3F4SA

Crystal structure of wolbachia pipientis alpha-dsba1 t172v
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
199
structure length
199
Chain Sequence
TSNELLLPLPNDKLLGDPKAPILMIEYASLTCYHCSLFHRNVFPKIKEKYIDTGKMLYIFRHFPLDYRGLKAAMLSHCYEKQEDYFNFNKAVFNSIDSWNYYNLSDLTLLQRIAALSNLKQDAFNQCINDKKIMDKIVNDKSLAINKLGITAVPIFFIKLNDDKSYIEHNKVKHGGYKELKYFTNVIDKLYGKAIVKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structural and Functional Characterization of the Oxidoreductase alpha-DsbA1 from Wolbachia pipientis
pubmed doi rcsb
source organism Wolbachia pipientis
molecule tags Oxidoreductase
total genus 74
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2008-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.80 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Ribonucleotide Reductase Protein R1; domain 1 3f4sA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3f4sA01
5H5SA 1XPVA 2M72A 5EL8A 2HRFA 3G7JA 1J08A 3FZ5A 5ENUA 1F9MA 5ECLB 1XW5A 3CYNA 3QFBC 4RQXA 4G19A 1XWCA 3HKRA 2HXKA 5AN1A 1V58A 4IJ3A 4JRRA 2P5RA 1XW6A 1XWBA 2PUKC 3M1GA 3ERWA 2PU9C 1I5GA 2O89A 4P3YB 2AJQB 1WRYA 5IPHA 2C3TA 3L4NA 5DBQA 5F07A 4RQRA 1T8EB 2HLSA 5D73A 2DIZA 2WFCA 1SK2A 1M0UA 4XIHA 1BX9A 4GSSA 1WP0A 14GSA 4X0XA 3F4SA 3I69A 1R5PA 4K6XA 3UOMA 2L5OA 2AUVA 4OFNA 1QUWA 1FB0A 3IRAA 3WGDA 1M99A 2LJKA 2L4CA 2CX4A 4D73B 1B4QA 2H0HA 1AQWA 1OE8A 2VAFA 3LGCA 1FB6A 4HZ4A 4MZBA 7GSSA 4MF5A 4AF2A 4EDZA 1J0FA 1Z5YE 4JU5A 3VPTA 2DJKA 3P8WA 3ERGA 3BOAA 1FO5A 5DAKA 3HXSA 3QAVA 1V57A 2GT5A 4IVFA 2H01A 1WJKA 4HU9A 3GNJA 5J5NA 1FOVA 3FEUA 5EVOA 2I9HA 3DRNA 1AUCA 1PGTA 1ML6A 1U87A 12GSA 3ISOA 5ELAA 4L0WA 1WOUA 3LXTA 4GF0A 1Z6NA 2EIRA 2NDOA 2BTOT 4PNFA 5JCGA 2K8VA 3GUSA 4K7NA 1V98A 5IPGA 2WRTA 2LS5A 5CAXA 2L59A 2LNSA 3MNGA 2NBSA 4QL9A 2VLVA 19GSA 3A2XA 2YWMA 3EU3A 1XIYA 2HZEA 2H76A 3GFKA 4I8BA 3IE3A 2R3XA 1UVZA 1A2MA 2IN3A 4I6XA 4KNDA 1V40A 2ZCTA 1V9WA 2M46A 3EYTA 2C3NA 3QD9A 5J41A 3N9JA 3DGQA 1ZL9A 3F4TA 2H19A 1OC3A 2IFQA 3TKPA 5CRGA 4GXZA 4NXIA 1MTCA 1ERTA 4V2LA 2RM6A 4F82A 4EUYA 2QKEA 2HT9A 3TKRA 4K9ZA 4G2EA 3ZZXA 2HZFA 4BWQA 4J2FA 3DVXA 1OC9A 1ERUA 3I9V2 2LUSA 3HJOA 1B48A 2P31A 1K3YA 1O7UA 1PL1A 4YAPA 4MPGA 4ZBBA 1N8JA 3DKSA 1W89A 1G7OA 1MD4A 1BG5A 3FK8A 5G1LA 2LQQA 4TXOB 1FW1A 3VLNA 4HQZA 4ILFA 1THOA 2HSYA 4TR1A 2C0GA 4NWYA 3FR6A 4ML6A 3C73A 5CREA 1MD3A 3KZQA 1JZWA 4ECBA 5DALA 2REMA 3EWLA 3TKQA 4GLTA 3LQ7A 2XHFA 4I2TA 2B1KA 3NOFA 2CQ9A 3RHBA 5G2ZA 2H0GA 2C3QA 2I81A 2MYGA 1YEPA 1GSDA 3DWVA 3C1SA 4X1UA 2HSHA 4HDEA 4K0GA 1LBKA 2LTKA 3GL5A 4DSSB 2DJ1A 1JLVA 1PRXA 3D5JA 5IQYA 1A23A 1K0BA 2EIQA 3KCMA 4E8HA 4BVXA 3IAS2 4PURA 1MEKA 2H6XA 3U6VA 6GSWA 2FA8A 4JE1A 5KN2A 1GTAA 1FG4A 1JHBA 1TKDB 2H70A 1J9BA 1USBA 3CSJA 2L6DA 2C4JA 4ZB8A 2QSIA 2I3YA 5FHIA 4OMVA 2RUFA 3WGXA 2R5GA 4AJ6A 4NHZA 2VD1A 2KP1A 3APOA 2GLRA 6GSTA 3A3TA 4POKA 1Q4JA 3ZL5A 3M9KA 2B5XA 3IK9A 3Q19A 3HCZA 1JLWA 2HYXA 4OO5A 5GZZB 2YANA 4EL1A 2VL2C 2VCXA 1HNCA 5D9VA 5CRWA 2YJHA 3R2QA 1M2AA 1DE1A 3M3MA 5B7CA 3FZ9A 3ZIJA 1SKRB 1TDIA 3IBHA 3KP9A 1Z7RA 1IYHA 1HQOA 1GULA 2JZRA 3EMPA 1SYXA 4OFTA 1JFUA 3PH9A 1S3CA 4ACSA 4JR4A 1FHEA 3GTUB 3F9UA 1H75A 1KTEA 4MDCA 4FIWA 4EC0A 4O92A 1U3AA 2E7PA 5ECKB 1DUGA 3LXZA 22GSA 4IW9A 2R6KA 2ZUPA 3UL3A 4YH2A 1PA3A 4HS1A 2JZTA 3F0IA 2YV7A 3HYPA 3LG6A 3VWUA 2H0IA 1JZRA 2V32A 2MBSA 3EE2A 4QL7A 4LMWA 3LJRA 3LYKA 5IMDA 1FVJA 3S9FA 1AIUA 5ECHB 4DSQA 2K6VA 1YQ1A 4NV5A 1PKZA 2JZSA 1GH2A 4WR4A 2O87A 4JZQA 4F0BA 4EDYA 1ZGNA 5F06A 1EOGA 1UC7A 3D6IA 5DJMA 3D21A 6GSXA 3TJJA 1GSYA 2F8AA 1OVNA 3IK7A 1TRUA 3QPMA 1ZCPA 1PMTA 3L78A 2YV9A 3QOUA 2HNLA 4KSOA 1ZYEA 4RUVA 4XS1A 4MF6A 3FYGA 1BYEA 1RW1A 2IMDA 4MH2A 1IYIA 1AAZA 2LJRA 4OCFA 1EP7A 1CQHA 1OKDA 1TI3A 2K18A 3KH9A 2F9SA 4RI6A 2L57A 3UARA 2GZZA 3VFIA 1VF1A 3VWVA 5HFIA 3QFAC 2XC2A 4OCEA 2G2QA 4HEA2 2WCIA 3U5RE 1XOBA 2X8HA 4XS4A 1GSUA 3W8SA 1GRXA 4MZCA 2H6YA 4WR5A 3CMIA 1QGVA 4GSTA 3CSIA 4NAXA 2LRNA 2N5FA 3GHAA 5DVBA 1A2JA 2H66A 1F3BA 5FWGA 4ZXGA 3CXGA 4K8MA 3CTGA 4YQVA 4MJAA 2IIYA 3OR5A 2J9HA 3WD6A 3V1WA 5L71A 1WPIA 2GQKA 5ECIB 5AISA 2AYTA 2H73A 2VL2A 2IMIA 3H1NA 5D9WA 3TJKA 3UBKA 3FKFA 1TRWA 3W8JA 1OC8A 2OE3A 4TRXA 2MZCA 4GQFA 3HZ4A 2B5EA 4TR0A 1K3LA 1EGRA 3J7Yk 1NHOA 1TJDA 1T00A 1G7EA 1DSBA 4L5OA 2RM5A 5KN3A 2KHPA 2FGXA 3LYPA 2WDUA 1MDKA 3GH6A 1GTUA 4KE3A 1QMVA 1OE7A 2B7JA 3MWHA 5D8IA 3KEBA 2FA4A 4NV2A 2MBTA 1EOHA 2F3MA 2DLXA 3Q18A 4KB3A 2GQMA 1XOAA 5IMAA 1XWAA 3G9BA 2H1DA 2OA7A 2QC7A 3UEMA 2F51A 1T1VA 4KSMA 4JEDA 2PVQA 2WS2A 4D73A 2V41A 3KP8A 1SD8A 2CAQA 1VGLA 2LNTA 1A24A 5CP1A 1YY7A 1XWGA 2GT6A 2CA8A 4BVYA 1GSFA 4XCSA 1R26A 5ECNB 2L4QA 2CT6A 4MJBA 1SENA 1MDJA 1QFNA 1TOFA 5HFKA 4N30A 1H4OA 1ST9A 3EC3A 2E2GA 3TKSE 4GSNA 5AGYA 2R4VA 5DQYA 3IPZA 3UJ1A 2DJ2A 5J4UA 1TXXA 1WE0A 5ECQB 3RBTA 2PPTA 1SYRA 4IGJA 1Q98A 2OE0A 5G30A 4BA7A 1VRSD 1G6WA 3ZVJA 2GSRA 2YWIA 3KD0A 3TDGA 2CZ2A 4KA0A 4EF0A 2JSZA 1O85A 2VM2A 1SKWB 5IMCA 2BJXA 3GRXA 1M9BA 1TI1A 4N0VA 2E2MA 4OWYA 2LKUA 3HVSA 3HDCA 5F8BA 3KTBA 2LJAA 2O8VB 4FYUA 2A2SA 5IIZA 4O32A 3GA4A 1ZZYA 4YAVA 4MZWA 2LSTA 2FHEA 4K7IA 3FR3A 3ZREA 2DBCA 2RIIA 5FT3A 1XZOA 2V2GA 4N0ZA 3GURA 2LRCA 3TOTA 2DJ0A 1QQ2A 1A8LA 1SJ6A 2Z9SA 1K0AA 3GX0A 3PGTA 5F0GA 3F6FA 3GKXA 2H74A 3KH7A 4MABA 1K0CA 1SJZA 1SL0B 1KNGA 3ZIVA 3BJ5A 2YZHA 2FWGA 1SD9A 1HNAA 3A2VA 2MMNA 3HVVA 2AV4A 5ECPB 4QQ7A 3IHQA 5D93A 3NZNA 2OACA 3HJPA 4POMA 3KGKA 4TXOA 5A4WA 2N5BA 4ECJA 3I6AA 3E0UA 1JZDA 5HR2A 5D9TA 1X5CA 1QK8A 1M7TA 3MAKA 2BMXA 2AB6A 1BJXA 1URMA 4ECIA 4ZB9A 5D96A 3TJFA 2AHEA 1ERWA 3N5OA 1GSSA 2L5LA 2TRXA 4OFMA 1XCCA 5G5FA 5C04A 4L0UA 1KBNA 1WMJA 2CVBA 4PUFC 2OE1A 3US3A 5HQPA 2VD0A 1K0NA 3LORA 2NTOA 5JWRB 1DBYA 3KJYA 3HHVA 1EV9A 5CYYA 4MA9A 3GSSA 5DCGA 2LEGA 3G7YA 3QMXA 3WYWA 2X8GA 4ECCA 3KMNA 3UMAA 3BD2A 3EVIA 5ID2B 4ZILA 2LV3A 4DSSA 3Q74A 4FYBA 3GIXA 4IS0A 4ZL8A 2YOIA 4ZBDA 2E0QA 4ID0A 2GSQA 4F0CA 5ECOB 3SWLA 1R4WA 2P0GA 17GSA 3TRQA 4KUNA 1NW2A 2DC5A 1YKCA 1A2LA 4MH3A 1I9DA 5A4VA 2JSYA 1TRSA 3LFLA 2VO4A 3VPQA 4DSRA 4WF5A 4KAEA 3CTFA 1O8XA 3TJBA 2VOCA 2C80A 4FYCA 1V2AA 3VWXA 5IMVA 3FY7A 5JCUA 4HOJA 2YNXA 3C8EA 1Z6MA 3ME7A 1M9AA 5J3RA 1GL8A 3MSZA 2B5YA 3RDWA 1O8WA 4I97A 4HJMA 2AAWA 1EGOA 4IP1A 5J9CA 3WT1A 3F8UA 2WB9A 5ECMB 1UA5A 3L9SA 3BBYA 4RI7A 1EEMA 2OBKA 5CNWA 1SL2B 4ZB6A 1O73A 3MDKA 3NIVA 4HI7A 3DIEA 4HZ2A 1VF3A 2RLIA 5CRHA 1B9XC 2ON7A 3TRXA 2IJYA 3O76A 1AC1A 2CV4A 3GN3A 4MP4A 2MMAA 2V1MA 2JACA 5GSSA 3LSZA 3GTUA 5IO0A 5ECRB 2C0FA 1RQMA 3IXRA 1SK0A 5HR1A 2VL9A 3ZYWA 2YPMA 2JL4A 2B1LA 1ACVA 3O6TA 1EZKA 2TRCP 1EV4A 3ZTLA 1GTIA 2DJJA 3IAM2 3KMOA 2H8LA 2B6MA 2DIYA 1Z3EA 3KTLA 1FVKA 4TKYA 4GCIA 1T4YA 2X99A 2YP6A 3ZFBA 5LD0A 4KDUA 3UVTA 1G0TA 3F4RA 3PR8A 5INYA 3F3RA 4ZL9A 5KN1A 2IMKA 2CZ3A 3E3EA 3KM6A 3KIJA 3D4TA 1A8YA 5EPFA 1K3OA 3APSA 1GWCA 4TW5A 3P90A 5E4WA 4XS6A 3DEXA 4KH7A 1EWXA 2WJUA 5COHA 1GNEA 2VIMA 3H8QA 4K2DA 1AXDA 3P7XA 3VWWA 2FLSA 3C7MA 4K0NA 4PQ1A 3HD5A 1ABAA 4MF7A 3F3QA 3EU4A 2OJLA 3K8NA 4KX4A 4MCUA 5ELGA 5KEJA 3A5WA 2OADA 1PD21 3HA9A 4GWRA 2YZUA 5A5KA 4V2NA 2FY6A 3TUEA 5JWOB 1GTBA 3GKMA 4O7HA 4K1FA 2FWEA 2H30A 1RK4A 2D2ZA 1XXUA 3E9JB 3IR4A 3DD3A 2OKAA 1MDIA 4OO4A 4KW6A 1TU7A 2YJ7A 4GRFA 3LWAA 3VK9A 1EEJA 1E6BA 5H5RA 4IHUA 1U88A 1PX7A 1T3BA 3VI5A 2K9FA 2XBIA 1BQ7A 4TN8A 4GQCA 3UVHA 2C1YA 1SL1B 1A0RP 1KEBA 4JBBA 4YQMA 4XHMA 4I2UA 1W4VA 4PNGA 4HQSA 1YEXA 2CVKA 3D22A 9GSSA 1B9YC 2N5AA 1Z9HA 3GH9A 2YCDA 1X9SB 2VLTA 2YWOA 4YQUA 1F2EA 4DEJA 4LA1A 5IOXA 2CX3A 1TP9A 1AW9A 3QAWA 2GDRA 2L6CA 1BEDA 1T4ZA 3VI7A 3M9JA 4I5QA 2H72A 6GSSA 5GAND 4G9HA 2CVDA 4WBJA 11GSA 1OYJA 5IO2A 3CRUA 4IQ1A 2WULA 2C0EA 2A4VA 3G7IA 3L9UA 5IMFA 4Z7XA 3L9VA 5JWQB 4NMUA 4XRDA 4L8EA 4O5RA 4TR4A 1BAYA 1AQXA 2PN8A 2G0FA 2GVPA 3ZLPA 4ULXA 1OKTA 4E8EA 2DJ3A 2IMEA 5HR0A 1GSEA 2FCHA 2KUCA 6GSUA 5AIVA 4XTSA 1HD2A 4IBPA 1M2BA 4ML1A 2XBQA 1M2DA 3GKNA 3O3TA 3EMXA 2RUEA 1YJ6A 2A2RA 3GKKA 2IMFA 4IKHA 18GSA 3CBUA 3HZ8A 1OAZA 4Q5QA 1YF0A 4V1Ag 4TR3A 5B8BA 1NHYA 3GL3A 3FW2A 1XBSA 2ON5A 4J57E 5IMZA 2IPAA 3FHKA 5G5EA 1X5DA 4K7OA 4BWSA 5DAKB 4L5LA 5JCWA 3SBCA 6GSVA 4Q5FA 3QR6A 4DVCA 1TRVA 2PMTA 4CHSA 5E59A 3DXBA 5A4UA 2KP2A 1HNBA 3IV4A 3I43A 1GUHA 1ILOA 1NSWA 2I1UA 3AY8A 4JR6A 3UAPA 3CRTA 3UBLA 4BPYA 1C72A 5GAPD 4EO3A 5B6MA 1LJRA 2H75A 2WZ9A 2ES7A 3H4KA 5HR3A 2FWHA 3TCOA 2FUG2 2XPDA 2HRNA 4IELA 3GYKA 2HZEB 3GX8A 3TJGA 2MMOA 1PL2A 2H1BA 1XFLA 5C00A 2DSAA 4KCAA 2O7KA 2R2JA 1G6YA 3ZRDA 2H1GA 3PINA 5F05A 2B3SA 3J7Yb 4G10A 3D4MA 2DMLA 4ZL7A 5ECSA 3VURA 3A2WA 1A0FA 1U3IA 3QDNA 3W6GA 1U6TA 5IM9A 1ZMAA 2IFQB 5ABRA 2X8CA 1FAAA 4PQIA 3BCKA 3UIWA 2PGTA 5CRDA 3ED3A 2C8UA 1ZOFA 4IN0A 1WWJA 4WBRD 1OC9B 2M80A 3HJMA 2GZPA 4WEYA 2FNOA 1O6JA 3ZITA 3ZFLA 5CO3A 3JCML 4EXJA 2KOKA 1B4PA 5DCHA 1TU8A 4POLA 4PUAA 5KN0A 3Q6OA 4J56E 4H86A 3M8NA 10GSA 3H79A 1CQGA 1F37A 1JZOA 4LMVA 3EURA 1GUKA 2YN1A 2H1AA 1R5AA 3F63A 1GLQA 3GV1A 3HVXA 3P2AA 2J23A 4PGTA 4POBA 4TR1B 3RAZA 3TKSC 2B7KA 4MMMA 3KXOA 1PX6A 1GNWA 2GZYA 5DALB 1XVQA 1XVWA 4WF4A 3IC4A 1YZXA 4TOPA 3ZVJD 2R37A 4WETA 1UN2A 2VCQA 4EKZA 5ID2A 4CDOA 3F6DA 3DYRA 1YF1A 2VM1A 5G1KA 2NPBA 5B8AA 1T7PB 4ZBAA 4FO5A 4AJ7A 4MLYA 3FRCA 1TK5B 2ALBA 2MMZA 4MPFA 2XPEA 2OBIA 4WKWA 5D9XA 1PKWA 3FR9A 1ZYQB 4F2IA 4IP6A 2VCZA 4OD7A 1HYUA 2VL3A 1N2AA 4KCEA 4Q5RA 4MJEA 1F3AA 5IOWA 1QXHA 2TIRA 4WXTA 3RHCA 3WGEA 1SK1A 2YWNA 2PVOC 2PWJA 1NM3A 1X0RA 3TGZA 4N11A 4BL7A 4XRAA 3WT2A 3M0FA 2ZNMA 4PXOA 4LL1B 3EINA 4TXVA 3QAGA 4IJIA 3FZ4A 2H6ZA 5J9BA 2X64A 2F8FA 1PQNA 5LNKe 3DVWA 3BCIA 1E2YA 2GSSA 1X9WB 2LQOA 1VF4A 5DQSA 1R7HA 2IL3A 5DDLA 1B8XA 3CSHA 1X5EA 4V2MA 8GSSA 1EP8A 5EY6A 4F9ZA 1GLPA 1Y6EA 1TK0B 3ZMKA 1LU4A 4KGIA 1K0OA 2EIOA 2WGRA 3APQA 1Y25A 3RPNA 1XWKA 4MK3A 4PX1A 2PBJA 1K0DA 1AQVA 3ERFA 3GSTA 1SJIA 2GTUA 1K0MA 4LL4B 4LLRA 3FZAA 4IQAA 1Z7PA 3TB2A 2C0DA 2GGTA 3IDVA 1TTZA 2O85A 2HE3A 3C71A 5HFGA 4Q5NA 4PQHA 3QCPA 3D0ZA 4HU7A 20GSA 4EE0A 2VCVA 3ZMLA 4CW9A 2H71A 3LEFA 4ISDA 5LCZA 1DE2A 4EVMA 3DMLA 4AJ8A 2GS3A 4HJ2A 1YDKA 3TKSA 2V6KA 1TW9A 6GSYA 1O81A 4X43A 5DJLA 1ERVA 4F03A 3HY2A 4V1Ap 2HI7A 2QGVA 2VCWA 2JADA 3RPPA 4TVEA 2LRTA 1YKAA 1ON4A 4NPBA 2HFDA 1THXA 3C1RA 2JU5A 2K8SA 5AIXA 2VCTA 2FD3A 2CAIA 4FH8A 4HUAA 4MJCA 2FWFA 5G31A 1X9MB 2VUPA 3H93A 1SU9A 1PSQA 1S3AA 5B6NA 4AGSA 13GSA 3ME8A 4ZIJA 2V6OA 3L0HA 2GSTA 2I4AA 2IWTA 1GP1A 2PERA 1TK8B 1F6MC 2NVLA 5GSTA 1GSQA 1VF2A 2VLUA 3IOSA 5H5QA 4KDXA 4NHWA 3TRPA 1XW9A 4GTUA 1S3DA 1SKSB 2KLXA 1PN9A 1GUMA 4XS4B 16GSA 2GQLA 2EC4A 3TOUA 2DMMA 4N10A 3IA1A 2P5QA 4KDYA 1WIKA 3GMFA
