 5A4UA 4HS1A 2KUCA 4IBPA 5GAPD 4MLYA 4BL7A 4TR1B 4IVFA 3EU4A 2YWNA 2FCHA 4I2UA 4YAPA 2WCIA 5KN2A 3IDVA 3ME7A 5AIVA 4V1Ap 2YN1A 1VRSD 1DUGA 4GRFA 5KOXA 3IBHA 1X9MB 2UZ8A 2MMAA 5IMCA 3TB2A 1SYRA 4TVEA 5IMAA 3ZTLA 1PA3A 3IRAA 4HQSA 3GN3A 4DSSA 4BPYA 1O85A 2H76A 2F8AA 1OE7A 1RW1A 3M0FA 3C8EA 3TGZA 3GH9A 1V9WA 2A2SA 1A23A 1WRYA 4ZBBA 2IFQB 4XRAA 2C80A 2H66A 4KSOA 3DMLA 1GL8A 2XHFA 1O73A 1M2DA 2MMZA 3W8JA 4L0WA 3UARA 1QMVA 3FZ9A 4ZBDA 3WD6A 2O7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M1G A;  2D2Z A;  2DIY A;  2VCZ A;  2JAD A;  3M9K A;  4POM A;  1NHY A;  2L59 A;  4I5Q A;  2QC7 A;  4BWQ A;  3L78 A;  5DJL A;  4F9Z A;  2NPB A;  5ABR A;  2XBI A;  3Q74 A;  5IM9 A;  5IIZ A;  3F6F A;  3CRT A;  3QAG A;  1JFU A;  3GIX A;  5KEJ A;  1ERT A;  4DVC A;  1S3A A;  3H93 A;  2CT6 A;  2WB9 A;  2E0Q A;  3CMI A;  1NHO A;  2C4J A;  3I43 A;  1GWC A;  4J57 E;  4ECJ A;  3H4K A;  4ZB8 A;  2PGT A;  3VWW A;  1A24 A;  1N8J A;  4LL1 B;  2VM1 A;  4HQZ A;  2AV4 A;  2YAN A;  3K8N A;  4K2D A;  5B7C A;  1GP1 A;  1SK1 A;  3EMX A;  4Z7X A;  2VL9 A;  2VL2 C;  1XVQ A;  4PUA A;  4QL9 A;  1OC9 B;  5DJM A;  4KDX A;  2AUV A;  4EXJ A;  1V2A A;  2B1K A;  1TP9 A;  2MZC A;  1WIK A;  2B6M A;  1XW6 A;  1ZYQ B;  2IPA A;  4N0Z A;  2GGT A;  1ZGN A;  1SL0 B;  2I9H A;  4L5O A;  2H71 A;  2FWH A;  3LYP A;  4TOP A;  3LJR A;  4ISD A;  4HUA A;  2PVQ A;  4ZL8 A;  2M46 A;  1K3L A;  3FW2 A;  1M99 A;  1FVJ A;  1TDI A;  1X0R A;  20GS A;  2C3N A;  3GKM A;  5ECN B;  1PMT A;  3D21 A;  1T8E B;  13GS A;  4HU7 A;  1UC7 A;  2PVO C;  3ZZX A;  4CW9 A;  1F37 A;  5CRW A;  4NAX A;  3LG6 A;  3PIN A;  2L6D A;  4KDU A;  1XW9 A;  4X43 A;  4EVM A;  1WWJ A;  11GS A;  4F2I A;  5D8I A;  1WMJ A;  1X9S B;  2AAW A;  4K6X A;  5ECS A;  2MYG A;  4JED A;  3NOF A;  4DEJ A;  1UN2 A;  2H0I A;  1QGV A;  1Z6M A;  3KM6 A;  4WF5 A;  4O7H A;  4HOJ A;  3QAW A;  5FHI A;  2OE0 A;  3W6G A;  3DEX A;  3CTG A;  4NHW A;  1B48 A;  4MF6 A;  5F8B A;  2WDU A;  3CSI A;  1HQO A;  1VF2 A;  2HLS A;  5IOX A;  1AC1 A;  2DJK A;  2PN8 A;  1THO A;  5ECQ B;  3IC4 A;  2EC4 A;  4KUN A;  1K3Y A;  2OKA A;  1XOB A;  4JU5 A;  3U5R E;  1Z3E A;  3BJ5 A;  4OWY A;  2PER A;  3F9U A;  4HI7 A;  2H0G A;  1DBY A;  3GYK A;  4KAE A;  4TRX A;  1V58 A;  3UIW A;  5KN3 A;  1R26 A;  2LNT A;  3PR8 A;  1J0F A;  1O8W A;  3EE2 A;  3D22 A;  2PU9 C;  4FYB A;  3TJB A;  5GZZ B;  3ZYW A;  4RI6 A;  2VLT A;  1SKW B;  3RHC A;  4ECI A;  1U6T A;  2C0E A;  1SK2 A;  2LRC A;  4V2L A;  2LEG A;  6GSS A;  5JWR B;  3SBC A;  3DYR A;  1FO5 A;  3LYK A;  2F9S A;  6GSU A;  3F6D A;  4PQ1 A;  8GSS A;  5IMD A;  3M9J A;  2HYX A;  3TKS A;  2FA4 A;  2K18 A;  1AXD A;  1GSD A;  3GKN A;  3ZRD A;  1BG5 A;  3D6I A;  2NBS A;  3WGE A;  4YH2 A;  1EEJ A;  4MH3 A;  1PX6 A;  1HYU A;  2FGX A;  1AQX A;  2REM A;  2VLU A;  4G10 A;  2YWI A;  2X64 A;  3A3T A;  2LRT A;  2OAD A;  4QL7 A;  4XRD A;  5B8B A;  2YJH A;  2RLI A;  4MZB A;  1ZMA A;  2CVD A;  2J9H A;  2CVK A;  5F05 A;  3HYP A;  3MDK A;  2IWT A;  1K0D A;  3HXS A;  1ST9 A;  1O6J A;  4BVX A;  4WR4 A;  1Y25 A;  4YAV A;  2H01 A;  2H1B A;  1QK8 A;  3DD3 A;  1GUK A;  3LXZ A;  1GSU A;  3GKX A;  1OC8 A;  3LWA A;  4PXO A;  1U3A A;  4I6X A;  3G7I A;  2NDO A;  1GSY A;  5GSS A;  4OCF A;  3O6T A;  4P3Y B;  4FIW A;  2P0G A;  5ECI B;  4FO5 A;  4DSQ A;  1KBN A;  2H75 A;  2C8U A;  1MDK A;  1A8L A;  3CSH A;  2KP2 A;  3FY7 A;  4BA7 A;  3IK9 A;  1KTE A;  4FYU A;  1FHE A;  1GUH A;  5IOW A;  2CZ3 A;  3QR6 A;  2DML A;  2FUG 2;  2CZ2 A;  1GSF A;  1K0N A;  4MZW A;  4ZIJ A;  1YF0 A;  3UJ1 A;  1VGL A;  3LXT A;  1F2E A;  4EUY A;  4EE0 A;  3IPZ A;  3D4T A;  4MMM A;  3KJY A;  3DWV A;  3EC3 A;  1YZX A;  3ZFL A;  5ECK B;  1GLQ A;  2FWF A;  1SKS B;  1VF3 A;  4NWY A;  1MD4 A;  3ZMK A;  2E2M A;  5ELA A;  1SKR B;  5CYY A;  2CA8 A;  2IMK A;  5ELG A;  1GRX A;  5G1K A;  1ZCP A;  3WGX A;  5D9X A;  2DSA A;  5CRG A;  1O7U A;  2N5B A;  1U88 A;  4XS4 B;  3WT1 A;  1AUC A;  5D73 A;  3Q18 A;  3DVW A;  3TJF A;  1RQM A;  4MK3 A;  4GQF A;  1XPV A;  2TRX A;  3LFL A;  1R4W A;  3IHQ A;  2MMO A;  1GNE A;  5HR3 A;  4YQU A;  5ID2 B;  4XCS A;  2KHP A;  3TOT A;  1W89 A;  3CRU A;  4WKW A;  1Z6N A;  3VK9 A;  5G2Z A;  1ACV A;  1XXU A;  2YJ7 A;  4EDZ A;  2FA8 A;  2OBK A;  2DBC A;  4O32 A;  3LOR A;  12GS A;  1NM3 A;  4MDC A;  3EWL A;  2M72 A;  1EOH A;  1T1V A;  1SU9 A;  4GLT A;  4MAB A;  3ERW A;  1ERU A;  4GTU A;  1GSQ A;  1TW9 A;  2PBJ A;  1PKZ A;  2H8L A;  2GQL A;  5A5K A;  1LJR A;  5IO0 A;  3MSZ A;  2GZZ A;  4MJC A;  4MJB A;  1A2J A;  3IAS 2;  4I2T A;  1T00 A;  1K3O A;  4TKY A;  4WF4 A;  2V32 A;  4ECB A;  22GS A;  1T4Y A;  2HZF A;  3TKS E;  3EMP A;  3GUS A;  4GCI A;  3RHB A;  3KCM A;  4EKZ A;  4IN0 A;  1X5D A;  1SEN A;  2R2J A;  2FNO A;  2RUE A;  4MJE A;  4RUV A;  2V2G A;  2XC2 A;  3ISO A;  2LJK A;  2B7K A;  4HU9 A;  4RI7 A;  4HJM A;  4MCU A;  4NXI A;  3ZIJ A;  2LUS A;  4ML6 A;  1GTB A;  3Q19 A;  2G2Q A;  1GH2 A;  2DJ0 A;  1OKD A;  2IMD A;  3EIN A;  1VF4 A;  2VCT A;  2BJX A;  4ID0 A;  3QPM A;  1S3D A;  3KH7 A;  5D9V A;  2NTO A;  1TU7 A;  4K7I A;  2P5Q A;  4I8B A;  2QSI A;  2HFD A;  4KX4 A;  2VD1 A;  1ON4 A;  3F3Q A;  1PSQ A;  4LL4 B;  3HVX A;  3VUR A;  14GS A;  6GSX A;  5DAL A;  1PQN A;  3QAV A;  3P2A A;  4PNG A;  1ERV A;  5G1L A;  3UBK A;  1Q98 A;  3KTL A;  4PUF C;  1URM A;  2H74 A;  2ON5 A;  4TW5 A;  3GRX A;  1Z5Y E;  1QUW A;  1ZZY A;  1SJZ A;  3HD5 A;  3IA1 A;  1GUL A;  2A4V A;  3FZ5 A;  1BQ7 A;  1HNB A;  1EWX A;  4N10 A;  1KEB A;  4JR6 A;  2CX4 A;  1PKW A;  1FG4 A;  1G6Y A;  4TXO A;  4EC0 A;  4Q5N A;  4PQH A;  4WBJ A;  5HFG A;  3OR5 A;  2E7P A;  1XFL A;  3M8N A;  3JCM L;  3HJO A;  1EGR A;  5CRD A;  4D73 B;  1I5G A;  1Y6E