3GTDA

2.4 angstrom crystal structure of fumarate hydratase from rickettsia prowazekii
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
455
structure length
455
Chain Sequence
NYRIESDSFGEIQIEEKFYWGAQTQRSLNNFKISKQKMPKILIRALAILKKCAAQVNYEFGDLEYKIATSIDKAIDRILAGEFEDNFPLVVWQTGSGTQTNMNMNEVIASIANEELTGKKGGKFPVHPNDHVNKGQSSNDSFPTAMHIATVLATKQQLIPALNNLLTYLQDKSKDWDKIIKIGRTHLQDATPLTLKQEFSGYITQIEYALERIEDALKKVYLLAQGGTAVGTGINSKIGFDIKFAQKVAEFTQQPFKTAPNKFESLAAHDALVEFSGTLNTIAVSLMKIANDIRLLGSGPRCGLGELHLPENEPGSSIMPGKVNPTQVEALTMVCTQVMGNHVTVTIAGSNGHLELNVFKPVIIYNILQSIELLSDSVNSFVTHCVKGLEPNIARINTLRDKSLMLVTVLNPHIGYDNAAKIAKEAHKYGITLKEAAKKLNFLSEEEFDKIVVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Fumarate hydratase class II
publication title Structure of fumarate hydratase from Rickettsia prowazekii, the agent of typhus and suspected relative of the mitochondria.
pubmed doi rcsb
source organism Rickettsia prowazekii
total genus 175
structure length 455
sequence length 455
chains with identical sequence B
ec nomenclature ec 4.2.1.2: Fumarate hydratase.
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF10415 FumaraseC_C Fumarase C C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 3gtdA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 3gtdA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 3gtdA02
3GZHA 3OCEA 2NYFA 2O78A 2O7DA 2OHYA 1C3CA 1EB4A 1DCNA 1YFMA 1Q5NA 2O7BA 1RE5A 5HW2A 1B8FA 3R6VA 2RJRA 3CZOA 3R6YA 1Y2MA 3NO9A 4APBA 1GK2A 5EYTA 2X75A 2FUSA 1DOFA 1HY0A 1TJWA 3BHGA 3KDYA 1FUOA 2PTSA 2NYNA 1TJ7A 4ADLA 2HVGA 1FUPA 4HGVA 1FUQA 5F92A 2O7EA 1YFEA 3KDZA 3GTDA 5F91A 4V2QA 1U16A 1HY1A 1AUWA 4NLEA 1I0AA 4MX2A 2RJSA 2PTRA 4FFXA 1YISA 5EYVA 4EEIA 2O7FA 2QGAB 1JSWA 1TJUA 3QBPA 4APAA 4V2RA 3C8TA 2PTQA 3TV2A 1K62A 4C5UA 3R6QA 4FLCA 1TJVA 3OCFA 1K7WA 4C6GA 1VDKA 1GKMA 2PFMA 3E04A 2E9FA 2J91A 3RD8A 4C5RA 1GK3A 2O6YA 3NZ4A 4CQ5A 4NSLA 1W27A 3RRPA 4ADMA 2YIIA 1U15A 4EFCA 2VD6A 4BABA 1GKJA 1T6PA 1FURA 1C3UA 3UNVA 1KQ7A 1J3UA 2QVEA 4C5SA 1XWOA 4BAAA 1T6JA 5D6BA
chains in the Genus database with same CATH superfamily
