3F4SA

Crystal structure of wolbachia pipientis alpha-dsba1 t172v
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
199
structure length
199
Chain Sequence
TSNELLLPLPNDKLLGDPKAPILMIEYASLTCYHCSLFHRNVFPKIKEKYIDTGKMLYIFRHFPLDYRGLKAAMLSHCYEKQEDYFNFNKAVFNSIDSWNYYNLSDLTLLQRIAALSNLKQDAFNQCINDKKIMDKIVNDKSLAINKLGITAVPIFFIKLNDDKSYIEHNKVKHGGYKELKYFTNVIDKLYGKAIVKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of the Oxidoreductase alpha-DsbA1 from Wolbachia pipientis
pubmed doi rcsb
source organism Wolbachia pipientis
molecule tags Oxidoreductase
molecule keywords Putative uncharacterized protein
total genus 74
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2008-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.80 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Ribonucleotide Reductase Protein R1; domain 1 3f4sA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3f4sA01
3M0FA 3LQ7A 3HXSA 1T8EB 4KE3A 3FR6A 2XBQA 4XS4A 1SYRA 1K0MA 4ACSA 2L4QA 2PBJA 3H4KA 1T4YA 2HI7A 3IE3A 4ZB6A 3UJ1A 5JCUA 3CYNA 3IOSA 3DVWA 5J41A 4TXVA 2HLSA 2JSYA 1HD2A 1WMJA 1PA3A 3MDKA 1UVZA 5IM9A 3WT1A 4L5OA 5GAPD 2GVPA 2PUKC 3WGEA 1YZXA 3GKKA 1UC7A 1O7UA 3GL3A 1UN2A 3RHCA 2LV3A 3P2AA 1XVWA 3FY7A 3CRTA 2G0FA 2J23A 4MF5A 1EGOA 3K8NA 1MDKA 2MMNA 3OR5A 3LGCA 4JU5A 3HCZA 2VAFA 3GHAA 1XBSA 2HSYA 5GSSA 1OVNA 4MMMA 3GX0A 4ULXA 4YAVA 4ZL8A 3TOUA 2HZEB 2LKUA 3O6TA 4XRDA 1OAZA 4I2UA 4MF6A 2MBTA 1GTUA 5JWQB 1M9BA 2H1DA 4MPFA 4KCAA 2YJ7A 4OMVA 3WGDA 2F8AA 1B48A 4Z7XA 2JU5A 6GSYA 2H74A 2LJAA 1PQNA 4K0NA 5AIVA 1WWJA 1UA5A 1XZOA 3NZNA 2H76A 2WFCA 4POMA 1QMVA 4I5QA 1EEMA 3GKMA 4POKA 5J5NA 2GZZA 4RQXA 1U87A 4TKYA 3GTUB 1JHBA 1K3LA 4N0ZA 1F37A 4MK3A 2LUSA 1XOAA 1ZZYA 1H4OA 4GLTA 3S9FA 1Z3EA 2KHPA 3TKQA 3PINA 2A4VA 20GSA 4X1UA 3LG6A 3E0UA 3SBCA 3C7MA 4AJ6A 2GSRA 5DCGA 4MPGA 5J3RA 2C0GA 1K0CA 2C3NA 3F3RA 5A5KA 3FRCA 3FZ9A 4PNFA 2JZSA 1LBKA 3BCKA 2AYTA 1A0FA 4X43A 5EPFA 2TRCP 4MABA 1W89A 1ML6A 4WBJA 3A2VA 1K3OA 1FG4A 1XOBA 1GWCA 3F3QA 1DBYA 3DGQA 2CVDA 4KA0A 3O76A 4ILFA 4BVYA 5CAXA 4BA7A 2B5YA 3HJPA 3LORA 1A2JA 3EYTA 4JBBA 5AISA 3W8SA 1PX7A 1U6TA 1TOFA 4NV5A 3F8UA 3VPTA 1IYIA 4JR4A 5IMAA 2FD3A 1XW9A 2H0HA 3TJKA 2YCDA 3F4RA 1QFNA 3ZREA 3LSZA 3HY2A 1ZYQB 1X5EA 2P5RA 4LL1B 4PQ1A 1HQOA 4TR4A 1BQ7A 1MD3A 1OYJA 3TJFA 3L0HA 2JSZA 2YJHA 1F3BA 3IK9A 4D73A 1J9BA 1F2EA 3HHVA 10GSA 2IMKA 2M72A 1SKWB 2OACA 2HYXA 2EC4A 1OKTA 4MLYA 3GYKA 2H6XA 2GZYA 2N5AA 2AUVA 4ZIJA 4TN8A 2B1LA 2CZ2A 1R7HA 2XPEA 1RQMA 1YKAA 4IW9A 2H1BA 3ZFLA 2R3XA 4KAEA 2IIYA 1SJIA 2CVBA 1TKDB 2YANA 1GUKA 2H66A 4TXOA 2OADA 4ML6A 3CBUA 4BL7A 3DVXA 4DVCA 4J56E 3BD2A 2WZ9A 1PRXA 4MZWA 3H93A 6GSXA 2CX3A 4KB3A 4KSOA 1M0UA 4HJ2A 1TI1A 3ERWA 4OWYA 1ILOA 3FK8A 5CNWA 3GNJA 4HS1A 5CP1A 1EOHA 1V2AA 6GSWA 1TXXA 1GNEA 2B6MA 3TOTA 3KIJA 2V6KA 2K18A 4IP1A 4I97A 4XS4B 2ALBA 1Z7PA 3LJRA 3D21A 1GTIA 2DJJA 3HZ4A 2C0FA 5ABRA 4F2IA 4XCSA 1Y25A 2DSAA 3EU4A 3V1WA 4G9HA 2ZCTA 3DEXA 2O87A 3FKFA 4GRFA 3VWVA 1YDKA 1BX9A 4PQIA 4PXOA 2CT6A 3C71A 14GSA 5CRGA 3FR9A 5IPHA 2GTUA 2O8VB 3VPQA 1XVQA 1VF1A 3GKXA 5JCGA 3KJYA 2TRXA 2C0EA 1GP1A 4EL1A 3EWLA 1SJZA 2DJ3A 2VCXA 2HSHA 3FR3A 1HNAA 2PVOC 4N11A 4RI6A 3E3EA 4EO3A 2DJ1A 4HZ2A 4Q5QA 3KEBA 16GSA 2DMMA 2VLTA 2YP6A 1WRYA 1PKWA 5G1LA 2IMEA 1AQVA 2MYGA 5GZZB 3IK7A 4YQVA 4ZILA 1ABAA 1HYUA 3CTGA 1AIUA 4TR3A 2R2JA 2L5LA 1THXA 3DYRA 1Z9HA 22GSA 4E8HA 4EXJA 4YAPA 5CRHA 3APSA 5EVOA 3UIWA 3L9SA 4JZQA 3MAKA 4YH2A 3VWXA 1X9WB 4JRRA 3TRQA 3KXOA 1V9WA 1ZYEA 4TXOB 1GUMA 1YEPA 3C8EA 3Q19A 5F05A 1GLPA 2K9FA 4TVEA 1OE8A 1QUWA 3DKSA 1GUHA 1ERTA 1M2DA 1DE1A 1N2AA 2CV4A 1QK8A 2IMFA 2VOCA 5ECIB 3DWVA 1GH2A 2H1GA 2O7KA 3VLNA 3P8WA 2FWGA 2IMDA 5DCHA 5G5FA 2IJYA 4PNGA 2GS3A 3QMXA 1URMA 5DDLA 2RM6A 2V41A 1USBA 1SYXA 4GSSA 3CSIA 3KMOA 3M9KA 2LTKA 2JACA 1WPIA 5ELAA 3DRNA 2F3MA 3AY8A 3LXZA 2H6YA 3GRXA 2LS5A 3QPMA 6GSSA 2QKEA 3C1SA 3DMLA 3ZL5A 1TU8A 2OBKA 4MH3A 4JE1A 1SL1B 2LJKA 2FHEA 2RM5A 4EVMA 2AHEA 4ZBDA 2KLXA 2QSIA 4IJIA 3TDGA 1VGLA 5L71A 3H1NA 1PMTA 2IMIA 1GNWA 4L8EA 3HDCA 5CRDA 1M2BA 2R4VA 4NHWA 4DEJA 4HEA2 3LXTA 1GSDA 4ZBAA 5F06A 1JZRA 3O3TA 2OKAA 3F4TA 2I4AA 2F9SA 1OC9B 3MNGA 5DVBA 3WYWA 5HR3A 2X8CA 4IVFA 2VM2A 4ML1A 1M2AA 4MJBA 1AUCA 3P7XA 1AQWA 3GH6A 5G1KA 4CDOA 2DLXA 3W8JA 4RI7A 4GTUA 4NXIA 4OFMA 3IBHA 4QL9A 1A8YA 1NHOA 4GF0A 4BPYA 4EUYA 2V6OA 1JLVA 1U3AA 5CRWA 3QFAC 2GSQA 2XC2A 4OD7A 3ME7A 1FB0A 3KMNA 1E6BA 4WF4A 3EINA 4PX1A 1WJKA 2ES7A 13GSA 3IPZA 4NAXA 3PH9A 2OJLA 2KP1A 4OFTA 2E7PA 1K0DA 3CSHA 3DD3A 2FA4A 4IKHA 3HJMA 3LYKA 3PGTA 1GRXA 1YEXA 1YJ6A 3TKRA 5J9BA 4FYCA 1T4ZA 1B8XA 4IJ3A 4MZBA 3TJBA 3L78A 3VI5A 5HFGA 5DALB 1SK1A 5DQYA 5KN1A 3VWUA 1K0OA 1VF3A 3VWWA 1OC8A 1AQXA 1B4PA 1FHEA 1Z7RA 3A2WA 2HRFA 7GSSA 3CTFA 2RLIA 2L4CA 5G2ZA 2YPMA 2FCHA 4MCUA 1TW9A 1BJXA 2B7JA 1A0RP 3CMIA 2MZCA 1EV4A 1AAZA 2YWOA 4L0WA 4OO5A 2OA7A 3LFLA 1BEDA 4OCEA 5LNKe 5DJMA 1SD9A 2XPDA 3QR6A 2VO4A 2KUCA 2GQLA 1GL8A 3F63A 3RDWA 2IL3A 5DALA 3CSJA 1SK0A 1Z6MA 3KP9A 4RUVA 4WR5A 4HUAA 2TIRA 3LWAA 5KN0A 4ZB8A 5J9CA 2I9HA 1TP9A 3IAS2 3KH7A 1XCCA 2E0QA 1THOA 2PMTA 4KX4A 2CZ3A 3KTBA 2DJKA 1TK8B 4K1FA 2HRNA 5DAKA 3GUSA 2LQOA 2CQ9A 1A2LA 2Z9SA 2PVQA 1XPVA 4AF2A 4EC0A 5ECRB 4E8EA 3TKSC 1T3BA 1XWKA 5AN1A 2CX4A 4JEDA 4DSSB 1DE2A 1ACVA 2CVKA 3HVSA 4NWYA 1HNCA 2VIMA 2JZRA 1QQ2A 1F6MC 1W4VA 4X0XA 5ECQB 1TI3A 4CHSA 4WETA 1ERWA 1T00A 2NBSA 2VUPA 2OBIA 2HXKA 2OE1A 3QDNA 4YQMA 2EIOA 5CO3A 3MSZA 2AJQB 5ECKB 2NTOA 2AAWA 3BCIA 3KTLA 2WCIA 4G10A 3W6GA 1XFLA 5DBQA 3M3MA 4MA9A 1ON4A 4QQ7A 5D73A 3UBLA 5IO2A 5A4VA 4PUAA 5IO0A 2JZTA 3FYGA 1KEBA 4K7OA 2JADA 2H8LA 4K7NA 1VRSD 4ECBA 3RBTA 3QOUA 3HD5A 1B4QA 2GLRA 1SD8A 2GGTA 4HZ4A 2C1YA 1EV9A 3VK9A 5ELGA 2YNXA 3I69A 2H6ZA 2WULA 2VL2A 1KTEA 1F3AA 3J7Yk 3ZMKA 4V2MA 3QAGA 1JZDA 4MJCA 4KCEA 1WIKA 5G5EA 3UAPA 1ZMAA 5G31A 5IQYA 4N0VA 1X0RA 3FHKA 5IMDA 2VL2C 3Q74A 3UVHA 2H73A 3HYPA 3HZ8A 5EY6A 4FIWA 3ZLPA 1SKSB 1XW5A 2I1UA 2GSSA 4FO5A 2DIZA 2PERA 3A5WA 2LNSA 1V98A 3F6FA 3I9V2 1V40A 4N10A 1ERVA 2P31A 3IAM2 2PGTA 2ON7A 2I81A 1X9SB 1XIYA 3RHBA 2L59A 1SL0B 4K2DA 3Q6OA 1TK0B 1Y6EA 4YQUA 3ZYWA 4DSSA 4AJ7A 1JZOA 2YWIA 5IMVA 5ECMB 1FAAA 4HQSA 5KN3A 1K0BA 1JZWA 1TRSA 4G19A 3ZVJA 1RW1A 2MMAA 19GSA 3L9UA 2FGXA 3HVXA 4F82A 5KEJA 1JLWA 2FLSA 2CAIA 3RPNA 2B5XA 2DMLA 2HZEA 3TB2A 3CXGA 2BMXA 1K3YA 2OE0A 1A23A 1ST9A 4EF0A 1TRVA 4TOPA 5HR2A 3JCML 1RK4A 2YWNA 5ENUA 3APQA 4O92A 4NPBA 2DJ2A 3EMXA 4IBPA 2RIIA 2M46A 4AGSA 2QGVA 5D9XA 2ZNMA 1QGVA 4MDCA 1X5DA 3ISOA 1GSQA 1CQHA 4KDUA 4IQAA 4K8MA 5FT3A 1FVJA 3UVTA 3UL3A 2YZUA 1DUGA 4J2FA 4V1Ap 5ECPB 5C00A 5F8BA 2FWFA 1JFUA 4POLA 2B1KA 1A24A 4L5LA 5HFKA 1TRWA 3ERGA 4GSNA 1NW2A 5JWRB 1EP8A 2VCQA 3RPPA 3EE2A 1PD21 4IQ1A 4LLRA 2C0DA 1VF4A 5B7CA 4MF7A 3IC4A 2RUEA 3TCOA 1Z6NA 1LU4A 2D2ZA 4NV2A 2PWJA 5HR1A 3HKRA 5D9WA 4K6XA 4P3YB 3ZRDA 2C80A 3UMAA 4BWSA 5IOXA 3GMFA 3TRPA 4NHZA 1SL2B 1YF1A 3F6DA 3IDVA 2VCWA 2VL3A 3Q18A 1MDIA 3DIEA 4XHMA 3D22A 1SK2A 3HA9A 5H5RA 1O85A 5COHA 1ZOFA 2GQMA 2VM1A 4V2LA 4RQRA 4KGIA 3GN3A 1OE7A 2L6DA 1XW6A 2E2GA 1FW1A 2XHFA 5G30A 5ECNB 1WP0A 2LEGA 1M9AA 4PURA 4WR4A 3D4TA 3ZIVA 1TTZA 3BBYA 5DQSA 4WXTA 4EE0A 2ON5A 5D96A 2DJ0A 4DSQA 2O89A 1EP7A 2A2RA 2WJUA 3H79A 1DSBA 1IYHA 3WT2A 3DXBA 1LJRA 2HT9A 1M7TA 4DSRA 4TR1A 1Q98A 2L6CA 4G2EA 5A4UA 3ZTLA 5JWOB 1O8WA 2LRNA 4OO4A 5E59A 4I6XA 5IOWA 1F9MA 3CRUA 4JR6A 4MZCA 3FZAA 1O8XA 4XS1A 3ZFBA 3FW2A 1V58A 3D4MA 2ZUPA 2H01A 2VD0A 2YN1A 2J9HA 1EOGA 2LQQA 3R2QA 3LEFA 5FHIA 2WB9A 4ZL9A 3M1GA 2F51A 4TR0A 4Q5NA 5IMCA 2KOKA 4GWRA 2IFQA 2IN3A 5B8BA 2G2QA 2LJRA 2V32A 4TR1B 5LCZA 3IV4A 5ID2A 5D8IA 2YOIA 2GQKA 2GT6A 1R5AA 1GSYA 1J0FA 2PPTA 4IHUA 2N5FA 5ECLB 4O7HA 2H0GA 2C8UA 3TGZA 2LRTA 4XIHA 2NPBA 1XWCA 3UBKA 4POBA 5ECSA 1ZGNA 3F9UA 5H5SA 5D93A 2O85A 3G7JA 3C73A 2K8VA 2FY6A 3NIVA 3TJJA 4KDYA 1TU7A 4IELA 2RUFA 3IXRA 3M8NA 3EU3A 2NDOA 3I43A 2VCTA 2PU9C 2M80A 6GSTA 1TK5B 4HDEA 4F9ZA 1BG5A 5C04A 1PL2A 3G9BA 3APOA 2MMZA 4HU9A 1AXDA 1G6WA 4EKZA 3IR4A 1WE0A 2R37A 5D9VA 1G7OA 1ZL9A 2VL9A 1MDJA 1A8LA 1C72A 4LMVA 3TJGA 4F0CA 5B8AA 4XRAA 3IRAA 2HNLA 1WOUA 4CW9A 1PX6A 5F07A 5F0GA 1O6JA 5AGYA 1YF0A 2C3QA 1I9DA 3EVIA 1GTBA 3F4SA 2VLVA 1MTCA 1HNBA 1V57A 1G6YA 1CQGA 3WD6A 4NMUA 2V1MA 5FWGA 5IIZA 4V2NA 1K0NA 2K6VA 4GXZA 4ZXGA 1FO5A 4ECIA 1VF2A 1U88A 3N9JA 6GSVA 2PN8A 1GULA 4ZBBA 2F8FA 4XTSA 4OCFA 5IPGA 4GCIA 3EURA 1O81A 4D73B 1FOVA 1BAYA 4EDYA 2HE3A 2WRTA 2AV4A 4KW6A 3KZQA 3D6IA 2H30A 1Z5YE 1SJ6A 2H72A 2CAQA 3U5RE 3QFBC 1G7EA 1EGRA 3TKPA 2WGRA 5CYYA 3GV1A 3RAZA 2H70A 1FVKA 2FWHA 3A2XA 3QAVA 5DJLA 4AJ8A 3UEMA 4ZL7A 1SENA 4IP6A 4HQZA 1YQ1A 5ID2B 5D9TA 2IWTA 4FYUA 3BOAA 4WF5A 3EC3A 2H1AA 3D0ZA 5ECOB 3ME8A 2C4JA 2X64A 1GTAA 2GSTA 3GSTA 11GSA 3FZ4A 4ISDA 2K8SA 1T7PB 1SKRB 5CREA 3F0IA 4PQHA 5LD0A 1G0TA 1OKDA 4WEYA 4GQCA 3GIXA 4ECCA 4J57E 3EMPA 3M9JA 1R4WA 2H75A 1PGTA 2V2GA 2HFDA 1I5GA 3L9VA 2OE3A 2FNOA 2P5QA 2B7KA 1OC9A 3HVVA 2HZFA 1EEJA 2DIYA 1TDIA 3QD9A 1PL1A 1XXUA 1S3CA 3GURA 2WDUA 5HQPA 1M99A 1GSEA 3US3A 1B9YC 4I8BA 4H86A 3PR8A 1EWXA 5INYA 6GSUA 2VCVA 3KP8A 4TW5A 2LRCA 3IA1A 2N5BA 3N5OA 2GDRA 3J7Yb 3GH9A 3ZVJD 1GSSA 3GSSA 4Q5RA 1GLQA 2R5GA 3ZZXA 4OFNA 1FB6A 4TRXA 3C1RA 3L4NA 3G7IA 1TJDA 3VFIA 2VD1A 3H8QA 3IHQA 3KH9A 9GSSA 12GSA 3NOFA 4PUFC 1PN9A 4IS0A 2CA8A 2L5OA 4WKWA 4HOJA 4FYBA 4HI7A 4ZB9A 3TUEA 3GTUA 17GSA 1S3AA 3HJOA 2B5EA 1PKZA 2EIRA 4L0UA 5H5QA 4BVXA 5HR0A 1XWBA 4KSMA 3GKNA 4LL4B 4F03A 2YZHA 2BTOT 3ZITA 4FH8A 5B6NA 4MP4A 3D5JA 1YY7A 3TRXA 2QC7A 3P90A 4F0BA 4IGJA 3U6VA 1BYEA 2R6KA 2LNTA 5HFIA 4O5RA 3GA4A 2A2SA 2YV7A 2IPAA 2H0IA 2L57A 1U3IA 2MBSA 3UARA 5EL8A 4ID0A 3ZMLA 5E4WA 2E2MA 3G7YA 1XWGA 1E2YA 4KUNA 2WS2A 4GQFA 3BJ5A 4I2TA 1J08A 5DAKB 2XBIA 3QCPA 3LYPA 2GT5A 4XS6A 5ECHB 3FEUA 1KNGA 3TKSE 4O32A 5J4UA 4V1Ag 2B3SA 4GSTA 5GAND 8GSSA 1S3DA 4MJAA 1K0AA 1PSQA 1N8JA 2DBCA 1ERUA 2REMA 1X9MB 4K0GA 2YWMA 2P0GA 5IMFA 1A2MA 5AIXA 2MMOA 1EZKA 4KDXA 1MEKA 5JCWA 1GSFA 4IN0A 4N30A 1YKCA 1B9XC 3UOMA 4K7IA 4MH2A 4WBRD 3MWHA 1X5CA 3ZIJA 2H19A 1R5PA 3ED3A 2FUG2 1KBNA 1NHYA 4HU7A 3GX8A 2H71A 4MJEA 3KCMA 4KH7A 4EDZA 3A3TA 4ECJA 1T1VA 1ZCPA 2C3TA 5B6MA 5GSTA 5KN2A 4BWQA 2FWEA 2X8GA 1R26A 3GL5A 1TRUA 2I3YA 5A4WA 2IFQB 2VCZA 2LSTA 3VI7A 3QAWA 5IMZA 2AB6A 3ERFA 18GSA 4LA1A 1H75A 2NVLA 2X8HA 3KM6A 2KP2A 2JL4A 3SWLA 1AC1A 3I6AA 2X99A 4K9ZA 2FA8A 4HJMA 2BJXA 3VURA 3KGKA 2DC5A 1XWAA 3GFKA 4QL7A 1SU9A 4KNDA 3FZ5A 3E9JB 1Q4JA 4LMWA 1MD4A 2GZPA 3TKSA 3KD0A 1AW9A 2EIQA 3WGXA 1GSUA 1NSWA 4Q5FA 1NM3A 2YV9A 1OC3A 2VLUA 1O73A 4PGTA 1QXHA