A;  3MNG A;  4ML1 A;  5G5F A;  1A8Y A;  5HFK A;  3IAM 2;  3RAZ A;  3D0Z A;  5DQY A;  1B4Q A;  2GLR A;  4XS1 A;  1PD2 1;  1PRX A;  1G6W A;  3BCI A;  4IJ3 A;  2L4C A;  1OYJ A;  5ECM B;  2ALB A;  2YP6 A;  3CXG A;  5CRE A;  3EU3 A;  3V1W A;  2VCV A;  2L6C A;  1YKC A;  1Z9H A;  3FRC A;  3GFK A;  4EO3 A;  3TRP A;  2AB6 A;  3WYW A;  2C3T A;  3FK8 A;  5LNK e;  3TJK A;  1EEM A;  3ZFB A;  5ECR B;  1K0A A;  2RM6 A;  5IQY A;  1X5E A;  3GTU B;  2ZUP A;  1F3A A;  2GSS A;  1XOA A;  3HA9 A;  3GMF A;  1M2B A;  2V6K A;  5E59 A;  4O5R A;  2B1L A;  5JWO B;  1XWB A;  2VIM A;  1FB0 A;  4TR0 A;  3HZ4 A;  1YEP A;  3FEU A;  3O76 A;  4POK A;  3RBT A;  5J3R A;  5G30 A;  1JHB A;  2GTU A;  4OCE A;  9GSS A;  3A2W A;  3I9V 2;  1LBK A;  3MWH A;  1F6M C;  5H5S A;  4KSM A;  1FVK A;  2LST A;  2JSY A;  4PX1 A;  3J7Y k;  1R7H A;  5FWG A;  4ECC A;  1K0M A;  2P5R A;  2GQM A;  4DSR A;  3TKS C;  1OVN A;  2GST A;  2G0F A;  3GA4 A;  3FR9 A;  2H6X A;  4AJ7 A;  1JZO A;  5IMV A;  2K8S A;  5CNW A;  2FHE A;  2CAQ A;  3P90 A;  1TRU A;  1FB6 A;  2O89 A;  1SK0 A;  4N30 A;  3PH9 A;  2YV9 A;  2H0H A;  5E4W A;  4N11 A;  5CAX A;  4ZIL A;  3U6V A;  3DIE A;  2ES7 A;  3QFB C;  5AN1 A;  5FT3 A;  3BBY A;  5EVO A;  2I3Y A;  5J9C A;  4WEY A;  1QQ2 A;  3LGC A;  4GST A;  1Z7P A;  2F8F A;  3FZ4 A;  5COH A;  4DSS B;  3FR6 A;  3G7J A;  5LCZ A;  5LD0 A;  4KDY A;  1EZK A;  3VPT A;  1R5P A;  3IOS A;  2FLS A;  2YZU A;  4JR4 A;  3C1S A;  1YDK A;  3QD9 A;  4RQR A;  2VAF A;  3E9J B;  4KGI A;  3P7X A;  4TR1 A;  2C0G A;  2V6O A;  3ZIV A;  2DJ2 A;  4F03 A;  1ZOF A;  2WJU A;  4NHZ A;  4OD7 A;  3HVV A;  3F4R A;  2WGR A;  2HE3 A;  3KGK A;  2C3Q A;  5AIX A;  1EV4 A;  3O3T A;  4L0U A;  5GAN D;  1E6B A;  1T4Z A;  2I1U A;  2X8G A;  4ULX A;  5IMF A;  2JZR A;  3GX0 A;  1BJX A;  4L8E A;  3DVX A;  4K7N A;  2GZP A;  2L4Q A;  3KMO A;  1ILO A;  2JU5 A;  1TI3 A;  1RK4 A;  2IFQ A;  1SD8 A;  1MEK A;  4OMV A;  2IL3 A;  3L9S A;  3LQ7 A;  3HDC A;  1BYE A;  2LRN A;  4GWR A;  1UVZ A;  2GT6 A;  4WXT A;  3VLN A;  4KW6 A;  5G5E A;  4GQC A;  4IS0 A;  2H72 A;  3L9U A;  3E0U A;  3C7M A;  2FWE A;  1DE2 A;  1M2A A;  2MMN A;  4V1A g;  3TKQ A;  5D93 A;  2X99 A;  1SL2 B;  2VCQ A;  2HSY A;  1AIU A;  1ERW A;  4E8H A;  1YQ1 A;  5B8A A;  1QFN A;  2VO4 A;  3GST A;  3GL5 A;  1WE0 A;  4CHS A;  1F9M A;  1XWK A;  2C1Y A;  3ERF A;  3L4N A;  1U3I A;  3VI5 A;  2AYT A;  3N5O A;  2GQK A;  3BCK A;  3APQ A;  2CAI A;  2HSH A;  2R4V A;  3W8S A;  1PX7 A;  3UAP A;  4WBR D;  5L71 A;  2KOK A;  2YCD A;  1OE8 A;  2VLV A;  1JZR A;  2TRC P;  1SD9 A;  4TN8 A;  1U87 A;  2BMX A;  1YJ6 A;  1O81 A;  3VFI A;  2HI7 A;  1WJK A;  5C04 A;  1N2A A;  4KA0 A;  4HZ2 A;  3GH6 A;  3G9B A;  3FYG A;  5D96 A;  5IPH A;  1TXX A;  2F3M A;  1THX A;  3EVI A;  5C00 A;  3HY2 A;  1I9D A;  1YF1 A;  1HNA A;  4ZL9 A;  2FY6 A;  2GSQ A;  3ZLP A;  2VCX A;  3IK7 A;  5EY6 A;  1JLW A;  1NSW A;  1XW5 A;  3A2V A;  4MZC A;  2LV3 A;  3ZVJ D;  3F63 A;  5J4U A;  2I4A A;  3H1N A;  2B5Y A;  5IPG A;  2XPD A;  4MJA A;  1XZO A;  2XBQ A;  1TI1 A;  2LQQ A;  2V1M A;  4HEA 2;  1LU4 A;  4E8E A;  1XCC A;  2YWM A;  3ERG A;  3IE3 A;  4LLR A;  3KMN A;  10GS A;  1YEX A;  1OAZ A;  2E2G A;  3UL3 A;  2VOC A;  3HZ8 A;  3ME8 A;  3CBU A;  4IW9 A;  3F8U A;  3KZQ A;  4EDY A;  5EPF A;  4PUR A;  1XIY A;  5HFI A;  3VPQ A;  3TRQ A;  1YY7 A;  2PPT A;  2AHE A;  1C72 A;  4FYC A;  2K6V A;  4LMW A;  2EIR A;  3TUE A;  2IN3 A;  1XWG A;  1T7P B;  1MD3 A;  2LJR A;  4XTS A;  4IP6 A;  3C71 A;  3F4T A;  3F3R A;  3DGQ A;  3IV4 A;  5HR2 A;  1SJ6 A;  3FZA A;  4J56 E;  2YPM A;  5F06 A;  3QDN A;  1EOG A;  3ZRE A;  4AF2 A;  1CQH A;  2JZT A;  1X9W B;  1V98 A;  3APO A;  3KP8 A;  2OBI A;  3KEB A;  5JWQ B;  3TKP A;  4O92 A;  4K9Z A;  4IEL A;  4NPB A;  4I97 A;  5JCU A;  3I69 A;  2MBT A;  3GHA A;  4QQ7 A;  2OAC A;  1TOF A;  1SJI A;  3DKS A;  1WP0 A;  3SWL A;  5IO2 A;  3TOU A;  4EL1 A;  4IQ1 A;  3FKF A;  4LMV A;  4CDO A;  4K7O A;  4V2N A;  6GSW A;  4PGT A;  2OE1 A;  5JCG A;  2VL3 A;  4KND A;  3H79 A;  4KE3 A;  3QMX A;  4YQM A;  1XWA A;  5G31 A;  2DMM A;  1A0R P;  2M80 A;  2R6K A;  5CP1 A;  3ZVJ A;  1UA5 A;  3G7Y A;  1K0O A;  2H73 A;  5HR0 A;  3E3E A;  2VUP A;  2XPE A;  1ZL9 A;  2QKE A;  2X8C A;  1MDI A;  3FHK A;  2HRN A;  4IP1 A;  2EIQ A;  2WZ9 A;  4NMU A;  1S3C A;  4KCA A;  5DCH A;  5H5Q A;  4IKH A;  1M9B A;  5JCW A;  5INY A;  5DCG A;  1Q4J A;  3NZN A;  1KNG A;  2CX3 A;  3QFA C;  1H75 A;  4PQI A;  1T3B A;  1V57 A;  4Q5Q A;  2IMI A;  2IME A;  4IGJ A;  1G0T A;  3RPN A;  5J9B A;  3EYT A;  1TRS A;  4AJ6 A;  4H86 A;  1F3B A;  2WRT A;  2CVB A;  3TKR A;  4AGS A;  4G2E A;  4GSN A;  1ZYE A;  2LKU A;  4BVY A;  5J41 A;  4K1F A;  3HJM A;  2TIR A;  1B9Y C;  3PGT A;  6GSY A;  2DLX A;  2DC5 A;  3GX8 A;  5DAK A;  2GDR A;  2HRF A;  4XS6 A;  4K0G A;  5D9W A;  3TDG A;  4WR5 A;  4IQA A;  2MBS A;  2I81 A;  6GSV A;  4NV2 A;  3BD2 A;  1O8X A;  2OJL A;  1B9X C;  5ECP B;  1NW2 A;  4J2F A;  2H30 A;  1X5C A;  2PMT A;  4MP4 A;  1FW1 A;  2LNS A;  3IR4 A;  1TU8 A;  2P31 A;  4PNF A;  2FWG A;  3RDW A;  2LTK A;  2YOI A;  1GNW A;  17GS A;  4IHU A;  2CQ9 A;  4F0B A;  2F51 A;  3HHV A;  1EGO A;  2R3X A;  1B8X A;  3KP9 A;  1DSB A;  2YV7 A;  2N5F A;  2VL2 A;  4OFN A;  1IYI A;  1QXH A;  2L5L A;  1A2L A;  1OC3 A;  4GF0 A;  3TCO A;  2JL4 A;  2Z9S A;  1Z7R A;  3UBL A;  2RII A;  1SL1 B;  3KXO A;  3GL3 A;  3UMA A;  5HR1 A;  3GV1 A;  4X0X A;  1ML6 A;  7GSS A;  1K0C A;  3WT2 A;  3D5J A;  1M7T A;  4XS4 A;  1WPI A;  4BWS A;  2YZH A;  3LSZ A;  4G9H A;  2K9F A;  2OE3 A;  2RM5 A;  3KH9 A;  2CV4 A;  5HQP A;  2JZS A;  4ZBA A;  4HDE A;  5IMZ A;  1H4O A;  3WGD A;  3GKK A;  1J9B A;  1PL2 A;  2OA7 A;  4ILF A;  2C0F