1XL8A 5M0JA 3GZHA 3OCEA 2NYFA 2O78A 2O7DA 2OHYA 1C3CA 1EB4A 1DCNA 1YFMA 1Q5NA 2O7BA 1Z4JA 1Z4MA 1RE5A 5HW2A 1B8FA 3R6VA 2RJRA 3CZOA 3R6YA 1Y2MA 3CRW1 1XMDA 3NO9A 4APBA 1GK2A 2JARA 5EYTA 2X75A 2D27A 3F4RA 1Q92A 2FUSA 1DOFA 1HY0A 4MUMA 1TJWA 2VSFA 3BHGA 3BWVA 2VL7A 3KDYA 1FUOA 2PTSA 2NYNA 1TJ7A 4ADLA 2HVGA 1FUPA 4HGVA 1IW7D 1FUQA 5F92A 3CRVA 2O7EA 1U0LA 1YFEA 3GTDA 5F91A 3KDZA 3F4SA 4V2QA 4MWOA 1U16A 2RCNA 1HY1A 1AUWA 4NLEA 4YIKA 1I0AA 1XLYA 2JAUA 4NFLA 1Q91A 4MX2A 2RJSA 2PTRA 4L57A 4FFXA 1Z4KA 1Z4PX 1Z4QA 1YISA 5EYVA 4EEIA 3F4TA 4L6CA 2O7FA 2QGAB 1JSWA 2FENA 1TJUA 3U19A 3QBPA 5H8WA 3CI0K 2D28C 4APAA 4V2RA 4E88A 4A15A 3C8TA 2PTQA 3TV2A 1K62A 4C5UA 2FELA 3R6QA 4FLCA 1TJVA 1Z4IA 3OCFA 1Z4LA 1K7WA 4C6GA 1VDKA 1GKMA 2PFMA 3E04A 2JAOA 2I7DA 2E9FA 2J91A 1T9HA 3RD8A 4C5RA 1GK3A 1MH9A 2O6YA 3NZ4A 4CQ5A 4NSLA 1W27A 1XMCA 4WNLA 3RRPA 4ADMA 2YIIA 1U15A 4IQJM 5M0IA 4EFCA 2VD6A 4BABA 2YV5A 4YIHA 1GKJA 1T6PA 1FURA 1XL7A 1C3UA 3UNVA 1KQ7A 1J3UA 2JAWA 3U13A 2QVEA 4C5SA 1XWOA 4BAAA 4L6AA 1T6JA 5D6BA
chains in the Genus database with same CATH topology
3GZHA 3OCEA 2NYFA 2O78A 2O7DA 2OHYA 1C3CA 1EB4A 1DCNA 1YFMA 1Q5NA 2O7BA 1RE5A 5HW2A 1B8FA 3R6VA 2RJRA 3CZOA 3R6YA 1Y2MA 3NO9A 4APBA 1GK2A 5EYTA 2X75A 2FUSA 1DOFA 1HY0A 1TJWA 3BHGA 3KDYA 1FUOA 2PTSA 2NYNA 1TJ7A 4ADLA 2HVGA 1FUPA 4HGVA 1FUQA 5F92A 2O7EA 1YFEA 3KDZA 3GTDA 5F91A 4V2QA 1U16A 1HY1A 1AUWA 4NLEA 1I0AA 4MX2A 2RJSA 2PTRA 4FFXA 1YISA 5EYVA 4EEIA 2O7FA 2QGAB 1JSWA 1TJUA 3QBPA 4APAA 4V2RA 3C8TA 2PTQA 3TV2A 1K62A 4C5UA 3R6QA 4FLCA 1TJVA 3OCFA 1K7WA 4C6GA 1VDKA 1GKMA 2PFMA 3E04A 2E9FA 2J91A 3RD8A 4C5RA 1GK3A 2O6YA 3NZ4A 4CQ5A 4NSLA 1W27A 3RRPA 4ADMA 2YIIA 1U15A 4EFCA 2VD6A 4BABA 1GKJA 1T6PA 1FURA 1C3UA 3UNVA 1KQ7A 1J3UA 2QVEA 4C5SA 1XWOA 4BAAA 1T6JA 5D6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZH A;  3OCE A;  2NYF A;  2O78 A;  2O7D A;  2OHY A;  1C3C A;  1EB4 A;  1DCN A;  1YFM A;  1Q5N A;  2O7B A;  1RE5 A;  5HW2 A;  1B8F A;  3R6V A;  2RJR A;  3CZO A;  3R6Y A;  1Y2M A;  3NO9 A;  4APB A;  1GK2 A;  5EYT A;  2X75 A;  2FUS A;  1DOF A;  