3F4SA

Crystal structure of wolbachia pipientis alpha-dsba1 t172v
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
199
structure length
199
Chain Sequence
TSNELLLPLPNDKLLGDPKAPILMIEYASLTCYHCSLFHRNVFPKIKEKYIDTGKMLYIFRHFPLDYRGLKAAMLSHCYEKQEDYFNFNKAVFNSIDSWNYYNLSDLTLLQRIAALSNLKQDAFNQCINDKKIMDKIVNDKSLAINKLGITAVPIFFIKLNDDKSYIEHNKVKHGGYKELKYFTNVIDKLYGKAIVKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative uncharacterized protein
publication title Structural and Functional Characterization of the Oxidoreductase alpha-DsbA1 from Wolbachia pipientis
pubmed doi rcsb
source organism Wolbachia pipientis
total genus 74
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2008-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.80 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Ribonucleotide Reductase Protein R1; domain 1 3f4sA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3f4sA01
4IP1A 3E9JB 4LMVA 2O7KA 2K8VA 5CNWA 2FD3A 1TJDA 4G19A 4L5LA 1QXHA 4FYUA 4ZL7A 2FUG2 2H70A 5EY6A 5F07A 2GLRA 1IYIA 1EGOA 5B7CA 3JCML 3UAPA 1VF2A 1SL1B 2ZNMA 1T4YA 2MBTA 1LBKA 3ERWA 4MJAA 2VD0A 2LNTA 5A5KA 5FWGA 1ZL9A 2BTOT 1AAZA 2B3SA 5DCHA 3HA9A 2WB9A 1CQHA 3EE2A 2VCZA 1UVZA 4IN0A 4J56E 2WCIA 5AGYA 2LKUA 2F8AA 3QAGA 3UVHA 2GZPA 3FY7A 2GQKA 4P3YB 2C0DA 4J2FA 4Z7XA 3VLNA 2CVKA 5J5NA 2VL3A 2C0EA 5HR1A 1KEBA 3ZIJA 5CRGA 1PSQA 4Q5FA 4L0UA 5CRDA 5G2ZA 1V98A 3EMXA 1GUMA 1OE7A 3BJ5A 2WDUA 3G7YA 2QSIA 2IMFA 1G0TA 4KSOA 3LORA 4WR4A 2PUKC 4BWQA 2LEGA 1OVNA 5A4UA 4RQXA 1BX9A 1BAYA 4IQ1A 1EV9A 2GSTA 1PD21 2EC4A 5J9BA 4BWSA 4TR3A 4GWRA 2CVBA 4NV5A 3MDKA 4XS4A 5CP1A 3LYPA 4HZ2A 3C8EA 1FAAA 2NTOA 1GUHA 2CAQA 3GL5A 3J7Yb 1GP1A 3CRTA 3LSZA 3FR3A 1A2JA 5IO2A 2PN8A 3BBYA 5ID2B 5EVOA 5DQYA 2B5XA 2EIOA 2IPAA 1FB0A 5FT3A 4RI6A 2P5QA 5CREA 1GSUA 4EXJA 3F3RA 3K8NA 4POBA 5D9VA 4YQMA 4KSMA 2MBSA 4L8EA 3TKQA 4MA9A 4DSSB 3D4TA 2LTKA 1OYJA 2C0GA 3FHKA 1QGVA 2V41A 3UBKA 1Z6NA 4X0XA 1J9BA 3H4KA 2JZRA 5F0GA 5GAPD 1DE1A 1F37A 2VLUA 4MMMA 1NM3A 2HSYA 1QUWA 1GTBA 3FR6A 6GSSA 4WF5A 4QQ7A 1VGLA 4GXZA 4TR0A 4MZCA 3ISOA 4JE1A 1U88A 1SYXA 2VO4A 2MZCA 2IJYA 5ENUA 4ECBA 2P5RA 4BPYA 3IDVA 5J9CA 3GN3A 5CO3A 3VWUA 3E0UA 3ZIVA 2XBQA 4IJIA 5IO0A 1EEJA 2IIYA 1OKDA 4O92A 1YEPA 4EDYA 3FKFA 1A24A 2YWMA 2FA8A 5IM9A 2MMOA 1TI3A 1S3DA 4CHSA 1SJ6A 2TRCP 1SKSB 3FZ5A 2A4VA 1EP8A 2H72A 2GS3A 2B6MA 1SJZA 4O5RA 1EOGA 3SWLA 2FY6A 19GSA 3LXTA 1AQWA 1WPIA 3NZNA 3DWVA 3TJJA 4GCIA 2OE3A 5JWOB 4NHWA 4I2UA 1XWCA 2TIRA 2YPMA 3UOMA 1TI1A 4V2LA 5EL8A 3TRXA 4CW9A 4EKZA 1RW1A 3DEXA 3IK7A 4D73B 1WP0A 4HEA2 3HJOA 1HQOA 4WETA 4HU7A 5IPGA 3I9V2 4KX4A 2OADA 1SJIA 2WS2A 4IKHA 3GYKA 4IVFA 1DUGA 1J08A 1XWKA 3TRPA 4WXTA 2H8LA 2PERA 2CAIA 2KLXA 1K0NA 1URMA 3KGKA 1V9WA 2I9HA 4JR4A 3TJGA 2H0HA 1FO5A 4KCEA 3M3MA 4OCEA 2RLIA 4HI7A 4MF7A 4TW5A 4XRDA 1UC7A 3KTBA 1XPVA 2FWFA 5CRWA 2C8UA 4HJMA 4EUYA 5ECIB 2E7PA 3IOSA 2X8HA 1M9AA 2N5FA 2XPDA 4EDZA 5DJMA 4KUNA 1TK8B 3TB2A 4ECCA 3IAS2 3WT2A 4LL4B 5DAKB 4G9HA 1Y6EA 3F8UA 1TU7A 2E0QA 1XW5A 3WT1A 1DBYA 1M99A 2AHEA 1GSEA 4TOPA 1ILOA 4KDXA 1ON4A 5ECPB 1ERTA 2EIRA 5IMFA 1K0DA 1GUKA 3IK9A 3F0IA 3PINA 1M2DA 1OC9A 2QGVA 3RBTA 1XW6A 5CYYA 2VL2C 2YZUA 2DLXA 2HRFA 1N2AA 2HZEB 3SBCA 1T1VA 4ISDA 1XWBA 1B4PA 5KEJA 3KZQA 1G6YA 5G5EA 4FO5A 3ZFBA 4MPFA 3UIWA 3UMAA 3W8SA 2O85A 5GZZB 1BJXA 3HD5A 3KH7A 1R5AA 3HJMA 5H5QA 5IMVA 3IRAA 3WD6A 1HYUA 3CSJA 2DJKA 3VWVA 2CX3A 2ALBA 4YQUA 2C80A 1X9MB 3Q19A 2HZFA 1G7EA 3MSZA 4POLA 2PVOC 1F3BA 13GSA 2MYGA 2YWIA 2FHEA 1A0RP 1SENA 6GSVA 1AXDA 5H5SA 1XIYA 1Z7PA 4V2NA 2HE3A 2CT6A 2V1MA 3M8NA 3LXZA 5ECOB 2OACA 4IW9A 2VCWA 1Z3EA 2FNOA 3TCOA 1AUCA 3O76A 3D6IA 2ZCTA 4F2IA 3LYKA 2ON5A 1YKCA 2XPEA 5ECSA 5IIZA 3EVIA 5INYA 3IBHA 1H4OA 2H01A 1TW9A 5D9TA 5GSTA 3ZL5A 1XVWA 3GSTA 4GTUA 4F82A 1YF1A 3TKSC 1ZZYA 3PH9A 4GLTA 1GNEA 2OE0A 1SD9A 3QOUA 4YQVA 1OE8A 2AAWA 4ZB8A 1R7HA 4KNDA 4ZILA 4GSSA 4GF0A 2LJAA 1JZDA 1MD4A 1WWJA 1MDKA 3L9UA 1Z5YE 5HR3A 4MF5A 4GQFA 2YCDA 9GSSA 2L5LA 3KIJA 5HQPA 3HVXA 2OA7A 3QAVA 2K9FA 2O87A 2VCVA 3LJRA 3HCZA 2V6KA 1F3AA 2KP2A 1GULA 1WRYA 2G2QA 1X9WB 3EURA 3TKSE 2GTUA 4MPGA 1XVQA 4XHMA 1GRXA 3VURA 5C04A 3H1NA 2GGTA 1M7TA 5ELAA 2PBJA 2WGRA 1OKTA 3LQ7A 4MLYA 4ML1A 3HZ8A 4PUFC 4FIWA 2GDRA 3DMLA 2LRNA 1DE2A 22GSA 3GHAA 2HLSA 1FW1A 4Q5RA 2CX4A 2NDOA 5ECHB 2M46A 2GT5A 2KHPA 2R4VA 4OCFA 1X5EA 5G5FA 4ZBDA 3KCMA 3ERGA 3LWAA 5D9WA 1BQ7A 3L4NA 4TXOA 1WMJA 1A8LA 4HQSA 2DMLA 2P0GA 3AY8A 3BD2A 5F06A 5DJLA 2R5GA 4MZWA 3TJKA 2H73A 5D93A 2IN3A 4XS4B 3UEMA 5DCGA 2LQQA 4JRRA 4NXIA 3KH9A 5D9XA 2AV4A 5ELGA 2VUPA 2FWGA 1QK8A 2YOIA 3C7MA 3H79A 3VI7A 3VPQA 2RM6A 4MF6A 3TGZA 2B5EA 2LQOA 4N10A 1TRSA 3HY2A 5KN1A 2DIZA 3TUEA 5IOXA 2QKEA 4KH7A 2A2SA 2FA4A 2OBIA 1O8XA 4QL7A 3QD9A 1R4WA 3RDWA 2NPBA 2LRCA 3BCIA 5B8AA 3ERFA 4NMUA 3FRCA 1RQMA 4OFTA 2RM5A 3APOA 1PMTA 3GUSA 3L78A 3G7JA 1EP7A 2I81A 2K8SA 4MK3A 1JFUA 4PQIA 5ID2A 3EC3A 3APSA 1GTAA 2XBIA 2BJXA 2R37A 3FZ9A 3CBUA 3N5OA 1FVJA 2K18A 3KMOA 4HU9A 1TU8A 11GSA 4QL9A 4BA7A 5F8BA 3MAKA 2WRTA 4KE3A 1WJKA 4NHZA 1KBNA 2QC7A 6GSYA 5IMAA 1K0CA 4WR5A 4DSSA 5E59A 4KCAA 5IOWA 2DMMA 4ECIA 3TDGA 1O81A 4LMWA 2KP1A 4EC0A 3VWXA 1UN2A 3D0ZA 2OJLA 2XHFA 3IV4A 2FWEA 3MWHA 3WGXA 1Q98A 1G6WA 2VL9A 1Y25A 2JSZA 1F2EA 3H8QA 3A5WA 4GSNA 3D4MA 1Z9HA 5GAND 4IBPA 4AJ7A 2JL4A 3EU4A 3QPMA 5IMDA 1THXA 1V58A 1V40A 3PR8A 4ULXA 1YEXA 3A2XA 2CZ3A 1I9DA 1E6BA 4OO4A 4EVMA 3TKPA 4JBBA 1GSSA 4HUAA 4XIHA 2PPTA 1THOA 4EF0A 1K3YA 4HDEA 2L6CA 2VCQA 2M72A 3P7XA 4OFNA 1USBA 4NWYA 4XCSA 3L9SA 2H0GA 5CRHA 5EPFA 4AGSA 1WIKA 3QAWA 4ZBAA 1TK0B 2PGTA 1Z6MA 3CSIA 3TOUA 2H19A 2VAFA 4V2MA 1ZYEA 2H75A 1ZGNA 1EEMA 1OAZA 4YAVA 3CTFA 2REMA 3HDCA 4ZXGA 1K0BA 1O6JA 3ZRDA 2JU5A 3ZVJA 2DSAA 3DD3A 3RAZA 2GQLA 3L9VA 5JCUA 4EO3A 1U6TA 1H75A 2KUCA 1O8WA 2LUSA 2H30A 5DALB 2YJHA 2H71A 2V6OA 1SK0A 1LU4A 2VL2A 3UBLA 3TJBA 3EINA 1XOBA 1PX7A 2F8FA 4L0WA 2DBCA 3MNGA 4D73A 1BYEA 3M0FA 4K7OA 5G30A 3HXSA 5ECKB 3GKMA 4IELA 1SL0B 4PNGA 1TOFA 2L5OA 1ZCPA 1K0AA 1XWAA 2EIQA 1F6MC 4WKWA 2X8GA 3G9BA 1ACVA 2LSTA 3WGDA 14GSA 2PVQA 4MJCA 2PWJA 3KEBA 2LNSA 2YV7A 3ZREA 1HNBA 1ABAA 1PA3A 2AB6A 3GH9A 4DEJA 3RHCA 4F9ZA 3F4RA 4PURA 2FCHA 4TXVA 2DJ0A 5A4WA 4ZIJA 5HFIA 2R3XA 1WE0A 3GTUA 1GSYA 5GSSA 4DSQA 6GSWA 5IQYA 1PGTA 4K0NA 4ECJA 1K3LA 10GSA 2FGXA 3W8JA 2D2ZA 1G7OA 4IJ3A 4YAPA 4MZBA 2HT9A 1C72A 5DAKA 2L4QA 1T00A 1ML6A 3FW2A 3TKSA 1PN9A 4PNFA 2CVDA 1NSWA 5D73A 4HZ4A 3UVTA 1VF3A 4TR1B 5HFKA 4K6XA 2C1YA 2TRXA 4ILFA 2H74A 3GFKA 5FHIA 2HZEA 2I3YA 1EOHA 4GQCA 3DYRA 2IFQB 1M0UA 4O32A 3UARA 4ZB9A 5JWRB 2FLSA 1X0RA 3I69A 3CYNA 5B6NA 3J7Yk 1PKZA 1ST9A 3IC4A 1VF1A 3TKRA 1GSDA 5JCGA 2HSHA 2YN1A 1K0OA 1JZWA 4K9ZA 5B8BA 1ERUA 5G1KA 1JLVA 1JLWA 8GSSA 4I5QA 1Q4JA 4XS6A 4Q5QA 7GSSA 4N0ZA 1ZOFA 3IA1A 1AW9A 4LLRA 1O73A 3GA4A 2YJ7A 1S3CA 1KTEA 1XCCA 4MJEA 4EE0A 1NW2A 4HQZA 4FH8A 1JHBA 1MD3A 4WEYA 3IAM2 2HI7A 2L59A 3LGCA 5AISA 3U5RE 2GSQA 1A2MA 4J57E 1B9YC 5DQSA 3VK9A 2LS5A 2M80A 3C1RA 1CQGA 2C3NA 2DJ2A 2WZ9A 2B5YA 4I2TA 3KTLA 4POKA 4KA0A 3BOAA 1MTCA 1FOVA 1MDJA 2N5AA 1XZOA 3RPPA 1PL2A 2OKAA 3ZMLA 2CV4A 6GSUA 5LNKe 1TP9A 4EL1A 1OC3A 3QFBC 1T3BA 2H0IA 1HNAA 2GQMA 2H6ZA 5HR0A 3OR5A 3D5JA 4LL1B 2IMIA 1T7PB 4K7IA 2WULA 4E8EA 4KGIA 4F03A 1TRUA 3F4TA 5DDLA 1M9BA 3DIEA 1SU9A 3IPZA 5DVBA 5ABRA 3ED3A 1AQVA 4OFMA 2VCTA 2DJ1A 4MP4A 4LA1A 3M9JA 3O6TA 1S3AA 1FB6A 1J0FA 4K1FA 1OC8A 3DRNA 2H1DA 3HKRA 1N8JA 4WBJA 3TOTA 1YDKA 5KN0A 2B7KA 3M9KA 4TN8A 5AIVA 2MMZA 4K8MA 3DVXA 3CXGA 5ECQB 4JEDA 2I1UA 1NHYA 4V1Ag 3NOFA 3P2AA 4TXOB 2K6VA 3RPNA 2VLTA 2GSSA 2FWHA 2IWTA 5LCZA 1XFLA 4N30A 3ZYWA 3GRXA 4XS1A 1XXUA 2IMEA 3I6AA 2C3TA 2CA8A 2VM2A 3Q18A 4KAEA 4X43A 1X5CA 2VD1A 3GL3A 1ZMAA 1SK2A 3VWWA 3F6FA 2BMXA 4AF2A 1W4VA 2LJRA 2R2JA 5COHA 4MCUA 3M1GA 1PKWA 1RK4A 4K0GA 1GNWA 2L4CA 3G7IA 2HXKA 2F3MA 3P90A 1EV4A 2IMKA 2YANA 3GX8A 12GSA 2VCXA 2V32A 3CMIA 1DSBA 2GVPA 4RI7A 2AJQB 2IMDA 1TRVA 4BL7A 3ZMKA 1SK1A 3WGEA 1XOAA 1PRXA 1SD8A 2LRTA 2OBKA 3A2WA 1TTZA 1SL2B 2H6YA 2PMTA 1SKWB 4K7NA 3D21A 2YNXA 4FYCA 1BG5A 1MDIA 1GH2A 3CSHA 4HJ2A 2VOCA 5IMZA 1F9MA 4MH2A 4IS0A 3GSSA 3HZ4A 3W6GA 1WOUA 1R26A 3C1SA 1TRWA 4F0CA 3F4SA 1B8XA 2XC2A 2F51A 2J23A 3KM6A 2C3QA 3S9FA 4I8BA 2IL3A 5J3RA 3FZ4A 3F3QA 17GSA 2H76A 2VM1A 4KDUA 5B6MA 5AIXA 3QR6A 1LJRA 1A0FA 2MMAA 2RIIA 4V1Ap 1IYHA 3A2VA 4JR6A 5DBQA 2WJUA 4IHUA 2C0FA 3I43A 3F6DA 4POMA 1GLQA 1YF0A 4KB3A 1EZKA 1PL1A 2I4AA 1YKAA 1EWXA 1R5PA 4HOJA 2X99A 3NIVA 5LD0A 5J41A 2ES7A 2Z9SA 4MDCA 3FYGA 3GKKA 3O3TA 3QFAC 6GSTA 3EYTA 2H66A 3D22A 3GX0A 4IQAA 2OE1A 3IE3A 2HFDA 4RUVA 3U6VA 1MEKA 1FG4A 4ML6A 1ERVA 3GMFA 1TXXA 4TVEA 4X1UA 5D8IA 3LG6A 4Q5NA 18GSA 4BVYA 1GSFA 3VPTA 2E2GA 3KXOA 3APQA 4TR4A 2JSYA 4I6XA 2VLVA 3HHVA 1YQ1A 2LJKA 2KOKA 1B48A 3DGQA 3EMPA 4PQ1A 2N5BA 4AJ6A 3WYWA 3VFIA 5G31A 1GTUA 1X9SB 3N9JA 4HS1A 4WF4A 1EGRA 1GSQA 3HJPA 5JWQB 2X64A 5A4VA 4ZBBA 3IXRA 4XTSA 1GLPA 2JADA 1HNCA 3CRUA 3P8WA 4OO5A 2L6DA 3ZVJD 3HYPA 1JZRA 4KW6A 3KMNA 2H1GA 3Q6OA 2HNLA 4O7HA 1KNGA 4IGJA 2RUEA 5E4WA 3US3A 1I5GA 2H6XA 1XBSA 3GKXA 2O89A 1SKRB 4H86A 4WBRD 3F63A 3GIXA 4OWYA 1QQ2A 2AUVA 2ON7A 4DSRA 3C71A 3FK8A 4I97A 2JACA 3EU3A 3ZZXA 2JZTA 4OMVA 2YZHA 2GT6A 5KN2A 1A23A 2A2RA 5IPHA 3C73A 3R2QA 2AYTA 2GZYA 3QDNA 5C00A 4AJ8A 2DJ3A 2PU9C 2F9SA 2DIYA 1HD2A 5AN1A 5JCWA 3GNJA 4ZL8A 1V2AA 2X8CA 2B1LA 2GZZA 4MABA 2V2GA 3ME7A 5H5RA 3UJ1A 4N11A 5DALA 2WFCA 1B9XC 5F05A 1T4ZA 3F9UA 4TKYA 1U3AA 3GH6A 1QFNA 4PUAA 2DJJA 1W89A 1X5DA 1YZXA 3GTUB 3VI5A 3QCPA 4CDOA 5L71A 1YY7A 5HR2A 2J9HA 2DC5A 1OC9B 4IP6A 5G1LA 4TRXA 1AC1A 4NV2A 3E3EA 3RHBA 2HRNA 4PGTA 1YJ6A 6GSXA 3ZTLA 3FZAA 1NHOA 2H1BA 2R6KA 1K0MA 3TRQA 3ME8A 1XW9A 3EWLA 3GKNA 4L5OA 1AIUA 2JZSA 3UL3A 5ECRB 1UA5A 5J4UA 1E2YA 1GTIA 4BVXA 2E2MA 4MJBA 4XRAA 1GL8A 3KP9A 4G2EA 1M2AA 4E8HA 4K2DA 4F0BA 1AQXA 1BEDA 3GV1A 1M2BA 1PX6A 3QMXA 2HYXA 3IHQA 3DKSA 5D96A 1B4QA 2G0FA 3GURA 2H1AA 1ERWA 5CAXA 4KDYA 2YP6A 2ZUPA 1TDIA 5ECMB 3LEFA 2CZ2A 2LV3A 1TK5B 5ECLB 4RQRA 1VRSD 2C4JA 4YH2A 4NPBA 2B7JA 3KD0A 20GSA 3L0HA 2B1KA 1FHEA 3KJYA 4JU5A 4ZB6A 4GSTA 4DVCA 3KP8A 4ZL9A 2CQ9A 2NVLA 1GWCA 3FR9A 3IR4A 4N0VA 4TR1A 4PX1A 3LFLA 1V57A 1A2LA 4OD7A 5ECNB 4PXOA 1QMVA 4FYBA 4G10A 5HFGA 4ACSA 1VF4A 3HVSA 3PGTA 2IFQA 1A8YA 5IMCA 4GRFA 1SYRA 5KN3A 3BCKA 1PQNA 2NBSA 3ZFLA 4JZQA 3DXBA 2O8VB 3Q74A 2YV9A 1TKDB 2L57A 1O85A 2YWOA 4NAXA 3HVVA 1K3OA 2GSRA 1T8EB 3TJFA 1XWGA 1O7UA 4MH3A 2YWNA 4PQHA 2VIMA 16GSA 2MMNA 1U3IA 1Z7RA 2P31A 1FVKA 3V1WA 3ZLPA 3A3TA 1JZOA 1U87A 4ID0A 3CTGA 2RUFA 3H93A 3DVWA 1ZYQB 3ZITA 3FEUA