A;  3FR3 A;  2L5O A;  4ZL7 A;  4YQV A;  2O8V B;  1EP8 A;  4XIH A;  3APS A;  5ID2 A;  2AJQ B;  4JBB A;  3KTB A;  4KCE A;  5GST A;  2PUK C;  3QOU A;  1A2M A;  5KN0 A;  2C0D A;  5J5N A;  1XBS A;  5H5R A;  1ABA A;  3ED3 A;  4RQX A;  1VF1 A;  4N0V A;  3US3 A;  3VI7 A;  1GUM A;  2B5E A;  1GSE A;  3D4M A;  3AY8 A;  2IJY A;  3CYN A;  2H6Y A;  1TRW A;  1XWC A;  2HZE A;  1GTU A;  3C1R A;  2LJA A;  3QCP A;  5CO3 A;  5AGY A;  4F0C A;  3F0I A;  4MA9 A;  5B6N A;  5EL8 A;  2A2R A;  5DQS A;  4L5L A;  5ENU A;  4TR3 A;  5AIS A;  4GXZ A;  4HJ2 A;  3A2X A;  4K8M A;  2ZCT A;  3HJP A;  2H70 A;  3CTF A;  2R5G A;  1TRV A;  3IXR A;  4ZXG A;  2FD3 A;  1HD2 A;  1FOV A;  4Q5R A;  2HNL A;  4POB A;  3RPP A;  3NIV A;  1WOU A;  4JRR A;  1OKT A;  1G7E A;  2L57 A;  2VM2 A;  5DAL B;  3HKR A;  3LEF A;  3N9J A;  5ECO B;  5KN1 A;  4MH2 A;  5DVB A;  4LA1 A;  3MAK A;  3ZL5 A;  1YKA A;  5DBQ A;  2H19 A;  4POL A;  3GSS A;  4EF0 A;  2DJ3 A;  3Q6O A;  1AQW A;  2LS5 A;  1USB A;  1GTA A;  2GVP A;  4MPF A;  4XHM A;  1MDJ A;  1AAZ A;  2H1G A;  4KH7 A;  1GLP A;  3I6A A;  4MF7 A;  4JE1 A;  5F07 A;  2DJJ A;  4IJI A;  3UVH A;  4TXO B;  1JZW A;  1JZD A;  4NV5 A;  2B3S A;  1GTI A;  3A5W A;  1CQG A;  5A4V A;  2PWJ A;  3ZIT A;  3S9F A;  2GSR A;  3VWX A;  4JZQ A;  2N5A A;  3C73 A;  2EIO A;  2K8V A;  2HXK A;  1M9A A;  2H6Z A;  1HNC A;  1A0F A;  2JSZ A;  5ECL B;  5CRH A;  1K0B A;  1J08 A;  4OFM A;  1AQV A;  3R2Q A;  5DAK B;  2GT5 A;  2HT9 A;  3TJJ A;  2VCW A;  5A4W A;  1G7O A;  2V41 A;  3UEM A;  3KIJ A;  1M0U A;  3UOM A;  4Q5F A;  1EP7 A;  18GS A;  3GUR A;  1OC9 A;  2GS3 A;  5F0G A;  2WUL A;  3H8Q A;  1W4V A;  4KB3 A;  2YWO A;  3L0H A;  2IIY A;  4D73 A;  2GZY A;  1AW9 A;  4HZ4 A;  1BED A;  4GSS A;  3L9V A;  1TK8 B;  1GSS A;  2H1A A;  1IYH A;  1PL1 A;  4MF5 A;  2RUF A;  3HVS A;  1TJD A;  2B7J A;  3EUR A;  1BX9 A;  3BOA A;  2BTO T;  1PGT A;  2VD0 A;  1EV9 A;  6GST A;  2J23 A;  2KLX A;  2KP1 A;  4K0N A;  4ZB9 A;  1TTZ A;  1PN9 A;  2DIZ A;  4ACS A;  3TJG A;  4F82 A;  4TR4 A;  3ZML A;  4OO4 A;  4WET A;  2QGV A;  1TKD B;  4G19 A;  19GS A;  5ECH B;  4X1U A;  2IMF A;  2X8H A;  1V40 A;  3DRN A;  2ZNM A;  2WFC A;  3GTU A;  2NVL A;  2LQO A;  3UVT A;  1SYX A;  1R5A A;  4V2M A;  4MPG A;  2O85 A;  4ZB6 A;  2O87 A;  3M3M A;  4AJ8 A;  3J7Y b;  4TXV A;  2DJ1 A;  3CSJ A;  3P8W A;  3GNJ A;  1JLV A;  1TK5 B;  1B4P A;  4FH8 A;  3HCZ A;  3DXB A;  5DDL A;  1TK0 B;  5B6M A;  2B5X A;  1DE1 A;  2H1D A;  1MTC A;  1E2Y A;  1BAY A;  2WS2 A;  3TRX A;  2HZE B;  2R37 A;  4OFT A;  3VWV A;  1XVW A;  4OO5 A;  3F4S A;  2YNX A;  1FAA A;  3KD0 A;  5D9T A;  2JAC A;  3VWU A;  16GS A;  2ON7 A;  5A4U A;  4HS1 A;  2KUC A;  4IBP A;  5GAP D;  4MLY A;  4BL7 A;  4TR1 B;  4IVF A;  3EU4 A;  2YWN A;  2FCH A;  4I2U A;  4YAP A;  2WCI A;  5KN2 A;  3IDV A;  3ME7 A;  5AIV A;  4V1A p;  2YN1 A;  1VRS D;  1DUG A;  4GRF A;  3IBH A;  1X9M B;  2MMA A;  5IMC A;  3TB2 A;  1SYR A;  4TVE A;  5IMA A;  3ZTL A;  1PA3 A;  3IRA A;  4HQS A;  3GN3 A;  4DSS A;  4BPY A;  1O85 A;  2H76 A;  2F8A A;  1OE7 A;  1RW1 A;  3M0F A;  3C8E A;  3TGZ A;  3GH9 A;  1V9W A;  2A2S A;  1A23 A;  1WRY A;  4ZBB A;  2IFQ B;  4XRA A;  2C80 A;  2H66 A;  4KSO A;  3DML A;  1GL8 A;  2XHF A;  1O73 A;  1M2D A;  2MMZ A;  3W8J A;  4L0W A;  3UAR A;  1QMV A;  3FZ9 A;  4ZBD A;  3WD6 A;  2O7K A; 
#chains in the Genus database with same CATH topology
 3M1G A;  2D2Z A;  2DIY A;  2VCZ A;  2JAD A;  2X4A A;  3M9K A;  4POM A;  1NHY A;  2L59 A;  4I5Q A;  2QC7 A;  4BWQ A;  3L78 A;  5DJL A;  4F9Z A;  2NPB A;  5ABR A;  2XBI A;  3Q74 A;  5IM9 A;  5IIZ A;  1Z4J A;  3F6F A;  3CRT A;  3QAG A;  1JFU A;  3GIX A;  5KEJ A;  1ERT A;  4DVC A;  1S3A A;  3H93 A;  2CT6 A;  2WB9 A;  2E0Q A;  3CMI A;  1NHO A;  3EPT A;  2C4J A;  4NFL A;  3I43 A;  1GWC A;  4J57 E;  4ECJ A;  3H4K A;  4ZB8 A;  2PGT A;  3VWW A;  1A24 A;  1N8J A;  4LL1 B;  2VM1 A;  3BWV A;  4HQZ A;  1Z4M A;  2AV4 A;  2YAN A;  3QBP A;  3K8N A;  4K2D A;  5B7C A;  1GP1 A;  1SK1 A;  3EMX A;  4Z7X A;  3U19 A;  1U16 A;  2VL9 A;  2VL2 C;  1XVQ A;  4PUA A;  1DCN A;  4QL9 A;  1OC9 B;  5DJM A;  4KDX A;  2AUV A;  4EXJ A;  1V2A A;  2B1K A;  1TP9 A;  2MZC A;  4YKF A;  1WIK A;  2B6M A;  1XW6 A;  1ZYQ B;  2IPA A;  4N0Z A;  2GGT A;  1AUW A;  1ZGN A;  1SL0 B;  2I9H A;  4L5O A;  2H71 A;  2FWH A;  3LYP A;  4TOP A;  3LJR A;  4ISD A;  4HUA A;  2PVQ A;  4ZL8 A;  2M46 A;  1K3L A;  3FW2 A;  1M99 A;  1FVJ A;  1TDI A;  1X0R A;  20GS A;  2C3N A;  3GKM A;  5ECN B;  1PMT A;  3D21 A;  1T8E B;  13GS A;  4HU7 A;  1UC7 A;  2PVO C;  4YKG A;  3ZZX A;  4CW9 A;  1F37 A;  5CRW A;  4NAX A;  3LG6 A;  3PIN A;  2L6D A;  4KDU A;  1XW9 A;  4X43 A;  4EVM A;  1WWJ A;  11GS A;  4F2I A;  5D8I A;  1WMJ A;  1X9S B;  2AAW A;  4K6X A;  5ECS A;  2MYG A;  4JED A;  3NOF A;  4X4J A;  4DEJ A;  1UN2 A;  2H0I A;  1QGV A;  3MIX A;  1Z6M A;  3KM6 A;  4WF5 A;  4O7H A;  4HOJ A;  2FUS A;  3QAW A;  5FHI A;  2OE0 A;  3W6G A;  3DEX A;  3CTG A;  4NHW A;  1B48 A;  4MF6 A;  5F8B A;  2WDU A;  3CSI A;  1HQO A;  1VF2 A;  2HLS A;  5IOX A;  1AC1 A;  2DJK A;  2PN8 A;  1THO A;  4Z2T A;  5ECQ B;  3IC4 A;  2EC4 A;  4KUN A;  1K3Y A;  2OKA A;  1XOB A;  4JU5 A;  3U5R E;  2HVG A;  1Z3E A;  3BJ5 A;  2PER A;  3F9U A;  4OWY A;  1Q5N A;  2H0G A;  4HI7 A;  1DBY A;  3GYK A;  4KAE A;  4TRX A;  4BL7 B;  1V58 A;  4ICY A;  3UIW A;  5KN3 A;  1R26 A;  2LNT A;  3PR8 A;  1J0F A;  3IC8 A;  1O8W A;  3EE2 A;  3D22 A;  2PU9 C;  1HY0 A;  4FYB A;  3TJB A;  5GZZ B;  3ZYW A;  4RI6 A;  2VLT A;  1SKW B;  3RHC A;  4ECI A;  3GZH A;  1U6T A;  3U13 A;  2QGA B;  2C0E A;  1SK2 A;  2LRC A;  4V2L A;  2A4H A;  2LEG A;  6GSS A;  5JWR B;  3SBC A;  3DYR A;  1FO5 A;  3LYK A;  2F9S