chains in the Genus database with same CATH superfamily
5H5SA 1XPVA 2M72A 5EL8A 2HRFA 3G7JA 1J08A 3FZ5A 5ENUA 1F9MA 5ECLB 1XW5A 3CYNA 3QFBC 4RQXA 4G19A 1XWCA 3HKRA 2HXKA 5AN1A 1V58A 4IJ3A 4JRRA 1YFMA 4HSCX 2P5RA 4Z2UA 4YIKA 1M3IA 1XW6A 1XWBA 1Z4LA 2PUKC 1TJUA 3M1GA 3ERWA 4EIPA 2PU9C 1I5GA 2O89A 4P3YB 2AJQB 4YIHA 1WRYA 5IPHA 2C3TA 3L4NA 5DBQA 5F07A 4RQRA 3IHGA 1T8EB 2HLSA 5D73A 2DIZA 1Q92A 2WFCA 1SK2A 1M0UA 4XIHA 1BX9A 4GSSA 1WP0A 14GSA 4K5RA 4X0XA 3F4SA 3I69A 1R5PA 4K6XA 3UOMA 2L5OA 2AUVA 4OFNA 1QUWA 1FB0A 3IRAA 1FURA 3WGDA 1M99A 2LJKA 2L4CA 2CX4A 4D73B 1B4QA 2H0HA 1AQWA 1OE8A 1Q5NA 2VAFA 3LGCA 1FB6A 4HZ4A 4MZBA 7GSSA 4MF5A 4AF2A 4EDZA 1J0FA 1Z5YE 4JU5A 3VPTA 2DJKA 3P8WA 3ERGA 2HSMA 3BOAA 1FO5A 5DAKA 3HXSA 3QAVA 1V57A 2X4AA 2GT5A 4IVFA 2H01A 1WJKA 4HU9A 3GNJA 5J5NA 1FOVA 3FEUA 2I9HA 5EVOA 3DRNA 1AUCA 1PGTA 1ML6A 1U87A 12GSA 3ISOA 5ELAA 4L0WA 1WOUA 5KOXA 3LXTA 4GF0A 1Z6NA 2EIRA 2NDOA 2BTOT 4PNFA 5JCGA 2K8VA 3GUSA 4K7NA 1V98A 5IPGA 2WRTA 1Z4JA 2LS5A 5CAXA 2L59A 2LNSA 3MNGA 2NBSA 4QL9A 2VLVA 19GSA 3A2XA 2YWMA 3EU3A 1XIYA 2HZEA 2H76A 3GFKA 4I8BA 3IE3A 2R3XA 1UVZA 1A2MA 2IN3A 4I6XA 4KNDA 1V40A 2ZCTA 1V9WA 2M46A 3EYTA 2C3NA 3QD9A 5J41A 3N9JA 3DGQA 3R6QA 1ZL9A 3F4TA 2H19A 1OC3A 2IFQA 3TKPA 5CRGA 4GXZA 4NXIA 1MTCA 1ERTA 1Z4MA 4V2LA 2RM6A 4F82A 4EUYA 2QKEA 2HT9A 3TKRA 4K9ZA 4G2EA 3ZZXA 2HZFA 4BWQA 4J2FA 3DVXA 1OC9A 1ERUA 3I9V2 2LUSA 3HJOA 1HY1A 1B48A 2P31A 1K3YA 1O7UA 4ICYA 1PL1A 4YAPA 4MPGA 4ZBBA 1N8JA 3A5IA 3DKSA 1W89A 4G0IA 1G7OA 1MD4A 1BG5A 3FK8A 5G1LA 2LQQA 4TXOB 1FW1A 3VLNA 1U15A 1DCNA 4HQZA 4ILFA 1THOA 2HSYA 4TR1A 2C0GA 4NWYA 3FR6A 4ML6A 3C73A 5CREA 1MD3A 1FUPA 3KZQA 1JZWA 4ECBA 5DALA 2REMA 3EWLA 3TKQA 4GLTA 3LQ7A 2XHFA 4I2TA 2B1KA 3NOFA 4K5SA 2CQ9A 3RHBA 5G2ZA 2PTRA 2H0GA 2C3QA 2I81A 2MYGA 1YEPA 4MX2A 1GSDA 3DWVA 3C1SA 4X1UA 2HSHA 4HDEA 4K0GA 1LBKA 2LTKA 1TJWA 2YV5A 3GL5A 4DSSB 2DJ1A 1JLVA 1PRXA 3D5JA 4PTSA 5IQYA 1A23A 1K0BA 2EIQA 3KCMA 4E8HA 4BVXA 3IAS2 4PURA 1MEKA 2H6XA 3U6VA 6GSWA 2FA8A 4JE1A 5KN2A 1GTAA 1FG4A 1JHBA 1U16A 1TKDB 2H70A 1J9BA 1RE5A 1USBA 3CSJA 2L6DA 2C4JA 4ZB8A 2QSIA 2I3YA 5FHIA 4OMVA 2RUFA 3WGXA 2R5GA 4AJ6A 4NHZA 4EIQA 1U0LA 2VD1A 3TV2A 2KP1A 3APOA 4BL7B 2GLRA 6GSTA 3A3TA 4MWOA 4POKA 1Q4JA 3ZL5A 3CQFA 3M9KA 2B5XA 3IK9A 3Q19A 3HCZA 1JLWA 2HYXA 4OO5A 5GZZB 2YANA 4EL1A 2VL2C 2VCXA 1HNCA 5D9VA 5CRWA 2YJHA 3R2QA 3C8TA 1M2AA 1DE1A 3M3MA 5B7CA 3FZ9A 1FUOA 3ZIJA 1SKRB 1TDIA 3IBHA 3KP9A 1Z7RA 1IYHA 1HQOA 1GULA 2JZRA 2D28C 1SYXA 3EMPA 4OFTA 1JFUA 3PH9A 3BHGA 1S3CA 4ACSA 4JR4A 1FHEA 3GTUB 3F9UA 1H75A 1KTEA 1MH9A 4MDCA 4FIWA 1K7WA 4EC0A 4O92A 1U3AA 2E7PA 5ECKB 1DUGA 3LXZA 22GSA 4IW9A 2R6KA 2ZUPA 3UL3A 4YH2A 1PA3A 4HS1A 2JZTA 3F0IA 2YV7A 3HYPA 3LG6A 3VWUA 2H0IA 1JZRA 2V32A 2MBSA 3EE2A 4QL7A 4LMWA 3LJRA 3LYKA 5IMDA 1PN0A 1FVJA 3S9FA 1AIUA 5ECHB 4DSQA 2K6VA 1YQ1A 4NV5A 1PKZA 2JZSA 1GH2A 4WR4A 2O87A 4JZQA 4F0BA 4EDYA 1ZGNA 5F06A 1EOGA 1UC7A 3D6IA 5DJMA 3D21A 6GSXA 3TJJA 1GSYA 2F8AA 1OVNA 3IK7A 1TRUA 3QPMA 4CY6A 1ZCPA 1PMTA 3L78A 2YV9A 3QOUA 2HNLA 4KSOA 1ZYEA 4EEIA 4RUVA 4XS1A 4MF6A 3FYGA 1BYEA 1RW1A 2IMDA 4MH2A 1IYIA 1AAZA 2LJRA 4OCFA 1EP7A 1CQHA 4L6AA 1OKDA 1TI3A 2K18A 3KH9A 2F9SA 4RI6A 2L57A 3UARA 2GZZA 3VFIA 1VF1A 3VWVA 5HFIA 3QFAC 2XC2A 4OCEA 2G2QA 4HEA2 2WCIA 3U5RE 1XOBA 2X8HA 4XS4A 1GSUA 3W8SA 1GRXA 4MZCA 2H6YA 4WR5A 3CMIA 1QGVA 4GSTA 3CSIA 4NAXA 2LRNA 2N5FA 3GHAA 5DVBA 1A2JA 2H66A 1F3BA 5FWGA 4ZXGA 3CXGA 4K8MA 3CTGA 4YQVA 1J3UA 4MJAA 3OCEA 2IIYA 3OR5A 2J9HA 3WD6A 3V1WA 5L71A 1WPIA 2GQKA 4L6CA 5ECIB 5AISA 2AYTA 2H73A 2VL2A 2IMIA 3H1NA 5D9WA 3TJKA 3UBKA 3FKFA 1TRWA 3W8JA 1OC8A 2OE3A 2D27A 4TRXA 2MZCA 4GQFA 3HZ4A 2B5EA 4TR0A 1K3LA 1EGRA 3J7Yk 1NHOA 1TJDA 1T00A 1G7EA 1DSBA 2RCNA 4L5OA 2RM5A 5KN3A 2KHPA 2FGXA 3LYPA 2WDUA 2QGAB 1MDKA 3U13A 3GH6A 4Z2RA 1GTUA 4KE3A 1QMVA 1OE7A 2B7JA 3MWHA 5D8IA 3KEBA 2FA4A 4NV2A 2MBTA 1EOHA 2F3MA 2DLXA 3Q18A 4KB3A 2GQMA 1XOAA 5IMAA 1XWAA 3G9BA 2H1DA 2OA7A 2PFMA 2QC7A 3UEMA 2F51A 1T1VA 4KSMA 4JEDA 2PVQA 2WS2A 4D73A 2V41A 3KP8A 1SD8A 2CAQA 1VGLA 2LNTA 1A24A 3RD8A 5CP1A 1YY7A 1XWGA 2GT6A 2CA8A 4BVYA 1GSFA 4XCSA 1R26A 5ECNB 2L4QA 2CT6A 4MJBA 1SENA 1MDJA 1QFNA 1TOFA 5HFKA 4N30A 1H4OA 1ST9A 3QBPA 3EC3A 2E2GA 3TKSE 4GSNA 5AGYA 2R4VA 5DQYA 1TJ7A 3IPZA 3UJ1A 2DJ2A 5J4UA 2PTSA 1TXXA 1WE0A 5ECQB 3RBTA 2PPTA 1SYRA 4IGJA 1Q98A 2OE0A 5G30A 4BA7A 1VRSD 1G6WA 3ZVJA 2GSRA 2YWIA 3KD0A 4O5UA 3TDGA 2CZ2A 5HW2A 4KA0A 4EF0A 2JSZA 1O85A 2VM2A 1SKWB 5IMCA 2BJXA 3OCFA 3GRXA 1M9BA 1TI1A 4N0VA 2E2MA 4OWYA 2LKUA 3HVSA 3HDCA 5F8BA 3KTBA 2LJAA 2O8VB 4FYUA 2A2SA 5IIZA 4O32A 3GA4A 1ZZYA 4YAVA 4APAA 4MZWA 2LSTA 2FHEA 4K7IA 3FR3A 3ZREA 2JAOA 1TJVA 2DBCA 2RIIA 5FT3A 1XZOA 2V2GA 4N0ZA 3GURA 2LRCA 4O5QA 3TOTA 2DJ0A 1QQ2A 1A8LA 1Z4QA 1SJ6A 2Z9SA 1K0AA 3GX0A 3PGTA 5F0GA 3F6FA 3GKXA 2H74A 3KH7A 3R3EA 4MABA 1K0CA 1SJZA 2JAUA 1SL0B 1KNGA 3ZIVA 3BJ5A 2YZHA 4A5PA 2FWGA 1SD9A 1HNAA 3A2VA 2MMNA 3HVVA 2AV4A 5ECPB 4QQ7A 3IHQA 5D93A 3NZNA 2OACA 1IW7D 3HJPA 4POMA 3KGKA 4TXOA 5A4WA 2N5BA 4ECJA 3I6AA 3E0UA 1JZDA 5HR2A 5D9TA 1X5CA 1QK8A 1M7TA 3MAKA 2BMXA 2AB6A 1BJXA 1URMA 4ECIA 4ZB9A 5D96A 3TJFA 5D6BA 2AHEA 1ERWA 3N5OA 1GSSA 2L5LA 1DOFA 2TRXA 4OFMA 1XCCA 5G5FA 5C04A 4L0UA 1KBNA 1WMJA 2CVBA 4PUFC 2OE1A 3US3A 5HQPA 2VD0A 1K0NA 3LORA 2NTOA 5JWRB 1DBYA 3KJYA 3HHVA 4ADMA 1EV9A 5CYYA 3MYDA 4MA9A 3GSSA 5DCGA 2LEGA 3G7YA 3QMXA 3WYWA 2X8GA 4IQJM 4ECCA 3KMNA 3UMAA 3BD2A 3EVIA 5ID2B 4ZILA 2LV3A 4DSSA 3Q74A 4FYBA 3GIXA 4IS0A 1S3RA 2YOIA 1YFEA 4ZL8A 4ZBDA 3GZHA 1M3JA 2E0QA 4ID0A 2GSQA 4F0CA 2A2PA 5ECOB 3SWLA 1R4WA 2P0GA 17GSA 3TRQA 4KUNA 1NW2A 2DC5A 1YKCA 1A2LA 4MH3A 1I9DA 5A4VA 2JSYA 1TRSA 3LFLA 2VO4A 3VPQA 4DSRA 4K2XA 4WF5A 4KAEA 3CTFA 1O8XA 3TJBA 2VOCA 2C80A 4FYCA 1V2AA 3VWXA 5IMVA 3FY7A 5JCUA 4HOJA 2YNXA 3C8EA 1Z6MA 4MUMA 3ME7A 1M9AA 5J3RA 1Z4PX 1GL8A 3MSZA 2B5YA 3RDWA 1O8WA 4I97A 4HJMA 1C3UA 2AAWA 1EGOA 4IP1A 5J9CA 3WT1A 3F8UA 2WB9A 5ECMB 1UA5A 3L9SA 3BBYA 4RI7A 1EEMA 2OBKA 2HVGA 5CNWA 1SL2B 4ZB6A 1O73A 3MDKA 3NIVA 4HI7A 3DIEA 4HZ2A 1VF3A 2RLIA 5CRHA 1B9XC 2ON7A 2E9FA 3TRXA 4APBA 2IJYA 3O76A 1AC1A 2CV4A 3GN3A 4MP4A 2MMAA 3LW9A 2V1MA 2JACA 5GSSA 3LSZA 3GTUA 5IO0A 5ECRB 2C0FA 1RQMA 3IXRA 1SK0A 5KOWA 5HR1A 2VL9A 3ZYWA 2YPMA 2JL4A 3NO9A 2B1LA 1ACVA 3O6TA 1EZKA 2TRCP 1EV4A 3ZTLA 1GTIA 2DJJA 3IAM2 3KMOA 2H8LA 4HGVA 2B6MA 2DIYA 1Z3EA 3KTLA 1FVKA 4TKYA 4GCIA 1T4YA 2X99A 2YP6A 3ZFBA 5LD0A 4KDUA 3UVTA 1G0TA 3F4RA 3PR8A 5INYA 3E04A 3F3RA 4ZL9A 5KN1A 2IMKA 2CZ3A 3E3EA 3KM6A 3KIJA 2UZ8A 3D4TA 1A8YA 5EPFA 1K3OA 3APSA 1GWCA 4TW5A 1Z4KA 3P90A 5E4WA 4XS6A 3DEXA 4KH7A 1EWXA 2WJUA 5COHA 1GNEA 2VIMA 3H8QA 4K2DA 1AXDA 3P7XA 2I7DA 3VWWA 2FLSA 3C7MA 4K0NA 4PQ1A 3HD5A 1ABAA 4MF7A 4BIKA 3F3QA 3EU4A 4CY8A 2OJLA 1FOHA 3K8NA 4KX4A 4MCUA 5ELGA 5KEJA 3A5WA 2OADA 1PD21 3HA9A 4GWRA 2YZUA 5A5KA 1C3CA 4V2NA 2FY6A 3TUEA 5JWOB 1GTBA 3GKMA 4O7HA 4K1FA 2FWEA 2H30A 1RK4A 2D2ZA 1XXUA 3E9JB 3IR4A 3DD3A 2OKAA 1MDIA 4OO4A 4KW6A 1TU7A 2YJ7A 4GRFA 3LWAA 3VK9A 1EEJA 1E6BA 5H5RA 4IHUA 1T9HA 1U88A 1PX7A 1T3BA 1K62A 3VI5A 2K9FA 2XBIA 1BQ7A 4TN8A 4GQCA 3UVHA 2C1YA 1SL1B 1A0RP 1KEBA 4JBBA 4YQMA 4XHMA 4I2UA 1W4VA 4PNGA 4HQSA 1YEXA 2PTQA 2CVKA 3D22A 9GSSA 1B9YC 2N5AA 1Z9HA 3GH9A 2YCDA 1X9SB 2VLTA 2YWOA 4YQUA 1F2EA 4DEJA 4LA1A 5IOXA 2CX3A 1TP9A 1AW9A 3QAWA 2GDRA 2L6CA 1BEDA 1T4ZA 3VI7A 3M9JA 4I5QA 2H72A 6GSSA 5GAND 4G9HA 1I0AA 2CVDA 4WBJA 2HRAA 11GSA 1OYJA 5IO2A 3CRUA 4IQ1A 2WULA 2C0EA 2A4VA 3G7IA 3L9UA 5IMFA 4Z7XA 3L9VA 5JWQB 4NMUA 4XRDA 4L8EA 4O5RA 4TR4A 3U19A 1BAYA 1AQXA 3FMWA 2PN8A 2G0FA 2GVPA 3ZLPA 4ULXA 1OKTA 4E8EA 2DJ3A 2IMEA 5HR0A 1GSEA 2FCHA 2KUCA 6GSUA 5AIVA 5F91A 4XTSA 1HD2A 4YKGA 4IBPA 1M2BA 2QA1A 4ML1A 4MNNA 2R0PA 2XBQA 1M2DA 3GKNA 3O3TA 3EMXA 2RUEA 1YJ6A 2A2RA 2R0GA 3GKKA 2IMFA 4IKHA 18GSA 3CBUA 3HZ8A 1OAZA 4Q5QA 1YF0A 4V1Ag 4TR3A 5B8BA 1NHYA 3GL3A 3FW2A 1XBSA 2ON5A 4J57E 5IMZA 4BVYB 2IPAA 3FHKA 5G5EA 1X5DA 4K7OA 4BWSA 5DAKB 4L5LA 5JCWA 3SBCA 6GSVA 4Q5FA 3QR6A 4DVCA 1TRVA 2PMTA 4CHSA 5E59A 3DXBA 5A4UA 2KP2A 1HNBA 3IV4A 3I43A 1GUHA 1ILOA 1NSWA 2I1UA 3AY8A 4JR6A 3UAPA 3CRTA 3UBLA 4BPYA 1C72A 5GAPD 4EO3A 5B6MA 1LJRA 2H75A 2WZ9A 2ES7A 3H4KA 5HR3A 3EPTA 2FWHA 3TCOA 2FUG2 2XPDA 2HRNA 4IELA 3GYKA 2HZEB 3GX8A 3TJGA 5BMUA 2MMOA 1PL2A 2H1BA 1XFLA 5C00A 2DSAA 4KCAA 2O7KA 2R2JA 1G6YA 3ZRDA 2H1GA 3PINA 2FUSA 5F05A 2B3SA 2DKHA 3J7Yb 4G10A 3D4MA 2DMLA 4ZL7A 5ECSA 3VURA 3A2WA 1A0FA 1VDKA 2X49A 1U3IA 3QDNA 3W6GA 1U6TA 5IM9A 5F92A 1ZMAA 2IFQB 5ABRA 2X8CA 1FAAA 4PQIA 4G0KA 3BCKA 3UIWA 4ADLA 3GTDA 2PGTA 5CRDA 3ED3A 2C8UA 2A4HA 1ZOFA 4NFLA 4IN0A 1WWJA 4WBRD 1OC9B 2M80A 3HJMA 2GZPA 4WEYA 2FNOA 1O6JA 3ZITA 3ZFLA 5CO3A 3JCML 4EXJA 2KOKA 1Q91A 1B4PA 5DCHA 