3GTDA

2.4 angstrom crystal structure of fumarate hydratase from rickettsia prowazekii
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
455
structure length
455
Chain Sequence
NYRIESDSFGEIQIEEKFYWGAQTQRSLNNFKISKQKMPKILIRALAILKKCAAQVNYEFGDLEYKIATSIDKAIDRILAGEFEDNFPLVVWQTGSGTQTNMNMNEVIASIANEELTGKKGGKFPVHPNDHVNKGQSSNDSFPTAMHIATVLATKQQLIPALNNLLTYLQDKSKDWDKIIKIGRTHLQDATPLTLKQEFSGYITQIEYALERIEDALKKVYLLAQGGTAVGTGINSKIGFDIKFAQKVAEFTQQPFKTAPNKFESLAAHDALVEFSGTLNTIAVSLMKIANDIRLLGSGPRCGLGELHLPENEPGSSIMPGKVNPTQVEALTMVCTQVMGNHVTVTIAGSNGHLELNVFKPVIIYNILQSIELLSDSVNSFVTHCVKGLEPNIARINTLRDKSLMLVTVLNPHIGYDNAAKIAKEAHKYGITLKEAAKKLNFLSEEEFDKIVVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fumarate hydratase class II
publication title Structure of fumarate hydratase from Rickettsia prowazekii, the agent of typhus and suspected relative of the mitochondria.
pubmed doi rcsb
source organism Rickettsia prowazekii
molecule tags Lyase
total genus 175
structure length 455
sequence length 455
chains with identical sequence B
ec nomenclature ec 4.2.1.2: Fumarate hydratase.
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF10415 FumaraseC_C Fumarase C C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 3gtdA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 3gtdA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 3gtdA02
2X75A 1GK3A 4MX2A 3CZOA 2FUSA 3GTDA 2QGAB 3R6YA 3OCFA 2RJRA 2QVEA 2PTRA 3KDZA 1TJVA 2PTQA 3R6QA 3OCEA 1U16A 1YFMA 2O7EA 2OHYA 4CQ5A 1W27A 2O7FA 2O78A 1GKJA 1VDKA 1GK2A 4V2RA 1XWOA 2O7DA 4V2QA 4NSLA 4C5RA 3RRPA 1HY0A 2NYNA 4C6GA 1EB4A 4BAAA 1FUOA 3E04A 4FLCA 1GKMA 4APBA 4HGVA 5F91A 1FUPA 3C8TA 2PTSA 4APAA 1AUWA 1FURA 3UNVA 1TJUA 2E9FA 2J91A 3R6VA 4NLEA 2YIIA 1TJWA 4FFXA 5D6BA 4ADLA 1RE5A 1K62A 2NYFA 5HW2A 1K7WA 1YISA 2O6YA 1DCNA 1J3UA 2VD6A 3QBPA 1KQ7A 2HVGA 1B8FA 1I0AA 5EYVA 3BHGA 4BABA 3KDYA 1U15A 1T6PA 1JSWA 5F92A 2O7BA 1T6JA 3RD8A 4ADMA 1Y2MA 1C3UA 1YFEA 1C3CA 4EFCA 2PFMA 3NO9A 1HY1A 1TJ7A 3TV2A 2RJSA 1FUQA 3NZ4A 4C5UA 4C5SA 5EYTA 4EEIA 1DOFA 1Q5NA 3GZHA
chains in the Genus database with same CATH superfamily
2X75A 4L57A 1GK3A 5H8WA 1Z4QA 2YV5A 3F4RA 4MX2A 2JARA 2FUSA 1T9HA 3GTDA 3CZOA 4MWOA 1Z4LA 2QGAB 2VSFA 2FENA 3R6YA 4YIKA 3OCFA 2D27A 2RJRA 2QVEA 2PTRA 1XMDA 3KDZA 1TJVA 1Z4JA 2PTQA 3R6QA 2JAUA 3F4SA 1XL8A 3OCEA 1U16A 2JAWA 1Q92A 1YFMA 2O7EA 2OHYA 4CQ5A 1W27A 2O7FA 2O78A 1GKJA 1VDKA 1GK2A 4V2RA 1XWOA 2O7DA 4V2QA 4YIHA 4NSLA 4C5RA 4A15A 3RRPA 1HY0A 2NYNA 4C6GA 1EB4A 4BAAA 1FUOA 3E04A 4FLCA 1Z4KA 4APBA 1GKMA 4HGVA 5F91A 1FUPA 3C8TA 2PTSA 