A;  6GSU A;  3F6D A;  4PQ1 A;  8GSS A;  5IMD A;  2QA1 A;  5KOW A;  3M9J A;  2HYX A;  3TKS A;  2FA4 A;  2K18 A;  1AXD A;  1GSD A;  3GKN A;  3ZRD A;  1BG5 A;  3D6I A;  2NBS A;  3WGE A;  4YH2 A;  1EEJ A;  4MH3 A;  1PX6 A;  1HYU A;  2FGX A;  1AQX A;  2REM A;  2VLU A;  4G10 A;  2YWI A;  2X64 A;  3A3T A;  2LRT A;  2OAD A;  4QL7 A;  4XRD A;  1J3U A;  3IHG A;  4G0L A;  5B8B A;  2YJH A;  2RLI A;  4MZB A;  1ZMA A;  2CVD A;  2J9H A;  2CVK A;  5F05 A;  3GTD A;  3HYP A;  3MDK A;  2IWT A;  1K0D A;  3HXS A;  1ST9 A;  1O6J A;  4BVX A;  4WR4 A;  1Y25 A;  4YAV A;  2H01 A;  2H1B A;  1QK8 A;  3DD3 A;  2PTQ A;  1GUK A;  3LXZ A;  2E9F A;  1TJU A;  1GSU A;  3GKX A;  1OC8 A;  3LWA A;  4PXO A;  1U3A A;  4I6X A;  3G7I A;  2NDO A;  1GSY A;  5GSS A;  4OCF A;  4BVY B;  3O6T A;  4P3Y B;  4FIW A;  2P0G A;  5ECI B;  4FO5 A;  4DSQ A;  1KBN A;  2H75 A;  2C8U A;  1MDK A;  1A8L A;  3CSH A;  2KP2 A;  3FY7 A;  4BA7 A;  3IK9 A;  1KTE A;  4FYU A;  1FHE A;  1GUH A;  5IOW A;  2CZ3 A;  1PN0 A;  3QR6 A;  2DML A;  2FUG 2;  2CZ2 A;  1GSF A;  1K0N A;  4MZW A;  4ZIJ A;  2JAR A;  1YF0 A;  3UJ1 A;  1VGL A;  3LXT A;  1F2E A;  4EUY A;  4EE0 A;  3IPZ A;  3D4T A;  3CQF A;  4MMM A;  3KJY A;  3DWV A;  3EC3 A;  1YZX A;  3ZFL A;  5ECK B;  1GLQ A;  2FWF A;  1SKS B;  1VF3 A;  4NWY A;  1JSW A;  1MD4 A;  3ZMK A;  2E2M A;  5ELA A;  1SKR B;  5CYY A;  2CA8 A;  2IMK A;  5ELG A;  1GRX A;  5G1K A;  1ZCP A;  3WGX A;  1IW7 D;  5D9X A;  2DSA A;  5CRG A;  1O7U A;  2N5B A;  3TV2 A;  1U88 A;  2R0G A;  4XS4 B;  3WT1 A;  1AUC A;  5D73 A;  3Q18 A;  3DVW A;  3TJF A;  1RQM A;  4MK3 A;  4GQF A;  1XPV A;  2TRX A;  3LFL A;  1R4W A;  3IHQ A;  2MMO A;  1GNE A;  5HR3 A;  4YQU A;  5ID2 B;  4XCS A;  2KHP A;  1Z4P X;  3TOT A;  1W89 A;  3CRU A;  4WKW A;  1Z6N A;  3VK9 A;  4CY8 A;  5G2Z A;  1ACV A;  1XXU A;  2YJ7 A;  4EDZ A;  2FA8 A;  2OBK A;  2DBC A;  4O32 A;  3LOR A;  12GS A;  1NM3 A;  4MDC A;  3EWL A;  2M72 A;  1EOH A;  1T1V A;  4MAB A;  1SU9 A;  4GLT A;  3ERW A;  3OCE A;  1ERU A;  4GTU A;  1GSQ A;  1TW9 A;  2PBJ A;  1PKZ A;  2H8L A;  2GQL A;  5A5K A;  1LJR A;  5IO0 A;  3MSZ A;  2GZZ A;  4MJC A;  4MJB A;  2D27 A;  1A2J A;  4MX2 A;  4K2X A;  3FMW A;  3IAS 2;  4KF9 A;  4I2T A;  1T00 A;  1K3O A;  4TKY A;  4WF4 A;  2V32 A;  4ECB A;  22GS A;  1T4Y A;  2HZF A;  3TKS E;  3EMP A;  3GUS A;  4GCI A;  3RHB A;  3KCM A;  4EKZ A;  4IN0 A;  1X5D A;  1SEN A;  2R2J A;  2FNO A;  2RUE A;  4MJE A;  4RUV A;  4YIH A;  2V2G A;  2XC2 A;  3ISO A;  2LJK A;  2B7K A;  4HU9 A;  4RI7 A;  4HJM A;  4MCU A;  4NXI A;  3ZIJ A;  2LUS A;  4ML6 A;  3BHG A;  1GTB A;  3Q19 A;  2G2Q A;  1GH2 A;  2DJ0 A;  1OKD A;  2IMD A;  3EIN A;  1VF4 A;  2VCT A;  2BJX A;  4ID0 A;  4APB A;  3QPM A;  4BVX B;  1S3D A;  3KH7 A;  4YIK A;  5D9V A;  2NTO A;  1TU7 A;  4K7I A;  4ADM A;  2P5Q A;  4I8B A;  2QSI A;  2HFD A;  4KX4 A;  2VD1 A;  1ON4 A;  3F3Q A;  1PSQ A;  4LL4 B;  5F91 A;  3HVX A;  3VUR A;  14GS A;  6GSX A;  2HRK A;  5DAL A;  2R0P A;  1PQN A;  3QAV A;  3P2A A;  4PNG A;  1ERV A;  5G1L A;  3UBK A;  1Q98 A;  3KTL A;  5HW2 A;  1URM A;  2H74 A;  4PUF C;  2ON5 A;  4TW5 A;  3GRX A;  1Z5Y E;  1QUW A;  1ZZY A;  1SJZ A;  3HD5 A;  3IA1 A;  1GUL A;  2A4V A;  3FZ5 A;  1BQ7 A;  1HNB A;  1EWX A;  4N10 A;  1KEB A;  4JR6 A;  4HGV A;  2CX4 A;  1PKW A;  5BMU A;  1FG4 A;  1G6Y A;  4TXO A;  4EC0 A;  4Q5N A;  4PQH A;  4WBJ A;  5HFG A;  3OR5 A;  2E7P A;  1XFL A;  3M8N A;  3JCM L;  3HJO A;  1EGR A;  5CRD A;  4D73 B;  1I5G A;  4APA A;  1Y6E A;  3MNG A;  4ML1 A;  5G5F A;  1A8Y A;  5HFK A;  3IAM 2;  3RAZ A;  3D0Z A;  5DQY A;  1B4Q A;  2GLR A;  4XS1 A;  1PD2 1;  1PRX A;  1G6W A;  3BCI A;  4IJ3 A;  3RD8 A;  2L4C A;  1OYJ A;  5ECM B;  2ALB A;  2YP6 A;  3CXG A;  5CRE A;  3EU3 A;  3V1W A;  2VCV A;  2L6C A;  1YKC A;  1Z9H A;  3FRC A;  3GFK A;  4EO3 A;  3TRP A;  2AB6 A;  3WYW A;  2C3T A;  5D6B A;  3FK8 A;  5LNK e;  1M3I A;  3TJK A;  1EEM A;  3ZFB A;  5ECR B;  1K0A A;  2RM6 A;  5IQY A;  1X5E A;  3GTU B;  2ZUP A;  1F3A A;  2GSS A;  1XOA A;  3HA9 A;  4PTS A;  3GMF A;  1M2B A;  2V6K A;  5E59 A;  4O5R A;  2B1L A;  5JWO B;  1XWB A;  2VIM A;  1FB0 A;  4BIK A;  4TR0 A;  1FUQ A;  3HZ4 A;  1YEP A;  3FEU A;  3O76 A;  4POK A;  3RBT A;  5J3R A;  5G30 A;  1JHB A;  2GTU A;  4OCE A;  9GSS A;  3A2W A;  3I9V 2;  1LBK A;  3MWH A;  1F6M C;  5H5S A;  4KSM A;  1FVK A;  2LST A;  2JSY A;  4PX1 A;  3J7Y k;  1R7H A;  5FWG A;  4ECC A;  5BRT A;  1K0M A;  2P5R A;  2GQM A;  2DKI A;  4DSR A;  3TKS C;  3OCF A;  1OVN A;  2GST A;  2G0F A;  3GA4 A;  3FR9 A;  2H6X A;  4AJ7 A;  1JZO A;  5IMV A;  2K8S A;  5CNW A;  2FHE A;  2CAQ A;  3P90 A;  1TRU A;  4O5U A;  1FB6 A;  1HY1 A;  2O89 A;  1SK0 A;  4N30 A;  3PH9 A;  2YV9 A;  2H0H A;  5E4W A;  4N11 A;  5CAX A;  4ZIL A;  3U6V A;  4Z2R A;  3DIE A;  2ES7 A;  3QFB C;  5AN1 A;  5FT3 A;  3BBY A;  5EVO A;  2I3Y A;  5J9C A;  4WEY A;  1QQ2 A;  3LGC A;  4GST A;  1Z7P A;  2F8F A;  3FZ4 A;  5COH A;  4DSS B;  3FR6 A;  3G7J A;  5LCZ A;  5LD0 A;  1Q92 A;  4KDY A;  1EZK A;  3VPT A;  1R5P A;  3IOS A;  2FLS A;  2YZU A;  4JR4 A;  3C1S A;  1YDK A;  3QD9 A;  4RQR A;  2VAF A;  3E9J B;  4KGI A;  3P7X A;  4TR1 A;  2C0G A;  2V6O A;  3ZIV A;  2DJ2 A;  4F03 A;  1ZOF A;  2WJU A;  4NHZ A;  4OD7 A;  3HVV A;  3F4R A;  2WGR A;  2HE3 A;  3KGK A;  2C3Q A;  5AIX A;  1EV4 A;  4EEI A;  3O3T A;  4L0U A;  5GAN D;  2QA2 A;  1E6B A;  1T4Z A;  2I1U A;  2X8G A;  4ULX A;  2HRA A;  5IMF A;  2JZR A;  2PTS A;  3GX0 A;  2I7D A;  1BJX A;  4L8E A;  3DVX A;  5F92 A;  2DKH A;  4K7N A;  2GZP A;  3NO9 A;  2L4Q A;  3KMO A;  1ILO A;  2JU5 A;  1TI3 A;  2JAW A;  1RK4 A;  2IFQ A;  1SD8 A;  1MEK A;  4OMV A;  2IL3 A;  3L9S A;  3LQ7 A;  3HDC A;  1BYE A;  2LRN A;  