1TU8A 4KF9A 4POLA 4PUAA 1Z4IA 5KN0A 3Q6OA 4J56E 4H86A 3M8NA 10GSA 3H79A 1CQGA 1F37A 1JZOA 2JAWA 4LMVA 3EURA 1GUKA 2YN1A 2H1AA 1R5AA 3F63A 1GLQA 3GV1A 3HVXA 3P2AA 2J23A 4PGTA 4POBA 4TR1B 3RAZA 3TKSC 2B7KA 4MMMA 3KXOA 1PX6A 1GNWA 2GZYA 5DALB 1XVQA 1XVWA 4WF4A 3IC4A 1YZXA 4TOPA 3ZVJD 2R37A 4WETA 1UN2A 2VCQA 4G0LA 3PPUA 4EKZA 5ID2A 4CDOA 3F6DA 3DYRA 1YF1A 2VM1A 5G1KA 2NPBA 5B8AA 1T7PB 4ZBAA 4FO5A 4AJ7A 1XWOA 2QA2A 3MIXA 4MLYA 3FRCA 1TK5B 2ALBA 2MMZA 4MPFA 2XPEA 2OBIA 4WKWA 5D9XA 1PKWA 3FR9A 1ZYQB 4F2IA 4IP6A 4YKFA 2VCZA 4OD7A 1HYUA 3R6VA 2VL3A 3BWVA 1N2AA 4KCEA 4Q5RA 4MJEA 1F3AA 4BVXB 5IOWA 1PFOA 1QXHA 2TIRA 4WXTA 4X4JA 3RHCA 3WGEA 1SK1A 2YWNA 2PVOC 2PWJA 1NM3A 1X0RA 3TGZA 4N11A 4BL7A 4XRAA 3WT2A 1AUWA 3M0FA 2ZNMA 2X75A 4PXOA 5BRTA 4LL1B 4NSLA 3EINA 4TXVA 3QAGA 4IJIA 3FZ4A 2H6ZA 5J9BA 2X64A 2F8FA 1PQNA 5LNKe 3DVWA 3BCIA 4L57A 3IC8A 1E2YA 2GSSA 1X9WB 2LQOA 1VF4A 4EFCA 5DQSA 1R7HA 2IL3A 5DDLA 1B8XA 3CSHA 4NLEA 3RRPA 1X5EA 4V2MA 8GSSA 1EP8A 5EY6A 4F9ZA 1GLPA 4USSA 1Y6EA 1TK0B 3ZMKA 1LU4A 1FUQA 4KGIA 1K0OA 2EIOA 2WGRA 3APQA 1Y25A 3RPNA 1XWKA 4MK3A 2HRKA 4PX1A 2PBJA 1K0DA 1AQVA 3ERFA 3GSTA 3HVNA 1SJIA 2GTUA 1K0MA 1ZYNA 4LL4B 2DKIA 4LLRA 3FZAA 4IQAA 4FQUA 1Z7PA 3TB2A 2C0DA 2GGTA 3IDVA 1TTZA 2O85A 2HE3A 3C71A 2JARA 5HFGA 4Q5NA 4PQHA 3QCPA 3D0ZA 4HU7A 20GSA 4EE0A 2VCVA 4E88A 3ZMLA 4CW9A 2H71A 3LEFA 4ISDA 3CI0K 5LCZA 1DE2A 4EVMA 3DMLA 4AJ8A 2GS3A 4HJ2A 1YDKA 3TKSA 1HY0A 2V6KA 1TW9A 6GSYA 1O81A 4X43A 5DJLA 1ERVA 4F03A 3HY2A 4V1Ap 2HI7A 2QGVA 2VCWA 2JADA 3RPPA 4TVEA 2LRTA 1JSWA 1YKAA 1ON4A 4NPBA 2HFDA 1THXA 3C1RA 2JU5A 2K8SA 5AIXA 2VCTA 2FD3A 2CAIA 4FH8A 4HUAA 4MJCA 2FWFA 5G31A 1X9MB 2VUPA 3H93A 1SU9A 1PSQA 1S3AA 5B6NA 4AGSA 13GSA 3ME8A 4ZIJA 2V6OA 3L0HA 2GSTA 2I4AA 2IWTA 1GP1A 1XG8A 2PERA 1TK8B 1F6MC 2NVLA 5GSTA 1GSQA 1VF2A 2VLUA 3IOSA 5H5QA 4KDXA 4NHWA 3TRPA 1XW9A 4GTUA 1S3DA 4Z2TA 1ZYPA 1SKSB 2KLXA 1PN9A 1GUMA 16GSA 4XS4B 2GQLA 1KQ7A 2EC4A 3TOUA 2DMMA 4N10A 3IA1A 2P5QA 2R0CA 4KDYA 1WIKA 3GMFA
chains in the Genus database with same CATH topology
5H5SA 1XPVA 2M72A 5EL8A 2HRFA 3G7JA 1J08A 3FZ5A 5ENUA 1F9MA 5ECLB 1XW5A 3CYNA 3QFBC 4RQXA 4G19A 1XWCA 3HKRA 2HXKA 5AN1A 1V58A 4IJ3A 4JRRA 2P5RA 4Z2UA 1XW6A 1XWBA 2PUKC 3M1GA 3ERWA 4EIPA 2PU9C 1I5GA 2O89A 4P3YB 2AJQB 1WRYA 5IPHA 2C3TA 3L4NA 5DBQA 5F07A 4RQRA 3IHGA 1T8EB 2HLSA 5D73A 2DIZA 2WFCA 1SK2A 1M0UA 4XIHA 1BX9A 4GSSA 1WP0A 14GSA 4K5RA 4X0XA 3F4SA 3I69A 1R5PA 4K6XA 3UOMA 2L5OA 2AUVA 4OFNA 1QUWA 1FB0A 3IRAA 3WGDA 1M99A 2LJKA 2L4CA 2CX4A 4D73B 1B4QA 2H0HA 1AQWA 1OE8A 2VAFA 3LGCA 1FB6A 4HZ4A 4MZBA 7GSSA 4MF5A 4AF2A 4EDZA 1J0FA 1Z5YE 4JU5A 3VPTA 2DJKA 3P8WA 3ERGA 2HSMA 3BOAA 1FO5A 5DAKA 3HXSA 3QAVA 1V57A 2X4AA 2GT5A 4IVFA 2H01A 1WJKA 4HU9A 3GNJA 5J5NA 1FOVA 3FEUA 2I9HA 5EVOA 3DRNA 1AUCA 1PGTA 1ML6A 1U87A 12GSA 3ISOA 5ELAA 4L0WA 1WOUA 5KOXA 3LXTA 4GF0A 1Z6NA 2EIRA 2NDOA 2BTOT 4PNFA 5JCGA 2K8VA 3GUSA 4K7NA 1V98A 5IPGA 2WRTA 2LS5A 5CAXA 2L59A 2LNSA 3MNGA 2NBSA 4QL9A 2VLVA 19GSA 3A2XA 2YWMA 3EU3A 1XIYA 2HZEA 2H76A 3GFKA 4I8BA 3IE3A 2R3XA 1UVZA 1A2MA 2IN3A 4I6XA 4KNDA 1V40A 2ZCTA 1V9WA 2M46A 3EYTA 2C3NA 3QD9A 5J41A 3N9JA 3DGQA 1ZL9A 3F4TA 2H19A 1OC3A 2IFQA 3TKPA 5CRGA 4GXZA 4NXIA 1MTCA 1ERTA 4V2LA 2RM6A 4F82A 4EUYA 2QKEA 2HT9A 3TKRA 4K9ZA 4G2EA 3ZZXA 2HZFA 4BWQA 4J2FA 3DVXA 1OC9A 1ERUA 3I9V2 2LUSA 3HJOA 1B48A 2P31A 1K3YA 1O7UA 4ICYA 1PL1A 4YAPA 4MPGA 4ZBBA 1N8JA 3A5IA 3DKSA 1W89A 4G0IA 1G7OA 1MD4A 1BG5A 3FK8A 5G1LA 2LQQA 4TXOB 1FW1A 3VLNA 4HQZA 4ILFA 1THOA 2HSYA 4TR1A 2C0GA 4NWYA 3FR6A 4ML6A 3C73A 5CREA 1MD3A 3KZQA 1JZWA 4ECBA 5DALA 2REMA 3EWLA 3TKQA 4GLTA 3LQ7A 2XHFA 4I2TA 2B1KA 3NOFA 4K5SA 2CQ9A 3RHBA 5G2ZA 2H0GA 2C3QA 2I81A 2MYGA 1YEPA 1GSDA 3DWVA 3C1SA 4X1UA 2HSHA 4HDEA 4K0GA 1LBKA 2LTKA 3GL5A 4DSSB 2DJ1A 1JLVA 1PRXA 3D5JA 4PTSA 5IQYA 1A23A 1K0BA 2EIQA 3KCMA 4E8HA 4BVXA 3IAS2 4PURA 1MEKA 2H6XA 3U6VA 6GSWA 2FA8A 4JE1A 5KN2A 1GTAA 1FG4A 1JHBA 1TKDB 2H70A 1J9BA 1USBA 3CSJA 2L6DA 2C4JA 4ZB8A 2QSIA 2I3YA 5FHIA 4OMVA 2RUFA 3WGXA 2R5GA 4AJ6A 4NHZA 4EIQA 2VD1A 2KP1A 3APOA 4BL7B 2GLRA 6GSTA 3A3TA 4POKA 1Q4JA 3ZL5A 3M9KA 2B5XA 3IK9A 3Q19A 3HCZA 1JLWA 2HYXA 4OO5A 5GZZB 2YANA 4EL1A 2VL2C 2VCXA 1HNCA 5D9VA 5CRWA 2YJHA 3R2QA 1M2AA 1DE1A 3M3MA 5B7CA 3FZ9A 3ZIJA 1SKRB 1TDIA 3IBHA 3KP9A 1Z7RA 1IYHA 1HQOA 1GULA 2JZRA 2D28C 1SYXA 3EMPA 4OFTA 1JFUA 3PH9A 1S3CA 4ACSA 4JR4A 1FHEA 3GTUB 3F9UA 1H75A 1KTEA 4MDCA 4FIWA 4EC0A 4O92A 1U3AA 2E7PA 5ECKB 1DUGA 3LXZA 22GSA 4IW9A 2R6KA 2ZUPA 3UL3A 4YH2A 1PA3A 4HS1A 2JZTA 3F0IA 2YV7A 3HYPA 3LG6A 3VWUA 2H0IA 1JZRA 2V32A 2MBSA 3EE2A 4QL7A 4LMWA 3LJRA 3LYKA 5IMDA 1PN0A 1FVJA 3S9FA 1AIUA 5ECHB 4DSQA 2K6VA 1YQ1A 4NV5A 1PKZA 2JZSA 1GH2A 4WR4A 2O87A 4JZQA 4F0BA 4EDYA 1ZGNA 5F06A 1EOGA 1UC7A 3D6IA 5DJMA 3D21A 6GSXA 3TJJA 1GSYA 2F8AA 1OVNA 3IK7A 1TRUA 3QPMA 4CY6A 1ZCPA 1PMTA 3L78A 2YV9A 3QOUA 2HNLA 4KSOA 1ZYEA 4RUVA 4XS1A 4MF6A 3FYGA 1BYEA 1RW1A 2IMDA 4MH2A 1IYIA 1AAZA 2LJRA 4OCFA 1EP7A 1CQHA 1OKDA 1TI3A 2K18A 3KH9A 2F9SA 4RI6A 2L57A 3UARA 2GZZA 3VFIA 1VF1A 3VWVA 5HFIA 3QFAC 2XC2A 4OCEA 2G2QA 4HEA2 2WCIA 3U5RE 1XOBA 2X8HA 4XS4A 1GSUA 3W8SA 1GRXA 4MZCA 2H6YA 4WR5A 3CMIA 1QGVA 4GSTA 3CSIA 4NAXA 2LRNA 2N5FA 3GHAA 5DVBA 1A2JA 2H66A 1F3BA 5FWGA 4ZXGA 3CXGA 4K8MA 3CTGA 4YQVA 4MJAA 2IIYA 3OR5A 2J9HA 3WD6A 3V1WA 5L71A 1WPIA 2GQKA 5ECIB 5AISA 2AYTA 2H73A 2VL2A 2IMIA 3H1NA 5D9WA 3TJKA 3UBKA 3FKFA 1TRWA 3W8JA 1OC8A 2OE3A 2D27A 4TRXA 2MZCA 4GQFA 3HZ4A 2B5EA 4TR0A 1K3LA 1EGRA 3J7Yk 1NHOA 1TJDA 1T00A 1G7EA 1DSBA 4L5OA 2RM5A 5KN3A 2KHPA 2FGXA 3LYPA 2WDUA 1MDKA 3GH6A 4Z2RA 1GTUA 4KE3A 1QMVA 1OE7A 2B7JA 3MWHA 5D8IA 3KEBA 2FA4A 4NV2A 2MBTA 1EOHA 2F3MA 2DLXA 3Q18A 4KB3A 2GQMA 1XOAA 5IMAA 1XWAA 3G9BA 2H1DA 2OA7A 2QC7A 3UEMA 2F51A 1T1VA 4KSMA 4JEDA 2PVQA 2WS2A 4D73A 2V41A 3KP8A 1SD8A 2CAQA 1VGLA 2LNTA 1A24A 5CP1A 1YY7A 1XWGA 2GT6A 2CA8A 4BVYA 1GSFA 4XCSA 1R26A 5ECNB 2L4QA 2CT6A 4MJBA 1SENA 1MDJA 1QFNA 1TOFA 5HFKA 4N30A 1H4OA 1ST9A 3EC3A 2E2GA 3TKSE 4GSNA 5AGYA 2R4VA 5DQYA 3IPZA 3UJ1A 2DJ2A 5J4UA 1TXXA 1WE0A 5ECQB 3RBTA 2PPTA 1SYRA 4IGJA 1Q98A 2OE0A 5G30A 4BA7A 1VRSD 1G6WA 3ZVJA 2GSRA 2YWIA 3KD0A 4O5UA 3TDGA 2CZ2A 4KA0A 4EF0A 2JSZA 1O85A 2VM2A 1SKWB 5IMCA 2BJXA 3GRXA 1M9BA 1TI1A 4N0VA 2E2MA 4OWYA 2LKUA 3HVSA 3HDCA 5F8BA 3KTBA 2LJAA 2O8VB 4FYUA 2A2SA 5IIZA 4O32A 3GA4A 1ZZYA 4YAVA 4MZWA 2LSTA 2FHEA 4K7IA 3FR3A 3ZREA 2DBCA 2RIIA 5FT3A 1XZOA 2V2GA 4N0ZA 3GURA 2LRCA 4O5QA 3TOTA 2DJ0A 1QQ2A 1A8LA 1SJ6A 2Z9SA 1K0AA 3GX0A 3PGTA 5F0GA 3F6FA 3GKXA 2H74A 3KH7A 3R3EA 4MABA 1K0CA 1SJZA 1SL0B 1KNGA 3ZIVA 3BJ5A 2YZHA 4A5PA 2FWGA 1SD9A 1HNAA 3A2VA 2MMNA 3HVVA 2AV4A 5ECPB 4QQ7A 3IHQA 5D93A 3NZNA 2OACA 1IW7D 3HJPA 4POMA 3KGKA 4TXOA 5A4WA 2N5BA 4ECJA 3I6AA 3E0UA 1JZDA 5HR2A 5D9TA 1X5CA 1QK8A 1M7TA 3MAKA 2BMXA 2AB6A 1BJXA 1URMA 4ECIA 4ZB9A 5D96A 3TJFA 2AHEA 1ERWA 3N5OA 1GSSA 2L5LA 2TRXA 4OFMA 1XCCA 5G5FA 5C04A 4L0UA 1KBNA 1WMJA 2CVBA 4PUFC 2OE1A 3US3A 5HQPA 2VD0A 1K0NA 3LORA 2NTOA 5JWRB 1DBYA 3KJYA 3HHVA 1EV9A 5CYYA 3MYDA 4MA9A 3GSSA 5DCGA 2LEGA 3G7YA 3QMXA 3WYWA 2X8GA 4IQJM 4ECCA 3KMNA 3UMAA 3BD2A 3EVIA 5ID2B 4ZILA 2LV3A 4DSSA 3Q74A 4FYBA 3GIXA 4IS0A 4ZL8A 2YOIA 4ZBDA 2E0QA 4ID0A 2GSQA 4F0CA 2A2PA 5ECOB 3SWLA 1R4WA 2P0GA 17GSA 3TRQA 4KUNA 1NW2A 2DC5A 1YKCA 1A2LA 4MH3A 1I9DA 5A4VA 2JSYA 1TRSA 3LFLA 2VO4A 3VPQA 4DSRA 4K2XA 4WF5A 4KAEA 3CTFA 1O8XA 3TJBA 2VOCA 2C80A 4FYCA 1V2AA 3VWXA 5IMVA 3FY7A 5JCUA 4HOJA 2YNXA 3C8EA 1Z6MA 3ME7A 1M9AA 5J3RA 1GL8A 3MSZA 2B5YA 3RDWA 1O8WA 4I97A 4HJMA 2AAWA 1EGOA 4IP1A 5J9CA 3WT1A 3F8UA 2WB9A 5ECMB 1UA5A 3L9SA 3BBYA 4RI7A 1EEMA 2OBKA 5CNWA 1SL2B 4ZB6A 1O73A 3MDKA 3NIVA 4HI7A 3DIEA 4HZ2A 1VF3A 2RLIA 5CRHA 1B9XC 2ON7A 3TRXA 2IJYA 3O76A 1AC1A 2CV4A 3GN3A 4MP4A 2MMAA 3LW9A 2V1MA 2JACA 5GSSA 3LSZA 3GTUA 5IO0A 5ECRB 2C0FA 1RQMA 3IXRA 1SK0A 5KOWA 5HR1A 2VL9A 3ZYWA 2YPMA 2JL4A 2B1LA 1ACVA 3O6TA 1EZKA 2TRCP 1EV4A 3ZTLA 1GTIA 2DJJA 3IAM2 3KMOA 2H8LA 2B6MA 2DIYA 1Z3EA 3KTLA 1FVKA 4TKYA 4GCIA 1T4YA 2X99A 2YP6A 3ZFBA 5LD0A 4KDUA 3UVTA 1G0TA 3F4RA 3PR8A 5INYA 3F3RA 4ZL9A 5KN1A 2IMKA 2CZ3A 3E3EA 3KM6A 3KIJA 2UZ8A 3D4TA 1A8YA 5EPFA 1K3OA 3APSA 1GWCA 4TW5A 3P90A 5E4WA 4XS6A 3DEXA 4KH7A 1EWXA 2WJUA 5COHA 1GNEA 2VIMA 3H8QA 4K2DA 1AXDA 3P7XA 3VWWA 2FLSA 3C7MA 4K0NA 4PQ1A 3HD5A 1ABAA 4MF7A 3F3QA 3EU4A 4CY8A 2OJLA 1FOHA 3K8NA 4KX4A 4MCUA 5ELGA 5KEJA 3A5WA 2OADA 1PD21 3HA9A 4GWRA 2YZUA 5A5KA 4V2NA 2FY6A 3TUEA 5JWOB 1GTBA 3GKMA 4O7HA 4K1FA 2FWEA 2H30A 1RK4A 2D2ZA 1XXUA 3E9JB 3IR4A 3DD3A 2OKAA 1MDIA 4OO4A 4KW6A 1TU7A 2YJ7A 4GRFA 3LWAA 3VK9A 1EEJA 1E6BA 5H5RA 4IHUA 1U88A 1PX7A 1T3BA 3VI5A 2K9FA 2XBIA 1BQ7A 4TN8A 4GQCA 3UVHA 2C1YA 1SL1B 1A0RP 1KEBA 4JBBA 4YQMA 4XHMA 4I2UA 1W4VA 4PNGA 4HQSA 1YEXA 2CVKA 3D22A 9GSSA 1B9YC 2N5AA 1Z9HA 3GH9A 2YCDA 1X9SB 2VLTA 2YWOA 4YQUA 1F2EA 4DEJA 4LA1A 5IOXA 2CX3A 1TP9A 1AW9A 3QAWA 2GDRA 2L6CA 1BEDA 1T4ZA 3VI7A 3M9JA 4I5QA 2H72A 6GSSA 5GAND 4G9HA 2CVDA 4WBJA 2HRAA 11GSA 1OYJA 5IO2A 3CRUA 4IQ1A 2WULA 2C0EA 2A4VA 3G7IA 3L9UA 5IMFA 4Z7XA 3L9VA 5JWQB 4NMUA 4XRDA 4L8EA 4O5RA 4TR4A 1BAYA 3FMWA 1AQXA 2PN8A 2G0FA 2GVPA 3ZLPA 4ULXA 1OKTA 4E8EA 2DJ3A 2IMEA 5HR0A 1GSEA 2FCHA 2KUCA 6GSUA 5AIVA 4XTSA 1HD2A 4YKGA 4IBPA 1M2BA 2QA1A 4ML1A 4MNNA 2R0PA 2XBQA 1M2DA 3GKNA 3O3TA 3EMXA 2RUEA 1YJ6A 2A2RA 2R0GA 3GKKA 2IMFA 4IKHA 18GSA 3CBUA 3HZ8A 1OAZA 4Q5QA 1YF0A 4V1Ag 4TR3A 5B8BA 1NHYA 3GL3A 3FW2A 1XBSA 2ON5A 4J57E 5IMZA 4BVYB 2IPAA 3FHKA 5G5EA 1X5DA 4K7OA 4BWSA 5DAKB 4L5LA 5JCWA 3SBCA 6GSVA 4Q5FA 3QR6A 4DVCA 1TRVA 2PMTA 4CHSA 5E59A 3DXBA 5A4UA 2KP2A 1HNBA 3IV4A 3I43A 1GUHA 1ILOA 1NSWA 2I1UA 3AY8A 