chains in the Genus database with same CATH superfamily
3M0FA 3LQ7A 3HXSA 1T8EB 4KE3A 3FR6A 2XBQA 4XS4A 1SYRA 1K0MA 3EPTA 2L4QA 4ACSA 2PBJA 3H4KA 3CI0K 1T4YA 2HI7A 3IE3A 4ZB6A 3UJ1A 5JCUA 3CYNA 3IOSA 3DVWA 5J41A 4TXVA 2HLSA 2JSYA 2QA2A 1HD2A 1WMJA 1PA3A 3MDKA 1UVZA 5IM9A 3WT1A 4L5OA 5GAPD 2GVPA 2PUKC 3WGEA 1YZXA 3GKKA 1UC7A 1O7UA 3GL3A 1UN2A 3RHCA 2LV3A 3P2AA 1XVWA 3FY7A 3CRTA 2G0FA 2J23A 4MF5A 1EGOA 3K8NA 1MDKA 2MMNA 3OR5A 3LGCA 4JU5A 3HCZA 2VAFA 3GHAA 1XBSA 2HSYA 5GSSA 3C8TA 5D6BA 1M3JA 1OVNA 4MMMA 3GX0A 2FUSA 4ULXA 4YAVA 4ZL8A 3TOUA 2HZEB 2LKUA 3O6TA 4XRDA 1OAZA 4I2UA 4MF6A 2MBTA 1GTUA 1JSWA 5JWQB 1M9BA 2H1DA 4MPFA 4KCAA 2YJ7A 4OMVA 3WGDA 2F8AA 1B48A 4Z7XA 2JU5A 6GSYA 2H74A 2LJAA 1PQNA 4K0NA 5AIVA 1WWJA 5F92A 1UA5A 1XZOA 3NZNA 2H76A 2WFCA 4POMA 1Z4LA 1QMVA 4I5QA 1EEMA 3GKMA 4POKA 5J5NA 2GZZA 4RQXA 1U87A 4TKYA 3GTUB 1JHBA 1K3LA 2JAUA 4N0ZA 1F37A 4MK3A 2LUSA 1XOAA 1ZZYA 1H4OA 4GLTA 3S9FA 1Z3EA 2KHPA 3TKQA 3PINA 2A4VA 20GSA 4NSLA 4X1UA 3GZHA 3LG6A 3E0UA 3SBCA 3OCEA 3C7MA 4AJ6A 2GSRA 5DCGA 4MPGA 5J3RA 2C0GA 2JAWA 1K0CA 2C3NA 3F3RA 5A5KA 3FRCA 3FZ9A 4PNFA 2JZSA 3IC8A 1LBKA 3BCKA 2AYTA 4Z2UA 1A0FA 4X43A 5EPFA 2TRCP 4MABA 1W89A 1ML6A 4WBJA 3A2VA 1FOHA 1K3OA 1FG4A 1XOBA 1GWCA 3F3QA 1DBYA 3DGQA 2CVDA 4KA0A 3O76A 4ILFA 4BVYA 5CAXA 3TV2A 3RD8A 4BA7A 2B5YA 3HJPA 3LORA 1A2JA 3EYTA 4JBBA 5AISA 3W8SA 1PX7A 1FUPA 1U6TA 1TOFA 4NV5A 3F8UA 3VPTA 1IYIA 4JR4A 5IMAA 1TJUA 2FD3A 1XW9A 2H0HA 3TJKA 2YCDA 5F91A 3F4RA 1QFNA 1IW7D 3ZREA 3LSZA 3HY2A 1ZYQB 1X5EA 2P5RA 4LL1B 4PQ1A 1HQOA 4TR4A 1BQ7A 1MD3A 1OYJA 3TJFA 3L0HA 2JSZA 2YJHA 3R6QA 1F3BA 3IK9A 4D73A 1J9BA 1F2EA 5KOXA 3HHVA 10GSA 4Z2TA 2IMKA 2M72A 1SKWB 2OACA 2HYXA 2EC4A 1OKTA 4MLYA 3PPUA 3GYKA 2H6XA 2GZYA 4APBA 2N5AA 2AUVA 4ZIJA 4TN8A 2B1LA 2CZ2A 1R7HA 2XPEA 1RQMA 5BRTA 1YKAA 4IQJM 4IW9A 1M3IA 2H1BA 3ZFLA 2R3XA 4KAEA 2IIYA 1SJIA 2CVBA 1TKDB 3BWVA 2HVGA 2YANA 1GUKA 2H66A 4TXOA 2OADA 4ML6A 3CBUA 2DKIA 4BL7A 3DVXA 4DVCA 4J56E 1T9HA 3BD2A 2WZ9A 1PRXA 4MZWA 3H93A 1XWOA 6GSXA 2CX3A 4KB3A 4KSOA 1M0UA 1U15A 4HJ2A 1TI1A 3ERWA 4OWYA 1ILOA 3FK8A 5CNWA 1K62A 3GNJA 4HS1A 5CP1A 1EOHA 4YKFA 1V2AA 6GSWA 1TXXA 1GNEA 2B6MA 4MWOA 3TOTA 3KIJA 2V6KA 2K18A 4IP1A 4I97A 4XS4B 2ALBA 1Z7PA 3LJRA 3D21A 1GTIA 2DJJA 3HZ4A 2C0FA 5ABRA 4F2IA 4XCSA 1Y25A 2DSAA 3EU4A 3V1WA 4G9HA 2ZCTA 3DEXA 2O87A 3FKFA 4GRFA 3VWVA 1YDKA 1TJ7A 1C3CA 1BX9A 4PQIA 4PXOA 2CT6A 3RRPA 3C71A 14GSA 5CRGA 3FR9A 5IPHA 2GTUA 2O8VB 3VPQA 1XVQA 1Z4IA 1VF1A 3GKXA 2QA1A 2R0GA 5JCGA 3KJYA 2TRXA 2C0EA 1GP1A 4EL1A 3EWLA 1SJZA 2DJ3A 2VCXA 2HSHA 3U13A 3U19A 3FR3A 1HNAA 2PVOC 4N11A 4RI6A 3E3EA 4EO3A 2DJ1A 4HZ2A 4Q5QA 3KEBA 16GSA 2DMMA 2VLTA 2YP6A 1WRYA 1PKWA 1TJVA 5G1LA 2IMEA 1AQVA 4EIPA 2MYGA 5GZZB 3IK7A 4YQVA 4ZILA 1ABAA 1HYUA 3CTGA 4Z2RA 1AIUA 4TR3A 2R2JA 2L5LA 1THXA 3DYRA 1Z9HA 22GSA 4E8HA 4EXJA 4YAPA 5CRHA 1ZYNA 3APSA 5EVOA 3UIWA 3L9SA 4JZQA 3MAKA 4YH2A 3VWXA 1X9WB 4JRRA 3TRQA 3KXOA 1V9WA 4TXOB 1ZYEA 1GUMA 1YEPA 3C8EA 3Q19A 5F05A 4BL7B 1GLPA 2K9FA 4TVEA 1OE8A 1QUWA 3DKSA 1GUHA 1ERTA 1M2DA 1DE1A 1N2AA 2CV4A 1QK8A 2IMFA 2VOCA 5ECIB 3DWVA 1GH2A 2H1GA 2O7KA 3VLNA 3P8WA 2FWGA 2IMDA 5DCHA 5G5FA 2IJYA 4PNGA 2GS3A 3QMXA 1URMA 5DDLA 2RM6A 3MIXA 2V41A 1USBA 1SYXA 4GSSA 3CSIA 4EIQA 1VDKA 1Z4QA 3KMOA 3M9KA 2LTKA 2JACA 1WPIA 5ELAA 3DRNA 2F3MA 3AY8A 4ADMA 3LXZA 2H6YA 3GRXA 2LS5A 3QPMA 6GSSA 2QKEA 3HVNA 4L6AA 3C1SA 3DMLA 3ZL5A 1TU8A 2OBKA 4MH3A 4G0IA 4JE1A 1SL1B 2LJKA 2FHEA 2RM5A 4EVMA 2AHEA 4ZBDA 2KLXA 2QSIA 4IJIA 3TDGA 1VGLA 5L71A 3H1NA 1PMTA 2IMIA 1GNWA 4L8EA 3HDCA 5CRDA 3NO9A 1M2BA 2R4VA 4NHWA 4DEJA 4HEA2 3LXTA 1GSDA 4ZBAA 5F06A 1JZRA 3O3TA 2OKAA 3F4TA 2I4AA 2F9SA 1OC9B 3MNGA 5DVBA 3WYWA 5HR3A 4BIKA 2X8CA 4IVFA 2VM2A 4ML1A 1M2AA 4MJBA 1AUCA 3P7XA 1AQWA 3GH6A 5G1KA 4CDOA 2DLXA 3W8JA 4RI7A 4GTUA 4NXIA 4OFMA 3IBHA 4QL9A 1A8YA 1NHOA 4GF0A 4BPYA 4EUYA 2V6OA 1JLVA 1U3AA 5CRWA 3QFAC 2GSQA 2XC2A 1KQ7A 3ME7A 4OD7A 1FB0A 3KMNA 1E6BA 4WF4A 3EINA 4PX1A 1WJKA 2ES7A 13GSA 3IPZA 4NAXA 3PH9A 2OJLA 2KP1A 4OFTA 2E7PA 1K0DA 3CSHA 3DD3A 2FA4A 4IKHA 3HJMA 3LYKA 3PGTA 1GRXA 1YEXA 1YJ6A 3TKRA 5J9BA 4FYCA 4K2XA 1T4ZA 1B8XA 4IJ3A 4MZBA 3TJBA 3L78A 3VI5A 5HFGA 5DALB 1SK1A 1RE5A 5DQYA 5KN1A 3VWUA 1K0OA 1VF3A 3VWWA 1OC8A 4HSCX 1AQXA 4USSA 1B4PA 1FHEA 1Z7RA 3A2WA 2HRFA 7GSSA 3CTFA 2E9FA 2RLIA 2L4CA 5G2ZA 3LW9A 2YPMA 2FCHA 4MCUA 1TW9A 1BJXA 4BVXB 2B7JA 1A0RP 3CMIA 2MZCA 3GTDA 1EV4A 1AAZA 1K7WA 2YWOA 4L0WA 4OO5A 4NFLA 2OA7A 3LFLA 1BEDA 4OCEA 5LNKe 5DJMA 1SD9A 2XPDA 3MYDA 3QR6A 2VO4A 2KUCA 2GQLA 1GL8A 3F63A 3RDWA 2IL3A 5DALA 3CSJA 1SK0A 1Z6MA 3KP9A 4RUVA 1TJWA 4WR5A 4HUAA 2TIRA 1DCNA 3LWAA 5KN0A 4ZB8A 5J9CA 2I9HA 1TP9A 3IAS2 3KH7A 1XCCA 2E0QA 1THOA 2PMTA 4KX4A 1FUOA 2CZ3A 3KTBA 2DJKA 1TK8B 4K1FA 4L57A 2HRNA 5DAKA 3GUSA 2LQOA 4YKGA 2CQ9A 1A2LA 2Z9SA 2PVQA 1XPVA 4AF2A 4EC0A 5ECRB 4E8EA 3TKSC 1T3BA 1XWKA 5AN1A 2CX4A 4JEDA 4DSSB 1DE2A 1ACVA 2CVKA 3HVSA 4NWYA 4MUMA 1HNCA 2VIMA 2JZRA 1QQ2A 1F6MC 1W4VA 4X0XA 5ECQB 1TI3A 4CHSA 4WETA 1ERWA 1T00A 1Q92A 2NBSA 2VUPA 2OBIA 2HXKA 2OE1A 3QDNA 4YQMA 2EIOA 5CO3A 3MSZA 1YFMA 2AJQB 5ECKB 2NTOA 2AAWA 3BCIA 3KTLA 2WCIA 4G10A 1XFLA 2UZ8A 3W6GA 5DBQA 3M3MA 4MA9A 1ON4A 4QQ7A 5D73A 3UBLA 5IO2A 5A4VA 4PUAA 5IO0A 2JZTA 3FYGA 1KEBA 4K7OA 2JADA 2H8LA 4K7NA 1VRSD 2D28C 2R0PA 4ECBA 3RBTA 3QOUA 3HD5A 1B4QA 2GLRA 1SD8A 2GGTA 4K5RA 4HZ4A 2C1YA 4EFCA 1U16A 1EV9A 3VK9A 5ELGA 2YNXA 3I69A 2H6ZA 2WULA 2VL2A 1KTEA 2JAOA 1F3AA 3J7Yk 1Q91A 3ZMKA 4V2MA 4A5PA 4L6CA 3QAGA 1JZDA 4MJCA 4KCEA 1WIKA 5G5EA 3UAPA 1ZMAA 5G31A 5IQYA 4N0VA 1X0RA 3FHKA 5IMDA 2VL2C 2PTSA 3Q74A 3UVHA 2H73A 3HYPA 3HZ8A 5EY6A 4FIWA 3ZLPA 1SKSB 1XW5A 2I1UA 2GSSA 4FO5A 2DIZA 2PERA 3A5WA 2LNSA 1V98A 3F6FA 3I9V2 1V40A 4N10A 1ERVA 5KOWA 2P31A 3IAM2 2PGTA 2ON7A 4G0KA 2I81A 1X9SB 1XIYA 3RHBA 2L59A 1SL0B 4K2DA 3Q6OA 1TK0B 1Y6EA 4YQUA 3ZYWA 4DSSA 4AJ7A 1YFEA 1JZOA 2YWIA 5IMVA 5ECMB 1FAAA 2HRKA 4HQSA 5KN3A 1K0BA 1JZWA 1TRSA 4G19A 3ZVJA 1RW1A 2MMAA 19GSA 3L9UA 2FGXA 3HVXA 2HSMA 4F82A 5KEJA 1JLWA 2FLSA 2CAIA 3RPNA 2B5XA 2DMLA 2HZEA 4YIHA 3TB2A 4O5QA 3CXGA 2X4AA 2BMXA 1K3YA 2OE0A 1A23A 3A5IA 1ST9A 4EF0A 1TRVA 4TOPA 5HR2A 3JCML 1RK4A 2DKHA 2YWNA 5ENUA 3APQA 4O92A 4NPBA 2DJ2A 3EMXA 4IBPA 2RIIA 2M46A 4AGSA 2QGVA 5D9XA 2ZNMA 1QGVA 4MDCA 1X5DA 3ISOA 1GSQA 1CQHA 4KDUA 4IQAA 4K8MA 5FT3A 1FVJA 3UVTA 4MNNA 3UL3A 2YZUA 1DUGA 4J2FA 4G0LA 4V1Ap 5ECPB 5C00A 5F8BA 2FWFA 1JFUA 4POLA 2B1KA 1A24A 4L5LA 5HFKA 1Z4JA 1TRWA 3ERGA 4GSNA 1NW2A 5JWRB 1EP8A 2VCQA 3RPPA 3EE2A 1PD21 4IQ1A 4LLRA 2C0DA 1VF4A 5B7CA 4MF7A 3IC4A 2RUEA 3TCOA 1Z6NA 1LU4A 2D2ZA 4NV2A 2PWJA 1HY0A 2X49A 5HR1A 3BHGA 4KF9A 3HKRA 5D9WA 1S3RA 2A4HA 4K6XA 4P3YB 3ZRDA 2C80A 3UMAA 4BWSA 5IOXA 3GMFA 4NHZA 3TRPA 1SL2B 1YF1A 3F6DA 3IDVA 2VCWA 2VL3A 3Q18A 3DIEA 2PTRA 1MDIA 4XHMA 3D22A 1SK2A 3OCFA 3HA9A 5H5RA 1O85A 5COHA 1ZOFA 2GQMA 2VM1A 4V2LA 4RQRA 4KGIA 3GN3A 1OE7A 2L6DA 4CY6A 1XW6A 4APAA 2E2GA 1FW1A 2XHFA 5G30A 5ECNB 1WP0A 2LEGA 1M9AA 4PURA 4WR4A 3R6VA 3D4TA 3ZIVA 1TTZA 3BBYA 5DQSA 4WXTA 4EE0A 2ON5A 5D96A 2DJ0A 4DSQA 2O89A 4EEIA 1FURA 1EP7A 2A2RA 2WJUA 3H79A 1DSBA 1IYHA 3WT2A 3DXBA 1LJRA 2HT9A 1M7TA 4DSRA 4TR1A 1Q98A 2L6CA 4G2EA 5A4UA 3ZTLA 5JWOB 1O8WA 2LRNA 4OO4A 1J3UA 5E59A 4I6XA 5IOWA 1F9MA 3CRUA 4JR6A 4MZCA 3FZAA 1O8XA 4XS1A 3ZFBA 3FW2A 1V58A 3D4MA 2ZUPA 2H01A 2D27A 2VD0A 2YN1A 2J9HA 1EOGA 2LQQA 3R2QA 3LEFA 4X4JA 5FHIA 2WB9A 4ZL9A 3M1GA 2F51A 4TR0A 1Q5NA 4Q5NA 5IMCA 2KOKA 4GWRA 2IFQA 2IN3A 1PFOA 5B8BA 2G2QA 2LJRA 2V32A 4TR1B 5LCZA 3IV4A 5ID2A 5D8IA 2YOIA 2GQKA 2GT6A 1R5AA 1GSYA 1J0FA 1U0LA 2PPTA 4IHUA 2N5FA 5ECLB 4O7HA 2H0GA 2C8UA 3TGZA 2LRTA 4XIHA 2NPBA 1XWCA 3UBKA 4POBA 5ECSA 1ZGNA 3F9UA 5H5SA 5D93A 4K5SA 2O85A 3G7JA 3C73A 2K8VA 2FY6A 3NIVA 3TJJA 4KDYA 1TU7A 4IELA 2RUFA 1Z4KA 3IXRA 3M8NA 3EU3A 2NDOA 3I43A 2VCTA 2PU9C 2M80A 1MH9A 6GSTA 1TK5B 4HDEA 4F9ZA 2JARA 1BG5A 5HW2A 5C04A 1PL2A 3G9BA 3APOA 2MMZA 4HU9A 1AXDA 1G6WA 4EKZA 3IR4A 1WE0A 4FQUA 2R37A 5D9VA 1G7OA 5BMUA 1ZL9A 2VL9A 1MDJA 1A8LA 1C72A 4LMVA 3TJGA 4F0CA 5B8AA 4XRAA 3IRAA 2HNLA 1WOUA 4CW9A 1PX6A 5F07A 5F0GA 1O6JA 5AGYA 1YF0A 2C3QA 1I9DA 3EVIA 1GTBA 3F4SA 2VLVA 1MTCA 4PTSA 1HNBA 1V57A 2YV5A 1G6YA 1CQGA 3WD6A 4NMUA 1AUWA 2V1MA 5FWGA 5IIZA 4V2NA 1K0NA 2K6VA 4GXZA 4ZXGA 1FO5A 4ECIA 1VF2A 1U88A 3N9JA 6GSVA 2PN8A 4YIKA 1GULA 4ZBBA 2F8FA 4XTSA 4OCFA 5IPGA 4GCIA 3EURA 1O81A 4D73B 1FOVA 1BAYA 4EDYA 2HE3A 2WRTA 2AV4A 4KW6A 3KZQA 3CQFA 3R3EA 3D6IA 2H30A 1Z5YE 1SJ6A 2H72A 2CAQA 3U5RE 3QFBC 1G7EA 1EGRA 3TKPA 2WGRA 5CYYA 3GV1A 3RAZA 2H70A 1FVKA 2FWHA 3A2XA 3QAVA 5DJLA 4AJ8A 1DOFA 3UEMA 4ZL7A 1SENA 4IP6A 2I7DA 4HQZA 1YQ1A 5ID2B 3FMWA 5D9TA 2IWTA 4FYUA 3BOAA 4WF5A 3EC3A 2H1AA 3D0ZA 