chains in the Genus database with same CATH superfamily
4IP1A 3E9JB 4E88A 4LMVA 2O7KA 2K8VA 5CNWA 2FD3A 1Z4KA 1TJDA 4G19A 4L5LA 1QXHA 4FYUA 4ZL7A 2FUG2 2H70A 4G0KA 1M3JA 5EY6A 5F07A 2GLRA 1IYIA 1EGOA 5B7CA 3JCML 3UAPA 1VF2A 1SL1B 2ZNMA 1T4YA 2MBTA 1LBKA 3ERWA 4MJAA 2VD0A 2LNTA 5A5KA 5FWGA 1ZL9A 2BTOT 1AAZA 2B3SA 5DCHA 4ICYA 3HA9A 2WB9A 1CQHA 4IQJM 3EE2A 2VCZA 1UVZA 4IN0A 4J56E 3CI0K 2WCIA 4FQUA 5AGYA 2LKUA 2F8AA 3QAGA 3UVHA 2GZPA 3FY7A 2GQKA 4P3YB 2C0DA 4J2FA 4Z7XA 3VLNA 2CVKA 5J5NA 2VL3A 4YIHA 2C0EA 5HR1A 1KEBA 3ZIJA 5CRGA 1PSQA 4Q5FA 4L0UA 5CRDA 5G2ZA 1V98A 3EMXA 1GUMA 4MWOA 1OE7A 3BJ5A 2WDUA 3G7YA 2QSIA 2IMFA 1G0TA 2PTSA 4KSOA 3LORA 4WR4A 2PUKC 4BWQA 2LEGA 1OVNA 5A4UA 4RQXA 1BX9A 1Q91A 1BAYA 4IQ1A 1EV9A 2GSTA 1PD21 2EC4A 5J9BA 4BWSA 4TR3A 1DOFA 4GWRA 2CVBA 4NV5A 3MDKA 4XS4A 2QA2A 5CP1A 2X4AA 3LYPA 4HZ2A 3C8EA 1FAAA 2NTOA 1GUHA 2CAQA 3GL5A 3J7Yb 1GP1A 3CRTA 3LSZA 4NFLA 3FR3A 1A2JA 1S3RA 1K7WA 5IO2A 2PN8A 3BBYA 5ID2B 5EVOA 5DQYA 2B5XA 2EIOA 2IPAA 1FB0A 2RCNA 5FT3A 4RI6A 2P5QA 5CREA 1GSUA 4EXJA 3F3RA 3K8NA 4POBA 5D9VA 4YQMA 4KSMA 4YIKA 3RRPA 4K5SA 2MBSA 4L8EA 3TKQA 4MA9A 4DSSB 3D4TA 2LTKA 1OYJA 2C0GA 3FHKA 1QGVA 2V41A 3UBKA 1KQ7A 1Z6NA 4X0XA 1J9BA 3H4KA 2JZRA 5F0GA 5GAPD 1DE1A 1F37A 2VLUA 4MMMA 1VDKA 1NM3A 2HSYA 1QUWA 2HSMA 1GTBA 3FR6A 6GSSA 4WF5A 4QQ7A 1VGLA 4GXZA 4TR0A 4MZCA 3ISOA 4JE1A 1U88A 1SYXA 2VO4A 2MZCA 2IJYA 5ENUA 4ECBA 2P5RA 4BPYA 3IDVA 5J9CA 3GN3A 5CO3A 3VWUA 3E0UA 3ZIVA 2XBQA 4IJIA 5IO0A 2PTQA 1EEJA 2IIYA 1OKDA 3EPTA 4O92A 1YEPA 4EDYA 3FKFA 4APAA 1A24A 2YWMA 2FA8A 4MX2A 5IM9A 2MMOA 1TI3A 1S3DA 4CHSA 1SJ6A 1TJ7A 2TRCP 1SKSB 3FZ5A 2A4VA 1EP8A 2H72A 2GS3A 2B6MA 1SJZA 4O5RA 1EOGA 3SWLA 2UZ8A 4NSLA 2FY6A 19GSA 3LXTA 1AQWA 1WPIA 1TJVA 3NZNA 4Z2RA 3DWVA 3TJJA 4GCIA 2OE3A 5JWOB 4NHWA 4I2UA 1HY0A 1XWCA 2TIRA 2YPMA 3UOMA 1TI1A 2DKHA 4V2LA 5EL8A 3TRXA 4CW9A 4EKZA 1RW1A 3DEXA 3IK7A 4D73B 1WP0A 4HEA2 3HJOA 3R6VA 1HQOA 4WETA 4HU7A 5IPGA 3I9V2 4KX4A 2OADA 1SJIA 2JAOA 2WS2A 4IKHA 3GYKA 4IVFA 1DUGA 2R0CA 1J08A 1XWKA 3TRPA 4WXTA 3HVNA 2H8LA 2PERA 2CAIA 2KLXA 1K0NA 1URMA 3KGKA 1V9WA 2I9HA 4JR4A 3TJGA 2H0HA 1FO5A 4KCEA 3M3MA 4OCEA 2RLIA 4HI7A 4MF7A 4TW5A 4XRDA 1UC7A 3KTBA 1XPVA 2FWFA 5CRWA 2C8UA 4HJMA 4EUYA 5ECIB 2E7PA 3IOSA 2X75A 2X8HA 1M9AA 2N5FA 4A5PA 4L6AA 2XPDA 4EDZA 5DJMA 4KUNA 1TK8B 3TB2A 4ECCA 3IAS2 3WT2A 5F91A 4LL4B 5DAKB 4G9HA 2JAUA 1Y6EA 3F8UA 1TU7A 4BVXB 2E0QA 1XW5A 3WT1A 1DBYA 1M99A 2AHEA 1GSEA 4TOPA 1ILOA 4KDXA 1ON4A 5ECPB 1ERTA 2EIRA 5IMFA 1K0DA 1GUKA 3FMWA 3IK9A 3F0IA 3PINA 1M2DA 1OC9A 2QGVA 3RBTA 1XW6A 5CYYA 2VL2C 2YZUA 2DLXA 2HRFA 1FOHA 1N2AA 2HZEB 3SBCA 1T1VA 4ISDA 1AUWA 3CQFA 1XWBA 1B4PA 5KEJA 3KZQA 1G6YA 5G5EA 4FO5A 3ZFBA 4MPFA 3UIWA 3UMAA 3W8SA 2O85A 5GZZB 1BJXA 3HD5A 3KH7A 1R5AA 3HJMA 5H5QA 5IMVA 3IRAA 3WD6A 1HYUA 3CSJA 1FURA 2DJKA 3VWVA 2CX3A 2ALBA 4YQUA 2C80A 1X9MB 3Q19A 2HZFA 1G7EA 3MSZA 4POLA 2PVOC 1F3BA 13GSA 2MYGA 2YWIA 4O5UA 2FHEA 1A0RP 1SENA 6GSVA 1AXDA 5H5SA 1XIYA 1Z7PA 4V2NA 2HE3A 2CT6A 2V1MA 3M8NA 3LXZA 5ECOB 2OACA 4IW9A 2VCWA 1Z3EA 2FNOA 3TCOA 1AUCA 3O76A 3D6IA 2ZCTA 4F2IA 3LYKA 2ON5A 1YKCA 2XPEA 5ECSA 5IIZA 3EVIA 5INYA 3IBHA 1H4OA 2H01A 1TW9A 5D9TA 2HRAA 5GSTA 3ZL5A 1XVWA 3GSTA 4GTUA 4F82A 1YF1A 3TKSC 1ZZYA 3PH9A 4GLTA 1GNEA 2OE0A 1SD9A 1J3UA 3QOUA 4YQVA 1OE8A 2AAWA 4ZB8A 1R7HA 4KNDA 4ZILA 4GSSA 4GF0A 2LJAA 1JZDA 1MD4A 1WWJA 1MDKA 3L9UA 1Z5YE 1YFEA 5HR3A 4MF5A 4GQFA 4ADLA 2YCDA 9GSSA 2L5LA 3KIJA 5HQPA 3HVXA 2OA7A 3QAVA 2K9FA 2YV5A 2O87A 2VCVA 3LJRA 3HCZA 2V6KA 1F3AA 2KP2A 1GULA 1WRYA 2G2QA 1X9WB 3EURA 3TKSE 2GTUA 4MPGA 3LW9A 1XVQA 4XHMA 3BWVA 1GRXA 3VURA 5C04A 3H1NA 2GGTA 1M7TA 5ELAA 2PBJA 2WGRA 1OKTA 3LQ7A 4MLYA 1PN0A 1Z4IA 4ML1A 3HZ8A 4PUFC 4FIWA 4K5RA 2GDRA 3DMLA 2LRNA 1DE2A 22GSA 3GHAA 2HLSA 5BRTA 1FW1A 4Q5RA 2CX4A 2NDOA 5ECHB 2M46A 2GT5A 2KHPA 4HGVA 2R4VA 4OCFA 1X5EA 5G5FA 4ZBDA 2JAWA 3KCMA 3ERGA 3LWAA 5D9WA 1BQ7A 3L4NA 4TXOA 4K2XA 1WMJA 1XG8A 1A8LA 4G0IA 4HQSA 2DMLA 2P0GA 3AY8A 5D6BA 3BD2A 4O5QA 5F06A 5DJLA 2R5GA 4MZWA 3TJKA 4BL7B 2H73A 5D93A 2IN3A 4XS4B 3UEMA 5DCGA 2LQQA 4JRRA 4NXIA 3KH9A 5D9XA 2AV4A 5ELGA 2VUPA 2FWGA 1QK8A 1FUPA 5KOWA 2YOIA 3C7MA 3H79A 3VI7A 3VPQA 1U15A 2RM6A 1RE5A 4MF6A 3TGZA 3R3EA 2B5EA 2LQOA 4N10A 1TRSA 3HY2A 5KN1A 2DIZA 3TUEA 5IOXA 2QKEA 4KH7A 2A2SA 2FA4A 2OBIA 1O8XA 4QL7A 3QD9A 1R4WA 3RDWA 5F92A 2NPBA 2LRCA 3BCIA 5B8AA 3ERFA 4NMUA 5KOXA 3FRCA 3C8TA 1RQMA 4OFTA 1FUOA 4KF9A 2RM5A 3APOA 1PMTA 5HW2A 3GUSA 3L78A 3G7JA 3TV2A 1EP7A 2I81A 2K8SA 4MK3A 1JFUA 4PQIA 5ID2A 3EC3A 3APSA 1GTAA 2XBIA 2BJXA 2R37A 3FZ9A 3CBUA 3N5OA 1FVJA 2K18A 3KMOA 4HU9A 1TU8A 11GSA 4QL9A 4BA7A 5F8BA 3MAKA 2WRTA 4KE3A 1WJKA 4NHZA 1KBNA 2QC7A 6GSYA 5IMAA 1K0CA 4WR5A 4DSSA 5E59A 4BVYB 4KCAA 5IOWA 2DMMA 4ECIA 4MUMA 3TDGA 1O81A 4LMWA 2KP1A 4EC0A 3VWXA 1UN2A 3D0ZA 2OJLA 2XHFA 3IV4A 2PTRA 2FWEA 3MWHA 3WGXA 4L6CA 1Q98A 1G6WA 2VL9A 1Y25A 2JSZA 1F2EA 3H8QA 3A5WA 4GSNA 1HY1A 3D4MA 1Z9HA 3U13A 2E9FA 5GAND 4IBPA 4AJ7A 2JL4A 3EU4A 3QPMA 5IMDA 1THXA 1V58A 1V40A 3PR8A 4ULXA 1YEXA 3A2XA 2CZ3A 1I9DA 1E6BA 4OO4A 4EVMA 3TKPA 4JBBA 1GSSA 2A2PA 1DCNA 4HUAA 4XIHA 2PPTA 1THOA 4EF0A 1K3YA 1I0AA 4HDEA 2DKIA 2L6CA 2VCQA 2M72A 3P7XA 4OFNA 1USBA 4NWYA 4XCSA 3L9SA 2H0GA 5CRHA 5EPFA 3NO9A 4AGSA 1WIKA 3QAWA 4ZBAA 1TK0B 2PGTA 1Z6MA 3CSIA 3TOUA 2H19A 2VAFA 4V2MA 1ZYEA 2H75A 1ZGNA 1EEMA 1OAZA 4YAVA 3CTFA 2REMA 3E04A 3HDCA 4ZXGA 1K0BA 1O6JA 3ZRDA 2JU5A 3ZVJA 2DSAA 3DD3A 3RAZA 2GQLA 3OCFA 3L9VA 5JCUA 4EO3A 1U6TA 1H75A 2KUCA 1O8WA 2LUSA 2H30A 5DALB 2YJHA 2H71A 2V6OA 1SK0A 1LU4A 1TJWA 2VL2A 3UBLA 3TJBA 3EINA 1XOBA 1Q5NA 1PX7A 2F8FA 4L0WA 2DBCA 3MNGA 4D73A 1BYEA 3M0FA 4K7OA 5G30A 3HXSA 5ECKB 3GKMA 4IELA 1SL0B 2D27A 3GZHA 4PNGA 3A5IA 1TOFA 2L5OA 1ZCPA 1K0AA 1XWAA 2EIQA 1F6MC 4WKWA 2X8GA 3G9BA 1ACVA 2LSTA 3WGDA 14GSA 2PVQA 4MJCA 2PWJA 3KEBA 2LNSA 2YV7A 3ZREA 1HNBA 1ABAA 1PA3A 2AB6A 3GH9A 2X49A 4DEJA 1TJUA 3RHCA 4F9ZA 3F4RA 4PURA 2FCHA 4TXVA 2DJ0A 5A4WA 4ZIJA 5HFIA 2R3XA 1WE0A 3GTUA 1GSYA 1Z4LA 5GSSA 4DSQA 1FUQA 6GSWA 5IQYA 1PGTA 4K0NA 4ECJA 1K3LA 10GSA 2FGXA 3W8JA 2D2ZA 1G7OA 4IJ3A 4YAPA 4MZBA 1T9HA 2HT9A 1C72A 5DAKA 2L4QA 3U19A 1T00A 1ML6A 4YKGA 3FW2A 3TKSA 1PN9A 4PNFA 2CVDA 1NSWA 5D73A 4HZ4A 3UVTA 1VF3A 2FUSA 4TR1B 5HFKA 4K6XA 2C1YA 2TRXA 4ILFA 2H74A 3GFKA 5FHIA 2HZEA 2I3YA 1EOHA 4GQCA 3DYRA 1U16A 2IFQB 4EIQA 1M0UA 4O32A 3UARA 4ZB9A 5JWRB 4HSCX 2FLSA 1X0RA 3I69A 3CYNA 5B6NA 3J7Yk 1PKZA 1ST9A 3IC4A 1VF1A 3TKRA 1Z4PX 1GSDA 5JCGA 2HSHA 2YN1A 1K0OA 1JZWA 4K9ZA 5B8BA 1ERUA 5G1KA 1JLVA 1JLWA 8GSSA 4I5QA 1Q4JA 4XS6A 4Q5QA 7GSSA 4N0ZA 1ZOFA 3MYDA 3IA1A 4LLRA 1AW9A 2HRKA 1O73A 3GA4A 2YJ7A 1S3CA 1KTEA 1XCCA 4MJEA 4EE0A 4APBA 1NW2A 4HQZA 2HVGA 4FH8A 1JHBA 1MD3A 4WEYA 3IAM2 2HI7A 2L59A 3LGCA 5AISA 3U5RE 2GSQA 1A2MA 3PPUA 1B9YC 4J57E 5DQSA 3VK9A 2LS5A 2M80A 3C1RA 1CQGA 2C3NA 2DJ2A 2WZ9A 2B5YA 4I2TA 3KTLA 4POKA 4KA0A 3BOAA 1MTCA 1FOVA 1MDJA 2N5AA 1XZOA 3RPPA 1PL2A 2OKAA 3ZMLA 2CV4A 6GSUA 5LNKe 1TP9A 4EL1A 1OC3A 3QFBC 1T3BA 2H0IA 1HNAA 2GQMA 2H6ZA 5HR0A 3OR5A 3D5JA 4LL1B 2IMIA 1T7PB 4K7IA 2WULA 4E8EA 4KGIA 4G0LA 4F03A 1TRUA 3F4TA 1Q92A 5DDLA 1M9BA 3DIEA 1SU9A 3IPZA 5DVBA 5ABRA 3ED3A 1AQVA 4OFMA 2VCTA 2DJ1A 2I7DA 4MP4A 4LA1A 3M9JA 3O6TA 1S3AA 1FB6A 1J0FA 4K1FA 1OC8A 3DRNA 2H1DA 3HKRA 1N8JA 4WBJA 3TOTA 3QBPA 1YDKA 5KN0A 2B7KA 3M9KA 4TN8A 5AIVA 2MMZA 4K8MA 3DVXA 3CXGA 5ECQB 4JEDA 2I1UA 1NHYA 3GTDA 4V1Ag 3NOFA 3P2AA 4TXOB 2K6VA 3RPNA 2VLTA 2GSSA 2FWHA 2IWTA 4X4JA 5LCZA 2D28C 1JSWA 1XFLA 4N30A 3ZYWA 4EEIA 3GRXA 4XS1A 1XXUA 2IMEA 3I6AA 2C3TA 2CA8A 2VM2A 3Q18A 4KAEA 4X43A 1X5CA 2VD1A 3GL3A 1ZMAA 1SK2A 3VWWA 3F6FA 2BMXA 4AF2A 1W4VA 2LJRA 2R2JA 5COHA 4MCUA 3M1GA 1PKWA 1RK4A 4K0GA 1GNWA 2L4CA 4CY8A 3G7IA 2HXKA 2F3MA 3P90A 1EV4A 2IMKA 2YANA 3GX8A 12GSA 2VCXA 2V32A 3CMIA 1DSBA 2GVPA 4RI7A 2AJQB 2IMDA 1TRVA 4BL7A 3ZMKA 1SK1A 3WGEA 2JARA 1XOAA 1PRXA 1SD8A 2LRTA 2OBKA 3A2WA 1TTZA 1SL2B 2H6YA 2PMTA 1ZYPA 1SKWB 4K7NA 3D21A 2YNXA 4FYCA 1BG5A 1MDIA 1GH2A 3CSHA 4HJ2A 2VOCA 5IMZA 1F9MA 4MH2A 4Z2TA 4IS0A 3GSSA 3HZ4A 3W6GA 1WOUA 4NLEA 1R26A 3C1SA 1C3CA 1TRWA 4F0CA 3F4SA 1B8XA 2XC2A 2F51A 2J23A 3KM6A 2C3QA 3S9FA 4I8BA 2IL3A 5J3RA 3FZ4A 3F3QA 17GSA 2H76A 2VM1A 4KDUA 5B6MA 5AIXA 3QR6A 1LJRA 1A0FA 2MMAA 2RIIA 4V1Ap 1IYHA 3A2VA 4JR6A 5DBQA 2WJUA 4IHUA 2C0FA 3I43A 3F6DA 4POMA 1GLQA 3IC8A 1YF0A 4KB3A 4EFCA 1EZKA 4CY6A 1PL1A 2I4AA 1YKAA 1EWXA 1R5PA 4HOJA 2X99A 3NIVA 5LD0A 5J41A 2ES7A 1YFMA 2Z9SA 4MDCA 3FYGA 3GKKA 3O3TA 3QFAC 6GSTA 3EYTA 2H66A 3D22A 3GX0A 4IQAA 2OE1A 3IE3A 2HFDA 4RUVA 3U6VA 1MEKA 2PFMA 1FG4A 2A4HA 4ML6A 1ERVA 3GMFA 1TXXA 4TVEA 4X1UA 5D8IA 4PTSA 3LG6A 4Q5NA 18GSA 4BVYA 1GSFA 3VPTA 2E2GA 3KXOA 