4GWR A;  1UVZ A;  2GT6 A;  4WXT A;  3VLN A;  4KW6 A;  5G5E A;  1S3R A;  4GQC A;  4IS0 A;  2H72 A;  4O5Q A;  3L9U A;  3E0U A;  3C7M A;  2FWE A;  1DE2 A;  1M2A A;  2MMN A;  4V1A g;  3TKQ A;  5D93 A;  2X99 A;  1SL2 B;  2VCQ A;  2HSY A;  1AIU A;  1ERW A;  4E8H A;  1YQ1 A;  5B8A A;  1QFN A;  4MNN A;  2VO4 A;  3GST A;  3GL5 A;  1WE0 A;  4CHS A;  1F9M A;  1XWK A;  2C1Y A;  3ERF A;  1U0L A;  3L4N A;  1U3I A;  3VI5 A;  2AYT A;  3N5O A;  2GQK A;  4EIQ A;  3BCK A;  3APQ A;  2CAI A;  2HSH A;  2R4V A;  3W8S A;  1PX7 A;  3UAP A;  4WBR D;  5L71 A;  2KOK A;  2YCD A;  1OE8 A;  3PPU A;  2VLV A;  1JZR A;  2TRC P;  1SD9 A;  4TN8 A;  1U87 A;  2BMX A;  1YJ6 A;  1O81 A;  3VFI A;  2HI7 A;  1WJK A;  5C04 A;  4ADL A;  1N2A A;  4KA0 A;  4HZ2 A;  2X49 A;  3G9B A;  3FYG A;  3GH6 A;  5D96 A;  5IPH A;  2X75 A;  1TXX A;  2F3M A;  4FQU A;  1THX A;  3EVI A;  5C00 A;  3HY2 A;  1I9D A;  1YF1 A;  1HNA A;  4ZL9 A;  2FY6 A;  2GSQ A;  3ZLP A;  2VCX A;  4A5P A;  3IK7 A;  3MYD A;  5EY6 A;  3A5I A;  1JLW A;  3R3E A;  1NSW A;  1XW5 A;  3A2V A;  4MZC A;  2LV3 A;  3ZVJ D;  3F63 A;  5J4U A;  2I4A A;  3H1N A;  4L6C A;  2R0C A;  2B5Y A;  5IPG A;  2XPD A;  4MJA A;  1XZO A;  1Q91 A;  2XBQ A;  1TI1 A;  4K5R A;  2LQQ A;  2V1M A;  1T9H A;  4HEA 2;  1LU4 A;  4E8E A;  1XCC A;  2YWM A;  3ERG A;  3IE3 A;  4LLR A;  3KMN A;  10GS A;  1YEX A;  1OAZ A;  2E2G A;  3UL3 A;  2YV5 A;  2VOC A;  3HZ8 A;  3ME8 A;  3CBU A;  4IW9 A;  3F8U A;  1PFO A;  3KZQ A;  4EDY A;  5EPF A;  4PUR A;  1XIY A;  5HFI A;  3VPQ A;  3TRQ A;  3HVN A;  1YY7 A;  2PPT A;  2AHE A;  1C72 A;  4FYC A;  2K6V A;  4LMW A;  2EIR A;  3TUE A;  2IN3 A;  1XWG A;  1T7P B;  1MD3 A;  2LJR A;  4XTS A;  4IP6 A;  3C71 A;  3F4T A;  3F3R A;  3DGQ A;  3IV4 A;  3RRP A;  5HR2 A;  1M3J A;  4EFC A;  1SJ6 A;  3FZA A;  4J56 E;  2YPM A;  5F06 A;  3QDN A;  1EOG A;  3ZRE A;  4AF2 A;  1CQH A;  2JZT A;  1X9W B;  1V98 A;  3APO A;  3KP8 A;  2OBI A;  3KEB A;  5JWQ B;  3TKP A;  4O92 A;  4K9Z A;  4IEL A;  4NPB A;  4I97 A;  5JCU A;  3I69 A;  2MBT A;  3GHA A;  4QQ7 A;  2OAC A;  1TOF A;  1SJI A;  3DKS A;  1WP0 A;  3SWL A;  5IO2 A;  3TOU A;  4IQJ M;  4EL1 A;  4IQ1 A;  3FKF A;  4LMV A;  4CDO A;  4K7O A;  4E88 A;  4V2N A;  1KQ7 A;  6GSW A;  4PGT A;  2OE1 A;  5JCG A;  2VL3 A;  4KND A;  4L57 A;  3H79 A;  4KE3 A;  3QMX A;  4YQM A;  1XWA A;  5G31 A;  2DMM A;  1A0R P;  2M80 A;  2R6K A;  5CP1 A;  3ZVJ A;  1UA5 A;  3G7Y A;  1K0O A;  2H73 A;  5HR0 A;  3E3E A;  2VUP A;  2XPE A;  1ZL9 A;  2QKE A;  2X8C A;  1MDI A;  3FHK A;  2HRN A;  4IP1 A;  2EIQ A;  2WZ9 A;  4NMU A;  1S3C A;  4KCA A;  5DCH A;  5H5Q A;  4IKH A;  2A2P A;  1M9B A;  5JCW A;  5INY A;  5DCG A;  1Q4J A;  3NZN A;  1KNG A;  2CX3 A;  4G0I A;  3QFA C;  1H75 A;  4PQI A;  1T3B A;  4NLE A;  1V57 A;  2IMI A;  4Q5Q A;  2IME A;  4IGJ A;  1G0T A;  3RPN A;  5J9B A;  3EYT A;  1TRS A;  4AJ6 A;  4H86 A;  1U15 A;  1F3B A;  2WRT A;  2CVB A;  3TKR A;  3E04 A;  4AGS A;  4G2E A;  4GSN A;  1ZYE A;  2LKU A;  4BVY A;  5J41 A;  4K1F A;  3HJM A;  2TIR A;  1B9Y C;  3PGT A;  6GSY A;  2DLX A;  2DC5 A;  3GX8 A;  5DAK A;  2GDR A;  2HRF A;  4XS6 A;  4K0G A;  5D9W A;  1Z4K A;  4WR5 A;  3TDG A;  4IQA A;  2MBS A;  2I81 A;  6GSV A;  4G0K A;  4NV2 A;  3BD2 A;  1Z4L A;  1O8X A;  2OJL A;  1B9X C;  5ECP B;  1NW2 A;  4J2F A;  2H30 A;  1X5C A;  2PMT A;  4MP4 A;  1FW1 A;  2LNS A;  3IR4 A;  1TU8 A;  2P31 A;  2JAO A;  4PNF A;  2FWG A;  1XG8 A;  3RDW A;  2LTK A;  2YOI A;  1GNW A;  17GS A;  1FOH A;  4IHU A;  2CQ9 A;  4F0B A;  2F51 A;  3HHV A;  1EGO A;  2R3X A;  1B8X A;  3KP9 A;  1DSB A;  2YV7 A;  2N5F A;  2VL2 A;  4OFN A;  1IYI A;  3R6Q A;  1TJV A;  1QXH A;  2L5L A;  1A2L A;  1OC3 A;  4GF0 A;  3TCO A;  2JL4 A;  2Z9S A;  1Z7R A;  3UBL A;  2RII A;  1SL1 B;  3KXO A;  3GL3 A;  3UMA A;  5HR1 A;  3GV1 A;  4X0X A;  1ML6 A;  7GSS A;  2D28 C;  1RE5 A;  1K0C A;  3WT2 A;  3D5J A;  1M7T A;  4XS4 A;  1WPI A;  4BWS A;  2YZH A;  3LSZ A;  4G9H A;  2K9F A;  2OE3 A;  2RM5 A;  3KH9 A;  2CV4 A;  5HQP A;  2JZS A;  4ZBA A;  4HDE A;  5IMZ A;  1H4O A;  3WGD A;  3GKK A;  1J9B A;  1PL2 A;  2OA7 A;  4ILF A;  2C0F A;  3FR3 A;  2L5O A;  4ZL7 A;  4YQV A;  2O8V B;  1EP8 A;  4XIH A;  3APS A;  5ID2 A;  2AJQ B;  4JBB A;  3KTB A;  4KCE A;  5GST A;  2PUK C;  3QOU A;  1A2M A;  3C8T A;  5KN0 A;  2C0D A;  5J5N A;  1XBS A;  5H5R A;  1ABA A;  3ED3 A;  4RQX A;  1VF1 A;  4N0V A;  3US3 A;  3VI7 A;  1GUM A;  2B5E A;  1GSE A;  3D4M A;  3AY8 A;  2IJY A;  3CYN A;  2H6Y A;  1TRW A;  1XWC A;  2HZE A;  1GTU A;  3C1R A;  2LJA A;  3QCP A;  5CO3 A;  5AGY A;  4F0C A;  3F0I A;  4MA9 A;  5B6N A;  5EL8 A;  2A2R A;  5DQS A;  4L5L A;  4MWO A;  5ENU A;  1K7W A;  4TR3 A;  5AIS A;  4EIP A;  3LW9 A;  4GXZ A;  1XWO A;  4HJ2 A;  3A2X A;  4K8M A;  1Z4I A;  2ZCT A;  3HJP A;  2H70 A;  3CTF A;  2R5G A;  1TRV A;  3IXR A;  4ZXG A;  2FD3 A;  1ZYN A;  1HD2 A;  1FOV A;  4Q5R A;  1FUP A;  2HNL A;  4POB A;  3RPP A;  3NIV A;  1WOU A;  4JRR A;  1OKT A;  1G7E A;  2L57 A;  2VM2 A;  5DAL B;  2HSM A;  3HKR A;  3LEF A;  3N9J A;  5ECO B;  5KN1 A;  1TJW A;  4MH2 A;  5DVB A;  4LA1 A;  3MAK A;  3ZL5 A;  1YKA A;  5DBQ A;  2H19 A;  4POL A;  3GSS A;  4EF0 A;  2DJ3 A;  3Q6O A;  1AQW A;  2LS5 A;  1FUO A;  1YFM A;  1USB A;  3CI0 K;  1GTA A;  2GVP A;  4MPF A;  4XHM A;  1MDJ A;  1AAZ A;  2H1G A;  4KH7 A;  1GLP A;  3I6A A;  1C3U A;  4MF7 A;  4JE1 A;  5F07 A;  2DJJ A;  4IJI A;  3UVH A;  4TXO B;  1JZW A;  1JZD A;  4NV5 A;  1C3C A;  2B3S A;  1GTI A;  3A5W A;  1CQG A;  5A4V A;  2PWJ A;  3ZIT A;  3S9F A;  2GSR A;  3VWX A;  4JZQ A;  2N5A A;  3C73 A;  2EIO A;  2K8V A;  2HXK A;  1M9A A;  2H6Z A;  1HNC A;  1A0F A;  2JSZ A;  1K62 A;  5ECL B;  5CRH A;  1K0B A;  1J08 A;  