5ECOB 3ME8A 2C4JA 2X64A 1GTAA 2R0CA 2GSTA 1C3UA 2PTQA 3GSTA 11GSA 3FZ4A 4ISDA 2K8SA 2QGAB 1T7PB 1SKRB 5CREA 1I0AA 3F0IA 4PQHA 5LD0A 1G0TA 1OKDA 4WEYA 4GQCA 3QBPA 3GIXA 4ECCA 1Z4MA 4J57E 3EMPA 3M9JA 1R4WA 2H75A 1PGTA 2V2GA 2HFDA 1I5GA 3L9VA 2OE3A 2FNOA 2P5QA 2B7KA 1OC9A 3HVVA 2HZFA 1EEJA 2DIYA 1TDIA 3QD9A 1PL1A 1XXUA 1S3CA 3GURA 2WDUA 5HQPA 1M99A 1GSEA 3US3A 1B9YC 4I8BA 4H86A 3PR8A 1EWXA 5INYA 6GSUA 2VCVA 3KP8A 4TW5A 2LRCA 3IA1A 2N5BA 3N5OA 2GDRA 3J7Yb 3GH9A 3ZVJD 1GSSA 3GSSA 4Q5RA 1GLQA 2R5GA 4O5UA 3ZZXA 4OFNA 1FB6A 4TRXA 3C1RA 1XG8A 3L4NA 3G7IA 1TJDA 3VFIA 2VD1A 3H8QA 3IHQA 3KH9A 9GSSA 12GSA 3NOFA 4PUFC 1PN9A 4IS0A 2CA8A 2L5OA 4WKWA 4HOJA 4FYBA 4HI7A 4ZB9A 3TUEA 4MX2A 17GSA 3GTUA 1S3AA 3HJOA 2B5EA 1PKZA 2RCNA 2EIRA 4L0UA 5H5QA 4BVXA 5HR0A 4ICYA 1XWBA 4KSMA 3GKNA 4LL4B 4F03A 2YZHA 2BTOT 3ZITA 4FH8A 5B6NA 2HRAA 4MP4A 3D5JA 1YY7A 3TRXA 2QC7A 3P90A 4F0BA 4IGJA 3U6VA 1FUQA 1BYEA 2R6KA 2LNTA 5HFIA 4O5RA 3GA4A 2A2SA 2YV7A 2IPAA 2H0IA 2L57A 1U3IA 2MBSA 3UARA 5EL8A 4ID0A 3ZMLA 5E4WA 2E2MA 3G7YA 1XWGA 1E2YA 4KUNA 2WS2A 4GQFA 3BJ5A 4I2TA 4BVYB 1J08A 5DAKB 2XBIA 3QCPA 3LYPA 2GT5A 4XS6A 5ECHB 3FEUA 1KNGA 3TKSE 4O32A 5J4UA 4V1Ag 2B3SA 4GSTA 2X75A 5GAND 8GSSA 1S3DA 4MJAA 1K0AA 1PSQA 1N8JA 2DBCA 1ERUA 1PN0A 2REMA 1X9MB 4E88A 4K0GA 2YWMA 2P0GA 5IMFA 1A2MA 5AIXA 2MMOA 1EZKA 4KDXA 1Z4PX 1MEKA 1HY1A 1GSFA 5JCWA 4IN0A 4N30A 4ADLA 1YKCA 1B9XC 3UOMA 4K7IA 4MH2A 4WBRD 3MWHA 1X5CA 3ZIJA 2H19A 1R5PA 3ED3A 2FUG2 1KBNA 4HGVA 1NHYA 3IHGA 4HU7A 3E04A 3GX8A 1ZYPA 2H71A 4MJEA 4CY8A 3KCMA 4KH7A 4EDZA 3A3TA 4ECJA 1T1VA 1ZCPA 2C3TA 5B6MA 5GSTA 5KN2A 4BWQA 2FWEA 2X8GA 1R26A 3GL5A 1TRUA 2I3YA 5A4WA 2IFQB 2VCZA 2LSTA 3VI7A 3QAWA 5IMZA 2AB6A 3ERFA 18GSA 4LA1A 1H75A 2NVLA 2X8HA 3KM6A 2KP2A 2JL4A 3SWLA 1AC1A 2PFMA 3I6AA 2X99A 4K9ZA 2FA8A 4HJMA 2BJXA 3VURA 3KGKA 2DC5A 1XWAA 3GFKA 4QL7A 1SU9A 4KNDA 3FZ5A 3E9JB 1Q4JA 4LMWA 1MD4A 2GZPA 3TKSA 3KD0A 1AW9A 2EIQA 3WGXA 1GSUA 1NSWA 4Q5FA 1NM3A 4NLEA 2A2PA 2YV9A 1OC3A 2VLUA 1O73A 4PGTA 1QXHA
chains in the Genus database with same CATH topology
3M0FA 3LQ7A 3HXSA 1T8EB 4KE3A 3FR6A 2XBQA 4XS4A 1SYRA 1K0MA 3EPTA 2L4QA 4ACSA 2PBJA 3H4KA 1T4YA 2HI7A 3IE3A 4ZB6A 3UJ1A 5JCUA 3CYNA 3IOSA 3DVWA 5J41A 4TXVA 2HLSA 2JSYA 2QA2A 1HD2A 1WMJA 1PA3A 3MDKA 1UVZA 5IM9A 3WT1A 4L5OA 5GAPD 2GVPA 2PUKC 3WGEA 1YZXA 3GKKA 1UC7A 1O7UA 3GL3A 1UN2A 3RHCA 2LV3A 3P2AA 1XVWA 3FY7A 3CRTA 2G0FA 2J23A 4MF5A 1EGOA 3K8NA 1MDKA 2MMNA 3OR5A 3LGCA 4JU5A 3HCZA 2VAFA 3GHAA 1XBSA 2HSYA 5GSSA 1OVNA 4MMMA 3GX0A 4ULXA 4YAVA 4ZL8A 3TOUA 2HZEB 2LKUA 3O6TA 4XRDA 1OAZA 4I2UA 4MF6A 2MBTA 1GTUA 5JWQB 1M9BA 2H1DA 4MPFA 4KCAA 2YJ7A 4OMVA 3WGDA 2F8AA 1B48A 4Z7XA 2JU5A 6GSYA 2H74A 2LJAA 1PQNA 4K0NA 5AIVA 1WWJA 1UA5A 1XZOA 3NZNA 2H76A 2WFCA 4POMA 1QMVA 4I5QA 1EEMA 3GKMA 4POKA 5J5NA 2GZZA 4RQXA 1U87A 4TKYA 3GTUB 1JHBA 1K3LA 4N0ZA 1F37A 4MK3A 2LUSA 1XOAA 1ZZYA 1H4OA 4GLTA 3S9FA 1Z3EA 2KHPA 3TKQA 3PINA 2A4VA 20GSA 4X1UA 3LG6A 3E0UA 3SBCA 3C7MA 4AJ6A 2GSRA 5DCGA 4MPGA 5J3RA 2C0GA 1K0CA 2C3NA 3F3RA 5A5KA 3FRCA 3FZ9A 4PNFA 2JZSA 3IC8A 1LBKA 3BCKA 2AYTA 4Z2UA 1A0FA 4X43A 5EPFA 2TRCP 4MABA 1W89A 1ML6A 4WBJA 3A2VA 1FOHA 1K3OA 1FG4A 1XOBA 1GWCA 3F3QA 1DBYA 3DGQA 2CVDA 4KA0A 3O76A 4ILFA 4BVYA 5CAXA 4BA7A 2B5YA 3HJPA 3LORA 1A2JA 3EYTA 4JBBA 5AISA 3W8SA 1PX7A 1U6TA 1TOFA 4NV5A 3F8UA 3VPTA 1IYIA 4JR4A 5IMAA 2FD3A 1XW9A 2H0HA 3TJKA 2YCDA 3F4RA 1QFNA 1IW7D 3ZREA 3LSZA 3HY2A 1ZYQB 1X5EA 2P5RA 4LL1B 4PQ1A 1HQOA 4TR4A 1BQ7A 1MD3A 1OYJA 3TJFA 3L0HA 2JSZA 2YJHA 1F3BA 3IK9A 4D73A 1J9BA 1F2EA 5KOXA 3HHVA 10GSA 4Z2TA 2IMKA 2M72A 1SKWB 2OACA 2HYXA 2EC4A 1OKTA 4MLYA 3PPUA 3GYKA 2H6XA 2GZYA 2N5AA 2AUVA 4ZIJA 4TN8A 2B1LA 2CZ2A 1R7HA 2XPEA 1RQMA 5BRTA 1YKAA 4IQJM 4IW9A 2H1BA 3ZFLA 2R3XA 4KAEA 2IIYA 1SJIA 2CVBA 1TKDB 2YANA 1GUKA 2H66A 4TXOA 2OADA 4ML6A 3CBUA 2DKIA 4BL7A 3DVXA 4DVCA 4J56E 3BD2A 2WZ9A 1PRXA 4MZWA 3H93A 6GSXA 2CX3A 4KB3A 4KSOA 1M0UA 4HJ2A 1TI1A 3ERWA 4OWYA 1ILOA 3FK8A 5CNWA 3GNJA 4HS1A 5CP1A 1EOHA 4YKFA 1V2AA 6GSWA 1TXXA 1GNEA 2B6MA 3TOTA 3KIJA 2V6KA 2K18A 4IP1A 4I97A 4XS4B 2ALBA 1Z7PA 3LJRA 3D21A 1GTIA 2DJJA 3HZ4A 2C0FA 5ABRA 4F2IA 4XCSA 1Y25A 2DSAA 3EU4A 3V1WA 4G9HA 2ZCTA 3DEXA 2O87A 3FKFA 4GRFA 3VWVA 1YDKA 1BX9A 4PQIA 4PXOA 2CT6A 3C71A 14GSA 5CRGA 3FR9A 5IPHA 2GTUA 2O8VB 3VPQA 1XVQA 1VF1A 3GKXA 2QA1A 2R0GA 5JCGA 3KJYA 2TRXA 2C0EA 1GP1A 4EL1A 3EWLA 1SJZA 2DJ3A 2VCXA 2HSHA 3FR3A 1HNAA 2PVOC 4N11A 4RI6A 3E3EA 4EO3A 2DJ1A 4HZ2A 4Q5QA 3KEBA 16GSA 2DMMA 2VLTA 2YP6A 1WRYA 1PKWA 5G1LA 2IMEA 1AQVA 4EIPA 2MYGA 5GZZB 3IK7A 4YQVA 4ZILA 1ABAA 1HYUA 3CTGA 4Z2RA 1AIUA 4TR3A 2R2JA 2L5LA 1THXA 3DYRA 1Z9HA 22GSA 4E8HA 4EXJA 4YAPA 5CRHA 1ZYNA 3APSA 5EVOA 3UIWA 3L9SA 4JZQA 3MAKA 4YH2A 3VWXA 1X9WB 4JRRA 3TRQA 3KXOA 1V9WA 1ZYEA 4TXOB 1GUMA 1YEPA 3C8EA 3Q19A 5F05A 4BL7B 1GLPA 2K9FA 4TVEA 1OE8A 1QUWA 3DKSA 1GUHA 1ERTA 1M2DA 1DE1A 1N2AA 2CV4A 1QK8A 2IMFA 2VOCA 5ECIB 3DWVA 1GH2A 2H1GA 2O7KA 3VLNA 3P8WA 2FWGA 2IMDA 5DCHA 5G5FA 2IJYA 4PNGA 2GS3A 3QMXA 1URMA 5DDLA 2RM6A 3MIXA 2V41A 1USBA 1SYXA 4GSSA 3CSIA 4EIQA 3KMOA 3M9KA 2LTKA 2JACA 1WPIA 5ELAA 3DRNA 2F3MA 3AY8A 3LXZA 2H6YA 3GRXA 2LS5A 3QPMA 6GSSA 2QKEA 3C1SA 3DMLA 3ZL5A 1TU8A 2OBKA 4MH3A 4G0IA 4JE1A 1SL1B 2LJKA 2FHEA 2RM5A 4EVMA 2AHEA 4ZBDA 2KLXA 2QSIA 4IJIA 3TDGA 1VGLA 5L71A 3H1NA 1PMTA 2IMIA 1GNWA 4L8EA 3HDCA 5CRDA 1M2BA 2R4VA 4NHWA 4DEJA 4HEA2 3LXTA 1GSDA 4ZBAA 5F06A 1JZRA 3O3TA 2OKAA 3F4TA 2I4AA 2F9SA 1OC9B 3MNGA 5DVBA 3WYWA 5HR3A 2X8CA 4IVFA 2VM2A 4ML1A 1M2AA 4MJBA 1AUCA 3P7XA 1AQWA 3GH6A 5G1KA 4CDOA 2DLXA 3W8JA 4RI7A 4GTUA 4NXIA 4OFMA 3IBHA 4QL9A 1A8YA 1NHOA 4GF0A 4BPYA 4EUYA 2V6OA 1JLVA 1U3AA 5CRWA 3QFAC 2GSQA 2XC2A 4OD7A 3ME7A 1FB0A 3KMNA 1E6BA 4WF4A 3EINA 4PX1A 1WJKA 2ES7A 13GSA 3IPZA 4NAXA 3PH9A 2OJLA 2KP1A 4OFTA 2E7PA 1K0DA 3CSHA 3DD3A 2FA4A 4IKHA 3HJMA 3LYKA 3PGTA 1GRXA 1YEXA 1YJ6A 3TKRA 5J9BA 4FYCA 4K2XA 1T4ZA 1B8XA 4IJ3A 4MZBA 3TJBA 3L78A 3VI5A 5HFGA 5DALB 1SK1A 5DQYA 5KN1A 3VWUA 1K0OA 1VF3A 3VWWA 1OC8A 1AQXA 4USSA 1B4PA 1FHEA 1Z7RA 3A2WA 2HRFA 7GSSA 3CTFA 2RLIA 2L4CA 5G2ZA 3LW9A 2YPMA 2FCHA 4MCUA 1TW9A 1BJXA 4BVXB 2B7JA 1A0RP 3CMIA 2MZCA 1EV4A 1AAZA 2YWOA 4L0WA 4OO5A 2OA7A 3LFLA 1BEDA 4OCEA 5LNKe 5DJMA 1SD9A 2XPDA 3MYDA 3QR6A 2VO4A 2KUCA 2GQLA 1GL8A 3F63A 3RDWA 2IL3A 5DALA 3CSJA 1SK0A 1Z6MA 3KP9A 4RUVA 4WR5A 4HUAA 2TIRA 3LWAA 5KN0A 4ZB8A 5J9CA 2I9HA 1TP9A 3IAS2 3KH7A 1XCCA 2E0QA 1THOA 2PMTA 4KX4A 2CZ3A 3KTBA 2DJKA 1TK8B 4K1FA 2HRNA 5DAKA 3GUSA 2LQOA 4YKGA 2CQ9A 1A2LA 2Z9SA 2PVQA 1XPVA 4AF2A 4EC0A 5ECRB 4E8EA 3TKSC 1T3BA 1XWKA 5AN1A 2CX4A 4JEDA 4DSSB 1DE2A 1ACVA 2CVKA 3HVSA 4NWYA 1HNCA 2VIMA 2JZRA 1QQ2A 1F6MC 1W4VA 4X0XA 5ECQB 1TI3A 4CHSA 4WETA 1ERWA 1T00A 2NBSA 2VUPA 2OBIA 2HXKA 2OE1A 3QDNA 4YQMA 2EIOA 5CO3A 3MSZA 2AJQB 5ECKB 2NTOA 2AAWA 3BCIA 3KTLA 2WCIA 4G10A 1XFLA 2UZ8A 3W6GA 5DBQA 3M3MA 4MA9A 1ON4A 4QQ7A 5D73A 3UBLA 5IO2A 5A4VA 4PUAA 5IO0A 2JZTA 3FYGA 1KEBA 4K7OA 2JADA 2H8LA 4K7NA 1VRSD 2D28C 2R0PA 4ECBA 3RBTA 3QOUA 3HD5A 1B4QA 2GLRA 1SD8A 2GGTA 4K5RA 4HZ4A 2C1YA 1EV9A 3VK9A 5ELGA 2YNXA 3I69A 2H6ZA 2WULA 2VL2A 1KTEA 1F3AA 3J7Yk 3ZMKA 4V2MA 4A5PA 3QAGA 1JZDA 4MJCA 4KCEA 1WIKA 5G5EA 3UAPA 1ZMAA 5G31A 5IQYA 4N0VA 1X0RA 3FHKA 5IMDA 2VL2C 3Q74A 3UVHA 2H73A 3HYPA 3HZ8A 5EY6A 4FIWA 3ZLPA 1SKSB 1XW5A 2I1UA 2GSSA 4FO5A 2DIZA 2PERA 3A5WA 2LNSA 1V98A 3F6FA 3I9V2 1V40A 4N10A 1ERVA 5KOWA 2P31A 3IAM2 2PGTA 2ON7A 4G0KA 2I81A 1X9SB 1XIYA 3RHBA 2L59A 1SL0B 4K2DA 3Q6OA 1TK0B 1Y6EA 4YQUA 3ZYWA 4DSSA 4AJ7A 1JZOA 2YWIA 5IMVA 5ECMB 1FAAA 2HRKA 4HQSA 5KN3A 1K0BA 1JZWA 1TRSA 4G19A 3ZVJA 1RW1A 2MMAA 19GSA 3L9UA 2FGXA 3HVXA 2HSMA 4F82A 5KEJA 1JLWA 2FLSA 2CAIA 3RPNA 2B5XA 2DMLA 2HZEA 3TB2A 4O5QA 3CXGA 2X4AA 2BMXA 1K3YA 2OE0A 1A23A 3A5IA 1ST9A 4EF0A 1TRVA 4TOPA 5HR2A 3JCML 1RK4A 2DKHA 2YWNA 5ENUA 3APQA 4O92A 4NPBA 2DJ2A 3EMXA 4IBPA 2RIIA 2M46A 4AGSA 2QGVA 5D9XA 2ZNMA 1QGVA 4MDCA 1X5DA 3ISOA 1GSQA 1CQHA 4KDUA 4IQAA 4K8MA 5FT3A 1FVJA 3UVTA 4MNNA 3UL3A 2YZUA 1DUGA 4J2FA 4G0LA 4V1Ap 5ECPB 5C00A 5F8BA 2FWFA 1JFUA 4POLA 2B1KA 1A24A 4L5LA 5HFKA 1TRWA 3ERGA 4GSNA 1NW2A 5JWRB 1EP8A 2VCQA 3RPPA 3EE2A 1PD21 4IQ1A 4LLRA 2C0DA 1VF4A 5B7CA 4MF7A 3IC4A 2RUEA 3TCOA 1Z6NA 1LU4A 2D2ZA 4NV2A 2PWJA 2X49A 5HR1A 4KF9A 3HKRA 5D9WA 2A4HA 4K6XA 4P3YB 3ZRDA 2C80A 3UMAA 4BWSA 5IOXA 3GMFA 3TRPA 4NHZA 1SL2B 1YF1A 3F6DA 3IDVA 2VCWA 2VL3A 3Q18A 1MDIA 3DIEA 4XHMA 3D22A 1SK2A 3HA9A 5H5RA 1O85A 5COHA 1ZOFA 2GQMA 2VM1A 4V2LA 4RQRA 4KGIA 3GN3A 1OE7A 2L6DA 4CY6A 1XW6A 2E2GA 5G30A 1FW1A 2XHFA 5ECNB 1WP0A 2LEGA 1M9AA 4PURA 4WR4A 3D4TA 3ZIVA 1TTZA 3BBYA 5DQSA 4WXTA 4EE0A 2ON5A 5D96A 2DJ0A 4DSQA 2O89A 1EP7A 2A2RA 2WJUA 3H79A 1DSBA 1IYHA 3WT2A 3DXBA 1LJRA 2HT9A 1M7TA 4DSRA 4TR1A 1Q98A 2L6CA 4G2EA 5A4UA 3ZTLA 5JWOB 1O8WA 2LRNA 4OO4A 5E59A 4I6XA 5IOWA 1F9MA 3CRUA 4JR6A 4MZCA 3FZAA 1O8XA 4XS1A 3ZFBA 3FW2A 1V58A 3D4MA 2ZUPA 2H01A 2D27A 2VD0A 2YN1A 2J9HA 1EOGA 2LQQA 3R2QA 3LEFA 4X4JA 5FHIA 2WB9A 4ZL9A 3M1GA 2F51A 4TR0A 4Q5NA 5IMCA 2KOKA 4GWRA 2IFQA 2IN3A 5B8BA 2G2QA 2LJRA 2V32A 4TR1B 5LCZA 3IV4A 5ID2A 5D8IA 2YOIA 2GQKA 2GT6A 1R5AA 1GSYA 1J0FA 2PPTA 4IHUA 2N5FA 5ECLB 4O7HA 2H0GA 2C8UA 3TGZA 2LRTA 4XIHA 2NPBA 1XWCA 3UBKA 4POBA 5ECSA 1ZGNA 3F9UA 5H5SA 5D93A 4K5SA 2O85A 3G7JA 3C73A 2K8VA 2FY6A 3NIVA 3TJJA 4KDYA 1TU7A 4IELA 2RUFA 3IXRA 3M8NA 3EU3A 2NDOA 3I43A 2VCTA 2PU9C 2M80A 6GSTA 1TK5B 4HDEA 4F9ZA 1BG5A 5C04A 1PL2A 3G9BA 3APOA 2MMZA 4HU9A 1AXDA 1G6WA 4EKZA 3IR4A 1WE0A 4FQUA 2R37A 5D9VA 1G7OA 5BMUA 1ZL9A 2VL9A 1MDJA 1A8LA 1C72A 4LMVA 3TJGA 4F0CA 5B8AA 4XRAA 3IRAA 2HNLA 1WOUA 4CW9A 1PX6A 5F07A 5F0GA 1O6JA 5AGYA 