3APQA 4TR4A 2JSYA 4I6XA 2VLVA 3HHVA 1YQ1A 2LJKA 2KOKA 1B48A 3DGQA 2QGAB 3EMPA 2N5BA 4PQ1A 4AJ6A 3WYWA 3VFIA 5G31A 1GTUA 1X9SB 3N9JA 2R0PA 4HS1A 4WF4A 1EGRA 1GSQA 3HJPA 4ADMA 5JWQB 2X64A 5A4VA 4ZBBA 3IXRA 4XTSA 2QA1A 1GLPA 2JADA 1HNCA 1ZYNA 3CRUA 3P8WA 4OO5A 2L6DA 3ZVJD 3HYPA 1JZRA 4KW6A 3KMNA 2H1GA 3Q6OA 2HNLA 3MIXA 3RD8A 4O7HA 1KNGA 4IGJA 2RUEA 5E4WA 3US3A 1I5GA 2H6XA 1XBSA 3GKXA 2O89A 1SKRB 4H86A 4WBRD 3F63A 3GIXA 4OWYA 1QQ2A 2AUVA 2ON7A 4DSRA 3C71A 3FK8A 4I97A 2JACA 3EU3A 3ZZXA 2JZTA 4OMVA 1MH9A 2YZHA 2GT6A 5KN2A 1A23A 2A2RA 5IPHA 3C73A 1IW7D 4YKFA 3R2QA 2AYTA 2GZYA 3QDNA 5C00A 4AJ8A 2DJ3A 2PU9C 1Z4JA 2F9SA 1XWOA 2DIYA 1HD2A 5AN1A 3BHGA 5JCWA 3GNJA 4ZL8A 1V2AA 2X8CA 2B1LA 2GZZA 4MABA 1Z4MA 2V2GA 3ME7A 5H5RA 3UJ1A 4N11A 5DALA 2WFCA 1B9XC 5F05A 1T4ZA 3F9UA 4TKYA 1Z4QA 1U3AA 3GH6A 1QFNA 4PUAA 2DJJA 1W89A 1X5DA 1YZXA 3GTUB 3VI5A 3QCPA 4MNNA 4CDOA 5L71A 1PFOA 1YY7A 5HR2A 2J9HA 2DC5A 1OC9B 4IP6A 5G1LA 4TRXA 1AC1A 4NV2A 3E3EA 3RHBA 2HRNA 4PGTA 1YJ6A 6GSXA 3ZTLA 3FZAA 4USSA 1NHOA 2H1BA 2R6KA 1K0MA 3TRQA 3ME8A 1XW9A 3EWLA 3GKNA 4L5OA 1AIUA 2JZSA 3UL3A 5ECRB 1UA5A 5J4UA 1E2YA 1GTIA 4BVXA 2E2MA 4EIPA 4MJBA 4XRAA 1GL8A 3KP9A 4G2EA 1M2AA 4E8HA 4K2DA 4F0BA 1AQXA 1BEDA 3GV1A 1M2BA 1PX6A 3QMXA 1K62A 2HYXA 3DKSA 3IHQA 5D96A 1B4QA 2G0FA 3GURA 2H1AA 1ERWA 5CAXA 4KDYA 2YP6A 2ZUPA 1TDIA 5ECMB 3LEFA 2CZ2A 2LV3A 1TK5B 5ECLB 4RQRA 1VRSD 2C4JA 4YH2A 4NPBA 2B7JA 3KD0A 20GSA 3L0HA 4BIKA 2B1KA 3OCEA 1FHEA 3KJYA 4JU5A 4ZB6A 4GSTA 1M3IA 4DVCA 3KP8A 4ZL9A 3R6QA 2CQ9A 2NVLA 1GWCA 3FR9A 3IR4A 4N0VA 4TR1A 4PX1A 3LFLA 1V57A 1A2LA 4OD7A 5ECNB 4PXOA 1QMVA 2R0GA 4FYBA 5BMUA 4G10A 5HFGA 4ACSA 1VF4A 3HVSA 3PGTA 2IFQA 1A8YA 5IMCA 4GRFA 1SYRA 5KN3A 3BCKA 1PQNA 2NBSA 3ZFLA 4JZQA 3DXBA 2O8VB 3Q74A 1U0LA 2YV9A 1TKDB 2L57A 1O85A 2YWOA 4Z2UA 4NAXA 3HVVA 1K3OA 2GSRA 1T8EB 3TJFA 1XWGA 1O7UA 4L57A 4MH3A 2YWNA 4PQHA 2VIMA 16GSA 2MMNA 1U3IA 1Z7RA 2P31A 1FVKA 3V1WA 3ZLPA 3A3TA 3IHGA 1JZOA 1C3UA 1U87A 4ID0A 3CTGA 2RUFA 3H93A 3DVWA 1ZYQB 3ZITA 3FEUA
chains in the Genus database with same CATH topology
4IP1A 3E9JB 4LMVA 2O7KA 2K8VA 5CNWA 2FD3A 1TJDA 4G19A 4L5LA 1QXHA 4FYUA 4ZL7A 2FUG2 2H70A 4G0KA 5EY6A 5F07A 2GLRA 1IYIA 1EGOA 5B7CA 3JCML 3UAPA 1VF2A 1SL1B 2ZNMA 1T4YA 2MBTA 1LBKA 3ERWA 4MJAA 2VD0A 2LNTA 5A5KA 5FWGA 1ZL9A 2BTOT 1AAZA 2B3SA 5DCHA 4ICYA 3HA9A 2WB9A 1CQHA 4IQJM 3EE2A 2VCZA 1UVZA 4IN0A 4J56E 2WCIA 4FQUA 5AGYA 2LKUA 2F8AA 3QAGA 3UVHA 2GZPA 3FY7A 2GQKA 4P3YB 2C0DA 4J2FA 4Z7XA 3VLNA 2CVKA 5J5NA 2VL3A 2C0EA 5HR1A 1KEBA 3ZIJA 5CRGA 1PSQA 4Q5FA 4L0UA 5CRDA 5G2ZA 1V98A 3EMXA 1GUMA 1OE7A 3BJ5A 2WDUA 3G7YA 2QSIA 2IMFA 1G0TA 4KSOA 3LORA 4WR4A 2PUKC 4BWQA 2LEGA 1OVNA 5A4UA 4RQXA 1BX9A 1BAYA 4IQ1A 1EV9A 2GSTA 1PD21 2EC4A 5J9BA 4BWSA 4TR3A 4GWRA 2CVBA 4NV5A 3MDKA 4XS4A 2QA2A 5CP1A 2X4AA 3LYPA 4HZ2A 3C8EA 1FAAA 2NTOA 1GUHA 2CAQA 3GL5A 3J7Yb 1GP1A 3CRTA 3LSZA 3FR3A 1A2JA 5IO2A 2PN8A 3BBYA 5ID2B 5EVOA 5DQYA 2B5XA 2EIOA 2IPAA 1FB0A 5FT3A 4RI6A 2P5QA 5CREA 1GSUA 4EXJA 3F3RA 3K8NA 4POBA 5D9VA 4YQMA 4KSMA 4K5SA 2MBSA 4L8EA 3TKQA 4MA9A 4DSSB 3D4TA 2LTKA 1OYJA 2C0GA 3FHKA 1QGVA 2V41A 3UBKA 1Z6NA 4X0XA 1J9BA 3H4KA 2JZRA 5F0GA 5GAPD 1DE1A 1F37A 2VLUA 4MMMA 1NM3A 2HSYA 1QUWA 2HSMA 1GTBA 3FR6A 6GSSA 4WF5A 4QQ7A 1VGLA 4GXZA 4TR0A 4MZCA 3ISOA 4JE1A 1U88A 1SYXA 2VO4A 2MZCA 2IJYA 5ENUA 4ECBA 2P5RA 4BPYA 3IDVA 5J9CA 3GN3A 5CO3A 3VWUA 3E0UA 3ZIVA 2XBQA 4IJIA 5IO0A 1EEJA 2IIYA 1OKDA 3EPTA 4O92A 1YEPA 4EDYA 3FKFA 1A24A 2YWMA 2FA8A 5IM9A 2MMOA 1TI3A 1S3DA 4CHSA 1SJ6A 2TRCP 1SKSB 3FZ5A 2A4VA 1EP8A 2H72A 2GS3A 2B6MA 1SJZA 4O5RA 1EOGA 3SWLA 2UZ8A 2FY6A 19GSA 3LXTA 1AQWA 1WPIA 3NZNA 4Z2RA 3DWVA 3TJJA 4GCIA 2OE3A 5JWOB 4NHWA 4I2UA 1XWCA 2TIRA 2YPMA 3UOMA 1TI1A 2DKHA 4V2LA 5EL8A 3TRXA 4CW9A 4EKZA 1RW1A 3DEXA 3IK7A 4D73B 1WP0A 4HEA2 3HJOA 1HQOA 4WETA 4HU7A 5IPGA 3I9V2 4KX4A 2OADA 1SJIA 2WS2A 4IKHA 3GYKA 4IVFA 1DUGA 2R0CA 1J08A 1XWKA 3TRPA 4WXTA 2H8LA 2PERA 2CAIA 2KLXA 1K0NA 1URMA 3KGKA 1V9WA 2I9HA 4JR4A 3TJGA 2H0HA 1FO5A 4KCEA 3M3MA 4OCEA 2RLIA 4HI7A 4MF7A 4TW5A 4XRDA 1UC7A 3KTBA 1XPVA 2FWFA 5CRWA 2C8UA 4HJMA 4EUYA 5ECIB 2E7PA 3IOSA 2X8HA 1M9AA 2N5FA 4A5PA 2XPDA 4EDZA 5DJMA 4KUNA 1TK8B 3TB2A 4ECCA 3IAS2 3WT2A 4LL4B 5DAKB 4G9HA 1Y6EA 3F8UA 1TU7A 4BVXB 2E0QA 1XW5A 3WT1A 1DBYA 1M99A 2AHEA 1GSEA 4TOPA 1ILOA 4KDXA 1ON4A 5ECPB 1ERTA 2EIRA 5IMFA 1K0DA 1GUKA 3FMWA 3IK9A 3F0IA 3PINA 1M2DA 1OC9A 2QGVA 3RBTA 1XW6A 5CYYA 2VL2C 2YZUA 2DLXA 2HRFA 1FOHA 1N2AA 2HZEB 3SBCA 1T1VA 4ISDA 1XWBA 1B4PA 5KEJA 3KZQA 1G6YA 5G5EA 4FO5A 3ZFBA 4MPFA 3UIWA 3UMAA 3W8SA 2O85A 5GZZB 1BJXA 3HD5A 3KH7A 1R5AA 3HJMA 5H5QA 5IMVA 3IRAA 3WD6A 1HYUA 3CSJA 2DJKA 3VWVA 2CX3A 2ALBA 4YQUA 2C80A 1X9MB 3Q19A 2HZFA 1G7EA 3MSZA 4POLA 2PVOC 1F3BA 13GSA 2MYGA 2YWIA 4O5UA 2FHEA 1A0RP 1SENA 6GSVA 1AXDA 5H5SA 1XIYA 1Z7PA 4V2NA 2HE3A 2CT6A 2V1MA 3M8NA 3LXZA 5ECOB 2OACA 4IW9A 2VCWA 1Z3EA 2FNOA 3TCOA 1AUCA 3O76A 3D6IA 2ZCTA 4F2IA 3LYKA 2ON5A 1YKCA 2XPEA 5ECSA 5IIZA 3EVIA 5INYA 3IBHA 1H4OA 2H01A 1TW9A 5D9TA 2HRAA 5GSTA 3ZL5A 1XVWA 3GSTA 4GTUA 4F82A 1YF1A 3TKSC 1ZZYA 3PH9A 4GLTA 1GNEA 2OE0A 1SD9A 3QOUA 4YQVA 1OE8A 2AAWA 4ZB8A 1R7HA 4KNDA 4ZILA 4GSSA 4GF0A 2LJAA 1JZDA 1MD4A 1WWJA 1MDKA 3L9UA 1Z5YE 5HR3A 4MF5A 4GQFA 2YCDA 9GSSA 2L5LA 3KIJA 5HQPA 3HVXA 2OA7A 3QAVA 2K9FA 2O87A 2VCVA 3LJRA 3HCZA 2V6KA 1F3AA 2KP2A 1GULA 1WRYA 2G2QA 1X9WB 3EURA 3TKSE 2GTUA 4MPGA 3LW9A 1XVQA 4XHMA 1GRXA 3VURA 5C04A 3H1NA 2GGTA 1M7TA 5ELAA 2PBJA 2WGRA 1OKTA 3LQ7A 4MLYA 1PN0A 4ML1A 3HZ8A 4PUFC 4FIWA 4K5RA 2GDRA 3DMLA 2LRNA 1DE2A 22GSA 3GHAA 2HLSA 5BRTA 1FW1A 4Q5RA 2CX4A 2NDOA 5ECHB 2M46A 2GT5A 2KHPA 2R4VA 4OCFA 1X5EA 5G5FA 4ZBDA 3KCMA 3ERGA 3LWAA 5D9WA 1BQ7A 3L4NA 4TXOA 4K2XA 1WMJA 1A8LA 4G0IA 4HQSA 2DMLA 2P0GA 3AY8A 3BD2A 4O5QA 5F06A 5DJLA 2R5GA 4MZWA 3TJKA 4BL7B 2H73A 5D93A 2IN3A 4XS4B 3UEMA 5DCGA 2LQQA 4JRRA 4NXIA 3KH9A 5D9XA 2AV4A 5ELGA 2VUPA 2FWGA 1QK8A 5KOWA 2YOIA 3C7MA 3H79A 3VI7A 3VPQA 2RM6A 4MF6A 3TGZA 3R3EA 2B5EA 2LQOA 4N10A 1TRSA 3HY2A 5KN1A 2DIZA 3TUEA 5IOXA 2QKEA 4KH7A 2A2SA 2FA4A 2OBIA 1O8XA 4QL7A 3QD9A 1R4WA 3RDWA 2NPBA 2LRCA 3BCIA 5B8AA 3ERFA 4NMUA 5KOXA 3FRCA 1RQMA 4OFTA 4KF9A 2RM5A 3APOA 1PMTA 3GUSA 3L78A 3G7JA 1EP7A 2I81A 2K8SA 4MK3A 1JFUA 4PQIA 5ID2A 3EC3A 3APSA 1GTAA 2XBIA 2BJXA 2R37A 3FZ9A 3CBUA 3N5OA 1FVJA 2K18A 3KMOA 4HU9A 1TU8A 11GSA 4QL9A 4BA7A 5F8BA 3MAKA 2WRTA 4KE3A 1WJKA 4NHZA 1KBNA 2QC7A 6GSYA 5IMAA 1K0CA 4WR5A 4DSSA 5E59A 4BVYB 4KCAA 5IOWA 2DMMA 4ECIA 3TDGA 1O81A 4LMWA 2KP1A 4EC0A 3VWXA 1UN2A 3D0ZA 2OJLA 2XHFA 3IV4A 2FWEA 3MWHA 3WGXA 1Q98A 1G6WA 2VL9A 1Y25A 2JSZA 1F2EA 3H8QA 3A5WA 4GSNA 3D4MA 1Z9HA 5GAND 4IBPA 4AJ7A 2JL4A 3EU4A 3QPMA 5IMDA 1THXA 1V58A 1V40A 3PR8A 4ULXA 1YEXA 3A2XA 2CZ3A 1I9DA 1E6BA 4OO4A 4EVMA 3TKPA 4JBBA 1GSSA 2A2PA 4HUAA 4XIHA 2PPTA 1THOA 4EF0A 1K3YA 4HDEA 2DKIA 2L6CA 2VCQA 2M72A 3P7XA 4OFNA 1USBA 4NWYA 4XCSA 3L9SA 2H0GA 5CRHA 5EPFA 4AGSA 1WIKA 3QAWA 4ZBAA 1TK0B 2PGTA 1Z6MA 3CSIA 3TOUA 2H19A 2VAFA 4V2MA 1ZYEA 2H75A 1ZGNA 1EEMA 1OAZA 4YAVA 3CTFA 2REMA 3HDCA 4ZXGA 1K0BA 1O6JA 3ZRDA 2JU5A 3ZVJA 2DSAA 3DD3A 3RAZA 2GQLA 3L9VA 5JCUA 4EO3A 1U6TA 1H75A 2KUCA 1O8WA 2LUSA 2H30A 5DALB 2YJHA 2H71A 2V6OA 1SK0A 1LU4A 2VL2A 3UBLA 3TJBA 3EINA 1XOBA 1PX7A 2F8FA 4L0WA 2DBCA 3MNGA 4D73A 1BYEA 3M0FA 4K7OA 5G30A 3HXSA 5ECKB 3GKMA 4IELA 1SL0B 2D27A 4PNGA 3A5IA 1TOFA 2L5OA 1ZCPA 1K0AA 1XWAA 2EIQA 1F6MC 4WKWA 2X8GA 3G9BA 1ACVA 2LSTA 3WGDA 14GSA 2PVQA 4MJCA 2PWJA 3KEBA 2LNSA 2YV7A 3ZREA 1HNBA 1ABAA 1PA3A 2AB6A 3GH9A 2X49A 4DEJA 3RHCA 4F9ZA 3F4RA 4PURA 2FCHA 4TXVA 2DJ0A 5A4WA 4ZIJA 5HFIA 2R3XA 1WE0A 3GTUA 1GSYA 5GSSA 4DSQA 6GSWA 5IQYA 1PGTA 4K0NA 4ECJA 1K3LA 10GSA 2FGXA 3W8JA 2D2ZA 1G7OA 4IJ3A 4YAPA 4MZBA 2HT9A 1C72A 5DAKA 2L4QA 1T00A 1ML6A 4YKGA 3FW2A 3TKSA 1PN9A 4PNFA 2CVDA 1NSWA 5D73A 4HZ4A 3UVTA 1VF3A 4TR1B 5HFKA 4K6XA 2C1YA 2TRXA 4ILFA 2H74A 3GFKA 5FHIA 2HZEA 2I3YA 1EOHA 4GQCA 3DYRA 2IFQB 4EIQA 1M0UA 4O32A 3UARA 4ZB9A 5JWRB 2FLSA 1X0RA 3I69A 3CYNA 5B6NA 3J7Yk 1PKZA 1ST9A 3IC4A 1VF1A 3TKRA 1GSDA 5JCGA 2HSHA 2YN1A 1K0OA 1JZWA 4K9ZA 5B8BA 1ERUA 5G1KA 1JLVA 1JLWA 8GSSA 4I5QA 1Q4JA 4XS6A 4Q5QA 7GSSA 4N0ZA 1ZOFA 3MYDA 3IA1A 4LLRA 1AW9A 2HRKA 1O73A 3GA4A 2YJ7A 1S3CA 1KTEA 1XCCA 4MJEA 4EE0A 1NW2A 4HQZA 4FH8A 1JHBA 1MD3A 4WEYA 3IAM2 2HI7A 2L59A 3LGCA 5AISA 3U5RE 2GSQA 1A2MA 3PPUA 1B9YC 4J57E 5DQSA 3VK9A 2LS5A 2M80A 3C1RA 1CQGA 2C3NA 2DJ2A 2WZ9A 2B5YA 4I2TA 3KTLA 4POKA 4KA0A 3BOAA 1MTCA 1FOVA 1MDJA 2N5AA 1XZOA 3RPPA 1PL2A 2OKAA 3ZMLA 2CV4A 6GSUA 5LNKe 1TP9A 4EL1A 1OC3A 3QFBC 1T3BA 2H0IA 1HNAA 2GQMA 2H6ZA 5HR0A 3OR5A 3D5JA 4LL1B 2IMIA 1T7PB 4K7IA 2WULA 4E8EA 4KGIA 4G0LA 4F03A 1TRUA 3F4TA 5DDLA 1M9BA 3DIEA 1SU9A 3IPZA 5DVBA 5ABRA 3ED3A 1AQVA 4OFMA 2VCTA 2DJ1A 4MP4A 4LA1A 3M9JA 3O6TA 1S3AA 1FB6A 1J0FA 4K1FA 1OC8A 3DRNA 2H1DA 3HKRA 1N8JA 4WBJA 3TOTA 1YDKA 5KN0A 2B7KA 3M9KA 4TN8A 5AIVA 2MMZA 4K8MA 3DVXA 3CXGA 5ECQB 4JEDA 2I1UA 1NHYA 4V1Ag 3NOFA 3P2AA 4TXOB 2K6VA 3RPNA 2VLTA 2GSSA 2FWHA 2IWTA 4X4JA 5LCZA 2D28C 1XFLA 4N30A 3ZYWA 3GRXA 4XS1A 1XXUA 2IMEA 3I6AA 2C3TA 2CA8A 2VM2A 3Q18A 4KAEA 4X43A 1X5CA 2VD1A 3GL3A 1ZMAA 1SK2A 3VWWA 3F6FA 2BMXA 4AF2A 1W4VA 2LJRA 2R2JA 5COHA 4MCUA 3M1GA 1PKWA 1RK4A 4K0GA 1GNWA 2L4CA 4CY8A 3G7IA 2HXKA 2F3MA 3P90A 1EV4A 2IMKA 2YANA 3GX8A 12GSA 2VCXA 2V32A 3CMIA 1DSBA 2GVPA 4RI7A 2AJQB 2IMDA 1TRVA 4BL7A 3ZMKA 1SK1A 3WGEA 1XOAA 1PRXA 1SD8A 2LRTA 2OBKA 3A2WA 1TTZA 1SL2B 2H6YA 2PMTA 1ZYPA 1SKWB 4K7NA 3D21A 2YNXA 4FYCA 1BG5A 1MDIA 1GH2A 3CSHA 4HJ2A 2VOCA 5IMZA 1F9MA 4MH2A 4Z2TA 4IS0A 3GSSA 3HZ4A 3W6GA 1WOUA 1R26A 3C1SA 1TRWA 4F0CA 3F4SA 1B8XA 