4JR6A 3UAPA 3CRTA 3UBLA 4BPYA 1C72A 5GAPD 4EO3A 5B6MA 1LJRA 2H75A 2WZ9A 2ES7A 3H4KA 5HR3A 3EPTA 2FWHA 3TCOA 2FUG2 2XPDA 2HRNA 4IELA 3GYKA 2HZEB 3GX8A 3TJGA 5BMUA 2MMOA 1PL2A 2H1BA 1XFLA 5C00A 2DSAA 4KCAA 2O7KA 2R2JA 1G6YA 3ZRDA 2H1GA 3PINA 5F05A 2B3SA 2DKHA 3J7Yb 4G10A 3D4MA 2DMLA 4ZL7A 5ECSA 3VURA 3A2WA 1A0FA 2X49A 1U3IA 3QDNA 3W6GA 1U6TA 5IM9A 1ZMAA 2IFQB 5ABRA 2X8CA 1FAAA 4PQIA 4G0KA 3BCKA 3UIWA 2PGTA 5CRDA 3ED3A 2C8UA 2A4HA 1ZOFA 4IN0A 1WWJA 4WBRD 1OC9B 2M80A 3HJMA 2GZPA 4WEYA 2FNOA 1O6JA 3ZITA 3ZFLA 5CO3A 3JCML 4EXJA 2KOKA 1B4PA 5DCHA 1TU8A 4KF9A 4POLA 4PUAA 5KN0A 3Q6OA 4J56E 4H86A 3M8NA 10GSA 3H79A 1CQGA 1F37A 1JZOA 4LMVA 3EURA 1GUKA 2YN1A 2H1AA 1R5AA 3F63A 1GLQA 3GV1A 3HVXA 3P2AA 2J23A 4PGTA 4POBA 4TR1B 3RAZA 3TKSC 2B7KA 4MMMA 3KXOA 1PX6A 1GNWA 2GZYA 5DALB 1XVQA 1XVWA 4WF4A 3IC4A 1YZXA 4TOPA 3ZVJD 2R37A 4WETA 1UN2A 2VCQA 4G0LA 3PPUA 4EKZA 5ID2A 4CDOA 3F6DA 3DYRA 1YF1A 2VM1A 5G1KA 2NPBA 5B8AA 1T7PB 4ZBAA 4FO5A 4AJ7A 2QA2A 3MIXA 4MLYA 3FRCA 1TK5B 2ALBA 2MMZA 4MPFA 2XPEA 2OBIA 4WKWA 5D9XA 1PKWA 3FR9A 1ZYQB 4F2IA 4IP6A 4YKFA 2VCZA 4OD7A 1HYUA 2VL3A 1N2AA 4KCEA 4Q5RA 4MJEA 1F3AA 4BVXB 5IOWA 1QXHA 2TIRA 4WXTA 4X4JA 3RHCA 3WGEA 1SK1A 2YWNA 2PVOC 2PWJA 1NM3A 1X0RA 3TGZA 4N11A 4BL7A 4XRAA 3WT2A 3M0FA 2ZNMA 4PXOA 5BRTA 4LL1B 3EINA 4TXVA 3QAGA 4IJIA 3FZ4A 2H6ZA 5J9BA 2X64A 2F8FA 1PQNA 5LNKe 3DVWA 3BCIA 3IC8A 1E2YA 2GSSA 1X9WB 2LQOA 1VF4A 5DQSA 1R7HA 2IL3A 5DDLA 1B8XA 3CSHA 1X5EA 4V2MA 8GSSA 1EP8A 5EY6A 4F9ZA 1GLPA 4USSA 1Y6EA 1TK0B 3ZMKA 1LU4A 4KGIA 1K0OA 2EIOA 2WGRA 3APQA 1Y25A 3RPNA 1XWKA 4MK3A 2HRKA 4PX1A 2PBJA 1K0DA 1AQVA 3ERFA 3GSTA 1SJIA 2GTUA 1K0MA 1ZYNA 4LL4B 2DKIA 4LLRA 3FZAA 4IQAA 4FQUA 1Z7PA 3TB2A 2C0DA 2GGTA 3IDVA 1TTZA 2O85A 2HE3A 3C71A 5HFGA 4Q5NA 4PQHA 3QCPA 3D0ZA 4HU7A 20GSA 4EE0A 2VCVA 3ZMLA 4CW9A 2H71A 3LEFA 4ISDA 5LCZA 1DE2A 4EVMA 3DMLA 4AJ8A 2GS3A 4HJ2A 1YDKA 3TKSA 2V6KA 1TW9A 6GSYA 1O81A 4X43A 5DJLA 1ERVA 4F03A 3HY2A 4V1Ap 2HI7A 2QGVA 2VCWA 2JADA 3RPPA 4TVEA 2LRTA 1YKAA 1ON4A 4NPBA 2HFDA 1THXA 3C1RA 2JU5A 2K8SA 5AIXA 2VCTA 2FD3A 2CAIA 4FH8A 4HUAA 4MJCA 2FWFA 5G31A 1X9MB 2VUPA 3H93A 1SU9A 1PSQA 1S3AA 5B6NA 4AGSA 13GSA 3ME8A 4ZIJA 2V6OA 3L0HA 2GSTA 2I4AA 2IWTA 1GP1A 2PERA 1TK8B 1F6MC 2NVLA 5GSTA 1GSQA 1VF2A 2VLUA 3IOSA 5H5QA 4KDXA 4NHWA 3TRPA 1XW9A 4GTUA 1S3DA 4Z2TA 1ZYPA 1SKSB 2KLXA 1PN9A 1GUMA 4XS4B 16GSA 2GQLA 2EC4A 3TOUA 2DMMA 4N10A 3IA1A 2P5QA 2R0CA 4KDYA 1WIKA 3GMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H5S A;  1XPV A;  2M72 A;  5EL8 A;  2HRF A;  3G7J A;  1J08 A;  3FZ5 A;  5ENU A;  1F9M A;  5ECL B;  1XW5 A;  3CYN A;  3QFB C;  4RQX A;  4G19 A;  1XWC A;  3HKR A;  2HXK A;  5AN1 A;  1V58 A;  4IJ3 A;  4JRR A;  2P5R A;  1XW6 A;  1XWB A;  2PUK C;  3M1G A;  3ERW A;  2PU9 C;  1I5G A;  2O89 A;  4P3Y B;  2AJQ B;  1WRY A;  5IPH A;  2C3T A;  3L4N A;  5DBQ A;  5F07 A;  4RQR A;  1T8E B;  2HLS A;  5D73 A;  2DIZ A;  2WFC A;  1SK2 A;  1M0U A;  4XIH A;  1BX9 A;  4GSS A;  1WP0 A;  14GS A;  4X0X A;  3F4S A;  3I69 A;  1R5P A;  4K6X A;  3UOM A;  2L5O A;  2AUV A;  4OFN A;  1QUW A;  1FB0 A;  3IRA A;  3WGD A;  1M99 A;  2LJK A;  2L4C A;  2CX4 A;  4D73 B;  1B4Q A;  2H0H A;  1AQW A;  1OE8 A;  2VAF A;  3LGC A;  1FB6 A;  4HZ4 A;  4MZB A;  7GSS A;  4MF5 A;  4AF2 A;  4EDZ A;  1J0F A;  1Z5Y E;  4JU5 A;  3VPT A;  2DJK A;  3P8W A;  3ERG A;  3BOA A;  1FO5 A;  5DAK A;  3HXS A;  3QAV A;  1V57 A;  2GT5 A;  4IVF A;  2H01 A;  1WJK A;  4HU9 A;  3GNJ A;  5J5N A;  1FOV A;  3FEU A;  5EVO A;  2I9H A;  3DRN A;  1AUC A;  1PGT A;  1ML6 A;  1U87 A;  12GS A;  3ISO A;  5ELA A;  4L0W A;  1WOU A;  3LXT A;  4GF0 A;  1Z6N A;  2EIR A;  2NDO A;  2BTO T;  4PNF A;  5JCG A;  2K8V A;  3GUS A;  4K7N A;  1V98 A;  5IPG A;  2WRT A;  2LS5 A;  5CAX A;  2L59 A;  2LNS A;  3MNG A;  2NBS A;  4QL9 A;  2VLV A;  19GS A;  3A2X A;  2YWM A;  3EU3 A;  1XIY A;  2HZE A;  2H76 A;  3GFK A;  4I8B A;  3IE3 A;  2R3X A;  1UVZ A;  1A2M A;  2IN3 A;  4I6X A;  4KND A;  1V40 A;  2ZCT A;  1V9W A;  2M46 A;  3EYT A;  2C3N A;  3QD9 A;  5J41 A;  3N9J A;  3DGQ A;  1ZL9 A;  3F4T A;  2H19 A;  1OC3 A;  2IFQ A;  3TKP A;  5CRG A;  4GXZ A;  4NXI A;  1MTC A;  1ERT A;  4V2L A;  2RM6 A;  4F82 A;  4EUY A;  2QKE A;  2HT9 A;  3TKR A;  4K9Z A;  4G2E A;  3ZZX A;  2HZF A;  4BWQ A;  4J2F A;  3DVX A;  1OC9 A;  1ERU A;  3I9V 2;  2LUS A;  3HJO A;  1B48 A;  2P31 A;  1K3Y A;  1O7U A;  1PL1 A;  4YAP A;  4MPG A;  4ZBB A;  1N8J A;  3DKS A;  1W89 A;  1G7O A;  1MD4 A;  1BG5 A;  3FK8 A;  5G1L A;  2LQQ A;  4TXO B;  1FW1 A;  3VLN A;  4HQZ A;  4ILF A;  1THO A;  2HSY A;  4TR1 A;  2C0G A;  4NWY A;  3FR6 A;  4ML6 A;  3C73 A;  5CRE A;  1MD3 A;  3KZQ A;  1JZW A;  4ECB A;  5DAL A;  2REM A;  3EWL A;  3TKQ A;  4GLT A;  3LQ7 A;  2XHF A;  4I2T A;  2B1K A;  3NOF A;  2CQ9 A;  3RHB A;  5G2Z A;  2H0G A;  2C3Q A;  2I81 A;  2MYG A;  1YEP A;  1GSD A;  3DWV A;  3C1S A;  4X1U A;  2HSH A;  4HDE A;  4K0G A;  1LBK A;  2LTK A;  3GL5 A;  4DSS B;  2DJ1 A;  1JLV A;  1PRX A;  3D5J A;  5IQY A;  1A23 A;  1K0B A;  2EIQ A;  3KCM A;  4E8H A;  4BVX A;  3IAS 2;  4PUR A;  1MEK A;  2H6X A;  3U6V A;  6GSW A;  2FA8 A;  4JE1 A;  5KN2 A;  1GTA A;  1FG4 A;  1JHB A;  1TKD B;  2H70 A;  1J9B A;  1USB A;  3CSJ A;  2L6D A;  2C4J A;  4ZB8 A;  2QSI A;  2I3Y A;  5FHI A;  4OMV A;  2RUF A;  3WGX A;  2R5G A;  4AJ6 A;  4NHZ A;  2VD1 A;  2KP1 A;  3APO A;  2GLR A;  6GST A;  3A3T A;  4POK A;  1Q4J A;  3ZL5 A;  3M9K A;  2B5X A;  3IK9 A;  3Q19 A;  3HCZ A;  1JLW A;  2HYX A;  4OO5 A;  5GZZ B;  2YAN A;  4EL1 A;  2VL2 C;  2VCX A;  1HNC A;  5D9V A;  5CRW A;  2YJH A;  3R2Q A;  1M2A A;  1DE1 A;  3M3M A;  5B7C A;  3FZ9 A;  3ZIJ A;  1SKR B;  1TDI A;  3IBH A;  3KP9 A;  1Z7R A;  1IYH A;  1HQO A;  1GUL A;  2JZR A;  3EMP A;  1SYX A;  4OFT A;  1JFU A;  3PH9 A;  1S3C A;  4ACS A;  4JR4 A;  1FHE A;  3GTU B;  3F9U A;  1H75 A;  1KTE A;  4MDC A;  4FIW A;  4EC0 A;  4O92 A;  1U3A A;  2E7P A;  5ECK B;  1DUG A;  3LXZ A;  22GS A;  4IW9 A;  2R6K A;  2ZUP A;  3UL3 A;  4YH2 A;  1PA3 A;  4HS1 A;  2JZT A;  3F0I A;  2YV7 A;  3HYP A;  3LG6 A;  3VWU A;  2H0I A;  1JZR A;  2V32 A;  2MBS A;  3EE2 A;  4QL7 A;  4LMW A;  3LJR A;  3LYK A;  5IMD A;  1FVJ A;  3S9F A;  1AIU A;  5ECH B;  4DSQ A;  2K6V A;  1YQ1 A;  4NV5 A;  1PKZ A;  2JZS A;  1GH2 A;  4WR4 A;  2O87 A;  4JZQ A;  4F0B A;  4EDY A;  1ZGN A;  5F06 A;  1EOG A;  1UC7 A;  3D6I A;  5DJM A;  3D21 A;  6GSX A;  3TJJ A;  1GSY A;  2F8A A;  1OVN A;  3IK7 A;  1TRU A;  3QPM A;  1ZCP A;  1PMT A;  3L78 A;  2YV9 A;  3QOU A;  2HNL A;  4KSO A;  1ZYE A;  4RUV A;  4XS1 A;  4MF6 A;  3FYG A;  1BYE A;  1RW1 A;  2IMD A;  4MH2 A;  1IYI A;  1AAZ A;  2LJR A;  4OCF A;  1EP7 A;  1CQH A;  1OKD A;  1TI3 A;  2K18 A;  3KH9 A;  2F9S A;  4RI6 A;  2L57 A;  3UAR A;  2GZZ A;  3VFI A;  1VF1 A;  3VWV A;  5HFI A;  3QFA C;  2XC2 A;  4OCE A;  2G2Q A;  4HEA 2;  2WCI A;  3U5R E;  1XOB A;  2X8H A;  4XS4 A;  1GSU A;  3W8S A;  1GRX A;  4MZC A;  2H6Y A;  4WR5 A;  3CMI A;  1QGV A;  4GST A;  3CSI A;  4NAX A;  2LRN A;  2N5F A;  3GHA A;  5DVB A;  1A2J A;  2H66 A;  1F3B A;  5FWG A;  4ZXG A;  3CXG A;  4K8M A;  3CTG A;  4YQV A;  4MJA A;  2IIY A;  3OR5 A;  2J9H A;  3WD6 A;  3V1W A;  5L71 A;  1WPI A;  2GQK A;  5ECI B;  5AIS A;  2AYT A;  2H73 A;  2VL2 A;  2IMI A;  3H1N A;  5D9W A;  3TJK A;  3UBK A;  3FKF A;  1TRW A;  3W8J A;  1OC8 A;  2OE3 A;  4TRX A;  2MZC A;  4GQF A;  3HZ4 A;  2B5E A;  4TR0 A;  1K3L A;  1EGR A;  3J7Y k;  1NHO A;  1TJD A;  1T00 A;  1G7E A;  1DSB A;  4L5O A;  2RM5 A;  5KN3 A;  2KHP A;  2FGX A;  3LYP A;  2WDU A;  1MDK A;  3GH6 A;  1GTU A;  4KE3 A;  1QMV A;  1OE7 A;  2B7J A;  3MWH A;  5D8I A;  3KEB A;  2FA4 A;  4NV2 A;  2MBT A;  1EOH A;  2F3M A;  2DLX A;  3Q18 A;  4KB3 A;  2GQM A;  1XOA A;  5IMA A;  1XWA A;  3G9B A;  2H1D A;  2OA7 A;  2QC7 A;  3UEM A;  2F51 A;  1T1V A;  4KSM A;  4JED A;  2PVQ A;  2WS2 A;  4D73 A;  2V41 A;  3KP8 A;  1SD8 A;  2CAQ A;  1VGL A;  2LNT A;  1A24 A;  5CP1 A;  1YY7 A;  1XWG A;  2GT6 A;  2CA8 A;  4BVY A;  1GSF A;  4XCS A;  1R26 A;  5ECN B;  2L4Q A;  2CT6 A;  4MJB A;  1SEN A;  1MDJ A;  1QFN A;  1TOF A;  5HFK A;  4N30 A;  1H4O A;  1ST9 A;  3EC3 A;  2E2G A;  3TKS E;  4GSN A;  5AGY A;  2R4V A;  5DQY A;  3IPZ A;  3UJ1 A;  2DJ2 A;  5J4U A;  1TXX A;  1WE0 A;  5ECQ B;  3RBT A;  2PPT A;  1SYR A;  4IGJ A;  1Q98 A;  2OE0 A;  5G30 A;  4BA7 A;  1VRS D;  1G6W A;  3ZVJ A;  2GSR A;  2YWI A;  3KD0 A;  3TDG A;  2CZ2 A;  4KA0 A;  4EF0 A;  2JSZ A;  1O85 A;  2VM2 A;  1SKW B;  5IMC A;  2BJX A;  3GRX A;  1M9B A;  1TI1 A;  4N0V A;  2E2M A;  4OWY A;  2LKU A;  3HVS A;  3HDC A;  5F8B A;  3KTB A;  2LJA A;  2O8V B;  4FYU A;  2A2S A;  5IIZ A;  4O32 A;  3GA4 A;  1ZZY A;  4YAV A;  4MZW A;  2LST A;  2FHE A;  4K7I A;  3FR3 A;  3ZRE A;  2DBC A;  2RII A;  5FT3 A;  1XZO A;  2V2G A;  4N0Z A;  3GUR A;  2LRC A;  3TOT A;  2DJ0 A;  1QQ2 A;  1A8L A;  1SJ6 A;  2Z9S A;  1K0A A;  3GX0 A;  3PGT A;  5F0G A;  3F6F A;  3GKX A;  2H74 A;  3KH7 A;  4MAB A;  1K0C A;  1SJZ A;  1SL0 B;  1KNG A;  3ZIV A;  3BJ5 A;  2YZH A;  2FWG A;  1SD9 A;  1HNA A;  3A2V A;  2MMN A;  3HVV A;  2AV4 A;  5ECP B;  4QQ7 A;  3IHQ A;  5D93 A;  3NZN A;  2OAC A;  3HJP A;  4POM A;  3KGK A;  4TXO A;  5A4W A;  2N5B A;  4ECJ A;  3I6A A;  3E0U A;  1JZD A;  5HR2 A;  5D9T A;  1X5C A;  1QK8 A;  1M7T A;  3MAK A;  2BMX A;  2AB6 A;  1BJX A;  1URM A;  4ECI A;  4ZB9 A;  5D96 A;  3TJF A;  2AHE A;  1ERW A;  3N5O A;  1GSS A;  2L5L A;  2TRX A;  4OFM A;  1XCC A;  5G5F A;  5C04 A;  4L0U A;  1KBN A;  1WMJ A;  2CVB A;  4PUF C;  2OE1 A;  3US3 A;  5HQP A;  