1YF0A 2C3QA 1I9DA 3EVIA 1GTBA 3F4SA 2VLVA 1MTCA 4PTSA 1HNBA 1V57A 1G6YA 1CQGA 3WD6A 4NMUA 2V1MA 5FWGA 5IIZA 4V2NA 1K0NA 2K6VA 4GXZA 4ZXGA 1FO5A 4ECIA 1VF2A 1U88A 3N9JA 6GSVA 2PN8A 1GULA 4ZBBA 2F8FA 4XTSA 4OCFA 5IPGA 4GCIA 3EURA 1O81A 4D73B 1FOVA 1BAYA 4EDYA 2HE3A 2WRTA 2AV4A 4KW6A 3KZQA 3R3EA 3D6IA 2H30A 1Z5YE 1SJ6A 2H72A 2CAQA 3U5RE 3QFBC 1G7EA 1EGRA 3TKPA 2WGRA 5CYYA 3GV1A 3RAZA 2H70A 1FVKA 2FWHA 3A2XA 3QAVA 5DJLA 4AJ8A 3UEMA 4ZL7A 1SENA 4IP6A 4HQZA 1YQ1A 5ID2B 3FMWA 5D9TA 2IWTA 4FYUA 3BOAA 4WF5A 3EC3A 2H1AA 3D0ZA 5ECOB 3ME8A 2C4JA 2X64A 1GTAA 2R0CA 2GSTA 3GSTA 11GSA 3FZ4A 4ISDA 2K8SA 1T7PB 1SKRB 5CREA 3F0IA 4PQHA 5LD0A 1G0TA 1OKDA 4WEYA 4GQCA 3GIXA 4ECCA 4J57E 3EMPA 3M9JA 1R4WA 2H75A 1PGTA 2V2GA 2HFDA 1I5GA 3L9VA 2OE3A 2FNOA 2P5QA 2B7KA 1OC9A 3HVVA 2HZFA 1EEJA 2DIYA 1TDIA 3QD9A 1PL1A 1XXUA 1S3CA 3GURA 2WDUA 5HQPA 1M99A 1GSEA 3US3A 1B9YC 4I8BA 4H86A 3PR8A 1EWXA 5INYA 6GSUA 2VCVA 3KP8A 4TW5A 2LRCA 3IA1A 2N5BA 3N5OA 2GDRA 3J7Yb 3GH9A 3ZVJD 1GSSA 3GSSA 4Q5RA 1GLQA 2R5GA 4O5UA 3ZZXA 4OFNA 1FB6A 4TRXA 3C1RA 3L4NA 3G7IA 1TJDA 3VFIA 2VD1A 3H8QA 3IHQA 3KH9A 9GSSA 12GSA 3NOFA 4PUFC 1PN9A 4IS0A 2CA8A 2L5OA 4WKWA 4HOJA 4FYBA 4HI7A 4ZB9A 3TUEA 3GTUA 17GSA 1S3AA 3HJOA 2B5EA 1PKZA 2EIRA 4L0UA 5H5QA 4BVXA 5HR0A 4ICYA 1XWBA 4KSMA 3GKNA 4LL4B 4F03A 2YZHA 2BTOT 3ZITA 4FH8A 5B6NA 2HRAA 4MP4A 3D5JA 1YY7A 3TRXA 2QC7A 3P90A 4F0BA 4IGJA 3U6VA 1BYEA 2R6KA 2LNTA 5HFIA 4O5RA 3GA4A 2A2SA 2YV7A 2IPAA 2H0IA 2L57A 1U3IA 2MBSA 3UARA 5EL8A 4ID0A 3ZMLA 5E4WA 2E2MA 3G7YA 1XWGA 1E2YA 4KUNA 2WS2A 4GQFA 3BJ5A 4I2TA 4BVYB 1J08A 5DAKB 2XBIA 3QCPA 3LYPA 2GT5A 4XS6A 5ECHB 3FEUA 1KNGA 3TKSE 4O32A 5J4UA 4V1Ag 2B3SA 4GSTA 5GAND 8GSSA 1S3DA 4MJAA 1K0AA 1PSQA 1N8JA 2DBCA 1ERUA 1PN0A 2REMA 1X9MB 4K0GA 2YWMA 2P0GA 5IMFA 1A2MA 5AIXA 2MMOA 1EZKA 4KDXA 1MEKA 5JCWA 1GSFA 4IN0A 4N30A 1YKCA 1B9XC 3UOMA 4K7IA 4MH2A 4WBRD 3MWHA 1X5CA 3ZIJA 2H19A 1R5PA 3ED3A 2FUG2 1KBNA 3IHGA 1NHYA 4HU7A 3GX8A 1ZYPA 2H71A 4MJEA 4CY8A 3KCMA 4KH7A 4EDZA 3A3TA 4ECJA 1T1VA 1ZCPA 2C3TA 5B6MA 5GSTA 5KN2A 4BWQA 2FWEA 2X8GA 1R26A 3GL5A 1TRUA 2I3YA 5A4WA 2IFQB 2VCZA 2LSTA 3VI7A 3QAWA 5IMZA 2AB6A 3ERFA 18GSA 4LA1A 1H75A 2NVLA 2X8HA 3KM6A 2KP2A 2JL4A 3SWLA 1AC1A 3I6AA 2X99A 4K9ZA 2FA8A 4HJMA 2BJXA 3VURA 3KGKA 2DC5A 1XWAA 3GFKA 4QL7A 1SU9A 4KNDA 3FZ5A 3E9JB 1Q4JA 4LMWA 1MD4A 2GZPA 3TKSA 3KD0A 1AW9A 2EIQA 3WGXA 1GSUA 1NSWA 4Q5FA 1NM3A 2A2PA 2YV9A 1OC3A 2VLUA 1O73A 4PGTA 1QXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0F A;  3LQ7 A;  3HXS A;  1T8E B;  4KE3 A;  3FR6 A;  2XBQ A;  4XS4 A;  1SYR A;  1K0M A;  4ACS A;  2L4Q A;  2PBJ A;  3H4K A;  1T4Y A;  2HI7 A;  3IE3 A;  4ZB6 A;  3UJ1 A;  5JCU A;  3CYN A;  3IOS A;  3DVW A;  5J41 A;  4TXV A;  2HLS A;  2JSY A;  1HD2 A;  1WMJ A;  1PA3 A;  3MDK A;  1UVZ A;  5IM9 A;  3WT1 A;  4L5O A;  5GAP D;  2GVP A;  2PUK C;  3WGE A;  1YZX A;  3GKK A;  1UC7 A;  1O7U A;  3GL3 A;  1UN2 A;  3RHC A;  2LV3 A;  3P2A A;  1XVW A;  3FY7 A;  3CRT A;  2G0F A;  2J23 A;  4MF5 A;  1EGO A;  3K8N A;  1MDK A;  2MMN A;  3OR5 A;  3LGC A;  4JU5 A;  3HCZ A;  2VAF A;  3GHA A;  1XBS A;  2HSY A;  5GSS A;  1OVN A;  4MMM A;  3GX0 A;  4ULX A;  4YAV A;  4ZL8 A;  3TOU A;  2HZE B;  2LKU A;  3O6T A;  4XRD A;  1OAZ A;  4I2U A;  4MF6 A;  2MBT A;  1GTU A;  5JWQ B;  1M9B A;  2H1D A;  4MPF A;  4KCA A;  2YJ7 A;  4OMV A;  3WGD A;  2F8A A;  1B48 A;  4Z7X A;  2JU5 A;  6GSY A;  2H74 A;  2LJA A;  1PQN A;  4K0N A;  5AIV A;  1WWJ A;  1UA5 A;  1XZO A;  3NZN A;  2H76 A;  2WFC A;  4POM A;  1QMV A;  4I5Q A;  1EEM A;  3GKM A;  4POK A;  5J5N A;  2GZZ A;  4RQX A;  1U87 A;  4TKY A;  3GTU B;  1JHB A;  1K3L A;  4N0Z A;  1F37 A;  4MK3 A;  2LUS A;  1XOA A;  1ZZY A;  1H4O A;  4GLT A;  3S9F A;  1Z3E A;  2KHP A;  3TKQ A;  3PIN A;  2A4V A;  20GS A;  4X1U A;  3LG6 A;  3E0U A;  3SBC A;  3C7M A;  4AJ6 A;  2GSR A;  5DCG A;  4MPG A;  5J3R A;  2C0G A;  1K0C A;  2C3N A;  3F3R A;  5A5K A;  3FRC A;  3FZ9 A;  4PNF A;  2JZS A;  1LBK A;  3BCK A;  2AYT A;  1A0F A;  4X43 A;  5EPF A;  2TRC P;  4MAB A;  1W89 A;  1ML6 A;  4WBJ A;  3A2V A;  1K3O A;  1FG4 A;  1XOB A;  1GWC A;  3F3Q A;  1DBY A;  3DGQ A;  2CVD A;  4KA0 A;  3O76 A;  4ILF A;  4BVY A;  5CAX A;  4BA7 A;  2B5Y A;  3HJP A;  3LOR A;  1A2J A;  3EYT A;  4JBB A;  5AIS A;  3W8S A;  1PX7 A;  1U6T A;  1TOF A;  4NV5 A;  3F8U A;  3VPT A;  1IYI A;  4JR4 A;  5IMA A;  2FD3 A;  1XW9 A;  2H0H A;  3TJK A;  2YCD A;  3F4R A;  1QFN A;  3ZRE A;  3LSZ A;  3HY2 A;  1ZYQ B;  1X5E A;  2P5R A;  4LL1 B;  4PQ1 A;  1HQO A;  4TR4 A;  1BQ7 A;  1MD3 A;  1OYJ A;  3TJF A;  3L0H A;  2JSZ A;  2YJH A;  1F3B A;  3IK9 A;  4D73 A;  1J9B A;  1F2E A;  3HHV A;  10GS A;  2IMK A;  2M72 A;  1SKW B;  2OAC A;  2HYX A;  2EC4 A;  1OKT A;  4MLY A;  3GYK A;  2H6X A;  2GZY A;  2N5A A;  2AUV A;  4ZIJ A;  4TN8 A;  2B1L A;  2CZ2 A;  1R7H A;  2XPE A;  1RQM A;  1YKA A;  4IW9 A;  2H1B A;  3ZFL A;  2R3X A;  4KAE A;  2IIY A;  1SJI A;  2CVB A;  1TKD B;  2YAN A;  1GUK A;  2H66 A;  4TXO A;  2OAD A;  4ML6 A;  3CBU A;  4BL7 A;  3DVX A;  4DVC A;  4J56 E;  3BD2 A;  2WZ9 A;  1PRX A;  4MZW A;  3H93 A;  6GSX A;  2CX3 A;  4KB3 A;  4KSO A;  1M0U A;  4HJ2 A;  1TI1 A;  3ERW A;  4OWY A;  1ILO A;  3FK8 A;  5CNW A;  3GNJ A;  4HS1 A;  5CP1 A;  1EOH A;  1V2A A;  6GSW A;  1TXX A;  1GNE A;  2B6M A;  3TOT A;  3KIJ A;  2V6K A;  2K18 A;  4IP1 A;  4I97 A;  4XS4 B;  2ALB A;  1Z7P A;  3LJR A;  3D21 A;  1GTI A;  2DJJ A;  3HZ4 A;  2C0F A;  5ABR A;  4F2I A;  4XCS A;  1Y25 A;  2DSA A;  3EU4 A;  3V1W A;  4G9H A;  2ZCT A;  3DEX A;  2O87 A;  3FKF A;  4GRF A;  3VWV A;  1YDK A;  1BX9 A;  4PQI A;  4PXO A;  2CT6 A;  3C71 A;  14GS A;  5CRG A;  3FR9 A;  5IPH A;  2GTU A;  2O8V B;  3VPQ A;  1XVQ A;  1VF1 A;  3GKX A;  5JCG A;  3KJY A;  2TRX A;  2C0E A;  1GP1 A;  4EL1 A;  3EWL A;  1SJZ A;  2DJ3 A;  2VCX A;  2HSH A;  3FR3 A;  1HNA A;  2PVO C;  4N11 A;  4RI6 A;  3E3E A;  4EO3 A;  2DJ1 A;  4HZ2 A;  4Q5Q A;  3KEB A;  16GS A;  2DMM A;  2VLT A;  2YP6 A;  1WRY A;  1PKW A;  5G1L A;  2IME A;  1AQV A;  2MYG A;  5GZZ B;  3IK7 A;  4YQV A;  4ZIL A;  1ABA A;  1HYU A;  3CTG A;  1AIU A;  4TR3 A;  2R2J A;  2L5L A;  1THX A;  3DYR A;  1Z9H A;  22GS A;  4E8H A;  4EXJ A;  4YAP A;  5CRH A;  3APS A;  5EVO A;  3UIW A;  3L9S A;  4JZQ A;  3MAK A;  4YH2 A;  3VWX A;  1X9W B;  4JRR A;  3TRQ A;  3KXO A;  1V9W A;  1ZYE A;  4TXO B;  1GUM A;  1YEP A;  3C8E A;  3Q19 A;  5F05 A;  1GLP A;  2K9F A;  4TVE A;  1OE8 A;  1QUW A;  3DKS A;  1GUH A;  1ERT A;  1M2D A;  1DE1 A;  1N2A A;  2CV4 A;  1QK8 A;  2IMF A;  2VOC A;  5ECI B;  3DWV A;  1GH2 A;  2H1G A;  2O7K A;  3VLN A;  3P8W A;  2FWG A;  2IMD A;  5DCH A;  5G5F A;  2IJY A;  4PNG A;  2GS3 A;  3QMX A;  1URM A;  5DDL A;  2RM6 A;  2V41 A;  1USB A;  1SYX A;  4GSS A;  3CSI A;  3KMO A;  3M9K A;  2LTK A;  2JAC A;  1WPI A;  5ELA A;  3DRN A;  2F3M A;  3AY8 A;  3LXZ A;  2H6Y A;  3GRX A;  2LS5 A;  3QPM A;  6GSS A;  2QKE A;  3C1S A;  3DML A;  3ZL5 A;  1TU8 A;  2OBK A;  4MH3 A;  4JE1 A;  1SL1 B;  2LJK A;  2FHE A;  2RM5 A;  4EVM A;  2AHE A;  4ZBD A;  2KLX A;  2QSI A;  4IJI A;  3TDG A;  1VGL A;  5L71 A;  3H1N A;  1PMT A;  2IMI A;  1GNW A;  4L8E A;  3HDC A;  5CRD A;  1M2B A;  2R4V A;  4NHW A;  4DEJ A;  4HEA 2;  3LXT A;  1GSD A;  4ZBA A;  5F06 A;  1JZR A;  3O3T A;  2OKA A;  3F4T A;  2I4A A;  2F9S A;  1OC9 B;  3MNG A;  5DVB A;  3WYW A;  5HR3 A;  2X8C A;  4IVF A;  2VM2 A;  4ML1 A;  1M2A A;  4MJB A;  1AUC A;  3P7X A;  1AQW A;  3GH6 A;  5G1K A;  4CDO A;  2DLX A;  3W8J A;  4RI7 A;  4GTU A;  4NXI A;  4OFM A;  3IBH A;  4QL9 A;  1A8Y A;  1NHO A;  4GF0 A;  4BPY A;  4EUY A;  2V6O A;  1JLV A;  1U3A A;  5CRW A;  3QFA C;  2GSQ A;  2XC2 A;  4OD7 A;  3ME7 A;  1FB0 A;  3KMN A;  1E6B A;  4WF4 A;  3EIN A;  4PX1 A;  1WJK A;  2ES7 A;  13GS A;  3IPZ A;  4NAX A;  3PH9 A;  2OJL A;  2KP1 A;  4OFT A;  2E7P A;  1K0D A;  3CSH A;  3DD3 A;  2FA4 A;  4IKH A;  3HJM A;  3LYK A;  3PGT A;  1GRX A;  1YEX A;  1YJ6 A;  3TKR A;  5J9B A;  4FYC A;  1T4Z A;  1B8X A;  4IJ3 A;  4MZB A;  3TJB A;  3L78 A;  3VI5 A;  5HFG A;  5DAL B;  1SK1 A;  5DQY A;  5KN1 A;  3VWU A;  1K0O A;  1VF3 A;  3VWW A;  1OC8 A;  1AQX A;  1B4P A;  1FHE A;  1Z7R A;  3A2W A;  2HRF A;  7GSS A;  3CTF A;  2RLI A;  2L4C A;  5G2Z A;  2YPM A;  2FCH A;  4MCU A;  1TW9 A;  1BJX A;  2B7J A;  1A0R P;  3CMI A;  2MZC A;  1EV4 A;  1AAZ A;  2YWO A;  4L0W A;  4OO5 A;  2OA7 A;  3LFL A;  1BED A;  4OCE A;  5LNK e;  5DJM A;  1SD9 A;  2XPD A;  3QR6 A;  2VO4 A;  2KUC A;  2GQL A;  1GL8 A;  3F63 A;  3RDW A;  2IL3 A;  5DAL A;  3CSJ A;  1SK0 A;  1Z6M A;  3KP9 A;  4RUV A;  4WR5 A;  4HUA A;  2TIR A;  3LWA A;  5KN0 A;  4ZB8 A;  5J9C A;  2I9H A;  1TP9 A;  3IAS 2;  3KH7 A;  1XCC A;  2E0Q A;  1THO A;  2PMT A;  4KX4 A;  2CZ3 A;  3KTB A;  2DJK A;  1TK8 B;  4K1F A;  2HRN A;  5DAK A;  3GUS A;  2LQO A;  2CQ9 A;  1A2L A;  2Z9S A;  2PVQ A;  1XPV A;  4AF2 A;  4EC0 A;  5ECR B;  4E8E A;  3TKS C;  1T3B A;  1XWK A;  5AN1 A;  2CX4 A;  4JED A;  4DSS B;  1DE2 A;  1ACV A;  2CVK A;  3HVS A;  4NWY A;  1HNC A;  2VIM A;  2JZR A;  1QQ2 A;  1F6M C;  1W4V A;  4X0X A;  5ECQ B;  1TI3 A;  4CHS A;  4WET A;  1ERW A;  1T00 A;  2NBS A;  2VUP A;  2OBI A;  2HXK A;  2OE1 A;  3QDN A;  4YQM A;  2EIO A;  5CO3 A;  3MSZ A;  2AJQ B;  5ECK B;  2NTO A;  2AAW A;  3BCI A;  3KTL A;  2WCI A;  4G10 A;  3W6G A;  1XFL A;  5DBQ A;  3M3M A;  4MA9 A;  1ON4 A;  4QQ7 A;  5D73 A;  3UBL A;  5IO2 A;  5A4V A;  4PUA A;  5IO0 A;  2JZT A;  3FYG A;  1KEB A;  4K7O A;  2JAD A;  2H8L A;  4K7N A;  1VRS D;  4ECB A;  3RBT A;  3QOU A;  3HD5 A;  1B4Q A;  