2XC2A 2F51A 2J23A 3KM6A 2C3QA 3S9FA 4I8BA 2IL3A 5J3RA 3FZ4A 3F3QA 17GSA 2H76A 2VM1A 4KDUA 5B6MA 5AIXA 3QR6A 1LJRA 1A0FA 2MMAA 2RIIA 4V1Ap 1IYHA 3A2VA 4JR6A 5DBQA 2WJUA 4IHUA 2C0FA 3I43A 3F6DA 4POMA 1GLQA 3IC8A 1YF0A 4KB3A 1EZKA 4CY6A 1PL1A 2I4AA 1YKAA 1EWXA 1R5PA 4HOJA 2X99A 3NIVA 5LD0A 5J41A 2ES7A 2Z9SA 4MDCA 3FYGA 3GKKA 3O3TA 3QFAC 6GSTA 3EYTA 2H66A 3D22A 3GX0A 4IQAA 2OE1A 3IE3A 2HFDA 4RUVA 3U6VA 1MEKA 1FG4A 4ML6A 2A4HA 1ERVA 3GMFA 1TXXA 4TVEA 4X1UA 5D8IA 4PTSA 3LG6A 4Q5NA 18GSA 4BVYA 1GSFA 3VPTA 2E2GA 3KXOA 3APQA 4TR4A 2JSYA 4I6XA 2VLVA 3HHVA 1YQ1A 2LJKA 2KOKA 1B48A 3DGQA 3EMPA 4PQ1A 2N5BA 4AJ6A 3WYWA 3VFIA 5G31A 1GTUA 1X9SB 3N9JA 2R0PA 4HS1A 4WF4A 1EGRA 1GSQA 3HJPA 5JWQB 2X64A 5A4VA 4ZBBA 3IXRA 4XTSA 2QA1A 1GLPA 2JADA 1HNCA 1ZYNA 3CRUA 3P8WA 4OO5A 2L6DA 3ZVJD 3HYPA 1JZRA 4KW6A 3KMNA 2H1GA 3Q6OA 2HNLA 3MIXA 4O7HA 1KNGA 4IGJA 2RUEA 5E4WA 3US3A 1I5GA 2H6XA 1XBSA 3GKXA 2O89A 1SKRB 4H86A 4WBRD 3F63A 3GIXA 4OWYA 1QQ2A 2AUVA 2ON7A 4DSRA 3C71A 3FK8A 4I97A 2JACA 3EU3A 3ZZXA 2JZTA 4OMVA 2YZHA 2GT6A 5KN2A 1A23A 2A2RA 5IPHA 3C73A 1IW7D 4YKFA 3R2QA 2AYTA 2GZYA 3QDNA 5C00A 4AJ8A 2DJ3A 2PU9C 2F9SA 2DIYA 1HD2A 5AN1A 5JCWA 3GNJA 4ZL8A 1V2AA 2X8CA 2B1LA 2GZZA 4MABA 2V2GA 3ME7A 5H5RA 3UJ1A 4N11A 5DALA 2WFCA 1B9XC 5F05A 1T4ZA 3F9UA 4TKYA 1U3AA 3GH6A 1QFNA 4PUAA 2DJJA 1W89A 1X5DA 1YZXA 3GTUB 3VI5A 3QCPA 4MNNA 4CDOA 5L71A 1YY7A 5HR2A 2J9HA 2DC5A 1OC9B 4IP6A 5G1LA 4TRXA 1AC1A 4NV2A 3E3EA 3RHBA 2HRNA 4PGTA 1YJ6A 6GSXA 3ZTLA 3FZAA 4USSA 1NHOA 2H1BA 2R6KA 1K0MA 3TRQA 3ME8A 1XW9A 3EWLA 3GKNA 4L5OA 1AIUA 2JZSA 3UL3A 5ECRB 1UA5A 5J4UA 1E2YA 1GTIA 4BVXA 2E2MA 4EIPA 4MJBA 4XRAA 1GL8A 3KP9A 4G2EA 1M2AA 4E8HA 4K2DA 4F0BA 1AQXA 1BEDA 3GV1A 1M2BA 1PX6A 3QMXA 2HYXA 3IHQA 3DKSA 5D96A 1B4QA 2G0FA 3GURA 2H1AA 1ERWA 5CAXA 4KDYA 2YP6A 2ZUPA 1TDIA 5ECMB 3LEFA 2CZ2A 2LV3A 1TK5B 5ECLB 4RQRA 1VRSD 2C4JA 4YH2A 4NPBA 2B7JA 3KD0A 20GSA 3L0HA 2B1KA 1FHEA 3KJYA 4JU5A 4ZB6A 4GSTA 4DVCA 3KP8A 4ZL9A 2CQ9A 2NVLA 1GWCA 3FR9A 3IR4A 4N0VA 4TR1A 4PX1A 3LFLA 1V57A 1A2LA 4OD7A 5ECNB 4PXOA 1QMVA 2R0GA 4FYBA 5BMUA 4G10A 5HFGA 4ACSA 1VF4A 3HVSA 3PGTA 2IFQA 1A8YA 5IMCA 4GRFA 1SYRA 5KN3A 3BCKA 1PQNA 2NBSA 3ZFLA 4JZQA 3DXBA 2O8VB 3Q74A 2YV9A 1TKDB 2L57A 1O85A 2YWOA 4Z2UA 4NAXA 3HVVA 1K3OA 2GSRA 1T8EB 3TJFA 1XWGA 1O7UA 4MH3A 2YWNA 4PQHA 2VIMA 16GSA 2MMNA 1U3IA 1Z7RA 2P31A 1FVKA 3V1WA 3ZLPA 3A3TA 3IHGA 1JZOA 1U87A 4ID0A 3CTGA 2RUFA 3H93A 3DVWA 1ZYQB 3ZITA 3FEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IP1 A;  3E9J B;  4LMV A;  2O7K A;  2K8V A;  5CNW A;  2FD3 A;  1TJD A;  4G19 A;  4L5L A;  1QXH A;  4FYU A;  4ZL7 A;  2FUG 2;  2H70 A;  5EY6 A;  5F07 A;  2GLR A;  1IYI A;  1EGO A;  5B7C A;  3JCM L;  3UAP A;  1VF2 A;  1SL1 B;  2ZNM A;  1T4Y A;  2MBT A;  1LBK A;  3ERW A;  4MJA A;  2VD0 A;  2LNT A;  5A5K A;  5FWG A;  1ZL9 A;  2BTO T;  1AAZ A;  2B3S A;  5DCH A;  3HA9 A;  2WB9 A;  1CQH A;  3EE2 A;  2VCZ A;  1UVZ A;  4IN0 A;  4J56 E;  2WCI A;  5AGY A;  2LKU A;  2F8A A;  3QAG A;  3UVH A;  2GZP A;  3FY7 A;  2GQK A;  4P3Y B;  2C0D A;  4J2F A;  4Z7X A;  3VLN A;  2CVK A;  5J5N A;  2VL3 A;  2C0E A;  5HR1 A;  1KEB A;  3ZIJ A;  5CRG A;  1PSQ A;  4Q5F A;  4L0U A;  5CRD A;  5G2Z A;  1V98 A;  3EMX A;  1GUM A;  1OE7 A;  3BJ5 A;  2WDU A;  3G7Y A;  2QSI A;  2IMF A;  1G0T A;  4KSO A;  3LOR A;  4WR4 A;  2PUK C;  4BWQ A;  2LEG A;  1OVN A;  5A4U A;  4RQX A;  1BX9 A;  1BAY A;  4IQ1 A;  1EV9 A;  2GST A;  1PD2 1;  2EC4 A;  5J9B A;  4BWS A;  4TR3 A;  4GWR A;  2CVB A;  4NV5 A;  3MDK A;  4XS4 A;  5CP1 A;  3LYP A;  4HZ2 A;  3C8E A;  1FAA A;  2NTO A;  1GUH A;  2CAQ A;  3GL5 A;  3J7Y b;  1GP1 A;  3CRT A;  3LSZ A;  3FR3 A;  1A2J A;  5IO2 A;  2PN8 A;  3BBY A;  5ID2 B;  5EVO A;  5DQY A;  2B5X A;  2EIO A;  2IPA A;  1FB0 A;  5FT3 A;  4RI6 A;  2P5Q A;  5CRE A;  1GSU A;  4EXJ A;  3F3R A;  3K8N A;  4POB A;  5D9V A;  4YQM A;  4KSM A;  2MBS A;  4L8E A;  3TKQ A;  4MA9 A;  4DSS B;  3D4T A;  2LTK A;  1OYJ A;  2C0G A;  3FHK A;  1QGV A;  2V41 A;  3UBK A;  1Z6N A;  4X0X A;  1J9B A;  3H4K A;  2JZR A;  5F0G A;  5GAP D;  1DE1 A;  1F37 A;  2VLU A;  4MMM A;  1NM3 A;  2HSY A;  1QUW A;  1GTB A;  3FR6 A;  6GSS A;  4WF5 A;  4QQ7 A;  1VGL A;  4GXZ A;  4TR0 A;  4MZC A;  3ISO A;  4JE1 A;  1U88 A;  1SYX A;  2VO4 A;  2MZC A;  2IJY A;  5ENU A;  4ECB A;  2P5R A;  4BPY A;  3IDV A;  5J9C A;  3GN3 A;  5CO3 A;  3VWU A;  3E0U A;  3ZIV A;  2XBQ A;  4IJI A;  5IO0 A;  1EEJ A;  2IIY A;  1OKD A;  4O92 A;  1YEP A;  4EDY A;  3FKF A;  1A24 A;  2YWM A;  2FA8 A;  5IM9 A;  2MMO A;  1TI3 A;  1S3D A;  4CHS A;  1SJ6 A;  2TRC P;  1SKS B;  3FZ5 A;  2A4V A;  1EP8 A;  2H72 A;  2GS3 A;  2B6M A;  1SJZ A;  4O5R A;  1EOG A;  3SWL A;  2FY6 A;  19GS A;  3LXT A;  1AQW A;  1WPI A;  3NZN A;  3DWV A;  3TJJ A;  4GCI A;  2OE3 A;  5JWO B;  4NHW A;  4I2U A;  1XWC A;  2TIR A;  2YPM A;  3UOM A;  1TI1 A;  4V2L A;  5EL8 A;  3TRX A;  4CW9 A;  4EKZ A;  1RW1 A;  3DEX A;  3IK7 A;  4D73 B;  1WP0 A;  4HEA 2;  3HJO A;  1HQO A;  4WET A;  4HU7 A;  5IPG A;  3I9V 2;  4KX4 A;  2OAD A;  1SJI A;  2WS2 A;  4IKH A;  3GYK A;  4IVF A;  1DUG A;  1J08 A;  1XWK A;  3TRP A;  4WXT A;  2H8L A;  2PER A;  2CAI A;  2KLX A;  1K0N A;  1URM A;  3KGK A;  1V9W A;  2I9H A;  4JR4 A;  3TJG A;  2H0H A;  1FO5 A;  4KCE A;  3M3M A;  4OCE A;  2RLI A;  4HI7 A;  4MF7 A;  4TW5 A;  4XRD A;  1UC7 A;  3KTB A;  1XPV A;  2FWF A;  5CRW A;  2C8U A;  4HJM A;  4EUY A;  5ECI B;  2E7P A;  3IOS A;  2X8H A;  1M9A A;  2N5F A;  2XPD A;  4EDZ A;  5DJM A;  4KUN A;  1TK8 B;  3TB2 A;  4ECC A;  3IAS 2;  3WT2 A;  4LL4 B;  5DAK B;  4G9H A;  1Y6E A;  3F8U A;  1TU7 A;  2E0Q A;  1XW5 A;  3WT1 A;  1DBY A;  1M99 A;  2AHE A;  1GSE A;  4TOP A;  1ILO A;  4KDX A;  1ON4 A;  5ECP B;  1ERT A;  2EIR A;  5IMF A;  1K0D A;  1GUK A;  3IK9 A;  3F0I A;  3PIN A;  1M2D A;  1OC9 A;  2QGV A;  3RBT A;  1XW6 A;  5CYY A;  2VL2 C;  2YZU A;  2DLX A;  2HRF A;  1N2A A;  2HZE B;  3SBC A;  1T1V A;  4ISD A;  1XWB A;  1B4P A;  5KEJ A;  3KZQ A;  1G6Y A;  5G5E A;  4FO5 A;  3ZFB A;  4MPF A;  3UIW A;  3UMA A;  3W8S A;  2O85 A;  5GZZ B;  1BJX A;  3HD5 A;  3KH7 A;  1R5A A;  3HJM A;  5H5Q A;  5IMV A;  3IRA A;  3WD6 A;  1HYU A;  3CSJ A;  2DJK A;  3VWV A;  2CX3 A;  2ALB A;  4YQU A;  2C80 A;  1X9M B;  3Q19 A;  2HZF A;  1G7E A;  3MSZ A;  4POL A;  2PVO C;  1F3B A;  13GS A;  2MYG A;  2YWI A;  2FHE A;  1A0R P;  1SEN A;  6GSV A;  1AXD A;  5H5S A;  1XIY A;  1Z7P A;  4V2N A;  2HE3 A;  2CT6 A;  2V1M A;  3M8N A;  3LXZ A;  5ECO B;  2OAC A;  4IW9 A;  2VCW A;  1Z3E A;  2FNO A;  3TCO A;  1AUC A;  3O76 A;  3D6I A;  2ZCT A;  4F2I A;  3LYK A;  2ON5 A;  1YKC A;  2XPE A;  5ECS A;  5IIZ A;  3EVI A;  5INY A;  3IBH A;  1H4O A;  2H01 A;  1TW9 A;  5D9T A;  5GST A;  3ZL5 A;  1XVW A;  3GST A;  4GTU A;  4F82 A;  1YF1 A;  3TKS C;  1ZZY A;  3PH9 A;  4GLT A;  1GNE A;  2OE0 A;  1SD9 A;  3QOU A;  4YQV A;  1OE8 A;  2AAW A;  4ZB8 A;  1R7H A;  4KND A;  4ZIL A;  4GSS A;  4GF0 A;  2LJA A;  1JZD A;  1MD4 A;  1WWJ A;  1MDK A;  3L9U A;  1Z5Y E;  5HR3 A;  4MF5 A;  4GQF A;  2YCD A;  9GSS A;  2L5L A;  3KIJ A;  5HQP A;  3HVX A;  2OA7 A;  3QAV A;  2K9F A;  2O87 A;  2VCV A;  3LJR A;  3HCZ A;  2V6K A;  1F3A A;  2KP2 A;  1GUL A;  1WRY A;  2G2Q A;  1X9W B;  3EUR A;  3TKS E;  2GTU A;  4MPG A;  1XVQ A;  4XHM A;  1GRX A;  3VUR A;  5C04 A;  3H1N A;  2GGT A;  1M7T A;  5ELA A;  2PBJ A;  2WGR A;  1OKT A;  3LQ7 A;  4MLY A;  4ML1 A;  3HZ8 A;  4PUF C;  4FIW A;  2GDR A;  3DML A;  2LRN A;  1DE2 A;  22GS A;  3GHA A;  2HLS A;  1FW1 A;  4Q5R A;  2CX4 A;  2NDO A;  5ECH B;  2M46 A;  2GT5 A;  2KHP A;  2R4V A;  4OCF A;  1X5E A;  5G5F A;  4ZBD A;  3KCM A;  3ERG A;  3LWA A;  5D9W A;  1BQ7 A;  3L4N A;  4TXO A;  1WMJ A;  1A8L A;  4HQS A;  2DML A;  2P0G A;  3AY8 A;  3BD2 A;  5F06 A;  5DJL A;  2R5G A;  4MZW A;  3TJK A;  2H73 A;  5D93 A;  2IN3 A;  4XS4 B;  3UEM A;  5DCG A;  2LQQ A;  4JRR A;  4NXI A;  3KH9 A;  5D9X A;  2AV4 A;  5ELG A;  2VUP A;  2FWG A;  1QK8 A;  2YOI A;  3C7M A;  3H79 A;  3VI7 A;  3VPQ A;  2RM6 A;  4MF6 A;  3TGZ A;  2B5E A;  2LQO A;  4N10 A;  1TRS A;  3HY2 A;  5KN1 A;  2DIZ A;  3TUE A;  5IOX A;  2QKE A;  4KH7 A;  2A2S A;  2FA4 A;  2OBI A;  1O8X A;  4QL7 A;  3QD9 A;  1R4W A;  3RDW A;  2NPB A;  2LRC A;  3BCI A;  5B8A A;  3ERF A;  4NMU A;  3FRC A;  1RQM A;  4OFT A;  2RM5 A;  3APO A;  1PMT A;  3GUS A;  3L78 A;  3G7J A;  1EP7 A;  2I81 A;  2K8S A;  4MK3 A;  1JFU A;  4PQI A;  5ID2 A;  3EC3 A;  3APS A;  1GTA A;  2XBI A;  2BJX A;  2R37 A;  3FZ9 A;  3CBU A;  3N5O A;  1FVJ A;  2K18 A;  3KMO A;  4HU9 A;  1TU8 A;  11GS A;  4QL9 A;  4BA7 A;  5F8B A;  3MAK A;  2WRT A;  4KE3 A;  1WJK A;  4NHZ A;  1KBN A;  2QC7 A;  6GSY A;  5IMA A;  1K0C A;  4WR5 A;  4DSS A;  5E59 A;  4KCA A;  5IOW A;  2DMM A;  4ECI A;  3TDG A;  1O81 A;  4LMW A;  2KP1 A;  4EC0 A;  3VWX A;  1UN2 A;  3D0Z A;  2OJL A;  2XHF A;  3IV4 A;  2FWE A;  3MWH A;  3WGX A;  1Q98 A;  1G6W A;  2VL9 A;  1Y25 A;  2JSZ A;  1F2E A;  3H8Q A;  3A5W A;  4GSN A;  3D4M A;  1Z9H A;  5GAN D;  4IBP A;  4AJ7 A;  2JL4 A;  3EU4 A;  3QPM A;  5IMD A;  1THX A;  1V58 A;  1V40 A;  3PR8 A;  4ULX A;  1YEX A;  3A2X A;  2CZ3 A;  1I9D A;  1E6B A;  4OO4 A;  4EVM A;  3TKP A;  4JBB A;  1GSS A;  4HUA A;  4XIH A;  2PPT A;  1THO A;  4EF0 A;  1K3Y A;  4HDE A;  2L6C A;  2VCQ A;  2M72 A;  3P7X A;  4OFN A;  1USB A;  4NWY A;  4XCS A;  3L9S A;  2H0G A;  5CRH A;  5EPF A;  4AGS A;  1WIK A;  3QAW A;  4ZBA A;  1TK0 B;  2PGT A;  1Z6M A;  3CSI A;  3TOU A;  2H19 A;  2VAF A;  4V2M A;  1ZYE A;  2H75 A;  1ZGN A;  1EEM A;  1OAZ A;  4YAV A;  