2VD0 A;  1K0N A;  3LOR A;  2NTO A;  5JWR B;  1DBY A;  3KJY A;  3HHV A;  1EV9 A;  5CYY A;  4MA9 A;  3GSS A;  5DCG A;  2LEG A;  3G7Y A;  3QMX A;  3WYW A;  2X8G A;  4ECC A;  3KMN A;  3UMA A;  3BD2 A;  3EVI A;  5ID2 B;  4ZIL A;  2LV3 A;  4DSS A;  3Q74 A;  4FYB A;  3GIX A;  4IS0 A;  4ZL8 A;  2YOI A;  4ZBD A;  2E0Q A;  4ID0 A;  2GSQ A;  4F0C A;  5ECO B;  3SWL A;  1R4W A;  2P0G A;  17GS A;  3TRQ A;  4KUN A;  1NW2 A;  2DC5 A;  1YKC A;  1A2L A;  4MH3 A;  1I9D A;  5A4V A;  2JSY A;  1TRS A;  3LFL A;  2VO4 A;  3VPQ A;  4DSR A;  4WF5 A;  4KAE A;  3CTF A;  1O8X A;  3TJB A;  2VOC A;  2C80 A;  4FYC A;  1V2A A;  3VWX A;  5IMV A;  3FY7 A;  5JCU A;  4HOJ A;  2YNX A;  3C8E A;  1Z6M A;  3ME7 A;  1M9A A;  5J3R A;  1GL8 A;  3MSZ A;  2B5Y A;  3RDW A;  1O8W A;  4I97 A;  4HJM A;  2AAW A;  1EGO A;  4IP1 A;  5J9C A;  3WT1 A;  3F8U A;  2WB9 A;  5ECM B;  1UA5 A;  3L9S A;  3BBY A;  4RI7 A;  1EEM A;  2OBK A;  5CNW A;  1SL2 B;  4ZB6 A;  1O73 A;  3MDK A;  3NIV A;  4HI7 A;  3DIE A;  4HZ2 A;  1VF3 A;  2RLI A;  5CRH A;  1B9X C;  2ON7 A;  3TRX A;  2IJY A;  3O76 A;  1AC1 A;  2CV4 A;  3GN3 A;  4MP4 A;  2MMA A;  2V1M A;  2JAC A;  5GSS A;  3LSZ A;  3GTU A;  5IO0 A;  5ECR B;  2C0F A;  1RQM A;  3IXR A;  1SK0 A;  5HR1 A;  2VL9 A;  3ZYW A;  2YPM A;  2JL4 A;  2B1L A;  1ACV A;  3O6T A;  1EZK A;  2TRC P;  1EV4 A;  3ZTL A;  1GTI A;  2DJJ A;  3IAM 2;  3KMO A;  2H8L A;  2B6M A;  2DIY A;  1Z3E A;  3KTL A;  1FVK A;  4TKY A;  4GCI A;  1T4Y A;  2X99 A;  2YP6 A;  3ZFB A;  5LD0 A;  4KDU A;  3UVT A;  1G0T A;  3F4R A;  3PR8 A;  5INY A;  3F3R A;  4ZL9 A;  5KN1 A;  2IMK A;  2CZ3 A;  3E3E A;  3KM6 A;  3KIJ A;  3D4T A;  1A8Y A;  5EPF A;  1K3O A;  3APS A;  1GWC A;  4TW5 A;  3P90 A;  5E4W A;  4XS6 A;  3DEX A;  4KH7 A;  1EWX A;  2WJU A;  5COH A;  1GNE A;  2VIM A;  3H8Q A;  4K2D A;  1AXD A;  3P7X A;  3VWW A;  2FLS A;  3C7M A;  4K0N A;  4PQ1 A;  3HD5 A;  1ABA A;  4MF7 A;  3F3Q A;  3EU4 A;  2OJL A;  3K8N A;  4KX4 A;  4MCU A;  5ELG A;  5KEJ A;  3A5W A;  2OAD A;  1PD2 1;  3HA9 A;  4GWR A;  2YZU A;  5A5K A;  4V2N A;  2FY6 A;  3TUE A;  5JWO B;  1GTB A;  3GKM A;  4O7H A;  4K1F A;  2FWE A;  2H30 A;  1RK4 A;  2D2Z A;  1XXU A;  3E9J B;  3IR4 A;  3DD3 A;  2OKA A;  1MDI A;  4OO4 A;  4KW6 A;  1TU7 A;  2YJ7 A;  4GRF A;  3LWA A;  3VK9 A;  1EEJ A;  1E6B A;  5H5R A;  4IHU A;  1U88 A;  1PX7 A;  1T3B A;  3VI5 A;  2K9F A;  2XBI A;  1BQ7 A;  4TN8 A;  4GQC A;  3UVH A;  2C1Y A;  1SL1 B;  1A0R P;  1KEB A;  4JBB A;  4YQM A;  4XHM A;  4I2U A;  1W4V A;  4PNG A;  4HQS A;  1YEX A;  2CVK A;  3D22 A;  9GSS A;  1B9Y C;  2N5A A;  1Z9H A;  3GH9 A;  2YCD A;  1X9S B;  2VLT A;  2YWO A;  4YQU A;  1F2E A;  4DEJ A;  4LA1 A;  5IOX A;  2CX3 A;  1TP9 A;  1AW9 A;  3QAW A;  2GDR A;  2L6C A;  1BED A;  1T4Z A;  3VI7 A;  3M9J A;  4I5Q A;  2H72 A;  6GSS A;  5GAN D;  4G9H A;  2CVD A;  4WBJ A;  11GS A;  1OYJ A;  5IO2 A;  3CRU A;  4IQ1 A;  2WUL A;  2C0E A;  2A4V A;  3G7I A;  3L9U A;  5IMF A;  4Z7X A;  3L9V A;  5JWQ B;  4NMU A;  4XRD A;  4L8E A;  4O5R A;  4TR4 A;  1BAY A;  1AQX A;  2PN8 A;  2G0F A;  2GVP A;  3ZLP A;  4ULX A;  1OKT A;  4E8E A;  2DJ3 A;  2IME A;  5HR0 A;  1GSE A;  2FCH A;  2KUC A;  6GSU A;  5AIV A;  4XTS A;  1HD2 A;  4IBP A;  1M2B A;  4ML1 A;  2XBQ A;  1M2D A;  3GKN A;  3O3T A;  3EMX A;  2RUE A;  1YJ6 A;  2A2R A;  3GKK A;  2IMF A;  4IKH A;  18GS A;  3CBU A;  3HZ8 A;  1OAZ A;  4Q5Q A;  1YF0 A;  4V1A g;  4TR3 A;  5B8B A;  1NHY A;  3GL3 A;  3FW2 A;  1XBS A;  2ON5 A;  4J57 E;  5IMZ A;  2IPA A;  3FHK A;  5G5E A;  1X5D A;  4K7O A;  4BWS A;  5DAK B;  4L5L A;  5JCW A;  3SBC A;  6GSV A;  4Q5F A;  3QR6 A;  4DVC A;  1TRV A;  2PMT A;  4CHS A;  5E59 A;  3DXB A;  5A4U A;  2KP2 A;  1HNB A;  3IV4 A;  3I43 A;  1GUH A;  1ILO A;  1NSW A;  2I1U A;  3AY8 A;  4JR6 A;  3UAP A;  3CRT A;  3UBL A;  4BPY A;  1C72 A;  5GAP D;  4EO3 A;  5B6M A;  1LJR A;  2H75 A;  2WZ9 A;  2ES7 A;  3H4K A;  5HR3 A;  2FWH A;  3TCO A;  2FUG 2;  2XPD A;  2HRN A;  4IEL A;  3GYK A;  2HZE B;  3GX8 A;  3TJG A;  2MMO A;  1PL2 A;  2H1B A;  1XFL A;  5C00 A;  2DSA A;  4KCA A;  2O7K A;  2R2J A;  1G6Y A;  3ZRD A;  2H1G A;  3PIN A;  5F05 A;  2B3S A;  3J7Y b;  4G10 A;  3D4M A;  2DML A;  4ZL7 A;  5ECS A;  3VUR A;  3A2W A;  1A0F A;  1U3I A;  3QDN A;  3W6G A;  1U6T A;  5IM9 A;  1ZMA A;  2IFQ B;  5ABR A;  2X8C A;  1FAA A;  4PQI A;  3BCK A;  3UIW A;  2PGT A;  5CRD A;  3ED3 A;  2C8U A;  1ZOF A;  4IN0 A;  1WWJ A;  4WBR D;  1OC9 B;  2M80 A;  3HJM A;  2GZP A;  4WEY A;  2FNO A;  1O6J A;  3ZIT A;  3ZFL A;  5CO3 A;  3JCM L;  4EXJ A;  2KOK A;  1B4P A;  5DCH A;  1TU8 A;  4POL A;  4PUA A;  5KN0 A;  3Q6O A;  4J56 E;  4H86 A;  3M8N A;  10GS A;  3H79 A;  1CQG A;  1F37 A;  1JZO A;  4LMV A;  3EUR A;  1GUK A;  2YN1 A;  2H1A A;  1R5A A;  3F63 A;  1GLQ A;  3GV1 A;  3HVX A;  3P2A A;  2J23 A;  4PGT A;  4POB A;  4TR1 B;  3RAZ A;  3TKS C;  2B7K A;  4MMM A;  3KXO A;  1PX6 A;  1GNW A;  2GZY A;  5DAL B;  1XVQ A;  1XVW A;  4WF4 A;  3IC4 A;  1YZX A;  4TOP A;  3ZVJ D;  2R37 A;  4WET A;  1UN2 A;  2VCQ A;  4EKZ A;  5ID2 A;  4CDO A;  3F6D A;  3DYR A;  1YF1 A;  2VM1 A;  5G1K A;  2NPB A;  5B8A A;  1T7P B;  4ZBA A;  4FO5 A;  4AJ7 A;  4MLY A;  3FRC A;  1TK5 B;  2ALB A;  2MMZ A;  4MPF A;  2XPE A;  2OBI A;  4WKW A;  5D9X A;  1PKW A;  3FR9 A;  1ZYQ B;  4F2I A;  4IP6 A;  2VCZ A;  4OD7 A;  1HYU A;  2VL3 A;  1N2A A;  4KCE A;  4Q5R A;  4MJE A;  1F3A A;  5IOW A;  1QXH A;  2TIR A;  4WXT A;  3RHC A;  3WGE A;  1SK1 A;  2YWN A;  2PVO C;  2PWJ A;  1NM3 A;  1X0R A;  3TGZ A;  4N11 A;  4BL7 A;  4XRA A;  3WT2 A;  3M0F A;  2ZNM A;  4PXO A;  4LL1 B;  3EIN A;  4TXV A;  3QAG A;  4IJI A;  3FZ4 A;  2H6Z A;  5J9B A;  2X64 A;  2F8F A;  1PQN A;  5LNK e;  3DVW A;  3BCI A;  1E2Y A;  2GSS A;  1X9W B;  2LQO A;  1VF4 A;  5DQS A;  1R7H A;  2IL3 A;  5DDL A;  1B8X A;  3CSH A;  1X5E A;  4V2M A;  8GSS A;  1EP8 A;  5EY6 A;  4F9Z A;  1GLP A;  1Y6E A;  1TK0 B;  3ZMK A;  1LU4 A;  4KGI A;  1K0O A;  2EIO A;  2WGR A;  3APQ A;  1Y25 A;  3RPN A;  1XWK A;  4MK3 A;  4PX1 A;  2PBJ A;  1K0D A;  1AQV A;  3ERF A;  3GST A;  1SJI A;  2GTU A;  1K0M A;  4LL4 B;  4LLR A;  3FZA A;  4IQA A;  1Z7P A;  3TB2 A;  2C0D A;  2GGT A;  3IDV A;  1TTZ A;  2O85 A;  2HE3 A;  3C71 A;  5HFG A;  4Q5N A;  4PQH A;  3QCP A;  3D0Z A;  4HU7 A;  20GS A;  4EE0 A;  2VCV A;  3ZML A;  4CW9 A;  2H71 A;  3LEF A;  4ISD A;  5LCZ A;  1DE2 A;  4EVM A;  3DML A;  4AJ8 A;  2GS3 A;  4HJ2 A;  1YDK A;  3TKS A;  2V6K A;  1TW9 A;  6GSY A;  1O81 A;  4X43 A;  5DJL A;  1ERV A;  4F03 A;  3HY2 A;  4V1A p;  2HI7 A;  2QGV A;  2VCW A;  2JAD A;  3RPP A;  4TVE A;  2LRT A;  1YKA A;  1ON4 A;  4NPB A;  2HFD A;  1THX A;  3C1R A;  2JU5 A;  2K8S A;  5AIX A;  2VCT A;  2FD3 A;  2CAI A;  4FH8 A;  4HUA A;  4MJC A;  2FWF A;  5G31 A;  1X9M B;  2VUP A;  3H93 A;  1SU9 A;  1PSQ A;  1S3A A;  5B6N A;  4AGS A;  13GS A;  3ME8 A;  4ZIJ A;  2V6O A;  3L0H A;  2GST A;  2I4A A;  2IWT A;  1GP1 A;  2PER A;  1TK8 B;  1F6M C;  2NVL A;  5GST A;  1GSQ A;  1VF2 A;  2VLU A;  3IOS A;  5H5Q A;  4KDX A;  4NHW A;  3TRP A;  1XW9 A;  4GTU A;  1S3D A;  1SKS B;  2KLX A;  1PN9 A;  1GUM A;  4XS4 B;  16GS A;  2GQL A;  2EC4 A;  3TOU A;  2DMM A;  4N10 A;  3IA1 A;  2P5Q A;  4KDY A;  1WIK A;  3GMF A; 
#chains in the Genus database with same CATH topology
 5H5S A;  1XPV A;  2M72 A;  5EL8 A;  2HRF A;  3G7J A;  1J08 A;  3FZ5 A;  5ENU A;  1F9M A;  5ECL B;  1XW5 A;  3CYN A;  3QFB C;  4RQX A;  4G19 A;  1XWC A;  3HKR A;  2HXK A;  5AN1 A;  1V58 A;  4IJ3 A;  4JRR A;  1YFM A;  4HSC X;  2P5R A;  4Z2U A;  4YIK A;  1M3I A;  1XW6 A;  1XWB A;  1Z4L A;  2PUK C;  1TJU A;  3M1G A;  3ERW A;  4EIP A;  2PU9 C;  1I5G A;  2O89 A;  4P3Y B;  2AJQ B;  4YIH A;  1WRY A;  5IPH A;  2C3T A;  3L4N A;  5DBQ A;  5F07 A;  4RQR A;  3IHG A;  1T8E B;  2HLS A;  5D73 A;  2DIZ A;  1Q92 A;  2WFC A;  1SK2 A;  1M0U A;  4XIH A;  1BX9 A;  4GSS A;  1WP0 A;  14GS A;  4K5R A;  4X0X A;  3F4S A;  3I69 A;  1R5P A;  4K6X A;  3UOM A;  2L5O A;  2AUV A;  4OFN A;  1QUW A;  1FB0 A;  3IRA A;  1FUR A;  3WGD A;  1M99 A;  2LJK A;  2L4C A;  2CX4 A;  4D73 B;  1B4Q A;  2H0H A;  1AQW A;  1OE8 A;  1Q5N A;  2VAF A;  3LGC A;  1FB6 A;  4HZ4 A;  4MZB A;  7GSS A;  4MF5 A;  4AF2 A;  4EDZ A;  1J0F A;  1Z5Y E;  4JU5 A;  3VPT A;  2DJK A;  3P8W A;  3ERG A;  2HSM A;  3BOA A;  1FO5 A;  5DAK A;  3HXS A;  3QAV A;  1V57 A;  2X4A A;  2GT5 A;  4IVF A;  2H01 A;  1WJK A;  4HU9 A;  3GNJ A;  5J5N A;  1FOV A;  3FEU A;  2I9H A;  5EVO A;  3DRN A;  1AUC A;  1PGT A;  1ML6 A;  1U87 A;  12GS A;  3ISO A;  5ELA A;  4L0W A;  1WOU A;  5KOX A;  3LXT A;  4GF0 A;  1Z6N A;  2EIR A;  2NDO A;  2BTO T;  4PNF A;  5JCG A;  2K8V A;  3GUS A;  4K7N A;  1V98 A;  5IPG A;  2WRT A;  1Z4J A;  2LS5 A;  5CAX A;  2L59 A;  2LNS A;  3MNG A;  2NBS A;  4QL9 A;  2VLV A;  19GS A;  3A2X A;  2YWM A;  3EU3 A;  1XIY A;  2HZE A;  2H76 A;  3GFK A;  4I8B A;  3IE3 A;  2R3X A;  1UVZ A;  1A2M A;  2IN3 A;  4I6X A;  4KND A;  1V40 A;  2ZCT A;  1V9W A;  2M46 A;  3EYT A;  2C3N A;  3QD9 A;  5J41 A;  3N9J A;  3DGQ A;  3R6Q A;  1ZL9 A;  3F4T A;  2H19 A;  1OC3 A;  2IFQ A;  3TKP A;  5CRG A;  4GXZ A;  4NXI A;  1MTC A;  1ERT A;  1Z4M A;  4V2L A;  2RM6 A;  4F82 A;  4EUY A;  2QKE A;  2HT9 A;  3TKR A;  4K9Z A;  4G2E A;  3ZZX A;  2HZF A;  4BWQ A;  4J2F A;  3DVX A;  1OC9 A;  1ERU A;  3I9V 2;  2LUS A;  3HJO A;  1HY1 A;  1B48 A;  2P31 A;  1K3Y A;  1O7U A;  4ICY A;  1PL1 A;  4YAP A;  4MPG A;  4ZBB A;  1N8J A;  3A5I A;  3DKS A;  1W89 A;  4G0I A;  1G7O A;  1MD4 A;  1BG5 A;  3FK8 A;  5G1L A;  2LQQ A;  4TXO B;  1FW1 A;  