3BWVA 4APAA 1AUWA 1FURA 3UNVA 1TJUA 3CRVA 1Z4PX 2E9FA 3R6VA 2J91A 1XL7A 4MUMA 4NLEA 2YIIA 1TJWA 4FFXA 5D6BA 4ADLA 4WNLA 1RE5A 1K62A 2NYFA 2I7DA 5HW2A 1K7WA 1XMCA 4IQJM 1YISA 1XLYA 2O6YA 1DCNA 1J3UA 1Q91A 2VD6A 5M0JA 4L6AA 3QBPA 1Z4MA 3CRW1 1KQ7A 2HVGA 1B8FA 1I0AA 5EYVA 3BHGA 3U13A 3KDYA 4BABA 4E88A 5M0IA 1U15A 1T6PA 1JSWA 1Z4IA 5F92A 2O7BA 1T6JA 3RD8A 4ADMA 2JAOA 1Y2MA 1C3UA 1U0LA 4L6CA 2VL7A 1YFEA 2FELA 1C3CA 3U19A 4EFCA 1MH9A 2PFMA 3NO9A 1IW7D 1HY1A 1TJ7A 3TV2A 2RJSA 1FUQA 3CI0K 3NZ4A 4NFLA 4C5UA 4C5SA 2RCNA 5EYTA 4EEIA 2D28C 1DOFA 3F4TA 1Q5NA 3GZHA
chains in the Genus database with same CATH topology
2X75A 1GK3A 4MX2A 3CZOA 2FUSA 3GTDA 2QGAB 3R6YA 3OCFA 2RJRA 2QVEA 2PTRA 3KDZA 1TJVA 2PTQA 3R6QA 3OCEA 1U16A 1YFMA 2O7EA 2OHYA 4CQ5A 1W27A 2O7FA 2O78A 1GKJA 1VDKA 1GK2A 4V2RA 1XWOA 2O7DA 4V2QA 4NSLA 4C5RA 3RRPA 1HY0A 2NYNA 4C6GA 1EB4A 4BAAA 1FUOA 3E04A 4FLCA 1GKMA 4APBA 4HGVA 5F91A 1FUPA 3C8TA 2PTSA 4APAA 1AUWA 1FURA 3UNVA 1TJUA 2E9FA 2J91A 3R6VA 4NLEA 2YIIA 1TJWA 4FFXA 5D6BA 4ADLA 1RE5A 1K62A 2NYFA 5HW2A 1K7WA 1YISA 2O6YA 1DCNA 1J3UA 2VD6A 3QBPA 1KQ7A 2HVGA 1B8FA 1I0AA 5EYVA 3BHGA 4BABA 3KDYA 1U15A 1T6PA 1JSWA 5F92A 2O7BA 1T6JA 3RD8A 4ADMA 1Y2MA 1C3UA 1YFEA 1C3CA 4EFCA 2PFMA 3NO9A 1HY1A 1TJ7A 3TV2A 2RJSA 1FUQA 3NZ4A 4C5UA 4C5SA 5EYTA 4EEIA 1DOFA 1Q5NA 3GZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X75 A;  1GK3 A;  4MX2 A;  3CZO A;  2FUS A;  3GTD A;  2QGA B;  3R6Y A;  3OCF A;  2RJR A;  2QVE A;  2PTR A;  3KDZ A;  1TJV A;  2PTQ A;  3R6Q A;  3OCE A;  1U16 A;  1YFM A;  2O7E A;  2OHY A;  4CQ5 A;  1W27 A;  2O7F A;  2O78 A;  1GKJ A;  1VDK A;  1GK2 A;  4V2R A;  1XWO A;  2O7D A;  4V2Q A;  4NSL A;  4C5R A;  3RRP A;  1HY0 A;  2NYN A;  4C6G A;  1EB4 A;  4BAA A;  1FUO A;  3E04 A;  4FLC A;  1GKM A;  4APB A;  4HGV A;  5F91 A;  1FUP A;  3C8T A;  2PTS A;  4APA A;  1AUW A;  1FUR A;  3UNV A;  1TJU A;  2E9F A;  2J91 A;  3R6V A;  4NLE A;  2YII A;  1TJW A;  4FFX A;  5D6B A;  4ADL A;  1RE5 A;  1K62 A;  2NYF A;  5HW2 A;  1K7W A;  1YIS A;  2O6Y A;  1DCN A;  1J3U A;  2VD6 A;  3QBP A;  1KQ7 A;  2HVG A;  1B8F A;  1I0A A;  5EYV A;  3BHG A;  4BAB A;  3KDY A;  1U15 A;  1T6P A;  1JSW A;  5F92 A;  2O7B A;  1T6J A;  3RD8 A;  4ADM A;  1Y2M A;  1C3U A;  1YFE A;  1C3C A;  4EFC A;  2PFM A;  3NO9 A;  1HY1 A;  1TJ7 A;  3TV2 A;  2RJS A;  1FUQ A;  3NZ4 A;  4C5U A;  4C5S A;  5EYT A;  4EEI A;  1DOF A;  1Q5N A;  3GZH A; 
#chains in the Genus database with same CATH topology