2GLR A;  1SD8 A;  2GGT A;  4HZ4 A;  2C1Y A;  1EV9 A;  3VK9 A;  5ELG A;  2YNX A;  3I69 A;  2H6Z A;  2WUL A;  2VL2 A;  1KTE A;  1F3A A;  3J7Y k;  3ZMK A;  4V2M A;  3QAG A;  1JZD A;  4MJC A;  4KCE A;  1WIK A;  5G5E A;  3UAP A;  1ZMA A;  5G31 A;  5IQY A;  4N0V A;  1X0R A;  3FHK A;  5IMD A;  2VL2 C;  3Q74 A;  3UVH A;  2H73 A;  3HYP A;  3HZ8 A;  5EY6 A;  4FIW A;  3ZLP A;  1SKS B;  1XW5 A;  2I1U A;  2GSS A;  4FO5 A;  2DIZ A;  2PER A;  3A5W A;  2LNS A;  1V98 A;  3F6F A;  3I9V 2;  1V40 A;  4N10 A;  1ERV A;  2P31 A;  3IAM 2;  2PGT A;  2ON7 A;  2I81 A;  1X9S B;  1XIY A;  3RHB A;  2L59 A;  1SL0 B;  4K2D A;  3Q6O A;  1TK0 B;  1Y6E A;  4YQU A;  3ZYW A;  4DSS A;  4AJ7 A;  1JZO A;  2YWI A;  5IMV A;  5ECM B;  1FAA A;  4HQS A;  5KN3 A;  1K0B A;  1JZW A;  1TRS A;  4G19 A;  3ZVJ A;  1RW1 A;  2MMA A;  19GS A;  3L9U A;  2FGX A;  3HVX A;  4F82 A;  5KEJ A;  1JLW A;  2FLS A;  2CAI A;  3RPN A;  2B5X A;  2DML A;  2HZE A;  3TB2 A;  3CXG A;  2BMX A;  1K3Y A;  2OE0 A;  1A23 A;  1ST9 A;  4EF0 A;  1TRV A;  4TOP A;  5HR2 A;  3JCM L;  1RK4 A;  2YWN A;  5ENU A;  3APQ A;  4O92 A;  4NPB A;  2DJ2 A;  3EMX A;  4IBP A;  2RII A;  2M46 A;  4AGS A;  2QGV A;  5D9X A;  2ZNM A;  1QGV A;  4MDC A;  1X5D A;  3ISO A;  1GSQ A;  1CQH A;  4KDU A;  4IQA A;  4K8M A;  5FT3 A;  1FVJ A;  3UVT A;  3UL3 A;  2YZU A;  1DUG A;  4J2F A;  4V1A p;  5ECP B;  5C00 A;  5F8B A;  2FWF A;  1JFU A;  4POL A;  2B1K A;  1A24 A;  4L5L A;  5HFK A;  1TRW A;  3ERG A;  4GSN A;  1NW2 A;  5JWR B;  1EP8 A;  2VCQ A;  3RPP A;  3EE2 A;  1PD2 1;  4IQ1 A;  4LLR A;  2C0D A;  1VF4 A;  5B7C A;  4MF7 A;  3IC4 A;  2RUE A;  3TCO A;  1Z6N A;  1LU4 A;  2D2Z A;  4NV2 A;  2PWJ A;  5HR1 A;  3HKR A;  5D9W A;  4K6X A;  4P3Y B;  3ZRD A;  2C80 A;  3UMA A;  4BWS A;  5IOX A;  3GMF A;  3TRP A;  4NHZ A;  1SL2 B;  1YF1 A;  3F6D A;  3IDV A;  2VCW A;  2VL3 A;  3Q18 A;  1MDI A;  3DIE A;  4XHM A;  3D22 A;  1SK2 A;  3HA9 A;  5H5R A;  1O85 A;  5COH A;  1ZOF A;  2GQM A;  2VM1 A;  4V2L A;  4RQR A;  4KGI A;  3GN3 A;  1OE7 A;  2L6D A;  1XW6 A;  2E2G A;  1FW1 A;  2XHF A;  5G30 A;  5ECN B;  1WP0 A;  2LEG A;  1M9A A;  4PUR A;  4WR4 A;  3D4T A;  3ZIV A;  1TTZ A;  3BBY A;  5DQS A;  4WXT A;  4EE0 A;  2ON5 A;  5D96 A;  2DJ0 A;  4DSQ A;  2O89 A;  1EP7 A;  2A2R A;  2WJU A;  3H79 A;  1DSB A;  1IYH A;  3WT2 A;  3DXB A;  1LJR A;  2HT9 A;  1M7T A;  4DSR A;  4TR1 A;  1Q98 A;  2L6C A;  4G2E A;  5A4U A;  3ZTL A;  5JWO B;  1O8W A;  2LRN A;  4OO4 A;  5E59 A;  4I6X A;  5IOW A;  1F9M A;  3CRU A;  4JR6 A;  4MZC A;  3FZA A;  1O8X A;  4XS1 A;  3ZFB A;  3FW2 A;  1V58 A;  3D4M A;  2ZUP A;  2H01 A;  2VD0 A;  2YN1 A;  2J9H A;  1EOG A;  2LQQ A;  3R2Q A;  3LEF A;  5FHI A;  2WB9 A;  4ZL9 A;  3M1G A;  2F51 A;  4TR0 A;  4Q5N A;  5IMC A;  2KOK A;  4GWR A;  2IFQ A;  2IN3 A;  5B8B A;  2G2Q A;  2LJR A;  2V32 A;  4TR1 B;  5LCZ A;  3IV4 A;  5ID2 A;  5D8I A;  2YOI A;  2GQK A;  2GT6 A;  1R5A A;  1GSY A;  1J0F A;  2PPT A;  4IHU A;  2N5F A;  5ECL B;  4O7H A;  2H0G A;  2C8U A;  3TGZ A;  2LRT A;  4XIH A;  2NPB A;  1XWC A;  3UBK A;  4POB A;  5ECS A;  1ZGN A;  3F9U A;  5H5S A;  5D93 A;  2O85 A;  3G7J A;  3C73 A;  2K8V A;  2FY6 A;  3NIV A;  3TJJ A;  4KDY A;  1TU7 A;  4IEL A;  2RUF A;  3IXR A;  3M8N A;  3EU3 A;  2NDO A;  3I43 A;  2VCT A;  2PU9 C;  2M80 A;  6GST A;  1TK5 B;  4HDE A;  4F9Z A;  1BG5 A;  5C04 A;  1PL2 A;  3G9B A;  3APO A;  2MMZ A;  4HU9 A;  1AXD A;  1G6W A;  4EKZ A;  3IR4 A;  1WE0 A;  2R37 A;  5D9V A;  1G7O A;  1ZL9 A;  2VL9 A;  1MDJ A;  1A8L A;  1C72 A;  4LMV A;  3TJG A;  4F0C A;  5B8A A;  4XRA A;  3IRA A;  2HNL A;  1WOU A;  4CW9 A;  1PX6 A;  5F07 A;  5F0G A;  1O6J A;  5AGY A;  1YF0 A;  2C3Q A;  1I9D A;  3EVI A;  1GTB A;  3F4S A;  2VLV A;  1MTC A;  1HNB A;  1V57 A;  1G6Y A;  1CQG A;  3WD6 A;  4NMU A;  2V1M A;  5FWG A;  5IIZ A;  4V2N A;  1K0N A;  2K6V A;  4GXZ A;  4ZXG A;  1FO5 A;  4ECI A;  1VF2 A;  1U88 A;  3N9J A;  6GSV A;  2PN8 A;  1GUL A;  4ZBB A;  2F8F A;  4XTS A;  4OCF A;  5IPG A;  4GCI A;  3EUR A;  1O81 A;  4D73 B;  1FOV A;  1BAY A;  4EDY A;  2HE3 A;  2WRT A;  2AV4 A;  4KW6 A;  3KZQ A;  3D6I A;  2H30 A;  1Z5Y E;  1SJ6 A;  2H72 A;  2CAQ A;  3U5R E;  3QFB C;  1G7E A;  1EGR A;  3TKP A;  2WGR A;  5CYY A;  3GV1 A;  3RAZ A;  2H70 A;  1FVK A;  2FWH A;  3A2X A;  3QAV A;  5DJL A;  4AJ8 A;  3UEM A;  4ZL7 A;  1SEN A;  4IP6 A;  4HQZ A;  1YQ1 A;  5ID2 B;  5D9T A;  2IWT A;  4FYU A;  3BOA A;  4WF5 A;  3EC3 A;  2H1A A;  3D0Z A;  5ECO B;  3ME8 A;  2C4J A;  2X64 A;  1GTA A;  2GST A;  3GST A;  11GS A;  3FZ4 A;  4ISD A;  2K8S A;  1T7P B;  1SKR B;  5CRE A;  3F0I A;  4PQH A;  5LD0 A;  1G0T A;  1OKD A;  4WEY A;  4GQC A;  3GIX A;  4ECC A;  4J57 E;  3EMP A;  3M9J A;  1R4W A;  2H75 A;  1PGT A;  2V2G A;  2HFD A;  1I5G A;  3L9V A;  2OE3 A;  2FNO A;  2P5Q A;  2B7K A;  1OC9 A;  3HVV A;  2HZF A;  1EEJ A;  2DIY A;  1TDI A;  3QD9 A;  1PL1 A;  1XXU A;  1S3C A;  3GUR A;  2WDU A;  5HQP A;  1M99 A;  1GSE A;  3US3 A;  1B9Y C;  4I8B A;  4H86 A;  3PR8 A;  1EWX A;  5INY A;  6GSU A;  2VCV A;  3KP8 A;  4TW5 A;  2LRC A;  3IA1 A;  2N5B A;  3N5O A;  2GDR A;  3J7Y b;  3GH9 A;  3ZVJ D;  1GSS A;  3GSS A;  4Q5R A;  1GLQ A;  2R5G A;  3ZZX A;  4OFN A;  1FB6 A;  4TRX A;  3C1R A;  3L4N A;  3G7I A;  1TJD A;  3VFI A;  2VD1 A;  3H8Q A;  3IHQ A;  3KH9 A;  9GSS A;  12GS A;  3NOF A;  4PUF C;  1PN9 A;  4IS0 A;  2CA8 A;  2L5O A;  4WKW A;  4HOJ A;  4FYB A;  4HI7 A;  4ZB9 A;  3TUE A;  3GTU A;  17GS A;  1S3A A;  3HJO A;  2B5E A;  1PKZ A;  2EIR A;  4L0U A;  5H5Q A;  4BVX A;  5HR0 A;  1XWB A;  4KSM A;  3GKN A;  4LL4 B;  4F03 A;  2YZH A;  2BTO T;  3ZIT A;  4FH8 A;  5B6N A;  4MP4 A;  3D5J A;  1YY7 A;  3TRX A;  2QC7 A;  3P90 A;  4F0B A;  4IGJ A;  3U6V A;  1BYE A;  2R6K A;  2LNT A;  5HFI A;  4O5R A;  3GA4 A;  2A2S A;  2YV7 A;  2IPA A;  2H0I A;  2L57 A;  1U3I A;  2MBS A;  3UAR A;  5EL8 A;  4ID0 A;  3ZML A;  5E4W A;  2E2M A;  3G7Y A;  1XWG A;  1E2Y A;  4KUN A;  2WS2 A;  4GQF A;  3BJ5 A;  4I2T A;  1J08 A;  5DAK B;  2XBI A;  3QCP A;  3LYP A;  2GT5 A;  4XS6 A;  5ECH B;  3FEU A;  1KNG A;  3TKS E;  4O32 A;  5J4U A;  4V1A g;  2B3S A;  4GST A;  5GAN D;  8GSS A;  1S3D A;  4MJA A;  1K0A A;  1PSQ A;  1N8J A;  2DBC A;  1ERU A;  2REM A;  1X9M B;  4K0G A;  2YWM A;  2P0G A;  5IMF A;  1A2M A;  5AIX A;  2MMO A;  1EZK A;  4KDX A;  1MEK A;  5JCW A;  1GSF A;  4IN0 A;  4N30 A;  1YKC A;  1B9X C;  3UOM A;  4K7I A;  4MH2 A;  4WBR D;  3MWH A;  1X5C A;  3ZIJ A;  2H19 A;  1R5P A;  3ED3 A;  2FUG 2;  1KBN A;  1NHY A;  4HU7 A;  3GX8 A;  2H71 A;  4MJE A;  3KCM A;  4KH7 A;  4EDZ A;  3A3T A;  4ECJ A;  1T1V A;  1ZCP A;  2C3T A;  5B6M A;  5GST A;  5KN2 A;  4BWQ A;  2FWE A;  2X8G A;  1R26 A;  3GL5 A;  1TRU A;  2I3Y A;  5A4W A;  2IFQ B;  2VCZ A;  2LST A;  3VI7 A;  3QAW A;  5IMZ A;  2AB6 A;  3ERF A;  18GS A;  4LA1 A;  1H75 A;  2NVL A;  2X8H A;  3KM6 A;  2KP2 A;  2JL4 A;  3SWL A;  1AC1 A;  3I6A A;  2X99 A;  4K9Z A;  2FA8 A;  4HJM A;  2BJX A;  3VUR A;  3KGK A;  2DC5 A;  1XWA A;  3GFK A;  4QL7 A;  1SU9 A;  4KND A;  3FZ5 A;  3E9J B;  1Q4J A;  4LMW A;  1MD4 A;  2GZP A;  3TKS A;  3KD0 A;  1AW9 A;  2EIQ A;  3WGX A;  1GSU A;  1NSW A;  4Q5F A;  1NM3 A;  2YV9 A;  1OC3 A;  2VLU A;  1O73 A;  4PGT A;  1QXH A; 
#chains in the Genus database with same CATH topology
 3M0F A;  3LQ7 A;  3HXS A;  1T8E B;  4KE3 A;  3FR6 A;  2XBQ A;  4XS4 A;  1SYR A;  1K0M A;  3EPT A;  2L4Q A;  4ACS A;  2PBJ A;  3H4K A;  3CI0 K;  1T4Y A;  2HI7 A;  3IE3 A;  4ZB6 A;  3UJ1 A;  5JCU A;  3CYN A;  3IOS A;  3DVW A;  5J41 A;  4TXV A;  2HLS A;  2JSY A;  2QA2 A;  1HD2 A;  1WMJ A;  1PA3 A;  3MDK A;  1UVZ A;  5IM9 A;  3WT1 A;  4L5O A;  5GAP D;  2GVP A;  2PUK C;  3WGE A;  1YZX A;  3GKK A;  1UC7 A;  1O7U A;  3GL3 A;  1UN2 A;  3RHC A;  2LV3 A;  3P2A A;  1XVW A;  3FY7 A;  3CRT A;  2G0F A;  2J23 A;  4MF5 A;  1EGO A;  3K8N A;  1MDK A;  2MMN A;  3OR5 A;  3LGC A;  4JU5 A;  3HCZ A;  2VAF A;  3GHA A;  1XBS A;  2HSY A;  5GSS A;  3C8T A;  5D6B A;  1M3J A;  1OVN A;  4MMM A;  3GX0 A;  2FUS A;  4ULX A;  4YAV A;  4ZL8 A;  3TOU A;  2HZE B;  2LKU A;  3O6T A;  4XRD A;  1OAZ A;  4I2U A;  4MF6 A;  2MBT A;  1GTU A;  1JSW A;  5JWQ B;  1M9B A;  2H1D A;  4MPF A;  4KCA A;  2YJ7 A;  4OMV A;  3WGD A;  2F8A A;  1B48 A;  4Z7X A;  2JU5 A;  6GSY A;  2H74 A;  2LJA A;  1PQN A;  4K0N A;  5AIV A;  1WWJ A;  5F92 A;  1UA5 A;  1XZO A;  3NZN A;  2H76 A;  2WFC A;  4POM A;  1Z4L A;  1QMV A;  4I5Q A;  1EEM A;  3GKM A;  4POK A;  5J5N A;  2GZZ A;  4RQX A;  1U87 A;  4TKY A;  3GTU B;  1JHB A;  1K3L A;  2JAU A;  4N0Z A;  1F37 A;  4MK3 A;  2LUS A;  1XOA A;  1ZZY A;  1H4O A;  4GLT A;  3S9F A;  1Z3E A;  2KHP A;  3TKQ A;  3PIN A;  2A4V A;  20GS A;  4NSL A;  4X1U A;  3GZH A;  3LG6 A;  3E0U A;  3SBC A;  3OCE A;  3C7M A;  4AJ6 A;  2GSR A;  5DCG A;  4MPG A;  5J3R A;  2C0G A;  2JAW A;  1K0C A;  2C3N A;  3F3R A;  5A5K A;  3FRC A;  3FZ9 A;  4PNF A;  2JZS A;  3IC8 A;  1LBK A;  3BCK A;  2AYT A;  4Z2U A;  1A0F A;  4X43 A;  5EPF A;  2TRC P;  4MAB A;  1W89 A;  1ML6 A;  4WBJ A;  3A2V A;  1FOH A;  1K3O A;  1FG4 A;  1XOB A;  1GWC A;  3F3Q A;  1DBY A;  3DGQ A;  2CVD A;  4KA0 A;  3O76 A;  4ILF A;  4BVY A;  5CAX A;  3TV2 A;  3RD8 A;  4BA7 A;  2B5Y A;  3HJP A;  3LOR A;  1A2J A;  3EYT A;  4JBB A;  5AIS A;  3W8S A;  1PX7 A;  1FUP A;  1U6T A;  1TOF A;  4NV5 A;  3F8U A;  3VPT A;  1IYI A;  4JR4 A;  5IMA A;  1TJU A;  2FD3 A;  1XW9 A;  2H0H A;  3TJK A;  2YCD A;  5F91 A;  3F4R A;  1QFN A;  1IW7 D;  3ZRE A;  3LSZ A;  3HY2 A;  1ZYQ B;  1X5E A;  2P5R A;  4LL1 B;  4PQ1 A;  1HQO A;  4TR4 