3VLN A;  1U15 A;  1DCN A;  4HQZ A;  4ILF A;  1THO A;  2HSY A;  4TR1 A;  2C0G A;  4NWY A;  3FR6 A;  4ML6 A;  3C73 A;  5CRE A;  1MD3 A;  1FUP A;  3KZQ A;  1JZW A;  4ECB A;  5DAL A;  2REM A;  3EWL A;  3TKQ A;  4GLT A;  3LQ7 A;  2XHF A;  4I2T A;  2B1K A;  3NOF A;  4K5S A;  2CQ9 A;  3RHB A;  5G2Z A;  2PTR A;  2H0G A;  2C3Q A;  2I81 A;  2MYG A;  1YEP A;  4MX2 A;  1GSD A;  3DWV A;  3C1S A;  4X1U A;  2HSH A;  4HDE A;  4K0G A;  1LBK A;  2LTK A;  1TJW A;  2YV5 A;  3GL5 A;  4DSS B;  2DJ1 A;  1JLV A;  1PRX A;  3D5J A;  4PTS A;  5IQY A;  1A23 A;  1K0B A;  2EIQ A;  3KCM A;  4E8H A;  4BVX A;  3IAS 2;  4PUR A;  1MEK A;  2H6X A;  3U6V A;  6GSW A;  2FA8 A;  4JE1 A;  5KN2 A;  1GTA A;  1FG4 A;  1JHB A;  1U16 A;  1TKD B;  2H70 A;  1J9B A;  1RE5 A;  1USB A;  3CSJ A;  2L6D A;  2C4J A;  4ZB8 A;  2QSI A;  2I3Y A;  5FHI A;  4OMV A;  2RUF A;  3WGX A;  2R5G A;  4AJ6 A;  4NHZ A;  4EIQ A;  1U0L A;  2VD1 A;  3TV2 A;  2KP1 A;  3APO A;  4BL7 B;  2GLR A;  6GST A;  3A3T A;  4MWO A;  4POK A;  1Q4J A;  3ZL5 A;  3CQF A;  3M9K A;  2B5X A;  3IK9 A;  3Q19 A;  3HCZ A;  1JLW A;  2HYX A;  4OO5 A;  5GZZ B;  2YAN A;  4EL1 A;  2VL2 C;  2VCX A;  1HNC A;  5D9V A;  5CRW A;  2YJH A;  3R2Q A;  3C8T A;  1M2A A;  1DE1 A;  3M3M A;  5B7C A;  3FZ9 A;  1FUO A;  3ZIJ A;  1SKR B;  1TDI A;  3IBH A;  3KP9 A;  1Z7R A;  1IYH A;  1HQO A;  1GUL A;  2JZR A;  2D28 C;  1SYX A;  3EMP A;  4OFT A;  1JFU A;  3PH9 A;  3BHG A;  1S3C A;  4ACS A;  4JR4 A;  1FHE A;  3GTU B;  3F9U A;  1H75 A;  1KTE A;  1MH9 A;  4MDC A;  4FIW A;  1K7W A;  4EC0 A;  4O92 A;  1U3A A;  2E7P A;  5ECK B;  1DUG A;  3LXZ A;  22GS A;  4IW9 A;  2R6K A;  2ZUP A;  3UL3 A;  4YH2 A;  1PA3 A;  4HS1 A;  2JZT A;  3F0I A;  2YV7 A;  3HYP A;  3LG6 A;  3VWU A;  2H0I A;  1JZR A;  2V32 A;  2MBS A;  3EE2 A;  4QL7 A;  4LMW A;  3LJR A;  3LYK A;  5IMD A;  1PN0 A;  1FVJ A;  3S9F A;  1AIU A;  5ECH B;  4DSQ A;  2K6V A;  1YQ1 A;  4NV5 A;  1PKZ A;  2JZS A;  1GH2 A;  4WR4 A;  2O87 A;  4JZQ A;  4F0B A;  4EDY A;  1ZGN A;  5F06 A;  1EOG A;  1UC7 A;  3D6I A;  5DJM A;  3D21 A;  6GSX A;  3TJJ A;  1GSY A;  2F8A A;  1OVN A;  3IK7 A;  1TRU A;  3QPM A;  4CY6 A;  1ZCP A;  1PMT A;  3L78 A;  2YV9 A;  3QOU A;  2HNL A;  4KSO A;  1ZYE A;  4EEI A;  4RUV A;  4XS1 A;  4MF6 A;  3FYG A;  1BYE A;  1RW1 A;  2IMD A;  4MH2 A;  1IYI A;  1AAZ A;  2LJR A;  4OCF A;  1EP7 A;  1CQH A;  4L6A A;  1OKD A;  1TI3 A;  2K18 A;  3KH9 A;  2F9S A;  4RI6 A;  2L57 A;  3UAR A;  2GZZ A;  3VFI A;  1VF1 A;  3VWV A;  5HFI A;  3QFA C;  2XC2 A;  4OCE A;  2G2Q A;  4HEA 2;  2WCI A;  3U5R E;  1XOB A;  2X8H A;  4XS4 A;  1GSU A;  3W8S A;  1GRX A;  4MZC A;  2H6Y A;  4WR5 A;  3CMI A;  1QGV A;  4GST A;  3CSI A;  4NAX A;  2LRN A;  2N5F A;  3GHA A;  5DVB A;  1A2J A;  2H66 A;  1F3B A;  5FWG A;  4ZXG A;  3CXG A;  4K8M A;  3CTG A;  4YQV A;  1J3U A;  4MJA A;  3OCE A;  2IIY A;  3OR5 A;  2J9H A;  3WD6 A;  3V1W A;  5L71 A;  1WPI A;  2GQK A;  4L6C A;  5ECI B;  5AIS A;  2AYT A;  2H73 A;  2VL2 A;  2IMI A;  3H1N A;  5D9W A;  3TJK A;  3UBK A;  3FKF A;  1TRW A;  3W8J A;  1OC8 A;  2OE3 A;  2D27 A;  4TRX A;  2MZC A;  4GQF A;  3HZ4 A;  2B5E A;  4TR0 A;  1K3L A;  1EGR A;  3J7Y k;  1NHO A;  1TJD A;  1T00 A;  1G7E A;  1DSB A;  2RCN A;  4L5O A;  2RM5 A;  5KN3 A;  2KHP A;  2FGX A;  3LYP A;  2WDU A;  2QGA B;  1MDK A;  3U13 A;  3GH6 A;  4Z2R A;  1GTU A;  4KE3 A;  1QMV A;  1OE7 A;  2B7J A;  3MWH A;  5D8I A;  3KEB A;  2FA4 A;  4NV2 A;  2MBT A;  1EOH A;  2F3M A;  2DLX A;  3Q18 A;  4KB3 A;  2GQM A;  1XOA A;  5IMA A;  1XWA A;  3G9B A;  2H1D A;  2OA7 A;  2PFM A;  2QC7 A;  3UEM A;  2F51 A;  1T1V A;  4KSM A;  4JED A;  2PVQ A;  2WS2 A;  4D73 A;  2V41 A;  3KP8 A;  1SD8 A;  2CAQ A;  1VGL A;  2LNT A;  1A24 A;  3RD8 A;  5CP1 A;  1YY7 A;  1XWG A;  2GT6 A;  2CA8 A;  4BVY A;  1GSF A;  4XCS A;  1R26 A;  5ECN B;  2L4Q A;  2CT6 A;  4MJB A;  1SEN A;  1MDJ A;  1QFN A;  1TOF A;  5HFK A;  4N30 A;  1H4O A;  1ST9 A;  3QBP A;  3EC3 A;  2E2G A;  3TKS E;  4GSN A;  5AGY A;  2R4V A;  5DQY A;  1TJ7 A;  3IPZ A;  3UJ1 A;  2DJ2 A;  5J4U A;  2PTS A;  1TXX A;  1WE0 A;  5ECQ B;  3RBT A;  2PPT A;  1SYR A;  4IGJ A;  1Q98 A;  2OE0 A;  5G30 A;  4BA7 A;  1VRS D;  1G6W A;  3ZVJ A;  2GSR A;  2YWI A;  3KD0 A;  4O5U A;  3TDG A;  2CZ2 A;  5HW2 A;  4KA0 A;  4EF0 A;  2JSZ A;  1O85 A;  2VM2 A;  1SKW B;  5IMC A;  2BJX A;  3OCF A;  3GRX A;  1M9B A;  1TI1 A;  4N0V A;  2E2M A;  4OWY A;  2LKU A;  3HVS A;  3HDC A;  5F8B A;  3KTB A;  2LJA A;  2O8V B;  4FYU A;  2A2S A;  5IIZ A;  4O32 A;  3GA4 A;  1ZZY A;  4YAV A;  4APA A;  4MZW A;  2LST A;  2FHE A;  4K7I A;  3FR3 A;  3ZRE A;  2JAO A;  1TJV A;  2DBC A;  2RII A;  5FT3 A;  1XZO A;  2V2G A;  4N0Z A;  3GUR A;  2LRC A;  4O5Q A;  3TOT A;  2DJ0 A;  1QQ2 A;  1A8L A;  1Z4Q A;  1SJ6 A;  2Z9S A;  1K0A A;  3GX0 A;  3PGT A;  5F0G A;  3F6F A;  3GKX A;  2H74 A;  3KH7 A;  3R3E A;  4MAB A;  1K0C A;  1SJZ A;  2JAU A;  1SL0 B;  1KNG A;  3ZIV A;  3BJ5 A;  2YZH A;  4A5P A;  2FWG A;  1SD9 A;  1HNA A;  3A2V A;  2MMN A;  3HVV A;  2AV4 A;  5ECP B;  4QQ7 A;  3IHQ A;  5D93 A;  3NZN A;  2OAC A;  1IW7 D;  3HJP A;  4POM A;  3KGK A;  4TXO A;  5A4W A;  2N5B A;  4ECJ A;  3I6A A;  3E0U A;  1JZD A;  5HR2 A;  5D9T A;  1X5C A;  1QK8 A;  1M7T A;  3MAK A;  2BMX A;  2AB6 A;  1BJX A;  1URM A;  4ECI A;  4ZB9 A;  5D96 A;  3TJF A;  5D6B A;  2AHE A;  1ERW A;  3N5O A;  1GSS A;  2L5L A;  1DOF A;  2TRX A;  4OFM A;  1XCC A;  5G5F A;  5C04 A;  4L0U A;  1KBN A;  1WMJ A;  2CVB A;  4PUF C;  2OE1 A;  3US3 A;  5HQP A;  2VD0 A;  1K0N A;  3LOR A;  2NTO A;  5JWR B;  1DBY A;  3KJY A;  3HHV A;  4ADM A;  1EV9 A;  5CYY A;  3MYD A;  4MA9 A;  3GSS A;  5DCG A;  2LEG A;  3G7Y A;  3QMX A;  3WYW A;  2X8G A;  4IQJ M;  4ECC A;  3KMN A;  3UMA A;  3BD2 A;  3EVI A;  5ID2 B;  4ZIL A;  2LV3 A;  4DSS A;  3Q74 A;  4FYB A;  3GIX A;  4IS0 A;  1S3R A;  2YOI A;  1YFE A;  4ZL8 A;  4ZBD A;  3GZH A;  1M3J A;  2E0Q A;  4ID0 A;  2GSQ A;  4F0C A;  2A2P A;  5ECO B;  3SWL A;  1R4W A;  2P0G A;  17GS A;  3TRQ A;  4KUN A;  1NW2 A;  2DC5 A;  1YKC A;  1A2L A;  4MH3 A;  1I9D A;  5A4V A;  2JSY A;  1TRS A;  3LFL A;  2VO4 A;  3VPQ A;  4DSR A;  4K2X A;  4WF5 A;  4KAE A;  3CTF A;  1O8X A;  3TJB A;  2VOC A;  2C80 A;  4FYC A;  1V2A A;  3VWX A;  5IMV A;  3FY7 A;  5JCU A;  4HOJ A;  2YNX A;  3C8E A;  1Z6M A;  4MUM A;  3ME7 A;  1M9A A;  5J3R A;  1Z4P X;  1GL8 A;  3MSZ A;  2B5Y A;  3RDW A;  1O8W A;  4I97 A;  4HJM A;  1C3U A;  2AAW A;  1EGO A;  4IP1 A;  5J9C A;  3WT1 A;  3F8U A;  2WB9 A;  5ECM B;  1UA5 A;  3L9S A;  3BBY A;  4RI7 A;  1EEM A;  2OBK A;  2HVG A;  5CNW A;  1SL2 B;  4ZB6 A;  1O73 A;  3MDK A;  3NIV A;  4HI7 A;  3DIE A;  4HZ2 A;  1VF3 A;  2RLI A;  5CRH A;  1B9X C;  2ON7 A;  2E9F A;  3TRX A;  4APB A;  2IJY A;  3O76 A;  1AC1 A;  2CV4 A;  3GN3 A;  4MP4 A;  2MMA A;  3LW9 A;  2V1M A;  2JAC A;  5GSS A;  3LSZ A;  3GTU A;  5IO0 A;  5ECR B;  2C0F A;  1RQM A;  3IXR A;  1SK0 A;  5KOW A;  5HR1 A;  2VL9 A;  3ZYW A;  2YPM A;  2JL4 A;  3NO9 A;  2B1L A;  1ACV A;  3O6T A;  1EZK A;  2TRC P;  1EV4 A;  3ZTL A;  1GTI A;  2DJJ A;  3IAM 2;  3KMO A;  2H8L A;  4HGV A;  2B6M A;  2DIY A;  1Z3E A;  3KTL A;  1FVK A;  4TKY A;  4GCI A;  1T4Y A;  2X99 A;  2YP6 A;  3ZFB A;  5LD0 A;  4KDU A;  3UVT A;  1G0T A;  3F4R A;  3PR8 A;  5INY A;  3E04 A;  3F3R A;  4ZL9 A;  5KN1 A;  2IMK A;  2CZ3 A;  3E3E A;  3KM6 A;  3KIJ A;  2UZ8 A;  3D4T A;  1A8Y A;  5EPF A;  1K3O A;  3APS A;  1GWC A;  4TW5 A;  1Z4K A;  3P90 A;  5E4W A;  4XS6 A;  3DEX A;  4KH7 A;  1EWX A;  2WJU A;  5COH A;  1GNE A;  2VIM A;  3H8Q A;  4K2D A;  1AXD A;  3P7X A;  2I7D A;  3VWW A;  2FLS A;  3C7M A;  4K0N A;  4PQ1 A;  3HD5 A;  1ABA A;  4MF7 A;  4BIK A;  3F3Q A;  3EU4 A;  4CY8 A;  2OJL A;  1FOH A;  3K8N A;  4KX4 A;  4MCU A;  5ELG A;  5KEJ A;  3A5W A;  2OAD A;  1PD2 1;  3HA9 A;  4GWR A;  2YZU A;  5A5K A;  1C3C A;  4V2N A;  2FY6 A;  3TUE A;  5JWO B;  1GTB A;  3GKM A;  4O7H A;  4K1F A;  2FWE A;  2H30 A;  1RK4 A;  2D2Z A;  1XXU A;  3E9J B;  3IR4 A;  3DD3 A;  2OKA A;  1MDI A;  4OO4 A;  4KW6 A;  1TU7 A;  2YJ7 A;  4GRF A;  3LWA A;  3VK9 A;  1EEJ A;  1E6B A;  5H5R A;  4IHU A;  1T9H A;  1U88 A;  1PX7 A;  1T3B A;  1K62 A;  3VI5 A;  2K9F A;  2XBI A;  1BQ7 A;  4TN8 A;  4GQC A;  3UVH A;  2C1Y A;  1SL1 B;  1A0R P;  1KEB A;  4JBB A;  4YQM A;  4XHM A;  4I2U A;  1W4V A;  4PNG A;  4HQS A;  1YEX A;  2PTQ A;  2CVK A;  3D22 A;  9GSS A;  1B9Y C;  2N5A A;  1Z9H A;  3GH9 A;  2YCD A;  1X9S B;  2VLT A;  2YWO A;  4YQU A;  1F2E A;  4DEJ A;  4LA1 A;  5IOX A;  2CX3 A;  1TP9 A;  1AW9 A;  3QAW A;  2GDR A;  2L6C A;  1BED A;  1T4Z A;  3VI7 A;  3M9J A;  4I5Q A;  2H72 A;  6GSS A;  5GAN D;  4G9H A;  1I0A A;  2CVD A;  4WBJ A;  2HRA A;  11GS A;  1OYJ A;  5IO2 A;  3CRU A;  4IQ1 A;  2WUL A;  2C0E A;  2A4V A;  3G7I A;  3L9U A;  5IMF A;  4Z7X A;  3L9V A;  5JWQ B;  4NMU A;  4XRD A;  4L8E A;  4O5R A;  4TR4 A;  3U19 A;  1BAY A;  1AQX A;  3FMW A;  2PN8 A;  2G0F A;  2GVP A;  3ZLP A;  4ULX A;  1OKT A;  4E8E A;  2DJ3 A;  2IME A;  5HR0 A;  1GSE A;  2FCH A;  2KUC A;  6GSU A;  5AIV A;  5F91 A;  4XTS A;  1HD2 A;  4YKG A;  4IBP A;  1M2B A;  2QA1 A;  4ML1 A;  4MNN A;  2R0P A;  2XBQ A;  1M2D A;  3GKN A;  3O3T A;  3EMX A;  2RUE A;  1YJ6 A;  2A2R A;  2R0G A;  3GKK A;  2IMF A;  4IKH A;  18GS A;  3CBU A;  3HZ8 A;  1OAZ A;  4Q5Q A;  1YF0 A;  4V1A g;  4TR3 A;  5B8B A;  1NHY A;  3GL3 A;  3FW2 A;  1XBS A;  2ON5 A;  4J57 E;  5IMZ A;  4BVY B;  2IPA A;  3FHK A;  5G5E A;  1X5D A;  4K7O A;  4BWS A;  5DAK B;  4L5L A;  5JCW A;  3SBC A;  6GSV A;  4Q5F A;  3QR6 A;  4DVC