4OFM A;  1AQV A;  3R2Q A;  5DAK B;  2PTR A;  4USS A;  2GT5 A;  1FUR A;  2HT9 A;  3TJJ A;  2VCW A;  5A4W A;  1G7O A;  2V41 A;  3UEM A;  3KIJ A;  1M0U A;  3UOM A;  4Q5F A;  1I0A A;  1DOF A;  1EP7 A;  18GS A;  3GUR A;  1OC9 A;  2GS3 A;  5F0G A;  2WUL A;  3H8Q A;  1W4V A;  3R6V A;  4KB3 A;  2YWO A;  4HSC X;  3L0H A;  2IIY A;  4D73 A;  2GZY A;  1AW9 A;  4HZ4 A;  1BED A;  4GSS A;  3L9V A;  1TK8 B;  1GSS A;  2H1A A;  4Z2U A;  4CY6 A;  1IYH A;  1PL1 A;  4MF5 A;  2RUF A;  3HVS A;  1TJD A;  2B7J A;  3EUR A;  1BX9 A;  3BOA A;  1ZYP A;  2BTO T;  1TJ7 A;  1PGT A;  2VD0 A;  1EV9 A;  6GST A;  2J23 A;  2KLX A;  2KP1 A;  4K0N A;  4ZB9 A;  1TTZ A;  1PN9 A;  2DIZ A;  4ACS A;  3TJG A;  4F82 A;  4TR4 A;  3ZML A;  4OO4 A;  4WET A;  2QGV A;  1TKD B;  4G19 A;  19GS A;  5ECH B;  4X1U A;  2IMF A;  2X8H A;  1V40 A;  3DRN A;  2ZNM A;  1MH9 A;  2WFC A;  3GTU A;  2NVL A;  2LQO A;  3UVT A;  1SYX A;  1R5A A;  4V2M A;  4MPG A;  2O85 A;  4ZB6 A;  2O87 A;  3M3M A;  4AJ8 A;  3J7Y b;  4TXV A;  2DJ1 A;  3CSJ A;  3P8W A;  3GNJ A;  1JLV A;  1TK5 B;  1B4P A;  4K5S A;  2JAU A;  4FH8 A;  3HCZ A;  3DXB A;  5DDL A;  1TK0 B;  5B6M A;  2B5X A;  1DE1 A;  2H1D A;  1MTC A;  4NSL A;  1E2Y A;  1BAY A;  2WS2 A;  1YFE A;  3TRX A;  2HZE B;  2R37 A;  4OFT A;  3VWV A;  1XVW A;  4OO5 A;  3F4S A;  2YNX A;  1FAA A;  3KD0 A;  5D9T A;  2JAC A;  3VWU A;  16GS A;  2ON7 A;  5A4U A;  4HS1 A;  2KUC A;  4IBP A;  2PFM A;  5GAP D;  4MLY A;  4BL7 A;  4TR1 B;  4IVF A;  3EU4 A;  2YWN A;  2FCH A;  4I2U A;  4YAP A;  2WCI A;  5KN2 A;  3IDV A;  3ME7 A;  5AIV A;  4V1A p;  2YN1 A;  1VRS D;  1DUG A;  4GRF A;  5KOX A;  3IBH A;  1X9M B;  2UZ8 A;  2RCN A;  2MMA A;  5IMC A;  4MUM A;  1SYR A;  3TB2 A;  4TVE A;  5IMA A;  3ZTL A;  1PA3 A;  3IRA A;  4HQS A;  3GN3 A;  4DSS A;  4BPY A;  1O85 A;  1VDK A;  2H76 A;  2F8A A;  4L6A A;  1OE7 A;  1RW1 A;  1Z4Q A;  3M0F A;  3C8E A;  3TGZ A;  3GH9 A;  1V9W A;  2A2S A;  1A23 A;  1WRY A;  4ZBB A;  2IFQ B;  4XRA A;  2C80 A;  2H66 A;  4KSO A;  3DML A;  1GL8 A;  2XHF A;  1O73 A;  1M2D A;  2MMZ A;  3W8J A;  4L0W A;  3UAR A;  1QMV A;  3FZ9 A;  4ZBD A;  3WD6 A;  2O7K A; 
#chains in the Genus database with same CATH homology
 3M1G A;  2D2Z A;  2DIY A;  2VCZ A;  2JAD A;  2X4A A;  3M9K A;  4POM A;  1NHY A;  2L59 A;  4I5Q A;  2QC7 A;  4BWQ A;  3L78 A;  5DJL A;  4F9Z A;  2NPB A;  5ABR A;  2XBI A;  3Q74 A;  5IM9 A;  5IIZ A;  3F6F A;  3CRT A;  3QAG A;  1JFU A;  3GIX A;  5KEJ A;  1ERT A;  4DVC A;  1S3A A;  3H93 A;  2CT6 A;  2WB9 A;  2E0Q A;  3CMI A;  1NHO A;  3EPT A;  2C4J A;  3I43 A;  1GWC A;  4J57 E;  4ECJ A;  3H4K A;  4ZB8 A;  2PGT A;  3VWW A;  1A24 A;  1N8J A;  4LL1 B;  2VM1 A;  4HQZ A;  2AV4 A;  2YAN A;  3K8N A;  4K2D A;  5B7C A;  1GP1 A;  1SK1 A;  3EMX A;  4Z7X A;  2VL9 A;  2VL2 C;  1XVQ A;  4PUA A;  4QL9 A;  1OC9 B;  5DJM A;  4KDX A;  2AUV A;  4EXJ A;  1V2A A;  2B1K A;  1TP9 A;  2MZC A;  4YKF A;  1WIK A;  2B6M A;  1XW6 A;  1ZYQ B;  2IPA A;  4N0Z A;  2GGT A;  1ZGN A;  1SL0 B;  2I9H A;  4L5O A;  2H71 A;  2FWH A;  3LYP A;  4TOP A;  3LJR A;  4ISD A;  4HUA A;  2PVQ A;  4ZL8 A;  2M46 A;  1K3L A;  3FW2 A;  1M99 A;  1FVJ A;  1TDI A;  1X0R A;  20GS A;  2C3N A;  3GKM A;  5ECN B;  1PMT A;  3D21 A;  1T8E B;  13GS A;  4HU7 A;  1UC7 A;  2PVO C;  4YKG A;  3ZZX A;  4CW9 A;  1F37 A;  5CRW A;  4NAX A;  3LG6 A;  3PIN A;  2L6D A;  4KDU A;  1XW9 A;  4X43 A;  4EVM A;  1WWJ A;  11GS A;  4F2I A;  5D8I A;  1WMJ A;  1X9S B;  2AAW A;  4K6X A;  5ECS A;  2MYG A;  4JED A;  3NOF A;  4X4J A;  4DEJ A;  1UN2 A;  2H0I A;  1QGV A;  3MIX A;  1Z6M A;  3KM6 A;  4WF5 A;  4O7H A;  4HOJ A;  3QAW A;  5FHI A;  2OE0 A;  3W6G A;  3DEX A;  3CTG A;  4NHW A;  1B48 A;  4MF6 A;  5F8B A;  2WDU A;  3CSI A;  1HQO A;  1VF2 A;  2HLS A;  5IOX A;  1AC1 A;  2DJK A;  2PN8 A;  1THO A;  4Z2T A;  5ECQ B;  3IC4 A;  2EC4 A;  4KUN A;  1K3Y A;  2OKA A;  1XOB A;  4JU5 A;  3U5R E;  1Z3E A;  3BJ5 A;  4OWY A;  2PER A;  3F9U A;  4HI7 A;  2H0G A;  1DBY A;  3GYK A;  4KAE A;  4TRX A;  4BL7 B;  1V58 A;  4ICY A;  3UIW A;  5KN3 A;  1R26 A;  2LNT A;  3PR8 A;  1J0F A;  3IC8 A;  1O8W A;  3EE2 A;  3D22 A;  2PU9 C;  4FYB A;  3TJB A;  5GZZ B;  3ZYW A;  4RI6 A;  2VLT A;  1SKW B;  3RHC A;  4ECI A;  1U6T A;  2C0E A;  1SK2 A;  2LRC A;  4V2L A;  2A4H A;  2LEG A;  6GSS A;  5JWR B;  3SBC A;  3DYR A;  1FO5 A;  3LYK A;  2F9S A;  6GSU A;  3F6D A;  4PQ1 A;  8GSS A;  5IMD A;  2QA1 A;  5KOW A;  3M9J A;  2HYX A;  3TKS A;  2FA4 A;  2K18 A;  1AXD A;  1GSD A;  3GKN A;  3ZRD A;  1BG5 A;  3D6I A;  2NBS A;  3WGE A;  4YH2 A;  1EEJ A;  4MH3 A;  1PX6 A;  1HYU A;  2FGX A;  1AQX A;  2REM A;  2VLU A;  4G10 A;  2YWI A;  2X64 A;  3A3T A;  2LRT A;  2OAD A;  4QL7 A;  4XRD A;  3IHG A;  4G0L A;  5B8B A;  2YJH A;  2RLI A;  4MZB A;  1ZMA A;  2CVD A;  2J9H A;  2CVK A;  5F05 A;  3HYP A;  3MDK A;  2IWT A;  1K0D A;  3HXS A;  1ST9 A;  1O6J A;  4BVX A;  4WR4 A;  1Y25 A;  4YAV A;  2H01 A;  2H1B A;  1QK8 A;  3DD3 A;  1GUK A;  3LXZ A;  1GSU A;  3GKX A;  1OC8 A;  3LWA A;  4PXO A;  1U3A A;  4I6X A;  3G7I A;  2NDO A;  1GSY A;  5GSS A;  4OCF A;  4BVY B;  3O6T A;  4P3Y B;  4FIW A;  2P0G A;  5ECI B;  4FO5 A;  4DSQ A;  1KBN A;  2H75 A;  2C8U A;  1MDK A;  1A8L A;  3CSH A;  2KP2 A;  3FY7 A;  4BA7 A;  3IK9 A;  1KTE A;  4FYU A;  1FHE A;  1GUH A;  5IOW A;  2CZ3 A;  1PN0 A;  3QR6 A;  2DML A;  2FUG 2;  2CZ2 A;  1GSF A;  1K0N A;  4MZW A;  4ZIJ A;  1YF0 A;  3UJ1 A;  1VGL A;  3LXT A;  1F2E A;  4EUY A;  4EE0 A;  3IPZ A;  3D4T A;  4MMM A;  3KJY A;  3DWV A;  3EC3 A;  1YZX A;  3ZFL A;  5ECK B;  1GLQ A;  2FWF A;  1SKS B;  1VF3 A;  4NWY A;  1MD4 A;  3ZMK A;  2E2M A;  5ELA A;  1SKR B;  5CYY A;  2CA8 A;  2IMK A;  5ELG A;  1GRX A;  5G1K A;  