A;  1BQ7 A;  1MD3 A;  1OYJ A;  3TJF A;  3L0H A;  2JSZ A;  2YJH A;  3R6Q A;  1F3B A;  3IK9 A;  4D73 A;  1J9B A;  1F2E A;  5KOX A;  3HHV A;  10GS A;  4Z2T A;  2IMK A;  2M72 A;  1SKW B;  2OAC A;  2HYX A;  2EC4 A;  1OKT A;  4MLY A;  3PPU A;  3GYK A;  2H6X A;  2GZY A;  4APB A;  2N5A A;  2AUV A;  4ZIJ A;  4TN8 A;  2B1L A;  2CZ2 A;  1R7H A;  2XPE A;  1RQM A;  5BRT A;  1YKA A;  4IQJ M;  4IW9 A;  1M3I A;  2H1B A;  3ZFL A;  2R3X A;  4KAE A;  2IIY A;  1SJI A;  2CVB A;  1TKD B;  3BWV A;  2HVG A;  2YAN A;  1GUK A;  2H66 A;  4TXO A;  2OAD A;  4ML6 A;  3CBU A;  2DKI A;  4BL7 A;  3DVX A;  4DVC A;  4J56 E;  1T9H A;  3BD2 A;  2WZ9 A;  1PRX A;  4MZW A;  3H93 A;  1XWO A;  6GSX A;  2CX3 A;  4KB3 A;  4KSO A;  1M0U A;  1U15 A;  4HJ2 A;  1TI1 A;  3ERW A;  4OWY A;  1ILO A;  3FK8 A;  5CNW A;  1K62 A;  3GNJ A;  4HS1 A;  5CP1 A;  1EOH A;  4YKF A;  1V2A A;  6GSW A;  1TXX A;  1GNE A;  2B6M A;  4MWO A;  3TOT A;  3KIJ A;  2V6K A;  2K18 A;  4IP1 A;  4I97 A;  4XS4 B;  2ALB A;  1Z7P A;  3LJR A;  3D21 A;  1GTI A;  2DJJ A;  3HZ4 A;  2C0F A;  5ABR A;  4F2I A;  4XCS A;  1Y25 A;  2DSA A;  3EU4 A;  3V1W A;  4G9H A;  2ZCT A;  3DEX A;  2O87 A;  3FKF A;  4GRF A;  3VWV A;  1YDK A;  1TJ7 A;  1C3C A;  1BX9 A;  4PQI A;  4PXO A;  2CT6 A;  3RRP A;  3C71 A;  14GS A;  5CRG A;  3FR9 A;  5IPH A;  2GTU A;  2O8V B;  3VPQ A;  1XVQ A;  1Z4I A;  1VF1 A;  3GKX A;  2QA1 A;  2R0G A;  5JCG A;  3KJY A;  2TRX A;  2C0E A;  1GP1 A;  4EL1 A;  3EWL A;  1SJZ A;  2DJ3 A;  2VCX A;  2HSH A;  3U13 A;  3U19 A;  3FR3 A;  1HNA A;  2PVO C;  4N11 A;  4RI6 A;  3E3E A;  4EO3 A;  2DJ1 A;  4HZ2 A;  4Q5Q A;  3KEB A;  16GS A;  2DMM A;  2VLT A;  2YP6 A;  1WRY A;  1PKW A;  1TJV A;  5G1L A;  2IME A;  1AQV A;  4EIP A;  2MYG A;  5GZZ B;  3IK7 A;  4YQV A;  4ZIL A;  1ABA A;  1HYU A;  3CTG A;  4Z2R A;  1AIU A;  4TR3 A;  2R2J A;  2L5L A;  1THX A;  3DYR A;  1Z9H A;  22GS A;  4E8H A;  4EXJ A;  4YAP A;  5CRH A;  1ZYN A;  3APS A;  5EVO A;  3UIW A;  3L9S A;  4JZQ A;  3MAK A;  4YH2 A;  3VWX A;  1X9W B;  4JRR A;  3TRQ A;  3KXO A;  1V9W A;  4TXO B;  1ZYE A;  1GUM A;  1YEP A;  3C8E A;  3Q19 A;  5F05 A;  4BL7 B;  1GLP A;  2K9F A;  4TVE A;  1OE8 A;  1QUW A;  3DKS A;  1GUH A;  1ERT A;  1M2D A;  1DE1 A;  1N2A A;  2CV4 A;  1QK8 A;  2IMF A;  2VOC A;  5ECI B;  3DWV A;  1GH2 A;  2H1G A;  2O7K A;  3VLN A;  3P8W A;  2FWG A;  2IMD A;  5DCH A;  5G5F A;  2IJY A;  4PNG A;  2GS3 A;  3QMX A;  1URM A;  5DDL A;  2RM6 A;  3MIX A;  2V41 A;  1USB A;  1SYX A;  4GSS A;  3CSI A;  4EIQ A;  1VDK A;  1Z4Q A;  3KMO A;  3M9K A;  2LTK A;  2JAC A;  1WPI A;  5ELA A;  3DRN A;  2F3M A;  3AY8 A;  4ADM A;  3LXZ A;  2H6Y A;  3GRX A;  2LS5 A;  3QPM A;  6GSS A;  2QKE A;  3HVN A;  4L6A A;  3C1S A;  3DML A;  3ZL5 A;  1TU8 A;  2OBK A;  4MH3 A;  4G0I A;  4JE1 A;  1SL1 B;  2LJK A;  2FHE A;  2RM5 A;  4EVM A;  2AHE A;  4ZBD A;  2KLX A;  2QSI A;  4IJI A;  3TDG A;  1VGL A;  5L71 A;  3H1N A;  1PMT A;  2IMI A;  1GNW A;  4L8E A;  3HDC A;  5CRD A;  3NO9 A;  1M2B A;  2R4V A;  4NHW A;  4DEJ A;  4HEA 2;  3LXT A;  1GSD A;  4ZBA A;  5F06 A;  1JZR A;  3O3T A;  2OKA A;  3F4T A;  2I4A A;  2F9S A;  1OC9 B;  3MNG A;  5DVB A;  3WYW A;  5HR3 A;  4BIK A;  2X8C A;  4IVF A;  2VM2 A;  4ML1 A;  1M2A A;  4MJB A;  1AUC A;  3P7X A;  1AQW A;  3GH6 A;  5G1K A;  4CDO A;  2DLX A;  3W8J A;  4RI7 A;  4GTU A;  4NXI A;  4OFM A;  3IBH A;  4QL9 A;  1A8Y A;  1NHO A;  4GF0 A;  4BPY A;  4EUY A;  2V6O A;  1JLV A;  1U3A A;  5CRW A;  3QFA C;  2GSQ A;  2XC2 A;  1KQ7 A;  3ME7 A;  4OD7 A;  1FB0 A;  3KMN A;  1E6B A;  4WF4 A;  3EIN A;  4PX1 A;  1WJK A;  2ES7 A;  13GS A;  3IPZ A;  4NAX A;  3PH9 A;  2OJL A;  2KP1 A;  4OFT A;  2E7P A;  1K0D A;  3CSH A;  3DD3 A;  2FA4 A;  4IKH A;  3HJM A;  3LYK A;  3PGT A;  1GRX A;  1YEX A;  1YJ6 A;  3TKR A;  5J9B A;  4FYC A;  4K2X A;  1T4Z A;  1B8X A;  4IJ3 A;  4MZB A;  3TJB A;  3L78 A;  3VI5 A;  5HFG A;  5DAL B;  1SK1 A;  1RE5 A;  5DQY A;  5KN1 A;  3VWU A;  1K0O A;  1VF3 A;  3VWW A;  1OC8 A;  4HSC X;  1AQX A;  4USS A;  1B4P A;  1FHE A;  1Z7R A;  3A2W A;  2HRF A;  7GSS A;  3CTF A;  2E9F A;  2RLI A;  2L4C A;  5G2Z A;  3LW9 A;  2YPM A;  2FCH A;  4MCU A;  1TW9 A;  1BJX A;  4BVX B;  2B7J A;  1A0R P;  3CMI A;  2MZC A;  3GTD A;  1EV4 A;  1AAZ A;  1K7W A;  2YWO A;  4L0W A;  4OO5 A;  4NFL A;  2OA7 A;  3LFL A;  1BED A;  4OCE A;  5LNK e;  5DJM A;  1SD9 A;  2XPD A;  3MYD A;  3QR6 A;  2VO4 A;  2KUC A;  2GQL A;  1GL8 A;  3F63 A;  3RDW A;  2IL3 A;  5DAL A;  3CSJ A;  1SK0 A;  1Z6M A;  3KP9 A;  4RUV A;  1TJW A;  4WR5 A;  4HUA A;  2TIR A;  1DCN A;  3LWA A;  5KN0 A;  4ZB8 A;  5J9C A;  2I9H A;  1TP9 A;  3IAS 2;  3KH7 A;  1XCC A;  2E0Q A;  1THO A;  2PMT A;  4KX4 A;  1FUO A;  2CZ3 A;  3KTB A;  2DJK A;  1TK8 B;  4K1F A;  4L57 A;  2HRN A;  5DAK A;  3GUS A;  2LQO A;  4YKG A;  2CQ9 A;  1A2L A;  2Z9S A;  2PVQ A;  1XPV A;  4AF2 A;  4EC0 A;  5ECR B;  4E8E A;  3TKS C;  1T3B A;  1XWK A;  5AN1 A;  2CX4 A;  4JED A;  4DSS B;  1DE2 A;  1ACV A;  2CVK A;  3HVS A;  4NWY A;  4MUM A;  1HNC A;  2VIM A;  2JZR A;  1QQ2 A;  1F6M C;  1W4V A;  4X0X A;  5ECQ B;  1TI3 A;  4CHS A;  4WET A;  1ERW A;  1T00 A;  1Q92 A;  2NBS A;  2VUP A;  2OBI A;  2HXK A;  2OE1 A;  3QDN A;  4YQM A;  2EIO A;  5CO3 A;  3MSZ A;  1YFM A;  2AJQ B;  5ECK B;  2NTO A;  2AAW A;  3BCI A;  3KTL A;  2WCI A;  4G10 A;  1XFL A;  2UZ8 A;  3W6G A;  5DBQ A;  3M3M A;  4MA9 A;  1ON4 A;  4QQ7 A;  5D73 A;  3UBL A;  5IO2 A;  5A4V A;  4PUA A;  5IO0 A;  2JZT A;  3FYG A;  1KEB A;  4K7O A;  2JAD A;  2H8L A;  4K7N A;  1VRS D;  2D28 C;  2R0P A;  4ECB A;  3RBT A;  3QOU A;  3HD5 A;  1B4Q A;  2GLR A;  1SD8 A;  2GGT A;  4K5R A;  4HZ4 A;  2C1Y A;  4EFC A;  1U16 A;  1EV9 A;  3VK9 A;  5ELG A;  2YNX A;  3I69 A;  2H6Z A;  2WUL A;  2VL2 A;  1KTE A;  2JAO A;  1F3A A;  3J7Y k;  1Q91 A;  3ZMK A;  4V2M A;  4A5P A;  4L6C A;  3QAG A;  1JZD A;  4MJC A;  4KCE A;  1WIK A;  5G5E A;  3UAP A;  1ZMA A;  5G31 A;  5IQY A;  4N0V A;  1X0R A;  3FHK A;  5IMD A;  2VL2 C;  2PTS A;  3Q74 A;  3UVH A;  2H73 A;  3HYP A;  3HZ8 A;  5EY6 A;  4FIW A;  3ZLP A;  1SKS B;  1XW5 A;  2I1U A;  2GSS A;  4FO5 A;  2DIZ A;  2PER A;  3A5W A;  2LNS A;  1V98 A;  3F6F A;  3I9V 2;  1V40 A;  4N10 A;  1ERV A;  5KOW A;  2P31 A;  3IAM 2;  2PGT A;  2ON7 A;  4G0K A;  2I81 A;  1X9S B;  1XIY A;  3RHB A;  2L59 A;  1SL0 B;  4K2D A;  3Q6O A;  1TK0 B;  1Y6E A;  4YQU A;  3ZYW A;  4DSS A;  4AJ7 A;  1YFE A;  1JZO A;  2YWI A;  5IMV A;  5ECM B;  1FAA A;  2HRK A;  4HQS A;  5KN3 A;  1K0B A;  1JZW A;  1TRS A;  4G19 A;  3ZVJ A;  1RW1 A;  2MMA A;  19GS A;  3L9U A;  2FGX A;  3HVX A;  2HSM A;  4F82 A;  5KEJ A;  1JLW A;  2FLS A;  2CAI A;  3RPN A;  2B5X A;  2DML A;  2HZE A;  4YIH A;  3TB2 A;  4O5Q A;  3CXG A;  2X4A A;  2BMX A;  1K3Y A;  2OE0 A;  1A23 A;  3A5I A;  1ST9 A;  4EF0 A;  1TRV A;  4TOP A;  5HR2 A;  3JCM L;  1RK4 A;  2DKH A;  2YWN A;  5ENU A;  3APQ A;  4O92 A;  4NPB A;  2DJ2 A;  3EMX A;  4IBP A;  2RII A;  2M46 A;  4AGS A;  2QGV A;  5D9X A;  2ZNM A;  1QGV A;  4MDC A;  1X5D A;  3ISO A;  1GSQ A;  1CQH A;  4KDU A;  4IQA A;  4K8M A;  5FT3 A;  1FVJ A;  3UVT A;  4MNN A;  3UL3 A;  2YZU A;  1DUG A;  4J2F A;  4G0L A;  4V1A p;  5ECP B;  5C00 A;  5F8B A;  2FWF A;  1JFU A;  4POL A;  2B1K A;  1A24 A;  4L5L A;  5HFK A;  1Z4J A;  1TRW A;  3ERG A;  4GSN A;  1NW2 A;  5JWR B;  1EP8 A;  2VCQ A;  3RPP A;  3EE2 A;  1PD2 1;  4IQ1 A;  4LLR A;  2C0D A;  1VF4 A;  5B7C A;  4MF7 A;  3IC4 A;  2RUE A;  3TCO A;  1Z6N A;  1LU4 A;  2D2Z A;  4NV2 A;  2PWJ A;  1HY0 A;  2X49 A;  5HR1 A;  3BHG A;  4KF9 A;  3HKR A;  5D9W A;  1S3R A;  2A4H A;  4K6X A;  4P3Y B;  3ZRD A;  2C80 A;  3UMA A;  4BWS A;  5IOX A;  3GMF A;  4NHZ A;  3TRP A;  1SL2 B;  1YF1 A;  3F6D A;  3IDV A;  2VCW A;  2VL3 A;  3Q18 A;  3DIE A;  2PTR A;  1MDI A;  4XHM A;  3D22 A;  1SK2 A;  3OCF A;  3HA9 A;  5H5R A;  1O85 A;  5COH A;  1ZOF A;  2GQM A;  2VM1 A;  4V2L A;  4RQR A;  4KGI A;  3GN3 A;  1OE7 A;  2L6D A;  4CY6 A;  1XW6 A;  4APA A;  2E2G A;  1FW1 A;  2XHF A;  5G30 A;  5ECN B;  1WP0 A;  2LEG A;  1M9A A;  4PUR A;  4WR4 A;  3R6V A;  3D4T A;  3ZIV A;  1TTZ A;  3BBY A;  5DQS A;  4WXT A;  4EE0 A;  2ON5 A;  5D96 A;  2DJ0 A;  4DSQ A;  2O89 A;  4EEI A;  1FUR A;  1EP7 A;  2A2R A;  2WJU A;  3H79 A;  1DSB A;  1IYH A;  3WT2 A;  3DXB A;  1LJR A;  2HT9 A;  1M7T A;  4DSR A;  4TR1 A;  1Q98 A;  2L6C A;  4G2E A;  5A4U A;  3ZTL A;  5JWO B;  1O8W A;  2LRN A;  4OO4 A;  1J3U A;  5E59 A;  4I6X A;  5IOW A;  1F9M A;  3CRU A;  4JR6 A;  4MZC A;  3FZA A;  1O8X A;  4XS1 A;  3ZFB A;  3FW2 A;  1V58 A;  3D4M A;  2ZUP A;  2H01 A;  2D27 A;  2VD0 A;  2YN1 A;  2J9H A;  1EOG A;  2LQQ A;  3R2Q A;  3LEF A;  4X4J A;  5FHI A;  2WB9 A;  4ZL9 A;  3M1G A;  2F51 A;  4TR0 A;  1Q5N A;  4Q5N A;  5IMC A;  2KOK A;  4GWR A;  2IFQ A;  2IN3 A;  1PFO A;  5B8B A;  2G2Q A;  2LJR A;  2V32 A;  4TR1 B;  5LCZ A;  3IV4 A;  5ID2 A;  5D8I A;  2YOI A;  2GQK A;  2GT6 A;  1R5A A;  1GSY A;  1J0F A;  1U0L A;  2PPT A;  4IHU A;  2N5F A;  5ECL B;  4O7H A;  2H0G A;  2C8U A;  3TGZ A;  2LRT A;  4XIH A;  2NPB A;  1XWC A;  3UBK A;  4POB A;  5ECS A;  1ZGN A;  3F9U A;  5H5S A;  5D93 A;  4K5S A;  2O85 A;  3G7J A;  3C73 A;  2K8V A;  2FY6 A;  3NIV A;  3TJJ A;  4KDY A;  1TU7 A;  4IEL A;  2RUF A;  1Z4K A;  3IXR A;  3M8N A;  3EU3 A;  2NDO A;  3I43 A;  2VCT A;  2PU9 C;  2M80 A;  1MH9 A;  6GST A;  1TK5 B;  4HDE A;  4F9Z A;  2JAR A;  1BG5 A;  5HW2 A;  5C04 A;  1PL2 A;  3G9B A;  3APO A;  2MMZ A;  4HU9 A;  1AXD A;  1G6W A;  4EKZ A;  3IR4 A;  1WE0 A;  4FQU A;  2R37 A;  5D9V A;  1G7O A;  5BMU A;  