3CTF A;  2REM A;  3HDC A;  4ZXG A;  1K0B A;  1O6J A;  3ZRD A;  2JU5 A;  3ZVJ A;  2DSA A;  3DD3 A;  3RAZ A;  2GQL A;  3L9V A;  5JCU A;  4EO3 A;  1U6T A;  1H75 A;  2KUC A;  1O8W A;  2LUS A;  2H30 A;  5DAL B;  2YJH A;  2H71 A;  2V6O A;  1SK0 A;  1LU4 A;  2VL2 A;  3UBL A;  3TJB A;  3EIN A;  1XOB A;  1PX7 A;  2F8F A;  4L0W A;  2DBC A;  3MNG A;  4D73 A;  1BYE A;  3M0F A;  4K7O A;  5G30 A;  3HXS A;  5ECK B;  3GKM A;  4IEL A;  1SL0 B;  4PNG A;  1TOF A;  2L5O A;  1ZCP A;  1K0A A;  1XWA A;  2EIQ A;  1F6M C;  4WKW A;  2X8G A;  3G9B A;  1ACV A;  2LST A;  3WGD A;  14GS A;  2PVQ A;  4MJC A;  2PWJ A;  3KEB A;  2LNS A;  2YV7 A;  3ZRE A;  1HNB A;  1ABA A;  1PA3 A;  2AB6 A;  3GH9 A;  4DEJ A;  3RHC A;  4F9Z A;  3F4R A;  4PUR A;  2FCH A;  4TXV A;  2DJ0 A;  5A4W A;  4ZIJ A;  5HFI A;  2R3X A;  1WE0 A;  3GTU A;  1GSY A;  5GSS A;  4DSQ A;  6GSW A;  5IQY A;  1PGT A;  4K0N A;  4ECJ A;  1K3L A;  10GS A;  2FGX A;  3W8J A;  2D2Z A;  1G7O A;  4IJ3 A;  4YAP A;  4MZB A;  2HT9 A;  1C72 A;  5DAK A;  2L4Q A;  1T00 A;  1ML6 A;  3FW2 A;  3TKS A;  1PN9 A;  4PNF A;  2CVD A;  1NSW A;  5D73 A;  4HZ4 A;  3UVT A;  1VF3 A;  4TR1 B;  5HFK A;  4K6X A;  2C1Y A;  2TRX A;  4ILF A;  2H74 A;  3GFK A;  5FHI A;  2HZE A;  2I3Y A;  1EOH A;  4GQC A;  3DYR A;  2IFQ B;  1M0U A;  4O32 A;  3UAR A;  4ZB9 A;  5JWR B;  2FLS A;  1X0R A;  3I69 A;  3CYN A;  5B6N A;  3J7Y k;  1PKZ A;  1ST9 A;  3IC4 A;  1VF1 A;  3TKR A;  1GSD A;  5JCG A;  2HSH A;  2YN1 A;  1K0O A;  1JZW A;  4K9Z A;  5B8B A;  1ERU A;  5G1K A;  1JLV A;  1JLW A;  8GSS A;  4I5Q A;  1Q4J A;  4XS6 A;  4Q5Q A;  7GSS A;  4N0Z A;  1ZOF A;  3IA1 A;  1AW9 A;  4LLR A;  1O73 A;  3GA4 A;  2YJ7 A;  1S3C A;  1KTE A;  1XCC A;  4MJE A;  4EE0 A;  1NW2 A;  4HQZ A;  4FH8 A;  1JHB A;  1MD3 A;  4WEY A;  3IAM 2;  2HI7 A;  2L59 A;  3LGC A;  5AIS A;  3U5R E;  2GSQ A;  1A2M A;  4J57 E;  1B9Y C;  5DQS A;  3VK9 A;  2LS5 A;  2M80 A;  3C1R A;  1CQG A;  2C3N A;  2DJ2 A;  2WZ9 A;  2B5Y A;  4I2T A;  3KTL A;  4POK A;  4KA0 A;  3BOA A;  1MTC A;  1FOV A;  1MDJ A;  2N5A A;  1XZO A;  3RPP A;  1PL2 A;  2OKA A;  3ZML A;  2CV4 A;  6GSU A;  5LNK e;  1TP9 A;  4EL1 A;  1OC3 A;  3QFB C;  1T3B A;  2H0I A;  1HNA A;  2GQM A;  2H6Z A;  5HR0 A;  3OR5 A;  3D5J A;  4LL1 B;  2IMI A;  1T7P B;  4K7I A;  2WUL A;  4E8E A;  4KGI A;  4F03 A;  1TRU A;  3F4T A;  5DDL A;  1M9B A;  3DIE A;  1SU9 A;  3IPZ A;  5DVB A;  5ABR A;  3ED3 A;  1AQV A;  4OFM A;  2VCT A;  2DJ1 A;  4MP4 A;  4LA1 A;  3M9J A;  3O6T A;  1S3A A;  1FB6 A;  1J0F A;  4K1F A;  1OC8 A;  3DRN A;  2H1D A;  3HKR A;  1N8J A;  4WBJ A;  3TOT A;  1YDK A;  5KN0 A;  2B7K A;  3M9K A;  4TN8 A;  5AIV A;  2MMZ A;  4K8M A;  3DVX A;  3CXG A;  5ECQ B;  4JED A;  2I1U A;  1NHY A;  4V1A g;  3NOF A;  3P2A A;  4TXO B;  2K6V A;  3RPN A;  2VLT A;  2GSS A;  2FWH A;  2IWT A;  5LCZ A;  1XFL A;  4N30 A;  3ZYW A;  3GRX A;  4XS1 A;  1XXU A;  2IME A;  3I6A A;  2C3T A;  2CA8 A;  2VM2 A;  3Q18 A;  4KAE A;  4X43 A;  1X5C A;  2VD1 A;  3GL3 A;  1ZMA A;  1SK2 A;  3VWW A;  3F6F A;  2BMX A;  4AF2 A;  1W4V A;  2LJR A;  2R2J A;  5COH A;  4MCU A;  3M1G A;  1PKW A;  1RK4 A;  4K0G A;  1GNW A;  2L4C A;  3G7I A;  2HXK A;  2F3M A;  3P90 A;  1EV4 A;  2IMK A;  2YAN A;  3GX8 A;  12GS A;  2VCX A;  2V32 A;  3CMI A;  1DSB A;  2GVP A;  4RI7 A;  2AJQ B;  2IMD A;  1TRV A;  4BL7 A;  3ZMK A;  1SK1 A;  3WGE A;  1XOA A;  1PRX A;  1SD8 A;  2LRT A;  2OBK A;  3A2W A;  1TTZ A;  1SL2 B;  2H6Y A;  2PMT A;  1SKW B;  4K7N A;  3D21 A;  2YNX A;  4FYC A;  1BG5 A;  1MDI A;  1GH2 A;  3CSH A;  4HJ2 A;  2VOC A;  5IMZ A;  1F9M A;  4MH2 A;  4IS0 A;  3GSS A;  3HZ4 A;  3W6G A;  1WOU A;  1R26 A;  3C1S A;  1TRW A;  4F0C A;  3F4S A;  1B8X A;  2XC2 A;  2F51 A;  2J23 A;  3KM6 A;  2C3Q A;  3S9F A;  4I8B A;  2IL3 A;  5J3R A;  3FZ4 A;  3F3Q A;  17GS A;  2H76 A;  2VM1 A;  4KDU A;  5B6M A;  5AIX A;  3QR6 A;  1LJR A;  1A0F A;  2MMA A;  2RII A;  4V1A p;  1IYH A;  3A2V A;  4JR6 A;  5DBQ A;  2WJU A;  4IHU A;  2C0F A;  3I43 A;  3F6D A;  4POM A;  1GLQ A;  1YF0 A;  4KB3 A;  1EZK A;  1PL1 A;  2I4A A;  1YKA A;  1EWX A;  1R5P A;  4HOJ A;  2X99 A;  3NIV A;  5LD0 A;  5J41 A;  2ES7 A;  2Z9S A;  4MDC A;  3FYG A;  3GKK A;  3O3T A;  3QFA C;  6GST A;  3EYT A;  2H66 A;  3D22 A;  3GX0 A;  4IQA A;  2OE1 A;  3IE3 A;  2HFD A;  4RUV A;  3U6V A;  1MEK A;  1FG4 A;  4ML6 A;  1ERV A;  3GMF A;  1TXX A;  4TVE A;  4X1U A;  5D8I A;  3LG6 A;  4Q5N A;  18GS A;  4BVY A;  1GSF A;  3VPT A;  2E2G A;  3KXO A;  3APQ A;  4TR4 A;  2JSY A;  4I6X A;  2VLV A;  3HHV A;  1YQ1 A;  2LJK A;  2KOK A;  1B48 A;  3DGQ A;  3EMP A;  4PQ1 A;  2N5B A;  4AJ6 A;  3WYW A;  3VFI A;  5G31 A;  1GTU A;  1X9S B;  3N9J A;  4HS1 A;  4WF4 A;  1EGR A;  1GSQ A;  3HJP A;  5JWQ B;  2X64 A;  5A4V A;  4ZBB A;  3IXR A;  4XTS A;  1GLP A;  2JAD A;  1HNC A;  3CRU A;  3P8W A;  4OO5 A;  2L6D A;  3ZVJ D;  3HYP A;  1JZR A;  4KW6 A;  3KMN A;  2H1G A;  3Q6O A;  2HNL A;  4O7H A;  1KNG A;  4IGJ A;  2RUE A;  5E4W A;  3US3 A;  1I5G A;  2H6X A;  1XBS A;  3GKX A;  2O89 A;  1SKR B;  4H86 A;  4WBR D;  3F63 A;  3GIX A;  4OWY A;  1QQ2 A;  2AUV A;  2ON7 A;  4DSR A;  3C71 A;  3FK8 A;  4I97 A;  2JAC A;  3EU3 A;  3ZZX A;  2JZT A;  4OMV A;  2YZH A;  2GT6 A;  5KN2 A;  1A23 A;  2A2R A;  5IPH A;  3C73 A;  3R2Q A;  2AYT A;  2GZY A;  3QDN A;  5C00 A;  4AJ8 A;  2DJ3 A;  2PU9 C;  2F9S A;  2DIY A;  1HD2 A;  5AN1 A;  5JCW A;  3GNJ A;  4ZL8 A;  1V2A A;  2X8C A;  2B1L A;  2GZZ A;  4MAB A;  2V2G A;  3ME7 A;  5H5R A;  3UJ1 A;  4N11 A;  5DAL A;  2WFC A;  1B9X C;  5F05 A;  1T4Z A;  3F9U A;  4TKY A;  1U3A A;  3GH6 A;  1QFN A;  4PUA A;  2DJJ A;  1W89 A;  1X5D A;  1YZX A;  3GTU B;  3VI5 A;  3QCP A;  4CDO A;  5L71 A;  1YY7 A;  5HR2 A;  2J9H A;  2DC5 A;  1OC9 B;  4IP6 A;  5G1L A;  4TRX A;  1AC1 A;  4NV2 A;  3E3E A;  3RHB A;  2HRN A;  4PGT A;  1YJ6 A;  6GSX A;  3ZTL A;  3FZA A;  1NHO A;  2H1B A;  2R6K A;  1K0M A;  3TRQ A;  3ME8 A;  1XW9 A;  3EWL A;  3GKN A;  4L5O A;  1AIU A;  2JZS A;  3UL3 A;  5ECR B;  1UA5 A;  5J4U A;  1E2Y A;  1GTI A;  4BVX A;  2E2M A;  4MJB A;  4XRA A;  1GL8 A;  3KP9 A;  4G2E A;  1M2A A;  4E8H A;  4K2D A;  4F0B A;  1AQX A;  1BED A;  3GV1 A;  1M2B A;  1PX6 A;  3QMX A;  2HYX A;  3IHQ A;  3DKS A;  5D96 A;  1B4Q A;  2G0F A;  3GUR A;  2H1A A;  1ERW A;  5CAX A;  4KDY A;  2YP6 A;  2ZUP A;  1TDI A;  5ECM B;  3LEF A;  2CZ2 A;  2LV3 A;  1TK5 B;  5ECL B;  4RQR A;  1VRS D;  2C4J A;  4YH2 A;  4NPB A;  2B7J A;  3KD0 A;  20GS A;  3L0H A;  2B1K A;  1FHE A;  3KJY A;  4JU5 A;  4ZB6 A;  4GST A;  4DVC A;  3KP8 A;  4ZL9 A;  2CQ9 A;  2NVL A;  1GWC A;  3FR9 A;  3IR4 A;  4N0V A;  4TR1 A;  4PX1 A;  3LFL A;  1V57 A;  1A2L A;  4OD7 A;  5ECN B;  4PXO A;  1QMV A;  4FYB A;  4G10 A;  5HFG A;  4ACS A;  1VF4 A;  3HVS A;  3PGT A;  2IFQ A;  1A8Y A;  5IMC A;  4GRF A;  1SYR A;  5KN3 A;  3BCK A;  1PQN A;  2NBS A;  3ZFL A;  4JZQ A;  3DXB A;  2O8V B;  3Q74 A;  2YV9 A;  1TKD B;  2L57 A;  1O85 A;  2YWO A;  4NAX A;  3HVV A;  1K3O A;  2GSR A;  1T8E B;  3TJF A;  1XWG A;  1O7U A;  4MH3 A;  2YWN A;  4PQH A;  2VIM A;  16GS A;  2MMN A;  1U3I A;  1Z7R A;  2P31 A;  1FVK A;  3V1W A;  3ZLP A;  3A3T A;  1JZO A;  1U87 A;  4ID0 A;  3CTG A;  2RUF A;  3H93 A;  3DVW A;  1ZYQ B;  3ZIT A;  3FEU A; 
#chains in the Genus database with same CATH topology
 4IP1 A;  3E9J B;  4E88 A;  4LMV A;  2O7K A;  2K8V A;  5CNW A;  2FD3 A;  1Z4K A;  1TJD A;  4G19 A;  4L5L A;  1QXH A;  4FYU A;  4ZL7 A;  2FUG 2;  2H70 A;  4G0K A;  1M3J A;  5EY6 A;  5F07 A;  2GLR A;  1IYI A;  1EGO A;  5B7C A;  3JCM L;  3UAP A;  1VF2 A;  1SL1 B;  2ZNM A;  1T4Y A;  2MBT A;  1LBK A;  3ERW A;  4MJA A;  2VD0 A;  2LNT A;  5A5K A;  5FWG A;  1ZL9 A;  2BTO T;  1AAZ A;  2B3S A;  5DCH A;  4ICY A;  3HA9 A;  2WB9 A;  1CQH A;  4IQJ M;  3EE2 A;  2VCZ A;  1UVZ A;  4IN0 A;  4J56 E;  3CI0 K;  2WCI A;  4FQU A;  5AGY A;  2LKU A;  2F8A A;  3QAG A;  3UVH A;  2GZP A;  3FY7 A;  2GQK A;  4P3Y B;  2C0D A;  4J2F A;  4Z7X A;  3VLN A;  2CVK A;  5J5N A;  2VL3 A;  4YIH A;  2C0E A;  5HR1 A;  1KEB A;  3ZIJ A;  5CRG A;  1PSQ A;  4Q5F A;  4L0U A;  5CRD A;  5G2Z A;  1V98 A;  3EMX A;  1GUM A;  4MWO A;  1OE7 A;  3BJ5 A;  2WDU A;  3G7Y A;  2QSI A;  2IMF A;  1G0T A;  2PTS A;  4KSO A;  3LOR A;  4WR4 A;  2PUK C;  4BWQ A;  2LEG A;  1OVN A;  5A4U A;  4RQX A;  1BX9 A;  1Q91 A;  1BAY A;  4IQ1 A;  1EV9 A;  2GST A;  1PD2 1;  2EC4 A;  5J9B A;  4BWS A;  4TR3 A;  1DOF A;  4GWR A;  2CVB A;  4NV5 A;  3MDK A;  4XS4 A;  2QA2 A;  5CP1 A;  2X4A A;  3LYP A;  4HZ2 A;  3C8E A;  1FAA A;  2NTO A;  1GUH A;  2CAQ A;  3GL5 A;  3J7Y b;  1GP1 A;  3CRT A;  3LSZ A;  4NFL A;  3FR3 A;  1A2J A;  1S3R A;  1K7W A;  5IO2 A;  2PN8 A;  3BBY A;  5ID2 B;  5EVO A;  5DQY A;  2B5X A;  2EIO A;  2IPA A;  1FB0 A;  2RCN A;  5FT3 A;  4RI6 A;  2P5Q A;  5CRE A;  1GSU A;  4EXJ A;  3F3R A;  3K8N A;  4POB A;  5D9V A;  4YQM A;  4KSM A;  4YIK A;  3RRP A;  4K5S A;  2MBS A;  4L8E A;  3TKQ A;  4MA9 A;  4DSS B;  3D4T A;  2LTK A;  1OYJ A;  2C0G A;  3FHK A;  1QGV A;  2V41 A;  3UBK A;  1KQ7 A;  1Z6N A;  4X0X A;  1J9B A;  3H4K A;  2JZR A;  5F0G A;  5GAP D;  1DE1 A;  1F37 A;  2VLU A;  4MMM A;  1VDK A;  1NM3 A;  2HSY A;  1QUW A;  2HSM A;  1GTB A;  3FR6 A;  6GSS A;  4WF5 A;  4QQ7 A;  1VGL A;  4GXZ A;  4TR0 A;  4MZC A;  3ISO A;  4JE1 A;  1U88 A;  1SYX A;  2VO4 A;  2MZC A;  2IJY A;  5ENU A;  4ECB A;  2P5R A;  4BPY A;  3IDV A;  5J9C A;  3GN3 A;  5CO3 A;  3VWU A;  3E0U A;  3ZIV A;  2XBQ A;  4IJI A;  5IO0 A;  2PTQ A;  1EEJ A;  2IIY A;  1OKD A;  3EPT A;  4O92 A;  1YEP A;  4EDY A;  3FKF A;  4APA A;  