A;  1TRV A;  2PMT A;  4CHS A;  5E59 A;  3DXB A;  5A4U A;  2KP2 A;  1HNB A;  3IV4 A;  3I43 A;  1GUH A;  1ILO A;  1NSW A;  2I1U A;  3AY8 A;  4JR6 A;  3UAP A;  3CRT A;  3UBL A;  4BPY A;  1C72 A;  5GAP D;  4EO3 A;  5B6M A;  1LJR A;  2H75 A;  2WZ9 A;  2ES7 A;  3H4K A;  5HR3 A;  3EPT A;  2FWH A;  3TCO A;  2FUG 2;  2XPD A;  2HRN A;  4IEL A;  3GYK A;  2HZE B;  3GX8 A;  3TJG A;  5BMU A;  2MMO A;  1PL2 A;  2H1B A;  1XFL A;  5C00 A;  2DSA A;  4KCA A;  2O7K A;  2R2J A;  1G6Y A;  3ZRD A;  2H1G A;  3PIN A;  2FUS A;  5F05 A;  2B3S A;  2DKH A;  3J7Y b;  4G10 A;  3D4M A;  2DML A;  4ZL7 A;  5ECS A;  3VUR A;  3A2W A;  1A0F A;  1VDK A;  2X49 A;  1U3I A;  3QDN A;  3W6G A;  1U6T A;  5IM9 A;  5F92 A;  1ZMA A;  2IFQ B;  5ABR A;  2X8C A;  1FAA A;  4PQI A;  4G0K A;  3BCK A;  3UIW A;  4ADL A;  3GTD A;  2PGT A;  5CRD A;  3ED3 A;  2C8U A;  2A4H A;  1ZOF A;  4NFL A;  4IN0 A;  1WWJ A;  4WBR D;  1OC9 B;  2M80 A;  3HJM A;  2GZP A;  4WEY A;  2FNO A;  1O6J A;  3ZIT A;  3ZFL A;  5CO3 A;  3JCM L;  4EXJ A;  2KOK A;  1Q91 A;  1B4P A;  5DCH A;  1TU8 A;  4KF9 A;  4POL A;  4PUA A;  1Z4I A;  5KN0 A;  3Q6O A;  4J56 E;  4H86 A;  3M8N A;  10GS A;  3H79 A;  1CQG A;  1F37 A;  1JZO A;  2JAW A;  4LMV A;  3EUR A;  1GUK A;  2YN1 A;  2H1A A;  1R5A A;  3F63 A;  1GLQ A;  3GV1 A;  3HVX A;  3P2A A;  2J23 A;  4PGT A;  4POB A;  4TR1 B;  3RAZ A;  3TKS C;  2B7K A;  4MMM A;  3KXO A;  1PX6 A;  1GNW A;  2GZY A;  5DAL B;  1XVQ A;  1XVW A;  4WF4 A;  3IC4 A;  1YZX A;  4TOP A;  3ZVJ D;  2R37 A;  4WET A;  1UN2 A;  2VCQ A;  4G0L A;  3PPU A;  4EKZ A;  5ID2 A;  4CDO A;  3F6D A;  3DYR A;  1YF1 A;  2VM1 A;  5G1K A;  2NPB A;  5B8A A;  1T7P B;  4ZBA A;  4FO5 A;  4AJ7 A;  1XWO A;  2QA2 A;  3MIX A;  4MLY A;  3FRC A;  1TK5 B;  2ALB A;  2MMZ A;  4MPF A;  2XPE A;  2OBI A;  4WKW A;  5D9X A;  1PKW A;  3FR9 A;  1ZYQ B;  4F2I A;  4IP6 A;  4YKF A;  2VCZ A;  4OD7 A;  1HYU A;  3R6V A;  2VL3 A;  3BWV A;  1N2A A;  4KCE A;  4Q5R A;  4MJE A;  1F3A A;  4BVX B;  5IOW A;  1PFO A;  1QXH A;  2TIR A;  4WXT A;  4X4J A;  3RHC A;  3WGE A;  1SK1 A;  2YWN A;  2PVO C;  2PWJ A;  1NM3 A;  1X0R A;  3TGZ A;  4N11 A;  4BL7 A;  4XRA A;  3WT2 A;  1AUW A;  3M0F A;  2ZNM A;  2X75 A;  4PXO A;  5BRT A;  4LL1 B;  4NSL A;  3EIN A;  4TXV A;  3QAG A;  4IJI A;  3FZ4 A;  2H6Z A;  5J9B A;  2X64 A;  2F8F A;  1PQN A;  5LNK e;  3DVW A;  3BCI A;  4L57 A;  3IC8 A;  1E2Y A;  2GSS A;  1X9W B;  2LQO A;  1VF4 A;  4EFC A;  5DQS A;  1R7H A;  2IL3 A;  5DDL A;  1B8X A;  3CSH A;  4NLE A;  3RRP A;  1X5E A;  4V2M A;  8GSS A;  1EP8 A;  5EY6 A;  4F9Z A;  1GLP A;  4USS A;  1Y6E A;  1TK0 B;  3ZMK A;  1LU4 A;  1FUQ A;  4KGI A;  1K0O A;  2EIO A;  2WGR A;  3APQ A;  1Y25 A;  3RPN A;  1XWK A;  4MK3 A;  2HRK A;  4PX1 A;  2PBJ A;  1K0D A;  1AQV A;  3ERF A;  3GST A;  3HVN A;  1SJI A;  2GTU A;  1K0M A;  1ZYN A;  4LL4 B;  2DKI A;  4LLR A;  3FZA A;  4IQA A;  4FQU A;  1Z7P A;  3TB2 A;  2C0D A;  2GGT A;  3IDV A;  1TTZ A;  2O85 A;  2HE3 A;  3C71 A;  2JAR A;  5HFG A;  4Q5N A;  4PQH A;  3QCP A;  3D0Z A;  4HU7 A;  20GS A;  4EE0 A;  2VCV A;  4E88 A;  3ZML A;  4CW9 A;  2H71 A;  3LEF A;  4ISD A;  3CI0 K;  5LCZ A;  1DE2 A;  4EVM A;  3DML A;  4AJ8 A;  2GS3 A;  4HJ2 A;  1YDK A;  3TKS A;  1HY0 A;  2V6K A;  1TW9 A;  6GSY A;  1O81 A;  4X43 A;  5DJL A;  1ERV A;  4F03 A;  3HY2 A;  4V1A p;  2HI7 A;  2QGV A;  2VCW A;  2JAD A;  3RPP A;  4TVE A;  2LRT A;  1JSW A;  1YKA A;  1ON4 A;  4NPB A;  2HFD A;  1THX A;  3C1R A;  2JU5 A;  2K8S A;  5AIX A;  2VCT A;  2FD3 A;  2CAI A;  4FH8 A;  4HUA A;  4MJC A;  2FWF A;  5G31 A;  1X9M B;  2VUP A;  3H93 A;  1SU9 A;  1PSQ A;  1S3A A;  5B6N A;  4AGS A;  13GS A;  3ME8 A;  4ZIJ A;  2V6O A;  3L0H A;  2GST A;  2I4A A;  2IWT A;  1GP1 A;  1XG8 A;  2PER A;  1TK8 B;  1F6M C;  2NVL A;  5GST A;  1GSQ A;  1VF2 A;  2VLU A;  3IOS A;  5H5Q A;  4KDX A;  4NHW A;  3TRP A;  1XW9 A;  4GTU A;  1S3D A;  4Z2T A;  1ZYP A;  1SKS B;  2KLX A;  1PN9 A;  1GUM A;  16GS A;  4XS4 B;  2GQL A;  1KQ7 A;  2EC4 A;  3TOU A;  2DMM A;  4N10 A;  3IA1 A;  2P5Q A;  2R0C A;  4KDY A;  1WIK A;  3GMF A; 
#chains in the Genus database with same CATH homology
 5H5S A;  1XPV A;  2M72 A;  5EL8 A;  2HRF A;  3G7J A;  1J08 A;  3FZ5 A;  5ENU A;  1F9M A;  5ECL B;  1XW5 A;  3CYN A;  3QFB C;  4RQX A;  4G19 A;  1XWC A;  3HKR A;  2HXK A;  5AN1 A;  1V58 A;  4IJ3 A;  4JRR A;  2P5R A;  4Z2U A;  1XW6 A;  1XWB A;  2PUK C;  3M1G A;  3ERW A;  4EIP A;  2PU9 C;  1I5G A;  2O89 A;  4P3Y B;  2AJQ B;  1WRY A;  5IPH A;  2C3T A;  3L4N A;  5DBQ A;  5F07 A;  4RQR A;  3IHG A;  1T8E B;  2HLS A;  5D73 A;  2DIZ A;  2WFC A;  1SK2 A;  1M0U A;  4XIH A;  1BX9 A;  4GSS A;  1WP0 A;  14GS A;  4K5R A;  4X0X A;  3F4S A;  3I69 A;  1R5P A;  4K6X A;  3UOM A;  2L5O A;  2AUV A;  4OFN A;  1QUW A;  1FB0 A;  3IRA A;  3WGD A;  1M99 A;  2LJK A;  2L4C A;  2CX4 A;  4D73 B;  1B4Q A;  2H0H A;  1AQW A;  1OE8 A;  2VAF A;  3LGC A;  1FB6 A;  4HZ4 A;  4MZB A;  7GSS A;  4MF5 A;  4AF2 A;  4EDZ A;  1J0F A;  1Z5Y E;  4JU5 A;  3VPT A;  2DJK A;  3P8W A;  3ERG A;  2HSM A;  3BOA A;  1FO5 A;  5DAK A;  3HXS A;  3QAV A;  1V57 A;  2X4A A;  2GT5 A;  4IVF A;  2H01 A;  1WJK A;  4HU9 A;  3GNJ A;  5J5N A;  1FOV A;  3FEU A;  2I9H A;  5EVO A;  3DRN A;  1AUC A;  1PGT A;  1ML6 A;  1U87 A;  12GS A;  3ISO A;  5ELA A;  4L0W A;  1WOU A;  5KOX A;  3LXT A;  4GF0 A;  1Z6N A;  2EIR A;  2NDO A;  2BTO T;  4PNF A;  5JCG A;  2K8V A;  3GUS A;  4K7N A;  1V98 A;  5IPG A;  2WRT A;  2LS5 A;  5CAX A;  2L59 A;  2LNS A;  3MNG A;  2NBS A;  4QL9 A;  2VLV A;  19GS A;  3A2X A;  2YWM A;  3EU3 A;  1XIY A;  2HZE A;  2H76 A;  3GFK A;  4I8B A;  3IE3 A;  2R3X A;  1UVZ A;  1A2M A;  2IN3 A;  4I6X A;  4KND A;  1V40 A;  2ZCT A;  1V9W A;  2M46 A;  3EYT A;  2C3N A;  3QD9 A;  5J41 A;  3N9J A;  3DGQ A;  1ZL9 A;  3F4T A;  2H19 A;  1OC3 A;  2IFQ A;  3TKP A;  5CRG A;  4GXZ A;  4NXI A;  1MTC A;  1ERT A;  4V2L A;  2RM6 A;  4F82 A;  4EUY A;  2QKE A;  2HT9 A;  3TKR A;  4K9Z A;  4G2E A;  3ZZX A;  2HZF A;  4BWQ A;  4J2F A;  3DVX A;  1OC9 A;  1ERU A;  3I9V 2;  2LUS A;  3HJO A;  1B48 A;  2P31 A;  1K3Y A;  1O7U A;  4ICY A;  1PL1 A;  4YAP A;  4MPG A;  4ZBB A;  1N8J A;  3A5I A;  3DKS A;  1W89 A;  4G0I A;  1G7O A;  1MD4 A;  1BG5 A;  3FK8 A;  5G1L A;  2LQQ A;  4TXO B;  1FW1 A;  3VLN A;  4HQZ A;  4ILF A;  1THO A;  2HSY A;  4TR1 A;  2C0G A;  4NWY A;  3FR6 A;  4ML6 A;  3C73 A;  5CRE A;  1MD3 A;  3KZQ A;  1JZW A;  4ECB A;  5DAL A;  2REM A;  3EWL A;  3TKQ A;  4GLT A;  3LQ7 A;  2XHF A;  4I2T A;  2B1K A;  3NOF A;  4K5S A;  2CQ9 A;  3RHB A;  5G2Z A;  2H0G A;  2C3Q A;  2I81 A;  2MYG A;  1YEP A;  1GSD A;  3DWV A;  3C1S A;  4X1U A;  2HSH A;  4HDE A;  4K0G A;  1LBK A;  2LTK A;  3GL5 A;  4DSS B;  2DJ1 A;  1JLV A;  1PRX A;  3D5J A;  4PTS A;  5IQY A;  1A23 A;  1K0B A;  2EIQ A;  3KCM A;  4E8H A;  4BVX A;  3IAS 2;  4PUR A;  1MEK A;  2H6X A;  3U6V A;  6GSW A;  2FA8 A;  4JE1 A;  5KN2 A;  1GTA A;  1FG4 A;  1JHB A;  1TKD B;  2H70 A;  1J9B A;  1USB A;  3CSJ A;  2L6D A;  2C4J A;  4ZB8 A;  2QSI A;  2I3Y A;  5FHI A;  4OMV A;  2RUF A;  3WGX A;  2R5G A;  4AJ6 A;  4NHZ A;  4EIQ A;  2VD1 A;  2KP1 A;  3APO A;  4BL7 B;  2GLR A;  6GST A;  3A3T A;  4POK A;  1Q4J A;  3ZL5 A;  3M9K A;  2B5X A;  3IK9 A;  3Q19 A;  3HCZ A;  1JLW A;  2HYX A;  4OO5 A;  5GZZ B;  2YAN A;  4EL1 A;  2VL2 C;  2VCX A;  1HNC A;  5D9V A;  5CRW A;  2YJH A;  3R2Q A;  1M2A A;  1DE1 A;  3M3M A;  5B7C A;  3FZ9 A;  3ZIJ A;  1SKR B;  1TDI A;  3IBH A;  3KP9 A;  1Z7R A;  1IYH A;  1HQO A;  1GUL A;  2JZR A;  2D28 C;  1SYX A;  3EMP A;  4OFT A;  1JFU A;  3PH9 A;  1S3C A;  4ACS A;  4JR4 A;  1FHE A;  3GTU B;  3F9U A;  1H75 A;  1KTE A;  4MDC A;  4FIW A;  4EC0 A;  4O92 A;  1U3A A;  2E7P A;  5ECK B;  1DUG A;  3LXZ A;  22GS A;  4IW9 A;  2R6K A;  2ZUP A;  3UL3 A;  4YH2 A;  1PA3 A;  4HS1 A;  2JZT A;  3F0I A;  2YV7 A;  3HYP A;  3LG6 A;  3VWU A;  2H0I A;  1JZR A;  2V32 A;  2MBS A;  3EE2 A;  4QL7 A;  4LMW A;  3LJR A;  3LYK A;  5IMD A;  1PN0 A;  1FVJ A;  3S9F A;  1AIU A;  5ECH B;  4DSQ A;  2K6V A;  1YQ1 A;  4NV5 A;  1PKZ A;  2JZS A;  1GH2 A;  4WR4 A;  2O87 A;  4JZQ A;  4F0B A;  4EDY A;  1ZGN A;  5F06 A;  1EOG A;  1UC7 A;  3D6I A;  5DJM A;  3D21 A;  6GSX A;  3TJJ A;  1GSY A;  2F8A A;  1OVN A;  3IK7 A;  1TRU A;  3QPM A;  4CY6 A;  1ZCP A;  1PMT A;  3L78 A;  2YV9 A;  3QOU A;  2HNL A;  4KSO A;  1ZYE A;  4RUV A;  4XS1 A;  4MF6 A;  3FYG A;  1BYE A;  1RW1 A;  2IMD A;  4MH2 A;  1IYI A;  1AAZ A;  2LJR A;  4OCF A;  1EP7 A;  1CQH A;  1OKD A;  1TI3 A;  2K18 A;  3KH9 A;  2F9S A;  4RI6 A;  2L57 A;  3UAR A;  2GZZ A;  3VFI A;  1VF1 A;  3VWV A;  5HFI A;  3QFA C;  2XC2 A;  4OCE A;  2G2Q A;  4HEA 2;  2WCI A;  3U5R E;  1XOB A;  2X8H A;  4XS4 A;  1GSU A;  3W8S A;  1GRX A;  4MZC A;  2H6Y A;  4WR5 A;  3CMI A;  1QGV A;  4GST A;  3CSI A;  4NAX A;  2LRN A;  2N5F A;  3GHA A;  5DVB A;  1A2J A;  2H66 A;  1F3B A;  5FWG A;  4ZXG A;  3CXG A;  4K8M A;  3CTG A;  4YQV A;  4MJA A;  2IIY A;  3OR5 A;  2J9H A;  3WD6 A;  3V1W A;  5L71 A;  1WPI A;  2GQK A;  5ECI B;  5AIS A;  2AYT A;  2H73 A;  2VL2 A;  2IMI A;  3H1N A;  5D9W A;  3TJK A;  3UBK A;  3FKF A;  1TRW A;  3W8J A;  1OC8 A;  2OE3 A;  2D27 A;  4TRX A;  2MZC A;  4GQF A;  3HZ4 A;  2B5E A;  4TR0 A;  1K3L A;  1EGR A;  3J7Y k;  1NHO A;  1TJD A;  1T00 A;  1G7E A;  1DSB A;  4L5O A;  2RM5 A;  5KN3 A;  2KHP A;  2FGX A;  3LYP A;  2WDU A;  1MDK A;  3GH6 A;  4Z2R A;  1GTU A;  4KE3 A;  1QMV A;  1OE7 A;  2B7J A;  3MWH A;  5D8I A;  3KEB A;  2FA4 A;  4NV2 A;  2MBT A;  1EOH A;  2F3M A;  2DLX A;  3Q18 A;  4KB3 A;  