1ZL9 A;  2VL9 A;  1MDJ A;  1A8L A;  1C72 A;  4LMV A;  3TJG A;  4F0C A;  5B8A A;  4XRA A;  3IRA A;  2HNL A;  1WOU A;  4CW9 A;  1PX6 A;  5F07 A;  5F0G A;  1O6J A;  5AGY A;  1YF0 A;  2C3Q A;  1I9D A;  3EVI A;  1GTB A;  3F4S A;  2VLV A;  1MTC A;  4PTS A;  1HNB A;  1V57 A;  2YV5 A;  1G6Y A;  1CQG A;  3WD6 A;  4NMU A;  1AUW A;  2V1M A;  5FWG A;  5IIZ A;  4V2N A;  1K0N A;  2K6V A;  4GXZ A;  4ZXG A;  1FO5 A;  4ECI A;  1VF2 A;  1U88 A;  3N9J A;  6GSV A;  2PN8 A;  4YIK A;  1GUL A;  4ZBB A;  2F8F A;  4XTS A;  4OCF A;  5IPG A;  4GCI A;  3EUR A;  1O81 A;  4D73 B;  1FOV A;  1BAY A;  4EDY A;  2HE3 A;  2WRT A;  2AV4 A;  4KW6 A;  3KZQ A;  3CQF A;  3R3E A;  3D6I A;  2H30 A;  1Z5Y E;  1SJ6 A;  2H72 A;  2CAQ A;  3U5R E;  3QFB C;  1G7E A;  1EGR A;  3TKP A;  2WGR A;  5CYY A;  3GV1 A;  3RAZ A;  2H70 A;  1FVK A;  2FWH A;  3A2X A;  3QAV A;  5DJL A;  4AJ8 A;  1DOF A;  3UEM A;  4ZL7 A;  1SEN A;  4IP6 A;  2I7D A;  4HQZ A;  1YQ1 A;  5ID2 B;  3FMW A;  5D9T A;  2IWT A;  4FYU A;  3BOA A;  4WF5 A;  3EC3 A;  2H1A A;  3D0Z A;  5ECO B;  3ME8 A;  2C4J A;  2X64 A;  1GTA A;  2R0C A;  2GST A;  1C3U A;  2PTQ A;  3GST A;  11GS A;  3FZ4 A;  4ISD A;  2K8S A;  2QGA B;  1T7P B;  1SKR B;  5CRE A;  1I0A A;  3F0I A;  4PQH A;  5LD0 A;  1G0T A;  1OKD A;  4WEY A;  4GQC A;  3QBP A;  3GIX A;  4ECC A;  1Z4M A;  4J57 E;  3EMP A;  3M9J A;  1R4W A;  2H75 A;  1PGT A;  2V2G A;  2HFD A;  1I5G A;  3L9V A;  2OE3 A;  2FNO A;  2P5Q A;  2B7K A;  1OC9 A;  3HVV A;  2HZF A;  1EEJ A;  2DIY A;  1TDI A;  3QD9 A;  1PL1 A;  1XXU A;  1S3C A;  3GUR A;  2WDU A;  5HQP A;  1M99 A;  1GSE A;  3US3 A;  1B9Y C;  4I8B A;  4H86 A;  3PR8 A;  1EWX A;  5INY A;  6GSU A;  2VCV A;  3KP8 A;  4TW5 A;  2LRC A;  3IA1 A;  2N5B A;  3N5O A;  2GDR A;  3J7Y b;  3GH9 A;  3ZVJ D;  1GSS A;  3GSS A;  4Q5R A;  1GLQ A;  2R5G A;  4O5U A;  3ZZX A;  4OFN A;  1FB6 A;  4TRX A;  3C1R A;  1XG8 A;  3L4N A;  3G7I A;  1TJD A;  3VFI A;  2VD1 A;  3H8Q A;  3IHQ A;  3KH9 A;  9GSS A;  12GS A;  3NOF A;  4PUF C;  1PN9 A;  4IS0 A;  2CA8 A;  2L5O A;  4WKW A;  4HOJ A;  4FYB A;  4HI7 A;  4ZB9 A;  3TUE A;  4MX2 A;  17GS A;  3GTU A;  1S3A A;  3HJO A;  2B5E A;  1PKZ A;  2RCN A;  2EIR A;  4L0U A;  5H5Q A;  4BVX A;  5HR0 A;  4ICY A;  1XWB A;  4KSM A;  3GKN A;  4LL4 B;  4F03 A;  2YZH A;  2BTO T;  3ZIT A;  4FH8 A;  5B6N A;  2HRA A;  4MP4 A;  3D5J A;  1YY7 A;  3TRX A;  2QC7 A;  3P90 A;  4F0B A;  4IGJ A;  3U6V A;  1FUQ A;  1BYE A;  2R6K A;  2LNT A;  5HFI A;  4O5R A;  3GA4 A;  2A2S A;  2YV7 A;  2IPA A;  2H0I A;  2L57 A;  1U3I A;  2MBS A;  3UAR A;  5EL8 A;  4ID0 A;  3ZML A;  5E4W A;  2E2M A;  3G7Y A;  1XWG A;  1E2Y A;  4KUN A;  2WS2 A;  4GQF A;  3BJ5 A;  4I2T A;  4BVY B;  1J08 A;  5DAK B;  2XBI A;  3QCP A;  3LYP A;  2GT5 A;  4XS6 A;  5ECH B;  3FEU A;  1KNG A;  3TKS E;  4O32 A;  5J4U A;  4V1A g;  2B3S A;  4GST A;  2X75 A;  5GAN D;  8GSS A;  1S3D A;  4MJA A;  1K0A A;  1PSQ A;  1N8J A;  2DBC A;  1ERU A;  1PN0 A;  2REM A;  1X9M B;  4E88 A;  4K0G A;  2YWM A;  2P0G A;  5IMF A;  1A2M A;  5AIX A;  2MMO A;  1EZK A;  4KDX A;  1Z4P X;  1MEK A;  1HY1 A;  1GSF A;  5JCW A;  4IN0 A;  4N30 A;  4ADL A;  1YKC A;  1B9X C;  3UOM A;  4K7I A;  4MH2 A;  4WBR D;  3MWH A;  1X5C A;  3ZIJ A;  2H19 A;  1R5P A;  3ED3 A;  2FUG 2;  1KBN A;  4HGV A;  1NHY A;  3IHG A;  4HU7 A;  3E04 A;  3GX8 A;  1ZYP A;  2H71 A;  4MJE A;  4CY8 A;  3KCM A;  4KH7 A;  4EDZ A;  3A3T A;  4ECJ A;  1T1V A;  1ZCP A;  2C3T A;  5B6M A;  5GST A;  5KN2 A;  4BWQ A;  2FWE A;  2X8G A;  1R26 A;  3GL5 A;  1TRU A;  2I3Y A;  5A4W A;  2IFQ B;  2VCZ A;  2LST A;  3VI7 A;  3QAW A;  5IMZ A;  2AB6 A;  3ERF A;  18GS A;  4LA1 A;  1H75 A;  2NVL A;  2X8H A;  3KM6 A;  2KP2 A;  2JL4 A;  3SWL A;  1AC1 A;  2PFM A;  3I6A A;  2X99 A;  4K9Z A;  2FA8 A;  4HJM A;  2BJX A;  3VUR A;  3KGK A;  2DC5 A;  1XWA A;  3GFK A;  4QL7 A;  1SU9 A;  4KND A;  3FZ5 A;  3E9J B;  1Q4J A;  4LMW A;  1MD4 A;  2GZP A;  3TKS A;  3KD0 A;  1AW9 A;  2EIQ A;  3WGX A;  1GSU A;  1NSW A;  4Q5F A;  1NM3 A;  4NLE A;  2A2P A;  2YV9 A;  1OC3 A;  2VLU A;  1O73 A;  4PGT A;  1QXH A; 
#chains in the Genus database with same CATH homology
 3M0F A;  3LQ7 A;  3HXS A;  1T8E B;  4KE3 A;  3FR6 A;  2XBQ A;  4XS4 A;  1SYR A;  1K0M A;  3EPT A;  2L4Q A;  4ACS A;  2PBJ A;  3H4K A;  1T4Y A;  2HI7 A;  3IE3 A;  4ZB6 A;  3UJ1 A;  5JCU A;  3CYN A;  3IOS A;  3DVW A;  5J41 A;  4TXV A;  2HLS A;  2JSY A;  2QA2 A;  1HD2 A;  1WMJ A;  1PA3 A;  3MDK A;  1UVZ A;  5IM9 A;  3WT1 A;  4L5O A;  5GAP D;  2GVP A;  2PUK C;  3WGE A;  1YZX A;  3GKK A;  1UC7 A;  1O7U A;  3GL3 A;  1UN2 A;  3RHC A;  2LV3 A;  3P2A A;  1XVW A;  3FY7 A;  3CRT A;  2G0F A;  2J23 A;  4MF5 A;  1EGO A;  3K8N A;  1MDK A;  2MMN A;  3OR5 A;  3LGC A;  4JU5 A;  3HCZ A;  2VAF A;  3GHA A;  1XBS A;  2HSY A;  5GSS A;  1OVN A;  4MMM A;  3GX0 A;  4ULX A;  4YAV A;  4ZL8 A;  3TOU A;  2HZE B;  2LKU A;  3O6T A;  4XRD A;  1OAZ A;  4I2U A;  4MF6 A;  2MBT A;  1GTU A;  5JWQ B;  1M9B A;  2H1D A;  4MPF A;  4KCA A;  2YJ7 A;  4OMV A;  3WGD A;  2F8A A;  1B48 A;  4Z7X A;  2JU5 A;  6GSY A;  2H74 A;  2LJA A;  1PQN A;  4K0N A;  5AIV A;  1WWJ A;  1UA5 A;  1XZO A;  3NZN A;  2H76 A;  2WFC A;  4POM A;  1QMV A;  4I5Q A;  1EEM A;  3GKM A;  4POK A;  5J5N A;  2GZZ A;  4RQX A;  1U87 A;  4TKY A;  3GTU B;  1JHB A;  1K3L A;  4N0Z A;  1F37 A;  4MK3 A;  2LUS A;  1XOA A;  1ZZY A;  1H4O A;  4GLT A;  3S9F A;  1Z3E A;  2KHP A;  3TKQ A;  3PIN A;  2A4V A;  20GS A;  4X1U A;  3LG6 A;  3E0U A;  3SBC A;  3C7M A;  4AJ6 A;  2GSR A;  5DCG A;  4MPG A;  5J3R A;  2C0G A;  1K0C A;  2C3N A;  3F3R A;  5A5K A;  3FRC A;  3FZ9 A;  4PNF A;  2JZS A;  3IC8 A;  1LBK A;  3BCK A;  2AYT A;  4Z2U A;  1A0F A;  4X43 A;  5EPF A;  2TRC P;  4MAB A;  1W89 A;  1ML6 A;  4WBJ A;  3A2V A;  1FOH A;  1K3O A;  1FG4 A;  1XOB A;  1GWC A;  3F3Q A;  1DBY A;  3DGQ A;  2CVD A;  4KA0 A;  3O76 A;  4ILF A;  4BVY A;  5CAX A;  4BA7 A;  2B5Y A;  3HJP A;  3LOR A;  1A2J A;  3EYT A;  4JBB A;  5AIS A;  3W8S A;  1PX7 A;  1U6T A;  1TOF A;  4NV5 A;  3F8U A;  3VPT A;  1IYI A;  4JR4 A;  5IMA A;  2FD3 A;  1XW9 A;  2H0H A;  3TJK A;  2YCD A;  3F4R A;  1QFN A;  1IW7 D;  3ZRE A;  3LSZ A;  3HY2 A;  1ZYQ B;  1X5E A;  2P5R A;  4LL1 B;  4PQ1 A;  1HQO A;  4TR4 A;  1BQ7 A;  1MD3 A;  1OYJ A;  3TJF A;  3L0H A;  2JSZ A;  2YJH A;  1F3B A;  3IK9 A;  4D73 A;  1J9B A;  1F2E A;  5KOX A;  3HHV A;  10GS A;  4Z2T A;  2IMK A;  2M72 A;  1SKW B;  2OAC A;  2HYX A;  2EC4 A;  1OKT A;  4MLY A;  3PPU A;  3GYK A;  2H6X A;  2GZY A;  2N5A A;  2AUV A;  4ZIJ A;  4TN8 A;  2B1L A;  2CZ2 A;  1R7H A;  2XPE A;  1RQM A;  5BRT A;  1YKA A;  4IQJ M;  4IW9 A;  2H1B A;  3ZFL A;  2R3X A;  4KAE A;  2IIY A;  1SJI A;  2CVB A;  1TKD B;  2YAN A;  1GUK A;  2H66 A;  4TXO A;  2OAD A;  4ML6 A;  3CBU A;  2DKI A;  4BL7 A;  3DVX A;  4DVC A;  4J56 E;  3BD2 A;  2WZ9 A;  1PRX A;  4MZW A;  3H93 A;  6GSX A;  2CX3 A;  4KB3 A;  4KSO A;  1M0U A;  4HJ2 A;  1TI1 A;  3ERW A;  4OWY A;  1ILO A;  3FK8 A;  5CNW A;  3GNJ A;  4HS1 A;  5CP1 A;  1EOH A;  4YKF A;  1V2A A;  6GSW A;  1TXX A;  1GNE A;  2B6M A;  3TOT A;  3KIJ A;  2V6K A;  2K18 A;  4IP1 A;  4I97 A;  4XS4 B;  2ALB A;  1Z7P A;  3LJR A;  3D21 A;  1GTI A;  2DJJ A;  3HZ4 A;  2C0F A;  5ABR A;  4F2I A;  4XCS A;  1Y25 A;  2DSA A;  3EU4 A;  3V1W A;  4G9H A;  2ZCT A;  3DEX A;  2O87 A;  3FKF A;  4GRF A;  3VWV A;  1YDK A;  1BX9 A;  4PQI A;  4PXO A;  2CT6 A;  3C71 A;  14GS A;  5CRG A;  3FR9 A;  5IPH A;  2GTU A;  2O8V B;  3VPQ A;  1XVQ A;  1VF1 A;  3GKX A;  2QA1 A;  2R0G A;  5JCG A;  3KJY A;  2TRX A;  2C0E A;  1GP1 A;  4EL1 A;  3EWL A;  1SJZ A;  2DJ3 A;  2VCX A;  2HSH A;  3FR3 A;  1HNA A;  2PVO C;  4N11 A;  4RI6 A;  3E3E A;  4EO3 A;  2DJ1 A;  4HZ2 A;  4Q5Q A;  3KEB A;  16GS A;  2DMM A;  2VLT A;  2YP6 A;  1WRY A;  1PKW A;  5G1L A;  2IME A;  1AQV A;  4EIP A;  2MYG A;  5GZZ B;  3IK7 A;  4YQV A;  4ZIL A;  1ABA A;  1HYU A;  3CTG A;  4Z2R A;  1AIU A;  4TR3 A;  2R2J A;  2L5L A;  1THX A;  3DYR A;  1Z9H A;  22GS A;  4E8H A;  4EXJ A;  4YAP A;  5CRH A;  1ZYN A;  3APS A;  5EVO A;  3UIW A;  3L9S A;  4JZQ A;  3MAK A;  4YH2 A;  3VWX A;  1X9W B;  4JRR A;  3TRQ A;  3KXO A;  1V9W A;  1ZYE A;  4TXO B;  1GUM A;  1YEP A;  3C8E A;  3Q19 A;  5F05 A;  4BL7 B;  1GLP A;  2K9F A;  4TVE A;  1OE8 A;  1QUW A;  3DKS A;  1GUH A;  1ERT A;  1M2D A;  1DE1 A;  1N2A A;  2CV4 A;  1QK8 A;  2IMF A;  2VOC A;  5ECI B;  3DWV A;  1GH2 A;  2H1G A;  2O7K A;  3VLN A;  3P8W A;  2FWG A;  2IMD A;  5DCH A;  5G5F A;  2IJY A;  4PNG A;  2GS3 A;  3QMX A;  1URM A;  5DDL A;  2RM6 A;  3MIX A;  2V41 A;  1USB A;  1SYX A;  4GSS A;  3CSI A;  4EIQ A;  3KMO A;  3M9K A;  2LTK A;  2JAC A;  1WPI A;  5ELA A;  3DRN A;  2F3M A;  3AY8 A;  3LXZ A;  2H6Y A;  3GRX A;  2LS5 A;  3QPM A;  6GSS A;  2QKE A;  3C1S A;  3DML A;  3ZL5 A;  1TU8 A;  2OBK A;  4MH3 A;  4G0I A;  4JE1 A;  1SL1 B;  2LJK A;  2FHE A;  2RM5 A;  4EVM A;  2AHE A;  4ZBD A;  2KLX A;  2QSI A;  4IJI A;  3TDG A;  1VGL A;  5L71 A;  3H1N A;  1PMT A;  2IMI A;  1GNW A;  4L8E A;  3HDC A;  5CRD A;  1M2B A;  2R4V A;  4NHW A;  4DEJ A;  4HEA 2;  3LXT A;  1GSD A;  4ZBA A;  5F06 A;  1JZR A;  3O3T A;  2OKA A;  3F4T A;  2I4A A;  2F9S A;  1OC9 B;  3MNG A;  5DVB A;  3WYW A;  5HR3 A;  2X8C A;  4IVF A;  2VM2 A;  4ML1 A;  1M2A A;  4MJB A;  1AUC A;  3P7X A;  1AQW A;  3GH6 A;  5G1K A;  4CDO A;  2DLX A;  3W8J A;  4RI7 A;  4GTU A;  4NXI A;  4OFM A;  3IBH A;  4QL9 A;  1A8Y A;  1NHO A;  4GF0 A;  4BPY A;  4EUY A;  2V6O A;  1JLV A;  1U3A A;  5CRW A;  3QFA C;  2GSQ A;  2XC2 A;  4OD7 A;  3ME7 A;  1FB0 A;  