1A24 A;  2YWM A;  2FA8 A;  4MX2 A;  5IM9 A;  2MMO A;  1TI3 A;  1S3D A;  4CHS A;  1SJ6 A;  1TJ7 A;  2TRC P;  1SKS B;  3FZ5 A;  2A4V A;  1EP8 A;  2H72 A;  2GS3 A;  2B6M A;  1SJZ A;  4O5R A;  1EOG A;  3SWL A;  2UZ8 A;  4NSL A;  2FY6 A;  19GS A;  3LXT A;  1AQW A;  1WPI A;  1TJV A;  3NZN A;  4Z2R A;  3DWV A;  3TJJ A;  4GCI A;  2OE3 A;  5JWO B;  4NHW A;  4I2U A;  1HY0 A;  1XWC A;  2TIR A;  2YPM A;  3UOM A;  1TI1 A;  2DKH A;  4V2L A;  5EL8 A;  3TRX A;  4CW9 A;  4EKZ A;  1RW1 A;  3DEX A;  3IK7 A;  4D73 B;  1WP0 A;  4HEA 2;  3HJO A;  3R6V A;  1HQO A;  4WET A;  4HU7 A;  5IPG A;  3I9V 2;  4KX4 A;  2OAD A;  1SJI A;  2JAO A;  2WS2 A;  4IKH A;  3GYK A;  4IVF A;  1DUG A;  2R0C A;  1J08 A;  1XWK A;  3TRP A;  4WXT A;  3HVN A;  2H8L A;  2PER A;  2CAI A;  2KLX A;  1K0N A;  1URM A;  3KGK A;  1V9W A;  2I9H A;  4JR4 A;  3TJG A;  2H0H A;  1FO5 A;  4KCE A;  3M3M A;  4OCE A;  2RLI A;  4HI7 A;  4MF7 A;  4TW5 A;  4XRD A;  1UC7 A;  3KTB A;  1XPV A;  2FWF A;  5CRW A;  2C8U A;  4HJM A;  4EUY A;  5ECI B;  2E7P A;  3IOS A;  2X75 A;  2X8H A;  1M9A A;  2N5F A;  4A5P A;  4L6A A;  2XPD A;  4EDZ A;  5DJM A;  4KUN A;  1TK8 B;  3TB2 A;  4ECC A;  3IAS 2;  3WT2 A;  5F91 A;  4LL4 B;  5DAK B;  4G9H A;  2JAU A;  1Y6E A;  3F8U A;  1TU7 A;  4BVX B;  2E0Q A;  1XW5 A;  3WT1 A;  1DBY A;  1M99 A;  2AHE A;  1GSE A;  4TOP A;  1ILO A;  4KDX A;  1ON4 A;  5ECP B;  1ERT A;  2EIR A;  5IMF A;  1K0D A;  1GUK A;  3FMW A;  3IK9 A;  3F0I A;  3PIN A;  1M2D A;  1OC9 A;  2QGV A;  3RBT A;  1XW6 A;  5CYY A;  2VL2 C;  2YZU A;  2DLX A;  2HRF A;  1FOH A;  1N2A A;  2HZE B;  3SBC A;  1T1V A;  4ISD A;  1AUW A;  3CQF A;  1XWB A;  1B4P A;  5KEJ A;  3KZQ A;  1G6Y A;  5G5E A;  4FO5 A;  3ZFB A;  4MPF A;  3UIW A;  3UMA A;  3W8S A;  2O85 A;  5GZZ B;  1BJX A;  3HD5 A;  3KH7 A;  1R5A A;  3HJM A;  5H5Q A;  5IMV A;  3IRA A;  3WD6 A;  1HYU A;  3CSJ A;  1FUR A;  2DJK A;  3VWV A;  2CX3 A;  2ALB A;  4YQU A;  2C80 A;  1X9M B;  3Q19 A;  2HZF A;  1G7E A;  3MSZ A;  4POL A;  2PVO C;  1F3B A;  13GS A;  2MYG A;  2YWI A;  4O5U A;  2FHE A;  1A0R P;  1SEN A;  6GSV A;  1AXD A;  5H5S A;  1XIY A;  1Z7P A;  4V2N A;  2HE3 A;  2CT6 A;  2V1M A;  3M8N A;  3LXZ A;  5ECO B;  2OAC A;  4IW9 A;  2VCW A;  1Z3E A;  2FNO A;  3TCO A;  1AUC A;  3O76 A;  3D6I A;  2ZCT A;  4F2I A;  3LYK A;  2ON5 A;  1YKC A;  2XPE A;  5ECS A;  5IIZ A;  3EVI A;  5INY A;  3IBH A;  1H4O A;  2H01 A;  1TW9 A;  5D9T A;  2HRA A;  5GST A;  3ZL5 A;  1XVW A;  3GST A;  4GTU A;  4F82 A;  1YF1 A;  3TKS C;  1ZZY A;  3PH9 A;  4GLT A;  1GNE A;  2OE0 A;  1SD9 A;  1J3U A;  3QOU A;  4YQV A;  1OE8 A;  2AAW A;  4ZB8 A;  1R7H A;  4KND A;  4ZIL A;  4GSS A;  4GF0 A;  2LJA A;  1JZD A;  1MD4 A;  1WWJ A;  1MDK A;  3L9U A;  1Z5Y E;  1YFE A;  5HR3 A;  4MF5 A;  4GQF A;  4ADL A;  2YCD A;  9GSS A;  2L5L A;  3KIJ A;  5HQP A;  3HVX A;  2OA7 A;  3QAV A;  2K9F A;  2YV5 A;  2O87 A;  2VCV A;  3LJR A;  3HCZ A;  2V6K A;  1F3A A;  2KP2 A;  1GUL A;  1WRY A;  2G2Q A;  1X9W B;  3EUR A;  3TKS E;  2GTU A;  4MPG A;  3LW9 A;  1XVQ A;  4XHM A;  3BWV A;  1GRX A;  3VUR A;  5C04 A;  3H1N A;  2GGT A;  1M7T A;  5ELA A;  2PBJ A;  2WGR A;  1OKT A;  3LQ7 A;  4MLY A;  1PN0 A;  1Z4I A;  4ML1 A;  3HZ8 A;  4PUF C;  4FIW A;  4K5R A;  2GDR A;  3DML A;  2LRN A;  1DE2 A;  22GS A;  3GHA A;  2HLS A;  5BRT A;  1FW1 A;  4Q5R A;  2CX4 A;  2NDO A;  5ECH B;  2M46 A;  2GT5 A;  2KHP A;  4HGV A;  2R4V A;  4OCF A;  1X5E A;  5G5F A;  4ZBD A;  2JAW A;  3KCM A;  3ERG A;  3LWA A;  5D9W A;  1BQ7 A;  3L4N A;  4TXO A;  4K2X A;  1WMJ A;  1XG8 A;  1A8L A;  4G0I A;  4HQS A;  2DML A;  2P0G A;  3AY8 A;  5D6B A;  3BD2 A;  4O5Q A;  5F06 A;  5DJL A;  2R5G A;  4MZW A;  3TJK A;  4BL7 B;  2H73 A;  5D93 A;  2IN3 A;  4XS4 B;  3UEM A;  5DCG A;  2LQQ A;  4JRR A;  4NXI A;  3KH9 A;  5D9X A;  2AV4 A;  5ELG A;  2VUP A;  2FWG A;  1QK8 A;  1FUP A;  5KOW A;  2YOI A;  3C7M A;  3H79 A;  3VI7 A;  3VPQ A;  1U15 A;  2RM6 A;  1RE5 A;  4MF6 A;  3TGZ A;  3R3E A;  2B5E A;  2LQO A;  4N10 A;  1TRS A;  3HY2 A;  5KN1 A;  2DIZ A;  3TUE A;  5IOX A;  2QKE A;  4KH7 A;  2A2S A;  2FA4 A;  2OBI A;  1O8X A;  4QL7 A;  3QD9 A;  1R4W A;  3RDW A;  5F92 A;  2NPB A;  2LRC A;  3BCI A;  5B8A A;  3ERF A;  4NMU A;  5KOX A;  3FRC A;  3C8T A;  1RQM A;  4OFT A;  1FUO A;  4KF9 A;  2RM5 A;  3APO A;  1PMT A;  5HW2 A;  3GUS A;  3L78 A;  3G7J A;  3TV2 A;  1EP7 A;  2I81 A;  2K8S A;  4MK3 A;  1JFU A;  4PQI A;  5ID2 A;  3EC3 A;  3APS A;  1GTA A;  2XBI A;  2BJX A;  2R37 A;  3FZ9 A;  3CBU A;  3N5O A;  1FVJ A;  2K18 A;  3KMO A;  4HU9 A;  1TU8 A;  11GS A;  4QL9 A;  4BA7 A;  5F8B A;  3MAK A;  2WRT A;  4KE3 A;  1WJK A;  4NHZ A;  1KBN A;  2QC7 A;  6GSY A;  5IMA A;  1K0C A;  4WR5 A;  4DSS A;  5E59 A;  4BVY B;  4KCA A;  5IOW A;  2DMM A;  4ECI A;  4MUM A;  3TDG A;  1O81 A;  4LMW A;  2KP1 A;  4EC0 A;  3VWX A;  1UN2 A;  3D0Z A;  2OJL A;  2XHF A;  3IV4 A;  2PTR A;  2FWE A;  3MWH A;  3WGX A;  4L6C A;  1Q98 A;  1G6W A;  2VL9 A;  1Y25 A;  2JSZ A;  1F2E A;  3H8Q A;  3A5W A;  4GSN A;  1HY1 A;  3D4M A;  1Z9H A;  3U13 A;  2E9F A;  5GAN D;  4IBP A;  4AJ7 A;  2JL4 A;  3EU4 A;  3QPM A;  5IMD A;  1THX A;  1V58 A;  1V40 A;  3PR8 A;  4ULX A;  1YEX A;  3A2X A;  2CZ3 A;  1I9D A;  1E6B A;  4OO4 A;  4EVM A;  3TKP A;  4JBB A;  1GSS A;  2A2P A;  1DCN A;  4HUA A;  4XIH A;  2PPT A;  1THO A;  4EF0 A;  1K3Y A;  1I0A A;  4HDE A;  2DKI A;  2L6C A;  2VCQ A;  2M72 A;  3P7X A;  4OFN A;  1USB A;  4NWY A;  4XCS A;  3L9S A;  2H0G A;  5CRH A;  5EPF A;  3NO9 A;  4AGS A;  1WIK A;  3QAW A;  4ZBA A;  1TK0 B;  2PGT A;  1Z6M A;  3CSI A;  3TOU A;  2H19 A;  2VAF A;  4V2M A;  1ZYE A;  2H75 A;  1ZGN A;  1EEM A;  1OAZ A;  4YAV A;  3CTF A;  2REM A;  3E04 A;  3HDC A;  4ZXG A;  1K0B A;  1O6J A;  3ZRD A;  2JU5 A;  3ZVJ A;  2DSA A;  3DD3 A;  3RAZ A;  2GQL A;  3OCF A;  3L9V A;  5JCU A;  4EO3 A;  1U6T A;  1H75 A;  2KUC A;  1O8W A;  2LUS A;  2H30 A;  5DAL B;  2YJH A;  2H71 A;  2V6O A;  1SK0 A;  1LU4 A;  1TJW A;  2VL2 A;  3UBL A;  3TJB A;  3EIN A;  1XOB A;  1Q5N A;  1PX7 A;  2F8F A;  4L0W A;  2DBC A;  3MNG A;  4D73 A;  1BYE A;  3M0F A;  4K7O A;  5G30 A;  3HXS A;  5ECK B;  3GKM A;  4IEL A;  1SL0 B;  2D27 A;  3GZH A;  4PNG A;  3A5I A;  1TOF A;  2L5O A;  1ZCP A;  1K0A A;  1XWA A;  2EIQ A;  1F6M C;  4WKW A;  2X8G A;  3G9B A;  1ACV A;  2LST A;  3WGD A;  14GS A;  2PVQ A;  4MJC A;  2PWJ A;  3KEB A;  2LNS A;  2YV7 A;  3ZRE A;  1HNB A;  1ABA A;  1PA3 A;  2AB6 A;  3GH9 A;  2X49 A;  4DEJ A;  1TJU A;  3RHC A;  4F9Z A;  3F4R A;  4PUR A;  2FCH A;  4TXV A;  2DJ0 A;  5A4W A;  4ZIJ A;  5HFI A;  2R3X A;  1WE0 A;  3GTU A;  1GSY A;  1Z4L A;  5GSS A;  4DSQ A;  1FUQ A;  6GSW A;  5IQY A;  1PGT A;  4K0N A;  4ECJ A;  1K3L A;  10GS A;  2FGX A;  3W8J A;  2D2Z A;  1G7O A;  4IJ3 A;  4YAP A;  4MZB A;  1T9H A;  2HT9 A;  1C72 A;  5DAK A;  2L4Q A;  3U19 A;  1T00 A;  1ML6 A;  4YKG A;  3FW2 A;  3TKS A;  1PN9 A;  4PNF A;  2CVD A;  1NSW A;  5D73 A;  4HZ4 A;  3UVT A;  1VF3 A;  2FUS A;  4TR1 B;  5HFK A;  4K6X A;  2C1Y A;  2TRX A;  4ILF A;  2H74 A;  3GFK A;  5FHI A;  2HZE A;  2I3Y A;  1EOH A;  4GQC A;  3DYR A;  1U16 A;  2IFQ B;  4EIQ A;  1M0U A;  4O32 A;  3UAR A;  4ZB9 A;  5JWR B;  4HSC X;  2FLS A;  1X0R A;  3I69 A;  3CYN A;  5B6N A;  3J7Y k;  1PKZ A;  1ST9 A;  3IC4 A;  1VF1 A;  3TKR A;  1Z4P X;  1GSD A;  5JCG A;  2HSH A;  2YN1 A;  1K0O A;  1JZW A;  4K9Z A;  5B8B A;  1ERU A;  5G1K A;  1JLV A;  1JLW A;  8GSS A;  4I5Q A;  1Q4J A;  4XS6 A;  4Q5Q A;  7GSS A;  4N0Z A;  1ZOF A;  3MYD A;  3IA1 A;  4LLR A;  1AW9 A;  2HRK A;  1O73 A;  3GA4 A;  2YJ7 A;  1S3C A;  1KTE A;  1XCC A;  4MJE A;  4EE0 A;  4APB A;  1NW2 A;  4HQZ A;  2HVG A;  4FH8 A;  1JHB A;  1MD3 A;  4WEY A;  3IAM 2;  2HI7 A;  2L59 A;  3LGC A;  5AIS A;  3U5R E;  2GSQ A;  1A2M A;  3PPU A;  1B9Y C;  4J57 E;  5DQS A;  3VK9 A;  2LS5 A;  2M80 A;  3C1R A;  1CQG A;  2C3N A;  2DJ2 A;  2WZ9 A;  2B5Y A;  4I2T A;  3KTL A;  4POK A;  4KA0 A;  3BOA A;  1MTC A;  1FOV A;  1MDJ A;  2N5A A;  1XZO A;  3RPP A;  1PL2 A;  2OKA A;  3ZML A;  2CV4 A;  6GSU A;  5LNK e;  1TP9 A;  4EL1 A;  1OC3 A;  3QFB C;  1T3B A;  2H0I A;  1HNA A;  2GQM A;  2H6Z A;  5HR0 A;  3OR5 A;  3D5J A;  4LL1 B;  2IMI A;  1T7P B;  4K7I A;  2WUL A;  4E8E A;  4KGI A;  4G0L A;  4F03 A;  1TRU A;  3F4T A;  1Q92 A;  5DDL A;  1M9B A;  3DIE A;  1SU9 A;  3IPZ A;  5DVB A;  5ABR A;  3ED3 A;  1AQV A;  4OFM A;  2VCT A;  2DJ1 A;  2I7D A;  4MP4 A;  4LA1 A;  3M9J A;  3O6T A;  1S3A A;  1FB6 A;  1J0F A;  4K1F A;  1OC8 A;  3DRN A;  2H1D A;  3HKR A;  1N8J A;  4WBJ A;  3TOT A;  3QBP A;  1YDK A;  5KN0 A;  2B7K A;  3M9K A;  4TN8 A;  5AIV A;  2MMZ A;  4K8M A;  3DVX A;  3CXG A;  5ECQ B;  4JED A;  2I1U A;  1NHY A;  3GTD A;  4V1A g;  3NOF A;  3P2A A;  4TXO B;  2K6V A;  3RPN A;  2VLT A;  2GSS A;  2FWH A;  2IWT A;  4X4J A;  5LCZ A;  2D28 C;  1JSW A;  1XFL A;  4N30 A;  3ZYW A;  4EEI A;  3GRX A;  4XS1 A;  1XXU A;  2IME A;  3I6A A;  2C3T A;  2CA8 A;  2VM2 A;  3Q18 A;  4KAE A;  4X43 A;  1X5C A;  2VD1 A;  3GL3 A;  1ZMA A;  1SK2 A;  3VWW A;  3F6F A;  2BMX A;  4AF2 A;  1W4V A;  2LJR A;  2R2J A;  5COH A;  4MCU A;  3M1G A;  1PKW A;  1RK4 A;  4K0G A;  1GNW A;  2L4C A;  4CY8 A;  3G7I A;  2HXK A;  2F3M A;  3P90 A;  1EV4 A;  2IMK A;  2YAN A;  3GX8 A;  12GS A;  2VCX A;  2V32 A;  3CMI A;  1DSB A;  2GVP A;  4RI7 A;  2AJQ B;  2IMD A;  1TRV A;  4BL7 A;  3ZMK A;  1SK1 A;  3WGE A;  2JAR A;  1XOA A;  1PRX A;  1SD8 A;  2LRT A;  2OBK A;  3A2W A;  1TTZ A;  1SL2 B;  2H6Y A;  2PMT A;  1ZYP A;  1SKW B;  4K7N A;  3D21 A;  2YNX A;  4FYC A;  1BG5 A;  