1ZCP A;  3WGX A;  1IW7 D;  5D9X A;  2DSA A;  5CRG A;  1O7U A;  2N5B A;  1U88 A;  2R0G A;  4XS4 B;  3WT1 A;  1AUC A;  5D73 A;  3Q18 A;  3DVW A;  3TJF A;  1RQM A;  4MK3 A;  4GQF A;  1XPV A;  2TRX A;  3LFL A;  1R4W A;  3IHQ A;  2MMO A;  1GNE A;  5HR3 A;  4YQU A;  5ID2 B;  4XCS A;  2KHP A;  3TOT A;  1W89 A;  3CRU A;  4WKW A;  1Z6N A;  3VK9 A;  4CY8 A;  5G2Z A;  1ACV A;  1XXU A;  2YJ7 A;  4EDZ A;  2FA8 A;  2OBK A;  2DBC A;  4O32 A;  3LOR A;  12GS A;  1NM3 A;  4MDC A;  3EWL A;  2M72 A;  1EOH A;  1T1V A;  1SU9 A;  4GLT A;  4MAB A;  3ERW A;  1ERU A;  4GTU A;  1GSQ A;  1TW9 A;  2PBJ A;  1PKZ A;  2H8L A;  2GQL A;  5A5K A;  1LJR A;  5IO0 A;  3MSZ A;  2GZZ A;  4MJC A;  4MJB A;  2D27 A;  1A2J A;  4K2X A;  3FMW A;  3IAS 2;  4KF9 A;  4I2T A;  1T00 A;  1K3O A;  4TKY A;  4WF4 A;  2V32 A;  4ECB A;  22GS A;  1T4Y A;  2HZF A;  3TKS E;  3EMP A;  3GUS A;  4GCI A;  3RHB A;  3KCM A;  4EKZ A;  4IN0 A;  1X5D A;  1SEN A;  2R2J A;  2FNO A;  2RUE A;  4MJE A;  4RUV A;  2V2G A;  2XC2 A;  3ISO A;  2LJK A;  2B7K A;  4HU9 A;  4RI7 A;  4HJM A;  4MCU A;  4NXI A;  3ZIJ A;  2LUS A;  4ML6 A;  1GTB A;  3Q19 A;  2G2Q A;  1GH2 A;  2DJ0 A;  1OKD A;  2IMD A;  3EIN A;  1VF4 A;  2VCT A;  2BJX A;  4ID0 A;  3QPM A;  4BVX B;  1S3D A;  3KH7 A;  5D9V A;  2NTO A;  1TU7 A;  4K7I A;  2P5Q A;  4I8B A;  2QSI A;  2HFD A;  4KX4 A;  2VD1 A;  1ON4 A;  3F3Q A;  1PSQ A;  4LL4 B;  3HVX A;  3VUR A;  14GS A;  6GSX A;  2HRK A;  5DAL A;  2R0P A;  1PQN A;  3QAV A;  3P2A A;  4PNG A;  1ERV A;  5G1L A;  3UBK A;  1Q98 A;  3KTL A;  4PUF C;  1URM A;  2H74 A;  2ON5 A;  4TW5 A;  3GRX A;  1Z5Y E;  1QUW A;  1ZZY A;  1SJZ A;  3HD5 A;  3IA1 A;  1GUL A;  2A4V A;  3FZ5 A;  1BQ7 A;  1HNB A;  1EWX A;  4N10 A;  1KEB A;  4JR6 A;  2CX4 A;  1PKW A;  5BMU A;  1FG4 A;  1G6Y A;  4TXO A;  4EC0 A;  4Q5N A;  4PQH A;  4WBJ A;  5HFG A;  3OR5 A;  2E7P A;  1XFL A;  3M8N A;  3JCM L;  3HJO A;  1EGR A;  5CRD A;  4D73 B;  1I5G A;  1Y6E A;  3MNG A;  4ML1 A;  5G5F A;  1A8Y A;  5HFK A;  3IAM 2;  3RAZ A;  3D0Z A;  5DQY A;  1B4Q A;  2GLR A;  4XS1 A;  1PD2 1;  1PRX A;  1G6W A;  3BCI A;  4IJ3 A;  2L4C A;  1OYJ A;  5ECM B;  2ALB A;  2YP6 A;  3CXG A;  5CRE A;  3EU3 A;  3V1W A;  2VCV A;  2L6C A;  1YKC A;  1Z9H A;  3FRC A;  3GFK A;  4EO3 A;  3TRP A;  2AB6 A;  3WYW A;  2C3T A;  3FK8 A;  5LNK e;  3TJK A;  1EEM A;  3ZFB A;  5ECR B;  1K0A A;  2RM6 A;  5IQY A;  1X5E A;  3GTU B;  2ZUP A;  1F3A A;  2GSS A;  1XOA A;  3HA9 A;  4PTS A;  3GMF A;  1M2B A;  2V6K A;  5E59 A;  4O5R A;  2B1L A;  5JWO B;  1XWB A;  2VIM A;  1FB0 A;  4TR0 A;  3HZ4 A;  1YEP A;  3FEU A;  3O76 A;  4POK A;  3RBT A;  5J3R A;  5G30 A;  1JHB A;  2GTU A;  4OCE A;  9GSS A;  3A2W A;  3I9V 2;  1LBK A;  3MWH A;  1F6M C;  5H5S A;  4KSM A;  1FVK A;  2LST A;  2JSY A;  4PX1 A;  3J7Y k;  1R7H A;  5FWG A;  4ECC A;  5BRT A;  1K0M A;  2P5R A;  2GQM A;  2DKI A;  4DSR A;  3TKS C;  1OVN A;  2GST A;  2G0F A;  3GA4 A;  3FR9 A;  2H6X A;  4AJ7 A;  1JZO A;  5IMV A;  2K8S A;  5CNW A;  2FHE A;  2CAQ A;  3P90 A;  1TRU A;  4O5U A;  1FB6 A;  2O89 A;  1SK0 A;  4N30 A;  3PH9 A;  2YV9 A;  2H0H A;  5E4W A;  4N11 A;  5CAX A;  4ZIL A;  3U6V A;  4Z2R A;  3DIE A;  2ES7 A;  3QFB C;  5AN1 A;  5FT3 A;  3BBY A;  5EVO A;  2I3Y A;  5J9C A;  4WEY A;  1QQ2 A;  3LGC A;  4GST A;  1Z7P A;  2F8F A;  3FZ4 A;  5COH A;  4DSS B;  3FR6 A;  3G7J A;  5LCZ A;  5LD0 A;  4KDY A;  1EZK A;  3VPT A;  1R5P A;  3IOS A;  2FLS A;  2YZU A;  4JR4 A;  3C1S A;  1YDK A;  3QD9 A;  4RQR A;  2VAF A;  3E9J B;  4KGI A;  3P7X A;  4TR1 A;  2C0G A;  2V6O A;  3ZIV A;  2DJ2 A;  4F03 A;  1ZOF A;  2WJU A;  4NHZ A;  4OD7 A;  3HVV A;  3F4R A;  2WGR A;  2HE3 A;  3KGK A;  2C3Q A;  5AIX A;  1EV4 A;  3O3T A;  4L0U A;  5GAN D;  2QA2 A;  1E6B A;  1T4Z A;  2I1U A;  2X8G A;  4ULX A;  2HRA A;  5IMF A;  2JZR A;  3GX0 A;  1BJX A;  4L8E A;  3DVX A;  2DKH A;  4K7N A;  2GZP A;  2L4Q A;  3KMO A;  1ILO A;  2JU5 A;  1TI3 A;  1RK4 A;  2IFQ A;  1SD8 A;  1MEK A;  4OMV A;  2IL3 A;  3L9S A;  3LQ7 A;  3HDC A;  1BYE A;  2LRN A;  4GWR A;  1UVZ A;  2GT6 A;  4WXT A;  3VLN A;  4KW6 A;  5G5E A;  4GQC A;  4IS0 A;  2H72 A;  4O5Q A;  3L9U A;  3E0U A;  3C7M A;  2FWE A;  1DE2 A;  1M2A A;  2MMN A;  4V1A g;  3TKQ A;  5D93 A;  2X99 A;  1SL2 B;  2VCQ A;  2HSY A;  1AIU A;  1ERW A;  4E8H A;  1YQ1 A;  5B8A A;  1QFN A;  4MNN A;  2VO4 A;  3GST A;  3GL5 A;  1WE0 A;  4CHS A;  1F9M A;  1XWK A;  2C1Y A;  3ERF A;  3L4N A;  1U3I A;  3VI5 A;  2AYT A;  3N5O A;  2GQK A;  4EIQ A;  3BCK A;  3APQ A;  2CAI A;  2HSH A;  2R4V A;  3W8S A;  1PX7 A;  3UAP A;  4WBR D;  5L71 A;  2KOK A;  2YCD A;  1OE8 A;  3PPU A;  2VLV A;  1JZR A;  2TRC P;  1SD9 A;  4TN8 A;  1U87 A;  2BMX A;  1YJ6 A;  1O81 A;  3VFI A;  2HI7 A;  1WJK A;  5C04 A;  1N2A A;  4KA0 A;  4HZ2 A;  2X49 A;  3G9B A;  3FYG A;  3GH6 A;  5D96 A;  5IPH A;  1TXX A;  2F3M A;  4FQU A;  1THX A;  3EVI A;  5C00 A;  3HY2 A;  1I9D A;  1YF1 A;  1HNA A;  4ZL9 A;  2FY6 A;  2GSQ A;  3ZLP A;  2VCX A;  4A5P A;  3IK7 A;  3MYD A;  5EY6 A;  3A5I A;  1JLW A;  3R3E A;  1NSW A;  1XW5 A;  3A2V A;  4MZC A;  2LV3 A;  3ZVJ D;  3F63 A;  5J4U A;  2I4A A;  3H1N A;  2R0C A;  2B5Y A;  5IPG A;  2XPD A;  4MJA A;  1XZO A;  2XBQ A;  1TI1 A;  4K5R A;  2LQQ A;  2V1M A;  4HEA 2;  1LU4 A;  4E8E A;  1XCC A;  2YWM A;  3ERG A;  3IE3 A;  4LLR A;  3KMN A;  10GS A;  1YEX A;  1OAZ A;  2E2G A;  3UL3 A;  2VOC A;  3HZ8 A;  3ME8 A;  3CBU A;  4IW9 A;  3F8U A;  3KZQ A;  4EDY A;  5EPF A;  4PUR A;  1XIY A;  5HFI A;  3VPQ A;  3TRQ A;  1YY7 A;  2PPT A;  2AHE A;  1C72 A;  4FYC A;  2K6V A;  4LMW A;  2EIR A;  3TUE A;  2IN3 A;  1XWG A;  1T7P B;  1MD3 A;  2LJR A;  4XTS A;  4IP6 A;  3C71 A;  3F4T A;  3F3R A;  3DGQ A;  3IV4 A;  5HR2 A;  1SJ6 