2GQM A;  1XOA A;  5IMA A;  1XWA A;  3G9B A;  2H1D A;  2OA7 A;  2QC7 A;  3UEM A;  2F51 A;  1T1V A;  4KSM A;  4JED A;  2PVQ A;  2WS2 A;  4D73 A;  2V41 A;  3KP8 A;  1SD8 A;  2CAQ A;  1VGL A;  2LNT A;  1A24 A;  5CP1 A;  1YY7 A;  1XWG A;  2GT6 A;  2CA8 A;  4BVY A;  1GSF A;  4XCS A;  1R26 A;  5ECN B;  2L4Q A;  2CT6 A;  4MJB A;  1SEN A;  1MDJ A;  1QFN A;  1TOF A;  5HFK A;  4N30 A;  1H4O A;  1ST9 A;  3EC3 A;  2E2G A;  3TKS E;  4GSN A;  5AGY A;  2R4V A;  5DQY A;  3IPZ A;  3UJ1 A;  2DJ2 A;  5J4U A;  1TXX A;  1WE0 A;  5ECQ B;  3RBT A;  2PPT A;  1SYR A;  4IGJ A;  1Q98 A;  2OE0 A;  5G30 A;  4BA7 A;  1VRS D;  1G6W A;  3ZVJ A;  2GSR A;  2YWI A;  3KD0 A;  4O5U A;  3TDG A;  2CZ2 A;  4KA0 A;  4EF0 A;  2JSZ A;  1O85 A;  2VM2 A;  1SKW B;  5IMC A;  2BJX A;  3GRX A;  1M9B A;  1TI1 A;  4N0V A;  2E2M A;  4OWY A;  2LKU A;  3HVS A;  3HDC A;  5F8B A;  3KTB A;  2LJA A;  2O8V B;  4FYU A;  2A2S A;  5IIZ A;  4O32 A;  3GA4 A;  1ZZY A;  4YAV A;  4MZW A;  2LST A;  2FHE A;  4K7I A;  3FR3 A;  3ZRE A;  2DBC A;  2RII A;  5FT3 A;  1XZO A;  2V2G A;  4N0Z A;  3GUR A;  2LRC A;  4O5Q A;  3TOT A;  2DJ0 A;  1QQ2 A;  1A8L A;  1SJ6 A;  2Z9S A;  1K0A A;  3GX0 A;  3PGT A;  5F0G A;  3F6F A;  3GKX A;  2H74 A;  3KH7 A;  3R3E A;  4MAB A;  1K0C A;  1SJZ A;  1SL0 B;  1KNG A;  3ZIV A;  3BJ5 A;  2YZH A;  4A5P A;  2FWG A;  1SD9 A;  1HNA A;  3A2V A;  2MMN A;  3HVV A;  2AV4 A;  5ECP B;  4QQ7 A;  3IHQ A;  5D93 A;  3NZN A;  2OAC A;  1IW7 D;  3HJP A;  4POM A;  3KGK A;  4TXO A;  5A4W A;  2N5B A;  4ECJ A;  3I6A A;  3E0U A;  1JZD A;  5HR2 A;  5D9T A;  1X5C A;  1QK8 A;  1M7T A;  3MAK A;  2BMX A;  2AB6 A;  1BJX A;  1URM A;  4ECI A;  4ZB9 A;  5D96 A;  3TJF A;  2AHE A;  1ERW A;  3N5O A;  1GSS A;  2L5L A;  2TRX A;  4OFM A;  1XCC A;  5G5F A;  5C04 A;  4L0U A;  1KBN A;  1WMJ A;  2CVB A;  4PUF C;  2OE1 A;  3US3 A;  5HQP A;  2VD0 A;  1K0N A;  3LOR A;  2NTO A;  5JWR B;  1DBY A;  3KJY A;  3HHV A;  1EV9 A;  5CYY A;  3MYD A;  4MA9 A;  3GSS A;  5DCG A;  2LEG A;  3G7Y A;  3QMX A;  3WYW A;  2X8G A;  4IQJ M;  4ECC A;  3KMN A;  3UMA A;  3BD2 A;  3EVI A;  5ID2 B;  4ZIL A;  2LV3 A;  4DSS A;  3Q74 A;  4FYB A;  3GIX A;  4IS0 A;  4ZL8 A;  2YOI A;  4ZBD A;  2E0Q A;  4ID0 A;  2GSQ A;  4F0C A;  2A2P A;  5ECO B;  3SWL A;  1R4W A;  2P0G A;  17GS A;  3TRQ A;  4KUN A;  1NW2 A;  2DC5 A;  1YKC A;  1A2L A;  4MH3 A;  1I9D A;  5A4V A;  2JSY A;  1TRS A;  3LFL A;  2VO4 A;  3VPQ A;  4DSR A;  4K2X A;  4WF5 A;  4KAE A;  3CTF A;  1O8X A;  3TJB A;  2VOC A;  2C80 A;  4FYC A;  1V2A A;  3VWX A;  5IMV A;  3FY7 A;  5JCU A;  4HOJ A;  2YNX A;  3C8E A;  1Z6M A;  3ME7 A;  1M9A A;  5J3R A;  1GL8 A;  3MSZ A;  2B5Y A;  3RDW A;  1O8W A;  4I97 A;  4HJM A;  2AAW A;  1EGO A;  4IP1 A;  5J9C A;  3WT1 A;  3F8U A;  2WB9 A;  5ECM B;  1UA5 A;  3L9S A;  3BBY A;  4RI7 A;  1EEM A;  2OBK A;  5CNW A;  1SL2 B;  4ZB6 A;  1O73 A;  3MDK A;  3NIV A;  4HI7 A;  3DIE A;  4HZ2 A;  1VF3 A;  2RLI A;  5CRH A;  1B9X C;  2ON7 A;  3TRX A;  2IJY A;  3O76 A;  1AC1 A;  2CV4 A;  3GN3 A;  4MP4 A;  2MMA A;  3LW9 A;  2V1M A;  2JAC A;  5GSS A;  3LSZ A;  3GTU A;  5IO0 A;  5ECR B;  2C0F A;  1RQM A;  3IXR A;  1SK0 A;  5KOW A;  5HR1 A;  2VL9 A;  3ZYW A;  2YPM A;  2JL4 A;  2B1L A;  1ACV A;  3O6T A;  1EZK A;  2TRC P;  1EV4 A;  3ZTL A;  1GTI A;  2DJJ A;  3IAM 2;  3KMO A;  2H8L A;  2B6M A;  2DIY A;  1Z3E A;  3KTL A;  1FVK A;  4TKY A;  4GCI A;  1T4Y A;  2X99 A;  2YP6 A;  3ZFB A;  5LD0 A;  4KDU A;  3UVT A;  1G0T A;  3F4R A;  3PR8 A;  5INY A;  3F3R A;  4ZL9 A;  5KN1 A;  2IMK A;  2CZ3 A;  3E3E A;  3KM6 A;  3KIJ A;  2UZ8 A;  3D4T A;  1A8Y A;  5EPF A;  1K3O A;  3APS A;  1GWC A;  4TW5 A;  3P90 A;  5E4W A;  4XS6 A;  3DEX A;  4KH7 A;  1EWX A;  2WJU A;  5COH A;  1GNE A;  2VIM A;  3H8Q A;  4K2D A;  1AXD A;  3P7X A;  3VWW A;  2FLS A;  3C7M A;  4K0N A;  4PQ1 A;  3HD5 A;  1ABA A;  4MF7 A;  3F3Q A;  3EU4 A;  4CY8 A;  2OJL A;  1FOH A;  3K8N A;  4KX4 A;  4MCU A;  5ELG A;  5KEJ A;  3A5W A;  2OAD A;  1PD2 1;  3HA9 A;  4GWR A;  2YZU A;  5A5K A;  4V2N A;  2FY6 A;  3TUE A;  5JWO B;  1GTB A;  3GKM A;  4O7H A;  4K1F A;  2FWE A;  2H30 A;  1RK4 A;  2D2Z A;  1XXU A;  3E9J B;  3IR4 A;  3DD3 A;  2OKA A;  1MDI A;  4OO4 A;  4KW6 A;  1TU7 A;  2YJ7 A;  4GRF A;  3LWA A;  3VK9 A;  1EEJ A;  1E6B A;  5H5R A;  4IHU A;  1U88 A;  1PX7 A;  1T3B A;  3VI5 A;  2K9F A;  2XBI A;  1BQ7 A;  4TN8 A;  4GQC A;  3UVH A;  2C1Y A;  1SL1 B;  1A0R P;  1KEB A;  4JBB A;  4YQM A;  4XHM A;  4I2U A;  1W4V A;  4PNG A;  4HQS A;  1YEX A;  2CVK A;  3D22 A;  9GSS A;  1B9Y C;  2N5A A;  1Z9H A;  3GH9 A;  2YCD A;  1X9S B;  2VLT A;  2YWO A;  4YQU A;  1F2E A;  4DEJ A;  4LA1 A;  5IOX A;  2CX3 A;  1TP9 A;  1AW9 A;  3QAW A;  2GDR A;  2L6C A;  1BED A;  1T4Z A;  3VI7 A;  3M9J A;  4I5Q A;  2H72 A;  6GSS A;  5GAN D;  4G9H A;  2CVD A;  4WBJ A;  2HRA A;  11GS A;  1OYJ A;  5IO2 A;  3CRU A;  4IQ1 A;  2WUL A;  2C0E A;  2A4V A;  3G7I A;  3L9U A;  5IMF A;  4Z7X A;  3L9V A;  5JWQ B;  4NMU A;  4XRD A;  4L8E A;  4O5R A;  4TR4 A;  1BAY A;  3FMW A;  1AQX A;  2PN8 A;  2G0F A;  2GVP A;  3ZLP A;  4ULX A;  1OKT A;  4E8E A;  2DJ3 A;  2IME A;  5HR0 A;  1GSE A;  2FCH A;  2KUC A;  6GSU A;  5AIV A;  4XTS A;  1HD2 A;  4YKG A;  4IBP A;  1M2B A;  2QA1 A;  4ML1 A;  4MNN A;  2R0P A;  2XBQ A;  1M2D A;  3GKN A;  3O3T A;  3EMX A;  2RUE A;  1YJ6 A;  2A2R A;  2R0G A;  3GKK A;  2IMF A;  4IKH A;  18GS A;  3CBU A;  3HZ8 A;  1OAZ A;  4Q5Q A;  1YF0 A;  4V1A g;  4TR3 A;  5B8B A;  1NHY A;  3GL3 A;  3FW2 A;  1XBS A;  2ON5 A;  4J57 E;  5IMZ A;  4BVY B;  2IPA A;  3FHK A;  5G5E A;  1X5D A;  4K7O A;  4BWS A;  5DAK B;  4L5L A;  5JCW A;  3SBC A;  6GSV A;  4Q5F A;  3QR6 A;  4DVC A;  1TRV A;  2PMT A;  4CHS A;  5E59 A;  3DXB A;  5A4U A;  2KP2 A;  1HNB A;  3IV4 A;  3I43 A;  1GUH A;  1ILO A;  1NSW A;  2I1U A;  3AY8 A;  4JR6 A;  3UAP A;  3CRT A;  3UBL A;  4BPY A;  1C72 A;  5GAP D;  4EO3 A;  5B6M A;  1LJR A;  2H75 A;  2WZ9 A;  2ES7 A;  3H4K A;  5HR3 A;  3EPT A;  2FWH A;  3TCO A;  2FUG 2;  2XPD A;  2HRN A;  4IEL A;  3GYK A;  2HZE B;  3GX8 A;  3TJG A;  5BMU A;  2MMO A;  1PL2 A;  2H1B A;  1XFL A;  5C00 A;  2DSA A;  4KCA A;  2O7K A;  2R2J A;  1G6Y A;  3ZRD A;  2H1G A;  3PIN A;  5F05 A;  2B3S A;  2DKH A;  3J7Y b;  4G10 A;  3D4M A;  2DML A;  4ZL7 A;  5ECS A;  3VUR A;  3A2W A;  1A0F A;  2X49 A;  1U3I A;  3QDN A;  3W6G A;  1U6T A;  5IM9 A;  1ZMA A;  2IFQ B;  5ABR A;  2X8C A;  1FAA A;  4PQI A;  4G0K A;  3BCK A;  3UIW A;  2PGT A;  5CRD A;  3ED3 A;  2C8U A;  2A4H A;  1ZOF A;  4IN0 A;  1WWJ A;  4WBR D;  1OC9 B;  2M80 A;  3HJM A;  2GZP A;  4WEY A;  2FNO A;  1O6J A;  3ZIT A;  3ZFL A;  5CO3 A;  3JCM L;  4EXJ A;  2KOK A;  1B4P A;  5DCH A;  1TU8 A;  4KF9 A;  4POL A;  4PUA A;  5KN0 A;  3Q6O A;  4J56 E;  4H86 A;  3M8N A;  10GS A;  3H79 A;  1CQG A;  1F37 A;  1JZO A;  4LMV A;  3EUR A;  1GUK A;  2YN1 A;  2H1A A;  1R5A A;  3F63 A;  1GLQ A;  3GV1 A;  3HVX A;  3P2A A;  2J23 A;  4PGT A;  4POB A;  4TR1 B;  3RAZ A;  3TKS C;  2B7K A;  4MMM A;  3KXO A;  1PX6 A;  1GNW A;  2GZY A;  5DAL B;  1XVQ A;  1XVW A;  4WF4 A;  3IC4 A;  1YZX A;  4TOP A;  3ZVJ D;  2R37 A;  4WET A;  1UN2 A;  2VCQ A;  4G0L A;  3PPU A;  4EKZ A;  5ID2 A;  4CDO A;  3F6D A;  3DYR A;  1YF1 A;  2VM1 A;  5G1K A;  2NPB A;  5B8A A;  1T7P B;  4ZBA A;  4FO5 A;  4AJ7 A;  2QA2 A;  3MIX A;  4MLY A;  3FRC A;  1TK5 B;  2ALB A;  2MMZ A;  4MPF A;  2XPE A;  2OBI A;  4WKW A;  5D9X A;  1PKW A;  3FR9 A;  1ZYQ B;  4F2I A;  4IP6 A;  4YKF A;  2VCZ A;  4OD7 A;  1HYU A;  2VL3 A;  1N2A A;  4KCE A;  4Q5R A;  4MJE A;  1F3A A;  4BVX B;  5IOW A;  1QXH A;  2TIR A;  4WXT A;  4X4J A;  3RHC A;  3WGE A;  1SK1 A;  2YWN A;  2PVO C;  2PWJ A;  1NM3 A;  1X0R A;  3TGZ A;  4N11 A;  4BL7 A;  4XRA A;  3WT2 A;  3M0F A;  2ZNM A;  4PXO A;  5BRT A;  4LL1 B;  3EIN A;  4TXV A;  3QAG A;  4IJI A;  3FZ4 A;  2H6Z A;  5J9B A;  2X64 A;  2F8F A;  1PQN A;  5LNK e;  3DVW A;  3BCI A;  3IC8 A;  1E2Y A;  2GSS A;  1X9W B;  2LQO A;  1VF4 A;  5DQS A;  1R7H A;  2IL3 A;  5DDL A;  1B8X A;  3CSH A;  1X5E A;  4V2M A;  8GSS A;  1EP8 A;  5EY6 A;  4F9Z A;  1GLP A;  4USS A;  1Y6E A;  1TK0 B;  3ZMK A;  1LU4 A;  4KGI A;  1K0O A;  2EIO A;  2WGR A;  3APQ A;  1Y25 A;  3RPN A;  1XWK A;  4MK3 A;  2HRK A;  4PX1 A;  2PBJ A;  1K0D A;  1AQV A;  3ERF A;  3GST A;  1SJI A;  2GTU A;  1K0M A;  1ZYN A;  4LL4 B;  2DKI A;  4LLR A;  3FZA A;  4IQA A;  4FQU A;  1Z7P A;  3TB2 A;  2C0D A;  2GGT A;  3IDV A;  1TTZ A;  2O85 A;  2HE3 A;  3C71 A;  5HFG A;  4Q5N A;  4PQH A;  3QCP A;  3D0Z A;  4HU7 A;  20GS A;  4EE0 A;  2VCV A;  3ZML A;  4CW9 A;  2H71 A;  3LEF A;  4ISD A;  5LCZ A;  1DE2 A;  4EVM A;  3DML A;  4AJ8 A;  2GS3 A;  4HJ2 A;  1YDK A;  3TKS A;  2V6K A;  1TW9 A;  6GSY A;  1O81 A;  4X43 A;  5DJL A;  1ERV A;  4F03 A;  3HY2 A;  4V1A p;  2HI7 A;  2QGV A;  2VCW A;  2JAD A;  3RPP A;  4TVE A;  2LRT A;  1YKA A;  1ON4 A;  4NPB A;  2HFD A;  1THX A;  3C1R A;  2JU5 A;  2K8S A;  5AIX A;  2VCT A;  2FD3 A;  2CAI A;  4FH8 A;  4HUA A;  4MJC A;  2FWF A;  5G31 A;  1X9M B;  2VUP A;  3H93 A;  1SU9 A;  1PSQ A;  1S3A A;  5B6N A;  4AGS A;  13GS A;  3ME8 A;  4ZIJ A;  2V6O A;  3L0H A;  2GST A;  2I4A A;  2IWT A;  1GP1 A;  2PER A;  1TK8 B;  1F6M C;  2NVL A;  5GST A;  1GSQ A;  1VF2 A;  2VLU A;  3IOS A;  5H5Q A;  4KDX A;  4NHW A;  3TRP A;  1XW9 A;  4GTU A;  1S3D A;  4Z2T A;  1ZYP A;  1SKS B;  2KLX A;  1PN9 A;  1GUM A;  4XS4 B;  16GS A;  2GQL A;  2EC4 A;  3TOU A;  2DMM A;  4N10 A;  3IA1 A;  2P5Q A;  2R0C A;  4KDY A;  1WIK A;  3GMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...