1MDI A;  1GH2 A;  3CSH A;  4HJ2 A;  2VOC A;  5IMZ A;  1F9M A;  4MH2 A;  4Z2T A;  4IS0 A;  3GSS A;  3HZ4 A;  3W6G A;  1WOU A;  4NLE A;  1R26 A;  3C1S A;  1C3C A;  1TRW A;  4F0C A;  3F4S A;  1B8X A;  2XC2 A;  2F51 A;  2J23 A;  3KM6 A;  2C3Q A;  3S9F A;  4I8B A;  2IL3 A;  5J3R A;  3FZ4 A;  3F3Q A;  17GS A;  2H76 A;  2VM1 A;  4KDU A;  5B6M A;  5AIX A;  3QR6 A;  1LJR A;  1A0F A;  2MMA A;  2RII A;  4V1A p;  1IYH A;  3A2V A;  4JR6 A;  5DBQ A;  2WJU A;  4IHU A;  2C0F A;  3I43 A;  3F6D A;  4POM A;  1GLQ A;  3IC8 A;  1YF0 A;  4KB3 A;  4EFC A;  1EZK A;  4CY6 A;  1PL1 A;  2I4A A;  1YKA A;  1EWX A;  1R5P A;  4HOJ A;  2X99 A;  3NIV A;  5LD0 A;  5J41 A;  2ES7 A;  1YFM A;  2Z9S A;  4MDC A;  3FYG A;  3GKK A;  3O3T A;  3QFA C;  6GST A;  3EYT A;  2H66 A;  3D22 A;  3GX0 A;  4IQA A;  2OE1 A;  3IE3 A;  2HFD A;  4RUV A;  3U6V A;  1MEK A;  2PFM A;  1FG4 A;  2A4H A;  4ML6 A;  1ERV A;  3GMF A;  1TXX A;  4TVE A;  4X1U A;  5D8I A;  4PTS A;  3LG6 A;  4Q5N A;  18GS A;  4BVY A;  1GSF A;  3VPT A;  2E2G A;  3KXO A;  3APQ A;  4TR4 A;  2JSY A;  4I6X A;  2VLV A;  3HHV A;  1YQ1 A;  2LJK A;  2KOK A;  1B48 A;  3DGQ A;  2QGA B;  3EMP A;  2N5B A;  4PQ1 A;  4AJ6 A;  3WYW A;  3VFI A;  5G31 A;  1GTU A;  1X9S B;  3N9J A;  2R0P A;  4HS1 A;  4WF4 A;  1EGR A;  1GSQ A;  3HJP A;  4ADM A;  5JWQ B;  2X64 A;  5A4V A;  4ZBB A;  3IXR A;  4XTS A;  2QA1 A;  1GLP A;  2JAD A;  1HNC A;  1ZYN A;  3CRU A;  3P8W A;  4OO5 A;  2L6D A;  3ZVJ D;  3HYP A;  1JZR A;  4KW6 A;  3KMN A;  2H1G A;  3Q6O A;  2HNL A;  3MIX A;  3RD8 A;  4O7H A;  1KNG A;  4IGJ A;  2RUE A;  5E4W A;  3US3 A;  1I5G A;  2H6X A;  1XBS A;  3GKX A;  2O89 A;  1SKR B;  4H86 A;  4WBR D;  3F63 A;  3GIX A;  4OWY A;  1QQ2 A;  2AUV A;  2ON7 A;  4DSR A;  3C71 A;  3FK8 A;  4I97 A;  2JAC A;  3EU3 A;  3ZZX A;  2JZT A;  4OMV A;  1MH9 A;  2YZH A;  2GT6 A;  5KN2 A;  1A23 A;  2A2R A;  5IPH A;  3C73 A;  1IW7 D;  4YKF A;  3R2Q A;  2AYT A;  2GZY A;  3QDN A;  5C00 A;  4AJ8 A;  2DJ3 A;  2PU9 C;  1Z4J A;  2F9S A;  1XWO A;  2DIY A;  1HD2 A;  5AN1 A;  3BHG A;  5JCW A;  3GNJ A;  4ZL8 A;  1V2A A;  2X8C A;  2B1L A;  2GZZ A;  4MAB A;  1Z4M A;  2V2G A;  3ME7 A;  5H5R A;  3UJ1 A;  4N11 A;  5DAL A;  2WFC A;  1B9X C;  5F05 A;  1T4Z A;  3F9U A;  4TKY A;  1Z4Q A;  1U3A A;  3GH6 A;  1QFN A;  4PUA A;  2DJJ A;  1W89 A;  1X5D A;  1YZX A;  3GTU B;  3VI5 A;  3QCP A;  4MNN A;  4CDO A;  5L71 A;  1PFO A;  1YY7 A;  5HR2 A;  2J9H A;  2DC5 A;  1OC9 B;  4IP6 A;  5G1L A;  4TRX A;  1AC1 A;  4NV2 A;  3E3E A;  3RHB A;  2HRN A;  4PGT A;  1YJ6 A;  6GSX A;  3ZTL A;  3FZA A;  4USS A;  1NHO A;  2H1B A;  2R6K A;  1K0M A;  3TRQ A;  3ME8 A;  1XW9 A;  3EWL A;  3GKN A;  4L5O A;  1AIU A;  2JZS A;  3UL3 A;  5ECR B;  1UA5 A;  5J4U A;  1E2Y A;  1GTI A;  4BVX A;  2E2M A;  4EIP A;  4MJB A;  4XRA A;  1GL8 A;  3KP9 A;  4G2E A;  1M2A A;  4E8H A;  4K2D A;  4F0B A;  1AQX A;  1BED A;  3GV1 A;  1M2B A;  1PX6 A;  3QMX A;  1K62 A;  2HYX A;  3DKS A;  3IHQ A;  5D96 A;  1B4Q A;  2G0F A;  3GUR A;  2H1A A;  1ERW A;  5CAX A;  4KDY A;  2YP6 A;  2ZUP A;  1TDI A;  5ECM B;  3LEF A;  2CZ2 A;  2LV3 A;  1TK5 B;  5ECL B;  4RQR A;  1VRS D;  2C4J A;  4YH2 A;  4NPB A;  2B7J A;  3KD0 A;  20GS A;  3L0H A;  4BIK A;  2B1K A;  3OCE A;  1FHE A;  3KJY A;  4JU5 A;  4ZB6 A;  4GST A;  1M3I A;  4DVC A;  3KP8 A;  4ZL9 A;  3R6Q A;  2CQ9 A;  2NVL A;  1GWC A;  3FR9 A;  3IR4 A;  4N0V A;  4TR1 A;  4PX1 A;  3LFL A;  1V57 A;  1A2L A;  4OD7 A;  5ECN B;  4PXO A;  1QMV A;  2R0G A;  4FYB A;  5BMU A;  4G10 A;  5HFG A;  4ACS A;  1VF4 A;  3HVS A;  3PGT A;  2IFQ A;  1A8Y A;  5IMC A;  4GRF A;  1SYR A;  5KN3 A;  3BCK A;  1PQN A;  2NBS A;  3ZFL A;  4JZQ A;  3DXB A;  2O8V B;  3Q74 A;  1U0L A;  2YV9 A;  1TKD B;  2L57 A;  1O85 A;  2YWO A;  4Z2U A;  4NAX A;  3HVV A;  1K3O A;  2GSR A;  1T8E B;  3TJF A;  1XWG A;  1O7U A;  4L57 A;  4MH3 A;  2YWN A;  4PQH A;  2VIM A;  16GS A;  2MMN A;  1U3I A;  1Z7R A;  2P31 A;  1FVK A;  3V1W A;  3ZLP A;  3A3T A;  3IHG A;  1JZO A;  1C3U A;  1U87 A;  4ID0 A;  3CTG A;  2RUF A;  3H93 A;  3DVW A;  1ZYQ B;  3ZIT A;  3FEU A; 
#chains in the Genus database with same CATH homology
 4IP1 A;  3E9J B;  4LMV A;  2O7K A;  2K8V A;  5CNW A;  2FD3 A;  1TJD A;  4G19 A;  4L5L A;  1QXH A;  4FYU A;  4ZL7 A;  2FUG 2;  2H70 A;  4G0K A;  5EY6 A;  5F07 A;  2GLR A;  1IYI A;  1EGO A;  5B7C A;  3JCM L;  3UAP A;  1VF2 A;  1SL1 B;  2ZNM A;  1T4Y A;  2MBT A;  1LBK A;  3ERW A;  4MJA A;  2VD0 A;  2LNT A;  5A5K A;  5FWG A;  1ZL9 A;  2BTO T;  1AAZ A;  2B3S A;  5DCH A;  4ICY A;  3HA9 A;  2WB9 A;  1CQH A;  4IQJ M;  3EE2 A;  2VCZ A;  1UVZ A;  4IN0 A;  4J56 E;  2WCI A;  4FQU A;  5AGY A;  2LKU A;  2F8A A;  3QAG A;  3UVH A;  2GZP A;  3FY7 A;  2GQK A;  4P3Y B;  2C0D A;  4J2F A;  4Z7X A;  3VLN A;  2CVK A;  5J5N A;  2VL3 A;  2C0E A;  5HR1 A;  1KEB A;  3ZIJ A;  5CRG A;  1PSQ A;  4Q5F A;  4L0U A;  5CRD A;  5G2Z A;  1V98 A;  3EMX A;  1GUM A;  1OE7 A;  3BJ5 A;  2WDU A;  3G7Y A;  2QSI A;  2IMF A;  1G0T A;  4KSO A;  3LOR A;  4WR4 A;  2PUK C;  4BWQ A;  2LEG A;  1OVN A;  5A4U A;  4RQX A;  1BX9 A;  1BAY A;  4IQ1 A;  1EV9 A;  2GST A;  1PD2 1;  2EC4 A;  5J9B A;  4BWS A;  4TR3 A;  4GWR A;  2CVB A;  4NV5 A;  3MDK A;  4XS4 A;  2QA2 A;  5CP1 A;  2X4A A;  3LYP A;  4HZ2 A;  3C8E A;  1FAA A;  2NTO A;  1GUH A;  2CAQ A;  3GL5 A;  3J7Y b;  1GP1 A;  3CRT A;  3LSZ A;  3FR3 A;  1A2J A;  5IO2 A;  2PN8 A;  3BBY A;  5ID2 B;  5EVO A;  5DQY A;  2B5X A;  2EIO A;  2IPA A;  1FB0 A;  5FT3 A;  4RI6 A;  2P5Q A;  5CRE A;  1GSU A;  4EXJ A;  3F3R A;  3K8N A;  4POB A;  5D9V A;  4YQM A;  4KSM A;  4K5S A;  2MBS A;  4L8E A;  3TKQ A;  4MA9 A;  4DSS B;  3D4T A;  2LTK A;  1OYJ A;  2C0G A;  3FHK A;  1QGV A;  2V41 A;  3UBK A;  1Z6N A;  4X0X A;  1J9B A;  3H4K A;  2JZR A;  5F0G A;  5GAP D;  1DE1 A;  1F37 A;  2VLU A;  4MMM A;  1NM3 A;  2HSY A;  1QUW A;  2HSM A;  1GTB A;  3FR6 A;  6GSS A;  4WF5 A;  4QQ7 A;  1VGL A;  4GXZ A;  4TR0 A;  4MZC A;  3ISO A;  4JE1 A;  1U88 A;  1SYX A;  2VO4 A;  2MZC A;  2IJY A;  5ENU A;  4ECB A;  2P5R A;  4BPY A;  3IDV A;  5J9C A;  3GN3 A;  5CO3 A;  3VWU A;  3E0U A;  3ZIV A;  2XBQ A;  4IJI A;  5IO0 A;  1EEJ A;  2IIY A;  1OKD A;  3EPT A;  4O92 A;  1YEP A;  4EDY A;  3FKF A;  1A24 A;  2YWM A;  2FA8 A;  5IM9 A;  2MMO A;  1TI3 A;  1S3D A;  4CHS A;  1SJ6 A;  2TRC P;  1SKS B;  3FZ5 A;  2A4V A;  1EP8 A;  2H72 A;  2GS3 A;  2B6M A;  1SJZ A;  4O5R A;  1EOG A;  3SWL A;  2UZ8 A;  2FY6 A;  19GS A;  3LXT A;  1AQW A;  1WPI A;  3NZN A;  4Z2R A;  3DWV A;  3TJJ A;  4GCI A;  2OE3 A;  5JWO B;  4NHW A;  4I2U A;  1XWC A;  2TIR A;  2YPM A;  3UOM A;  1TI1 A;  2DKH A;  4V2L A;  5EL8 A;  3TRX A;  4CW9 A;  4EKZ A;  1RW1 A;  3DEX A;  3IK7 A;  4D73 B;  1WP0 A;  4HEA 2;  3HJO A;  1HQO A;  4WET A;  4HU7 A;  5IPG A;  3I9V 2;  4KX4 A;  2OAD A;  1SJI A;  2WS2 A;  4IKH A;  3GYK A;  4IVF A;  1DUG A;  2R0C A;  1J08 A;  1XWK A;  3TRP A;  4WXT A;  2H8L A;  2PER A;  2CAI A;  2KLX A;  1K0N A;  1URM A;  3KGK A;  1V9W A;  2I9H A;  4JR4 A;  3TJG A;  2H0H A;  1FO5 A;  4KCE A;  3M3M A;  4OCE A;  2RLI A;  4HI7 A;  4MF7 A;  4TW5 A;  4XRD A;  1UC7 A;  3KTB A;  1XPV A;  2FWF A;  5CRW A;  2C8U A;  4HJM A;  4EUY A;  5ECI B;  2E7P A;  3IOS A;  2X8H A;  1M9A A;  2N5F A;  4A5P A;  2XPD A;  4EDZ A;  5DJM A;  4KUN A;  1TK8 B;  3TB2 A;  4ECC A;  3IAS 2;  3WT2 A;  4LL4 B;  5DAK B;  4G9H A;  1Y6E A;  3F8U A;  1TU7 A;  4BVX B;  2E0Q A;  1XW5 A;  3WT1 A;  1DBY A;  1M99 A;  2AHE A;  1GSE A;  4TOP A;  1ILO A;  4KDX A;  1ON4 A;  5ECP B;  1ERT A;  2EIR A;  5IMF A;  1K0D A;  1GUK A;  3FMW A;  3IK9 A;  3F0I A;  3PIN A;  1M2D A;  1OC9 A;  2QGV A;  3RBT A;  1XW6 A;  5CYY A;  2VL2 C;  2YZU A;  2DLX A;  2HRF A;  1FOH A;  1N2A A;  2HZE B;  3SBC A;  1T1V A;  4ISD A;  1XWB A;  1B4P A;  5KEJ A;  3KZQ A;  1G6Y A;  5G5E A;  4FO5 A;  3ZFB A;  4MPF A;  3UIW A;  3UMA A;  3W8S A;  2O85 A;  5GZZ B;  1BJX A;  3HD5 A;  3KH7 A;  1R5A A;  3HJM A;  5H5Q A;  5IMV A;  3IRA A;  3WD6 A;  1HYU A;  3CSJ A;  2DJK A;  3VWV A;  2CX3 A;  2ALB A;  4YQU A;  2C80 A;  1X9M B;  3Q19 A;  2HZF A;  1G7E A;  3MSZ A;  4POL A;  2PVO C;  1F3B A;  13GS A;  2MYG A;  2YWI A;  4O5U A;  2FHE A;  1A0R P;  1SEN A;  6GSV A;  1AXD A;  5H5S A;  1XIY A;  1Z7P A;  4V2N A;  2HE3 A;  2CT6 A;  2V1M A;  3M8N A;  3LXZ A;  5ECO B;  2OAC A;  4IW9 A;  2VCW A;  1Z3E A;  2FNO A;  3TCO A;  1AUC A;  3O76 A;  3D6I A;  2ZCT A;  4F2I A;  3LYK A;  2ON5 A;  1YKC A;  2XPE A;  5ECS A;  5IIZ A;  3EVI A;  5INY A;  3IBH A;  1H4O A;  2H01 A;  1TW9 A;  5D9T A;  2HRA A;  5GST A;  3ZL5 A;  1XVW A;  3GST A;  4GTU A;  4F82 A;  1YF1 A;  3TKS C;  1ZZY A;  3PH9 A;  4GLT A;  1GNE A;  2OE0 A;  1SD9 A;  3QOU A;  4YQV A;  1OE8 A;  2AAW A;  4ZB8 A;  1R7H A;  4KND A;  4ZIL A;  4GSS A;  4GF0 A;  2LJA A;  1JZD A;  1MD4 A;  1WWJ A;  1MDK A;  3L9U A;  1Z5Y E;  5HR3 A;  4MF5 A;  4GQF A;  2YCD A;  9GSS A;  2L5L A;  3KIJ A;  5HQP A;  3HVX A;  2OA7 A;  3QAV A;  2K9F A;  2O87 A;  2VCV A;  3LJR A;  3HCZ A;  2V6K A;  1F3A A;  2KP2 A;  1GUL A;  1WRY A;  2G2Q A;  1X9W B;  3EUR A;  3TKS E;  2GTU A;  4MPG A;  3LW9 A;  1XVQ A;  4XHM A;  1GRX A;  3VUR A;  5C04 A;  3H1N A;  2GGT A;  1M7T A;  5ELA A;  2PBJ A;  2WGR A;  1OKT A;  3LQ7 A;  4MLY A;  1PN0 A;  4ML1 A;  3HZ8 A;  4PUF C;  4FIW A;  4K5R A;  2GDR A;  3DML A;  2LRN A;  1DE2 A;  22GS A;  3GHA A;  2HLS A;  5BRT A;  1FW1 A;  4Q5R A;  2CX4 A;  2NDO A;  5ECH B;  2M46 A;  2GT5 A;  2KHP A;  2R4V A;  4OCF A;  1X5E A;  5G5F A;  4ZBD A;  3KCM A;  3ERG A;  3LWA A;  5D9W A;  1BQ7 A;  3L4N A;  4TXO