A;  3FZA A;  4J56 E;  2YPM A;  5F06 A;  3QDN A;  1EOG A;  3ZRE A;  4AF2 A;  1CQH A;  2JZT A;  1X9W B;  1V98 A;  3APO A;  3KP8 A;  2OBI A;  3KEB A;  5JWQ B;  3TKP A;  4O92 A;  4K9Z A;  4IEL A;  4NPB A;  4I97 A;  5JCU A;  3I69 A;  2MBT A;  3GHA A;  4QQ7 A;  2OAC A;  1TOF A;  1SJI A;  3DKS A;  1WP0 A;  3SWL A;  5IO2 A;  3TOU A;  4IQJ M;  4EL1 A;  4IQ1 A;  3FKF A;  4LMV A;  4CDO A;  4K7O A;  4V2N A;  6GSW A;  4PGT A;  2OE1 A;  5JCG A;  2VL3 A;  4KND A;  3H79 A;  4KE3 A;  3QMX A;  4YQM A;  1XWA A;  5G31 A;  2DMM A;  1A0R P;  2M80 A;  2R6K A;  5CP1 A;  3ZVJ A;  1UA5 A;  3G7Y A;  1K0O A;  2H73 A;  5HR0 A;  3E3E A;  2VUP A;  2XPE A;  1ZL9 A;  2QKE A;  2X8C A;  1MDI A;  3FHK A;  2HRN A;  4IP1 A;  2EIQ A;  2WZ9 A;  4NMU A;  1S3C A;  4KCA A;  5DCH A;  5H5Q A;  4IKH A;  2A2P A;  1M9B A;  5JCW A;  5INY A;  5DCG A;  1Q4J A;  3NZN A;  1KNG A;  2CX3 A;  4G0I A;  3QFA C;  1H75 A;  4PQI A;  1T3B A;  1V57 A;  4Q5Q A;  2IMI A;  2IME A;  4IGJ A;  1G0T A;  3RPN A;  5J9B A;  3EYT A;  1TRS A;  4AJ6 A;  4H86 A;  1F3B A;  2WRT A;  2CVB A;  3TKR A;  4AGS A;  4G2E A;  4GSN A;  1ZYE A;  2LKU A;  4BVY A;  5J41 A;  4K1F A;  3HJM A;  2TIR A;  1B9Y C;  3PGT A;  6GSY A;  2DLX A;  2DC5 A;  3GX8 A;  5DAK A;  2GDR A;  2HRF A;  4XS6 A;  4K0G A;  5D9W A;  3TDG A;  4WR5 A;  4IQA A;  2MBS A;  2I81 A;  6GSV A;  4G0K A;  4NV2 A;  3BD2 A;  1O8X A;  2OJL A;  1B9X C;  5ECP B;  1NW2 A;  4J2F A;  2H30 A;  1X5C A;  2PMT A;  4MP4 A;  1FW1 A;  2LNS A;  3IR4 A;  1TU8 A;  2P31 A;  4PNF A;  2FWG A;  3RDW A;  2LTK A;  2YOI A;  1GNW A;  17GS A;  1FOH A;  4IHU A;  2CQ9 A;  4F0B A;  2F51 A;  3HHV A;  1EGO A;  2R3X A;  1B8X A;  3KP9 A;  1DSB A;  2YV7 A;  2N5F A;  2VL2 A;  4OFN A;  1IYI A;  1QXH A;  2L5L A;  1A2L A;  1OC3 A;  4GF0 A;  3TCO A;  2JL4 A;  2Z9S A;  1Z7R A;  3UBL A;  2RII A;  1SL1 B;  3KXO A;  3GL3 A;  3UMA A;  5HR1 A;  3GV1 A;  4X0X A;  1ML6 A;  7GSS A;  2D28 C;  1K0C A;  3WT2 A;  3D5J A;  1M7T A;  4XS4 A;  1WPI A;  4BWS A;  2YZH A;  3LSZ A;  4G9H A;  2K9F A;  2OE3 A;  2RM5 A;  3KH9 A;  2CV4 A;  5HQP A;  2JZS A;  4ZBA A;  4HDE A;  5IMZ A;  1H4O A;  3WGD A;  3GKK A;  1J9B A;  1PL2 A;  2OA7 A;  4ILF A;  2C0F A;  3FR3 A;  2L5O A;  4ZL7 A;  4YQV A;  2O8V B;  1EP8 A;  4XIH A;  3APS A;  5ID2 A;  2AJQ B;  4JBB A;  3KTB A;  4KCE A;  5GST A;  2PUK C;  3QOU A;  1A2M A;  5KN0 A;  2C0D A;  5J5N A;  1XBS A;  5H5R A;  1ABA A;  3ED3 A;  4RQX A;  1VF1 A;  4N0V A;  3US3 A;  3VI7 A;  1GUM A;  2B5E A;  1GSE A;  3D4M A;  3AY8 A;  2IJY A;  3CYN A;  2H6Y A;  1TRW A;  1XWC A;  2HZE A;  1GTU A;  3C1R A;  2LJA A;  3QCP A;  5CO3 A;  5AGY A;  4F0C A;  3F0I A;  4MA9 A;  5B6N A;  5EL8 A;  2A2R A;  5DQS A;  4L5L A;  5ENU A;  4TR3 A;  5AIS A;  4EIP A;  3LW9 A;  4GXZ A;  4HJ2 A;  3A2X A;  4K8M A;  2ZCT A;  3HJP A;  2H70 A;  3CTF A;  2R5G A;  1TRV A;  3IXR A;  4ZXG A;  2FD3 A;  1ZYN A;  1HD2 A;  1FOV A;  4Q5R A;  2HNL A;  4POB A;  3RPP A;  3NIV A;  1WOU A;  4JRR A;  1OKT A;  1G7E A;  2L57 A;  2VM2 A;  5DAL B;  2HSM A;  3HKR A;  3LEF A;  3N9J A;  5ECO B;  5KN1 A;  4MH2 A;  5DVB A;  4LA1 A;  3MAK A;  3ZL5 A;  1YKA A;  5DBQ A;  2H19 A;  4POL A;  3GSS A;  4EF0 A;  2DJ3 A;  3Q6O A;  1AQW A;  2LS5 A;  1USB A;  1GTA A;  2GVP A;  4MPF A;  4XHM A;  1MDJ A;  1AAZ A;  2H1G A;  4KH7 A;  1GLP A;  3I6A A;  4MF7 A;  4JE1 A;  5F07 A;  2DJJ A;  4IJI A;  3UVH A;  4TXO B;  1JZW A;  1JZD A;  4NV5 A;  2B3S A;  1GTI A;  3A5W A;  1CQG A;  5A4V A;  2PWJ A;  3ZIT A;  3S9F A;  2GSR A;  3VWX A;  4JZQ A;  2N5A A;  3C73 A;  2EIO A;  2K8V A;  2HXK A;  1M9A A;  2H6Z A;  1HNC A;  1A0F A;  2JSZ A;  5ECL B;  5CRH A;  1K0B A;  1J08 A;  4OFM A;  1AQV A;  3R2Q A;  5DAK B;  4USS A;  2GT5 A;  2HT9 A;  3TJJ A;  2VCW A;  5A4W A;  1G7O A;  2V41 A;  3UEM A;  3KIJ A;  1M0U A;  3UOM A;  4Q5F A;  1EP7 A;  18GS A;  3GUR A;  1OC9 A;  2GS3 A;  5F0G A;  2WUL A;  3H8Q A;  1W4V A;  4KB3 A;  2YWO A;  3L0H A;  2IIY A;  4D73 A;  2GZY A;  1AW9 A;  4HZ4 A;  1BED A;  4GSS A;  3L9V A;  1TK8 B;  1GSS A;  2H1A A;  4Z2U A;  4CY6 A;  1IYH A;  1PL1 A;  4MF5 A;  2RUF A;  3HVS A;  1TJD A;  2B7J A;  3EUR A;  1BX9 A;  3BOA A;  1ZYP A;  2BTO T;  1PGT A;  2VD0 A;  1EV9 A;  6GST A;  2J23 A;  2KLX A;  2KP1 A;  4K0N A;  4ZB9 A;  1TTZ A;  1PN9 A;  2DIZ A;  4ACS A;  3TJG A;  4F82 A;  4TR4 A;  3ZML A;  4OO4 A;  4WET A;  2QGV A;  1TKD B;  4G19 A;  19GS A;  5ECH B;  4X1U A;  2IMF A;  2X8H A;  1V40 A;  3DRN A;  2ZNM A;  2WFC A;  3GTU A;  2NVL A;  2LQO A;  3UVT A;  1SYX A;  1R5A A;  4V2M A;  4MPG A;  2O85 A;  4ZB6 A;  2O87 A;  3M3M A;  4AJ8 A;  3J7Y b;  4TXV A;  2DJ1 A;  3CSJ A;  3P8W A;  3GNJ A;  1JLV A;  1TK5 B;  1B4P A;  4K5S A;  4FH8 A;  3HCZ A;  3DXB A;  5DDL A;  1TK0 B;  5B6M A;  2B5X A;  1DE1 A;  2H1D A;  1MTC A;  1E2Y A;  1BAY A;  2WS2 A;  3TRX A;  2HZE B;  2R37 A;  4OFT A;  3VWV A;  1XVW A;  4OO5 A;  3F4S A;  2YNX A;  1FAA A;  3KD0 A;  5D9T A;  2JAC A;  3VWU A;  16GS A;  2ON7 A;  5A4U A;  4HS1 A;  2KUC A;  4IBP A;  5GAP D;  4MLY A;  4BL7 A;  4TR1 B;  4IVF A;  3EU4 A;  2YWN A;  2FCH A;  4I2U A;  4YAP A;  2WCI A;  5KN2 A;  3IDV A;  3ME7 A;  5AIV A;  4V1A p;  2YN1 A;  1VRS D;  1DUG A;  4GRF A;  5KOX A;  3IBH A;  1X9M B;  2UZ8 A;  2MMA A;  5IMC A;  3TB2 A;  1SYR A;  4TVE A;  5IMA A;  3ZTL A;  1PA3 A;  3IRA A;  4HQS A;  3GN3 A;  4DSS A;  4BPY A;  1O85 A;  2H76 A;  2F8A A;  1OE7 A;  1RW1 A;  3M0F A;  3C8E A;  3TGZ A;  3GH9 A;  1V9W A;  2A2S A;  1A23 A;  1WRY A;  4ZBB A;  2IFQ B;  4XRA A;  2C80 A;  2H66 A;  4KSO A;  3DML A;  1GL8 A;  2XHF A;  1O73 A;  1M2D A;  2MMZ A;  3W8J A;  4L0W A;  3UAR A;  1QMV A;  3FZ9 A;  4ZBD A;  3WD6 A;  2O7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...