 2X75 A;  4L57 A;  1GK3 A;  5H8W A;  1Z4Q A;  2YV5 A;  3F4R A;  4MX2 A;  2JAR A;  2FUS A;  1T9H A;  3GTD A;  3CZO A;  4MWO A;  1Z4L A;  2QGA B;  2VSF A;  2FEN A;  3R6Y A;  4YIK A;  3OCF A;  2D27 A;  2RJR A;  2QVE A;  2PTR A;  1XMD A;  3KDZ A;  1TJV A;  1Z4J A;  2PTQ A;  3R6Q A;  2JAU A;  3F4S A;  1XL8 A;  3OCE A;  1U16 A;  2JAW A;  1Q92 A;  1YFM A;  2O7E A;  2OHY A;  4CQ5 A;  1W27 A;  2O7F A;  2O78 A;  1GKJ A;  1VDK A;  1GK2 A;  4V2R A;  1XWO A;  2O7D A;  4V2Q A;  4YIH A;  4NSL A;  4C5R A;  4A15 A;  3RRP A;  1HY0 A;  2NYN A;  4C6G A;  1EB4 A;  4BAA A;  1FUO A;  3E04 A;  4FLC A;  1Z4K A;  4APB A;  1GKM A;  4HGV A;  5F91 A;  1FUP A;  3C8T A;  2PTS A;  3BWV A;  4APA A;  1AUW A;  1FUR A;  3UNV A;  1TJU A;  3CRV A;  1Z4P X;  2E9F A;  3R6V A;  2J91 A;  1XL7 A;  4MUM A;  4NLE A;  2YII A;  1TJW A;  4FFX A;  5D6B A;  4ADL A;  4WNL A;  1RE5 A;  1K62 A;  2NYF A;  2I7D A;  5HW2 A;  1K7W A;  1XMC A;  4IQJ M;  1YIS A;  1XLY A;  2O6Y A;  1DCN A;  1J3U A;  1Q91 A;  2VD6 A;  5M0J A;  4L6A A;  3QBP A;  1Z4M A;  3CRW 1;  1KQ7 A;  2HVG A;  1B8F A;  1I0A A;  5EYV A;  3BHG A;  3U13 A;  3KDY A;  4BAB A;  4E88 A;  5M0I A;  1U15 A;  1T6P A;  1JSW A;  1Z4I A;  5F92 A;  2O7B A;  1T6J A;  3RD8 A;  4ADM A;  2JAO A;  1Y2M A;  1C3U A;  1U0L A;  4L6C A;  2VL7 A;  1YFE A;  2FEL A;  1C3C A;  3U19 A;  4EFC A;  1MH9 A;  2PFM A;  3NO9 A;  1IW7 D;  1HY1 A;  1TJ7 A;  3TV2 A;  2RJS A;  1FUQ A;  3CI0 K;  3NZ4 A;  4NFL A;  4C5U A;  4C5S A;  2RCN A;  5EYT A;  4EEI A;  2D28 C;  1DOF A;  3F4T A;  1Q5N A;  3GZH A; 
#chains in the Genus database with same CATH homology
 2X75 A;  1GK3 A;  4MX2 A;  3CZO A;  2FUS A;  3GTD A;  2QGA B;  3R6Y A;  3OCF A;  2RJR A;  2QVE A;  2PTR A;  3KDZ A;  1TJV A;  2PTQ A;  3R6Q A;  3OCE A;  1U16 A;  1YFM A;  2O7E A;  2OHY A;  4CQ5 A;  1W27 A;  2O7F A;  2O78 A;  1GKJ A;  1VDK A;  1GK2 A;  4V2R A;  1XWO A;  2O7D A;  4V2Q A;  4NSL A;  4C5R A;  3RRP A;  1HY0 A;  2NYN A;  4C6G A;  1EB4 A;  4BAA A;  1FUO A;  3E04 A;  4FLC A;  1GKM A;  4APB A;  4HGV A;  5F91 A;  1FUP A;  3C8T A;  2PTS A;  4APA A;  1AUW A;  1FUR A;  3UNV A;  1TJU A;  2E9F A;  2J91 A;  3R6V A;  4NLE A;  2YII A;  1TJW A;  4FFX A;  5D6B A;  4ADL A;  1RE5 A;  1K62 A;  2NYF A;  5HW2 A;  1K7W A;  1YIS A;  2O6Y A;  1DCN A;  1J3U A;  2VD6 A;  3QBP A;  1KQ7 A;  2HVG A;  1B8F A;  1I0A A;  5EYV A;  3BHG A;  4BAB A;  3KDY A;  1U15 A;  1T6P A;  1JSW A;  5F92 A;  2O7B A;  1T6J A;  3RD8 A;  4ADM A;  1Y2M A;  1C3U A;  1YFE A;  1C3C A;  4EFC A;  2PFM A;  3NO9 A;  1HY1 A;  1TJ7 A;  3TV2 A;  2RJS A;  1FUQ A;  3NZ4 A;  4C5U A;  4C5S A;  5EYT A;  4EEI A;  1DOF A;  1Q5N A;  3GZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...