A;  4K2X A;  1WMJ A;  1A8L A;  4G0I A;  4HQS A;  2DML A;  2P0G A;  3AY8 A;  3BD2 A;  4O5Q A;  5F06 A;  5DJL A;  2R5G A;  4MZW A;  3TJK A;  4BL7 B;  2H73 A;  5D93 A;  2IN3 A;  4XS4 B;  3UEM A;  5DCG A;  2LQQ A;  4JRR A;  4NXI A;  3KH9 A;  5D9X A;  2AV4 A;  5ELG A;  2VUP A;  2FWG A;  1QK8 A;  5KOW A;  2YOI A;  3C7M A;  3H79 A;  3VI7 A;  3VPQ A;  2RM6 A;  4MF6 A;  3TGZ A;  3R3E A;  2B5E A;  2LQO A;  4N10 A;  1TRS A;  3HY2 A;  5KN1 A;  2DIZ A;  3TUE A;  5IOX A;  2QKE A;  4KH7 A;  2A2S A;  2FA4 A;  2OBI A;  1O8X A;  4QL7 A;  3QD9 A;  1R4W A;  3RDW A;  2NPB A;  2LRC A;  3BCI A;  5B8A A;  3ERF A;  4NMU A;  5KOX A;  3FRC A;  1RQM A;  4OFT A;  4KF9 A;  2RM5 A;  3APO A;  1PMT A;  3GUS A;  3L78 A;  3G7J A;  1EP7 A;  2I81 A;  2K8S A;  4MK3 A;  1JFU A;  4PQI A;  5ID2 A;  3EC3 A;  3APS A;  1GTA A;  2XBI A;  2BJX A;  2R37 A;  3FZ9 A;  3CBU A;  3N5O A;  1FVJ A;  2K18 A;  3KMO A;  4HU9 A;  1TU8 A;  11GS A;  4QL9 A;  4BA7 A;  5F8B A;  3MAK A;  2WRT A;  4KE3 A;  1WJK A;  4NHZ A;  1KBN A;  2QC7 A;  6GSY A;  5IMA A;  1K0C A;  4WR5 A;  4DSS A;  5E59 A;  4BVY B;  4KCA A;  5IOW A;  2DMM A;  4ECI A;  3TDG A;  1O81 A;  4LMW A;  2KP1 A;  4EC0 A;  3VWX A;  1UN2 A;  3D0Z A;  2OJL A;  2XHF A;  3IV4 A;  2FWE A;  3MWH A;  3WGX A;  1Q98 A;  1G6W A;  2VL9 A;  1Y25 A;  2JSZ A;  1F2E A;  3H8Q A;  3A5W A;  4GSN A;  3D4M A;  1Z9H A;  5GAN D;  4IBP A;  4AJ7 A;  2JL4 A;  3EU4 A;  3QPM A;  5IMD A;  1THX A;  1V58 A;  1V40 A;  3PR8 A;  4ULX A;  1YEX A;  3A2X A;  2CZ3 A;  1I9D A;  1E6B A;  4OO4 A;  4EVM A;  3TKP A;  4JBB A;  1GSS A;  2A2P A;  4HUA A;  4XIH A;  2PPT A;  1THO A;  4EF0 A;  1K3Y A;  4HDE A;  2DKI A;  2L6C A;  2VCQ A;  2M72 A;  3P7X A;  4OFN A;  1USB A;  4NWY A;  4XCS A;  3L9S A;  2H0G A;  5CRH A;  5EPF A;  4AGS A;  1WIK A;  3QAW A;  4ZBA A;  1TK0 B;  2PGT A;  1Z6M A;  3CSI A;  3TOU A;  2H19 A;  2VAF A;  4V2M A;  1ZYE A;  2H75 A;  1ZGN A;  1EEM A;  1OAZ A;  4YAV A;  3CTF A;  2REM A;  3HDC A;  4ZXG A;  1K0B A;  1O6J A;  3ZRD A;  2JU5 A;  3ZVJ A;  2DSA A;  3DD3 A;  3RAZ A;  2GQL A;  3L9V A;  5JCU A;  4EO3 A;  1U6T A;  1H75 A;  2KUC A;  1O8W A;  2LUS A;  2H30 A;  5DAL B;  2YJH A;  2H71 A;  2V6O A;  1SK0 A;  1LU4 A;  2VL2 A;  3UBL A;  3TJB A;  3EIN A;  1XOB A;  1PX7 A;  2F8F A;  4L0W A;  2DBC A;  3MNG A;  4D73 A;  1BYE A;  3M0F A;  4K7O A;  5G30 A;  3HXS A;  5ECK B;  3GKM A;  4IEL A;  1SL0 B;  2D27 A;  4PNG A;  3A5I A;  1TOF A;  2L5O A;  1ZCP A;  1K0A A;  1XWA A;  2EIQ A;  1F6M C;  4WKW A;  2X8G A;  3G9B A;  1ACV A;  2LST A;  3WGD A;  14GS A;  2PVQ A;  4MJC A;  2PWJ A;  3KEB A;  2LNS A;  2YV7 A;  3ZRE A;  1HNB A;  1ABA A;  1PA3 A;  2AB6 A;  3GH9 A;  2X49 A;  4DEJ A;  3RHC A;  4F9Z A;  3F4R A;  4PUR A;  2FCH A;  4TXV A;  2DJ0 A;  5A4W A;  4ZIJ A;  5HFI A;  2R3X A;  1WE0 A;  3GTU A;  1GSY A;  5GSS A;  4DSQ A;  6GSW A;  5IQY A;  1PGT A;  4K0N A;  4ECJ A;  1K3L A;  10GS A;  2FGX A;  3W8J A;  2D2Z A;  1G7O A;  4IJ3 A;  4YAP A;  4MZB A;  2HT9 A;  1C72 A;  5DAK A;  2L4Q A;  1T00 A;  1ML6 A;  4YKG A;  3FW2 A;  3TKS A;  1PN9 A;  4PNF A;  2CVD A;  1NSW A;  5D73 A;  4HZ4 A;  3UVT A;  1VF3 A;  4TR1 B;  5HFK A;  4K6X A;  2C1Y A;  2TRX A;  4ILF A;  2H74 A;  3GFK A;  5FHI A;  2HZE A;  2I3Y A;  1EOH A;  4GQC A;  3DYR A;  2IFQ B;  4EIQ A;  1M0U A;  4O32 A;  3UAR A;  4ZB9 A;  5JWR B;  2FLS A;  1X0R A;  3I69 A;  3CYN A;  5B6N A;  3J7Y k;  1PKZ A;  1ST9 A;  3IC4 A;  1VF1 A;  3TKR A;  1GSD A;  5JCG A;  2HSH A;  2YN1 A;  1K0O A;  1JZW A;  4K9Z A;  5B8B A;  1ERU A;  5G1K A;  1JLV A;  1JLW A;  8GSS A;  4I5Q A;  1Q4J A;  4XS6 A;  4Q5Q A;  7GSS A;  4N0Z A;  1ZOF A;  3MYD A;  3IA1 A;  4LLR A;  1AW9 A;  2HRK A;  1O73 A;  3GA4 A;  2YJ7 A;  1S3C A;  1KTE A;  1XCC A;  4MJE A;  4EE0 A;  1NW2 A;  4HQZ A;  4FH8 A;  1JHB A;  1MD3 A;  4WEY A;  3IAM 2;  2HI7 A;  2L59 A;  3LGC A;  5AIS A;  3U5R E;  2GSQ A;  1A2M A;  3PPU A;  1B9Y C;  4J57 E;  5DQS A;  3VK9 A;  2LS5 A;  2M80 A;  3C1R A;  1CQG A;  2C3N A;  2DJ2 A;  2WZ9 A;  2B5Y A;  4I2T A;  3KTL A;  4POK A;  4KA0 A;  3BOA A;  1MTC A;  1FOV A;  1MDJ A;  2N5A A;  1XZO A;  3RPP A;  1PL2 A;  2OKA A;  3ZML A;  2CV4 A;  6GSU A;  5LNK e;  1TP9 A;  4EL1 A;  1OC3 A;  3QFB C;  1T3B A;  2H0I A;  1HNA A;  2GQM A;  2H6Z A;  5HR0 A;  3OR5 A;  3D5J A;  4LL1 B;  2IMI A;  1T7P B;  4K7I A;  2WUL A;  4E8E A;  4KGI A;  4G0L A;  4F03 A;  1TRU A;  3F4T A;  5DDL A;  1M9B A;  3DIE A;  1SU9 A;  3IPZ A;  5DVB A;  5ABR A;  3ED3 A;  1AQV A;  4OFM A;  2VCT A;  2DJ1 A;  4MP4 A;  4LA1 A;  3M9J A;  3O6T A;  1S3A A;  1FB6 A;  1J0F A;  4K1F A;  1OC8 A;  3DRN A;  2H1D A;  3HKR A;  1N8J A;  4WBJ A;  3TOT A;  1YDK A;  5KN0 A;  2B7K A;  3M9K A;  4TN8 A;  5AIV A;  2MMZ A;  4K8M A;  3DVX A;  3CXG A;  5ECQ B;  4JED A;  2I1U A;  1NHY A;  4V1A g;  3NOF A;  3P2A A;  4TXO B;  2K6V A;  3RPN A;  2VLT A;  2GSS A;  2FWH A;  2IWT A;  4X4J A;  5LCZ A;  2D28 C;  1XFL A;  4N30 A;  3ZYW A;  3GRX A;  4XS1 A;  1XXU A;  2IME A;  3I6A A;  2C3T A;  2CA8 A;  2VM2 A;  3Q18 A;  4KAE A;  4X43 A;  1X5C A;  2VD1 A;  3GL3 A;  1ZMA A;  1SK2 A;  3VWW A;  3F6F A;  2BMX A;  4AF2 A;  1W4V A;  2LJR A;  2R2J A;  5COH A;  4MCU A;  3M1G A;  1PKW A;  1RK4 A;  4K0G A;  1GNW A;  2L4C A;  4CY8 A;  3G7I A;  2HXK A;  2F3M A;  3P90 A;  1EV4 A;  2IMK A;  2YAN A;  3GX8 A;  12GS A;  2VCX A;  2V32 A;  3CMI A;  1DSB A;  2GVP A;  4RI7 A;  2AJQ B;  2IMD A;  1TRV A;  4BL7 A;  3ZMK A;  1SK1 A;  3WGE A;  1XOA A;  1PRX A;  1SD8 A;  2LRT A;  2OBK A;  3A2W A;  1TTZ A;  1SL2 B;  2H6Y A;  2PMT A;  1ZYP A;  1SKW B;  4K7N A;  3D21 A;  2YNX A;  4FYC A;  1BG5 A;  1MDI A;  1GH2 A;  3CSH A;  4HJ2 A;  2VOC A;  5IMZ A;  1F9M A;  4MH2 A;  4Z2T A;  4IS0 A;  3GSS A;  3HZ4 A;  3W6G A;  1WOU A;  1R26 A;  3C1S A;  1TRW A;  4F0C A;  3F4S A;  1B8X A;  2XC2 A;  2F51 A;  2J23 A;  3KM6 A;  2C3Q A;  3S9F A;  4I8B A;  2IL3 A;  5J3R A;  3FZ4 A;  3F3Q A;  17GS A;  2H76 A;  2VM1 A;  4KDU A;  5B6M A;  5AIX A;  3QR6 A;  1LJR A;  1A0F A;  2MMA A;  2RII A;  4V1A p;  1IYH A;  3A2V A;  4JR6 A;  5DBQ A;  2WJU A;  4IHU A;  2C0F A;  3I43 A;  3F6D A;  4POM A;  1GLQ A;  3IC8 A;  1YF0 A;  4KB3 A;  1EZK A;  4CY6 A;  1PL1 A;  2I4A A;  1YKA A;  1EWX A;  1R5P A;  4HOJ A;  2X99 A;  3NIV A;  5LD0 A;  5J41 A;  2ES7 A;  2Z9S A;  4MDC A;  3FYG A;  3GKK A;  3O3T A;  3QFA C;  6GST A;  3EYT A;  2H66 A;  3D22 A;  3GX0 A;  4IQA A;  2OE1 A;  3IE3 A;  2HFD A;  4RUV A;  3U6V A;  1MEK A;  1FG4 A;  4ML6 A;  2A4H A;  1ERV A;  3GMF A;  1TXX A;  4TVE A;  4X1U A;  5D8I A;  4PTS A;  3LG6 A;  4Q5N A;  18GS A;  4BVY A;  1GSF A;  3VPT A;  2E2G A;  3KXO A;  3APQ A;  4TR4 A;  2JSY A;  4I6X A;  2VLV A;  3HHV A;  1YQ1 A;  2LJK A;  2KOK A;  1B48 A;  3DGQ A;  3EMP A;  4PQ1 A;  2N5B A;  4AJ6 A;  3WYW A;  3VFI A;  5G31 A;  1GTU A;  1X9S B;  3N9J A;  2R0P A;  4HS1 A;  4WF4 A;  1EGR A;  1GSQ A;  3HJP A;  5JWQ B;  2X64 A;  5A4V A;  4ZBB A;  3IXR A;  4XTS A;  2QA1 A;  1GLP A;  2JAD A;  1HNC A;  1ZYN A;  3CRU A;  3P8W A;  4OO5 A;  2L6D A;  3ZVJ D;  3HYP A;  1JZR A;  4KW6 A;  3KMN A;  2H1G A;  3Q6O A;  2HNL A;  3MIX A;  4O7H A;  1KNG A;  4IGJ A;  2RUE A;  5E4W A;  3US3 A;  1I5G A;  2H6X A;  1XBS A;  3GKX A;  2O89 A;  1SKR B;  4H86 A;  4WBR D;  3F63 A;  3GIX A;  4OWY A;  1QQ2 A;  2AUV A;  2ON7 A;  4DSR A;  3C71 A;  3FK8 A;  4I97 A;  2JAC A;  3EU3 A;  3ZZX A;  2JZT A;  4OMV A;  2YZH A;  2GT6 A;  5KN2 A;  1A23 A;  2A2R A;  5IPH A;  3C73 A;  1IW7 D;  4YKF A;  3R2Q A;  2AYT A;  2GZY A;  3QDN A;  5C00 A;  4AJ8 A;  2DJ3 A;  2PU9 C;  2F9S A;  2DIY A;  1HD2 A;  5AN1 A;  5JCW A;  3GNJ A;  4ZL8 A;  1V2A A;  2X8C A;  2B1L A;  2GZZ A;  4MAB A;  2V2G A;  3ME7 A;  5H5R A;  3UJ1 A;  4N11 A;  5DAL A;  2WFC A;  1B9X C;  5F05 A;  1T4Z A;  3F9U A;  4TKY A;  1U3A A;  3GH6 A;  1QFN A;  4PUA A;  2DJJ A;  1W89 A;  1X5D A;  1YZX A;  3GTU B;  3VI5 A;  3QCP A;  4MNN A;  4CDO A;  5L71 A;  1YY7 A;  5HR2 A;  2J9H A;  2DC5 A;  1OC9 B;  4IP6 A;  5G1L A;  4TRX A;  1AC1 A;  4NV2 A;  3E3E A;  3RHB A;  2HRN A;  4PGT A;  1YJ6 A;  6GSX A;  3ZTL A;  3FZA A;  4USS A;  1NHO A;  2H1B A;  2R6K A;  1K0M A;  3TRQ A;  3ME8 A;  1XW9 A;  3EWL A;  3GKN A;  4L5O A;  1AIU A;  2JZS A;  3UL3 A;  5ECR B;  1UA5 A;  5J4U A;  1E2Y A;  1GTI A;  4BVX A;  2E2M A;  4EIP A;  4MJB A;  4XRA A;  1GL8 A;  3KP9 A;  4G2E A;  1M2A A;  4E8H A;  4K2D A;  4F0B A;  1AQX A;  1BED A;  3GV1 A;  1M2B A;  1PX6 A;  3QMX A;  2HYX A;  3IHQ A;  3DKS A;  5D96 A;  1B4Q A;  2G0F A;  3GUR A;  2H1A A;  1ERW A;  5CAX A;  4KDY A;  2YP6 A;  2ZUP A;  1TDI A;  5ECM B;  3LEF A;  2CZ2 A;  2LV3 A;  1TK5 B;  5ECL B;  4RQR A;  1VRS D;  2C4J A;  4YH2 A;  4NPB A;  2B7J A;  3KD0 A;  20GS A;  3L0H A;  2B1K A;  1FHE A;  3KJY A;  4JU5 A;  4ZB6 A;  4GST A;  4DVC A;  3KP8 A;  4ZL9 A;  2CQ9 A;  2NVL A;  1GWC A;  3FR9 A;  3IR4 A;  4N0V A;  4TR1 A;  4PX1 A;  3LFL A;  1V57 A;  1A2L A;  4OD7 A;  5ECN B;  4PXO A;  1QMV A;  2R0G A;  4FYB A;  5BMU A;  4G10 A;  5HFG A;  4ACS A;  1VF4 A;  3HVS A;  3PGT A;  2IFQ A;  1A8Y A;  5IMC A;  4GRF A;  1SYR A;  5KN3 A;  3BCK A;  1PQN A;  2NBS A;  3ZFL A;  4JZQ A;  3DXB A;  2O8V B;  3Q74 A;  2YV9 A;  1TKD B;  2L57 A;  1O85 A;  2YWO A;  4Z2U A;  4NAX A;  3HVV A;  1K3O A;  2GSR A;  1T8E B;  3TJF A;  1XWG A;  1O7U A;  4MH3 A;  2YWN A;  4PQH A;  2VIM A;  16GS A;  2MMN A;  1U3I A;  1Z7R A;  2P31 A;  1FVK A;  3V1W A;  3ZLP A;  3A3T A;  3IHG A;  1JZO A;  1U87 A;  4ID0 A;  3CTG A;  2RUF A;  3H93 A;  3DVW A;  1ZYQ B;  3ZIT A;  3FEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...