3KMN A;  1E6B A;  4WF4 A;  3EIN A;  4PX1 A;  1WJK A;  2ES7 A;  13GS A;  3IPZ A;  4NAX A;  3PH9 A;  2OJL A;  2KP1 A;  4OFT A;  2E7P A;  1K0D A;  3CSH A;  3DD3 A;  2FA4 A;  4IKH A;  3HJM A;  3LYK A;  3PGT A;  1GRX A;  1YEX A;  1YJ6 A;  3TKR A;  5J9B A;  4FYC A;  4K2X A;  1T4Z A;  1B8X A;  4IJ3 A;  4MZB A;  3TJB A;  3L78 A;  3VI5 A;  5HFG A;  5DAL B;  1SK1 A;  5DQY A;  5KN1 A;  3VWU A;  1K0O A;  1VF3 A;  3VWW A;  1OC8 A;  1AQX A;  4USS A;  1B4P A;  1FHE A;  1Z7R A;  3A2W A;  2HRF A;  7GSS A;  3CTF A;  2RLI A;  2L4C A;  5G2Z A;  3LW9 A;  2YPM A;  2FCH A;  4MCU A;  1TW9 A;  1BJX A;  4BVX B;  2B7J A;  1A0R P;  3CMI A;  2MZC A;  1EV4 A;  1AAZ A;  2YWO A;  4L0W A;  4OO5 A;  2OA7 A;  3LFL A;  1BED A;  4OCE A;  5LNK e;  5DJM A;  1SD9 A;  2XPD A;  3MYD A;  3QR6 A;  2VO4 A;  2KUC A;  2GQL A;  1GL8 A;  3F63 A;  3RDW A;  2IL3 A;  5DAL A;  3CSJ A;  1SK0 A;  1Z6M A;  3KP9 A;  4RUV A;  4WR5 A;  4HUA A;  2TIR A;  3LWA A;  5KN0 A;  4ZB8 A;  5J9C A;  2I9H A;  1TP9 A;  3IAS 2;  3KH7 A;  1XCC A;  2E0Q A;  1THO A;  2PMT A;  4KX4 A;  2CZ3 A;  3KTB A;  2DJK A;  1TK8 B;  4K1F A;  2HRN A;  5DAK A;  3GUS A;  2LQO A;  4YKG A;  2CQ9 A;  1A2L A;  2Z9S A;  2PVQ A;  1XPV A;  4AF2 A;  4EC0 A;  5ECR B;  4E8E A;  3TKS C;  1T3B A;  1XWK A;  5AN1 A;  2CX4 A;  4JED A;  4DSS B;  1DE2 A;  1ACV A;  2CVK A;  3HVS A;  4NWY A;  1HNC A;  2VIM A;  2JZR A;  1QQ2 A;  1F6M C;  1W4V A;  4X0X A;  5ECQ B;  1TI3 A;  4CHS A;  4WET A;  1ERW A;  1T00 A;  2NBS A;  2VUP A;  2OBI A;  2HXK A;  2OE1 A;  3QDN A;  4YQM A;  2EIO A;  5CO3 A;  3MSZ A;  2AJQ B;  5ECK B;  2NTO A;  2AAW A;  3BCI A;  3KTL A;  2WCI A;  4G10 A;  1XFL A;  2UZ8 A;  3W6G A;  5DBQ A;  3M3M A;  4MA9 A;  1ON4 A;  4QQ7 A;  5D73 A;  3UBL A;  5IO2 A;  5A4V A;  4PUA A;  5IO0 A;  2JZT A;  3FYG A;  1KEB A;  4K7O A;  2JAD A;  2H8L A;  4K7N A;  1VRS D;  2D28 C;  2R0P A;  4ECB A;  3RBT A;  3QOU A;  3HD5 A;  1B4Q A;  2GLR A;  1SD8 A;  2GGT A;  4K5R A;  4HZ4 A;  2C1Y A;  1EV9 A;  3VK9 A;  5ELG A;  2YNX A;  3I69 A;  2H6Z A;  2WUL A;  2VL2 A;  1KTE A;  1F3A A;  3J7Y k;  3ZMK A;  4V2M A;  4A5P A;  3QAG A;  1JZD A;  4MJC A;  4KCE A;  1WIK A;  5G5E A;  3UAP A;  1ZMA A;  5G31 A;  5IQY A;  4N0V A;  1X0R A;  3FHK A;  5IMD A;  2VL2 C;  3Q74 A;  3UVH A;  2H73 A;  3HYP A;  3HZ8 A;  5EY6 A;  4FIW A;  3ZLP A;  1SKS B;  1XW5 A;  2I1U A;  2GSS A;  4FO5 A;  2DIZ A;  2PER A;  3A5W A;  2LNS A;  1V98 A;  3F6F A;  3I9V 2;  1V40 A;  4N10 A;  1ERV A;  5KOW A;  2P31 A;  3IAM 2;  2PGT A;  2ON7 A;  4G0K A;  2I81 A;  1X9S B;  1XIY A;  3RHB A;  2L59 A;  1SL0 B;  4K2D A;  3Q6O A;  1TK0 B;  1Y6E A;  4YQU A;  3ZYW A;  4DSS A;  4AJ7 A;  1JZO A;  2YWI A;  5IMV A;  5ECM B;  1FAA A;  2HRK A;  4HQS A;  5KN3 A;  1K0B A;  1JZW A;  1TRS A;  4G19 A;  3ZVJ A;  1RW1 A;  2MMA A;  19GS A;  3L9U A;  2FGX A;  3HVX A;  2HSM A;  4F82 A;  5KEJ A;  1JLW A;  2FLS A;  2CAI A;  3RPN A;  2B5X A;  2DML A;  2HZE A;  3TB2 A;  4O5Q A;  3CXG A;  2X4A A;  2BMX A;  1K3Y A;  2OE0 A;  1A23 A;  3A5I A;  1ST9 A;  4EF0 A;  1TRV A;  4TOP A;  5HR2 A;  3JCM L;  1RK4 A;  2DKH A;  2YWN A;  5ENU A;  3APQ A;  4O92 A;  4NPB A;  2DJ2 A;  3EMX A;  4IBP A;  2RII A;  2M46 A;  4AGS A;  2QGV A;  5D9X A;  2ZNM A;  1QGV A;  4MDC A;  1X5D A;  3ISO A;  1GSQ A;  1CQH A;  4KDU A;  4IQA A;  4K8M A;  5FT3 A;  1FVJ A;  3UVT A;  4MNN A;  3UL3 A;  2YZU A;  1DUG A;  4J2F A;  4G0L A;  4V1A p;  5ECP B;  5C00 A;  5F8B A;  2FWF A;  1JFU A;  4POL A;  2B1K A;  1A24 A;  4L5L A;  5HFK A;  1TRW A;  3ERG A;  4GSN A;  1NW2 A;  5JWR B;  1EP8 A;  2VCQ A;  3RPP A;  3EE2 A;  1PD2 1;  4IQ1 A;  4LLR A;  2C0D A;  1VF4 A;  5B7C A;  4MF7 A;  3IC4 A;  2RUE A;  3TCO A;  1Z6N A;  1LU4 A;  2D2Z A;  4NV2 A;  2PWJ A;  2X49 A;  5HR1 A;  4KF9 A;  3HKR A;  5D9W A;  2A4H A;  4K6X A;  4P3Y B;  3ZRD A;  2C80 A;  3UMA A;  4BWS A;  5IOX A;  3GMF A;  3TRP A;  4NHZ A;  1SL2 B;  1YF1 A;  3F6D A;  3IDV A;  2VCW A;  2VL3 A;  3Q18 A;  1MDI A;  3DIE A;  4XHM A;  3D22 A;  1SK2 A;  3HA9 A;  5H5R A;  1O85 A;  5COH A;  1ZOF A;  2GQM A;  2VM1 A;  4V2L A;  4RQR A;  4KGI A;  3GN3 A;  1OE7 A;  2L6D A;  4CY6 A;  1XW6 A;  2E2G A;  5G30 A;  1FW1 A;  2XHF A;  5ECN B;  1WP0 A;  2LEG A;  1M9A A;  4PUR A;  4WR4 A;  3D4T A;  3ZIV A;  1TTZ A;  3BBY A;  5DQS A;  4WXT A;  4EE0 A;  2ON5 A;  5D96 A;  2DJ0 A;  4DSQ A;  2O89 A;  1EP7 A;  2A2R A;  2WJU A;  3H79 A;  1DSB A;  1IYH A;  3WT2 A;  3DXB A;  1LJR A;  2HT9 A;  1M7T A;  4DSR A;  4TR1 A;  1Q98 A;  2L6C A;  4G2E A;  5A4U A;  3ZTL A;  5JWO B;  1O8W A;  2LRN A;  4OO4 A;  5E59 A;  4I6X A;  5IOW A;  1F9M A;  3CRU A;  4JR6 A;  4MZC A;  3FZA A;  1O8X A;  4XS1 A;  3ZFB A;  3FW2 A;  1V58 A;  3D4M A;  2ZUP A;  2H01 A;  2D27 A;  2VD0 A;  2YN1 A;  2J9H A;  1EOG A;  2LQQ A;  3R2Q A;  3LEF A;  4X4J A;  5FHI A;  2WB9 A;  4ZL9 A;  3M1G A;  2F51 A;  4TR0 A;  4Q5N A;  5IMC A;  2KOK A;  4GWR A;  2IFQ A;  2IN3 A;  5B8B A;  2G2Q A;  2LJR A;  2V32 A;  4TR1 B;  5LCZ A;  3IV4 A;  5ID2 A;  5D8I A;  2YOI A;  2GQK A;  2GT6 A;  1R5A A;  1GSY A;  1J0F A;  2PPT A;  4IHU A;  2N5F A;  5ECL B;  4O7H A;  2H0G A;  2C8U A;  3TGZ A;  2LRT A;  4XIH A;  2NPB A;  1XWC A;  3UBK A;  4POB A;  5ECS A;  1ZGN A;  3F9U A;  5H5S A;  5D93 A;  4K5S A;  2O85 A;  3G7J A;  3C73 A;  2K8V A;  2FY6 A;  3NIV A;  3TJJ A;  4KDY A;  1TU7 A;  4IEL A;  2RUF A;  3IXR A;  3M8N A;  3EU3 A;  2NDO A;  3I43 A;  2VCT A;  2PU9 C;  2M80 A;  6GST A;  1TK5 B;  4HDE A;  4F9Z A;  1BG5 A;  5C04 A;  1PL2 A;  3G9B A;  3APO A;  2MMZ A;  4HU9 A;  1AXD A;  1G6W A;  4EKZ A;  3IR4 A;  1WE0 A;  4FQU A;  2R37 A;  5D9V A;  1G7O A;  5BMU A;  1ZL9 A;  2VL9 A;  1MDJ A;  1A8L A;  1C72 A;  4LMV A;  3TJG A;  4F0C A;  5B8A A;  4XRA A;  3IRA A;  2HNL A;  1WOU A;  4CW9 A;  1PX6 A;  5F07 A;  5F0G A;  1O6J A;  5AGY A;  1YF0 A;  2C3Q A;  1I9D A;  3EVI A;  1GTB A;  3F4S A;  2VLV A;  1MTC A;  4PTS A;  1HNB A;  1V57 A;  1G6Y A;  1CQG A;  3WD6 A;  4NMU A;  2V1M A;  5FWG A;  5IIZ A;  4V2N A;  1K0N A;  2K6V A;  4GXZ A;  4ZXG A;  1FO5 A;  4ECI A;  1VF2 A;  1U88 A;  3N9J A;  6GSV A;  2PN8 A;  1GUL A;  4ZBB A;  2F8F A;  4XTS A;  4OCF A;  5IPG A;  4GCI A;  3EUR A;  1O81 A;  4D73 B;  1FOV A;  1BAY A;  4EDY A;  2HE3 A;  2WRT A;  2AV4 A;  4KW6 A;  3KZQ A;  3R3E A;  3D6I A;  2H30 A;  1Z5Y E;  1SJ6 A;  2H72 A;  2CAQ A;  3U5R E;  3QFB C;  1G7E A;  1EGR A;  3TKP A;  2WGR A;  5CYY A;  3GV1 A;  3RAZ A;  2H70 A;  1FVK A;  2FWH A;  3A2X A;  3QAV A;  5DJL A;  4AJ8 A;  3UEM A;  4ZL7 A;  1SEN A;  4IP6 A;  4HQZ A;  1YQ1 A;  5ID2 B;  3FMW A;  5D9T A;  2IWT A;  4FYU A;  3BOA A;  4WF5 A;  3EC3 A;  2H1A A;  3D0Z A;  5ECO B;  3ME8 A;  2C4J A;  2X64 A;  1GTA A;  2R0C A;  2GST A;  3GST A;  11GS A;  3FZ4 A;  4ISD A;  2K8S A;  1T7P B;  1SKR B;  5CRE A;  3F0I A;  4PQH A;  5LD0 A;  1G0T A;  1OKD A;  4WEY A;  4GQC A;  3GIX A;  4ECC A;  4J57 E;  3EMP A;  3M9J A;  1R4W A;  2H75 A;  1PGT A;  2V2G A;  2HFD A;  1I5G A;  3L9V A;  2OE3 A;  2FNO A;  2P5Q A;  2B7K A;  1OC9 A;  3HVV A;  2HZF A;  1EEJ A;  2DIY A;  1TDI A;  3QD9 A;  1PL1 A;  1XXU A;  1S3C A;  3GUR A;  2WDU A;  5HQP A;  1M99 A;  1GSE A;  3US3 A;  1B9Y C;  4I8B A;  4H86 A;  3PR8 A;  1EWX A;  5INY A;  6GSU A;  2VCV A;  3KP8 A;  4TW5 A;  2LRC A;  3IA1 A;  2N5B A;  3N5O A;  2GDR A;  3J7Y b;  3GH9 A;  3ZVJ D;  1GSS A;  3GSS A;  4Q5R A;  1GLQ A;  2R5G A;  4O5U A;  3ZZX A;  4OFN A;  1FB6 A;  4TRX A;  3C1R A;  3L4N A;  3G7I A;  1TJD A;  3VFI A;  2VD1 A;  3H8Q A;  3IHQ A;  3KH9 A;  9GSS A;  12GS A;  3NOF A;  4PUF C;  1PN9 A;  4IS0 A;  2CA8 A;  2L5O A;  4WKW A;  4HOJ A;  4FYB A;  4HI7 A;  4ZB9 A;  3TUE A;  3GTU A;  17GS A;  1S3A A;  3HJO A;  2B5E A;  1PKZ A;  2EIR A;  4L0U A;  5H5Q A;  4BVX A;  5HR0 A;  4ICY A;  1XWB A;  4KSM A;  3GKN A;  4LL4 B;  4F03 A;  2YZH A;  2BTO T;  3ZIT A;  4FH8 A;  5B6N A;  2HRA A;  4MP4 A;  3D5J A;  1YY7 A;  3TRX A;  2QC7 A;  3P90 A;  4F0B A;  4IGJ A;  3U6V A;  1BYE A;  2R6K A;  2LNT A;  5HFI A;  4O5R A;  3GA4 A;  2A2S A;  2YV7 A;  2IPA A;  2H0I A;  2L57 A;  1U3I A;  2MBS A;  3UAR A;  5EL8 A;  4ID0 A;  3ZML A;  5E4W A;  2E2M A;  3G7Y A;  1XWG A;  1E2Y A;  4KUN A;  2WS2 A;  4GQF A;  3BJ5 A;  4I2T A;  4BVY B;  1J08 A;  5DAK B;  2XBI A;  3QCP A;  3LYP A;  2GT5 A;  4XS6 A;  5ECH B;  3FEU A;  1KNG A;  3TKS E;  4O32 A;  5J4U A;  4V1A g;  2B3S A;  4GST A;  5GAN D;  8GSS A;  1S3D A;  4MJA A;  1K0A A;  1PSQ A;  1N8J A;  2DBC A;  1ERU A;  1PN0 A;  2REM A;  1X9M B;  4K0G A;  2YWM A;  2P0G A;  5IMF A;  1A2M A;  5AIX A;  2MMO A;  1EZK A;  4KDX A;  1MEK A;  5JCW A;  1GSF A;  4IN0 A;  4N30 A;  1YKC A;  1B9X C;  3UOM A;  4K7I A;  4MH2 A;  4WBR D;  3MWH A;  1X5C A;  3ZIJ A;  2H19 A;  1R5P A;  3ED3 A;  2FUG 2;  1KBN A;  3IHG A;  1NHY A;  4HU7 A;  3GX8 A;  1ZYP A;  2H71 A;  4MJE A;  4CY8 A;  3KCM A;  4KH7 A;  4EDZ A;  3A3T A;  4ECJ A;  1T1V A;  1ZCP A;  2C3T A;  5B6M A;  5GST A;  5KN2 A;  4BWQ A;  2FWE A;  2X8G A;  1R26 A;  3GL5 A;  1TRU A;  2I3Y A;  5A4W A;  2IFQ B;  2VCZ A;  2LST A;  3VI7 A;  3QAW A;  5IMZ A;  2AB6 A;  3ERF A;  18GS A;  4LA1 A;  1H75 A;  2NVL A;  2X8H A;  3KM6 A;  2KP2 A;  2JL4 A;  3SWL A;  1AC1 A;  3I6A A;  2X99 A;  4K9Z A;  2FA8 A;  4HJM A;  2BJX A;  3VUR A;  3KGK A;  2DC5 A;  1XWA A;  3GFK A;  4QL7 A;  1SU9 A;  4KND A;  3FZ5 A;  3E9J B;  1Q4J A;  4LMW A;  1MD4 A;  2GZP A;  3TKS A;  3KD0 A;  1AW9 A;  2EIQ A;  3WGX A;  1GSU A;  1NSW A;  4Q5F A;  1NM3 A;  2A2P A;  2YV9 A;  1OC3 A;  2VLU A;  1O73 A;  4PGT A;  1QXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...