1HY0 A;  1TJW A;  3BHG A;  3KDY A;  1FUO A;  2PTS A;  2NYN A;  1TJ7 A;  4ADL A;  2HVG A;  1FUP A;  4HGV A;  1FUQ A;  5F92 A;  2O7E A;  1YFE A;  3KDZ A;  3GTD A;  5F91 A;  4V2Q A;  1U16 A;  1HY1 A;  1AUW A;  4NLE A;  1I0A A;  4MX2 A;  2RJS A;  2PTR A;  4FFX A;  1YIS A;  5EYV A;  4EEI A;  2O7F A;  2QGA B;  1JSW A;  1TJU A;  3QBP A;  4APA A;  4V2R A;  3C8T A;  2PTQ A;  3TV2 A;  1K62 A;  4C5U A;  3R6Q A;  4FLC A;  1TJV A;  3OCF A;  1K7W A;  4C6G A;  1VDK A;  1GKM A;  2PFM A;  3E04 A;  2E9F A;  2J91 A;  3RD8 A;  4C5R A;  1GK3 A;  2O6Y A;  3NZ4 A;  4CQ5 A;  4NSL A;  1W27 A;  3RRP A;  4ADM A;  2YII A;  1U15 A;  4EFC A;  2VD6 A;  4BAB A;  1GKJ A;  1T6P A;  1FUR A;  1C3U A;  3UNV A;  1KQ7 A;  1J3U A;  2QVE A;  4C5S A;  1XWO A;  4BAA A;  1T6J A;  5D6B A; 
#chains in the Genus database with same CATH topology
 1XL8 A;  5M0J A;  3GZH A;  3OCE A;  2NYF A;  2O78 A;  2O7D A;  2OHY A;  1C3C A;  1EB4 A;  1DCN A;  1YFM A;  1Q5N A;  2O7B A;  1Z4J A;  1Z4M A;  1RE5 A;  5HW2 A;  1B8F A;  3R6V A;  2RJR A;  3CZO A;  3R6Y A;  1Y2M A;  3CRW 1;  1XMD A;  3NO9 A;  4APB A;  1GK2 A;  2JAR A;  5EYT A;  2X75 A;  2D27 A;  3F4R A;  1Q92 A;  2FUS A;  1DOF A;  1HY0 A;  4MUM A;  1TJW A;  2VSF A;  3BHG A;  3BWV A;  2VL7 A;  3KDY A;  1FUO A;  2PTS A;  2NYN A;  1TJ7 A;  4ADL A;  2HVG A;  1FUP A;  4HGV A;  1IW7 D;  1FUQ A;  5F92 A;  3CRV A;  2O7E A;  1U0L A;  1YFE A;  3GTD A;  5F91 A;  3KDZ A;  3F4S A;  4V2Q A;  4MWO A;  1U16 A;  2RCN A;  1HY1 A;  1AUW A;  4NLE A;  4YIK A;  1I0A A;  1XLY A;  2JAU A;  4NFL A;  1Q91 A;  4MX2 A;  2RJS A;  2PTR A;  4L57 A;  4FFX A;  1Z4K A;  1Z4P X;  1Z4Q A;  1YIS A;  5EYV A;  4EEI A;  3F4T A;  4L6C A;  2O7F A;  2QGA B;  1JSW A;  2FEN A;  1TJU A;  3U19 A;  3QBP A;  5H8W A;  3CI0 K;  2D28 C;  4APA A;  4V2R A;  4E88 A;  4A15 A;  3C8T A;  2PTQ A;  3TV2 A;  1K62 A;  4C5U A;  2FEL A;  3R6Q A;  4FLC A;  1TJV A;  1Z4I A;  3OCF A;  1Z4L A;  1K7W A;  4C6G A;  1VDK A;  1GKM A;  2PFM A;  3E04 A;  2JAO A;  2I7D A;  2E9F A;  2J91 A;  1T9H A;  3RD8 A;  4C5R A;  1GK3 A;  1MH9 A;  2O6Y A;  3NZ4 A;  4CQ5 A;  4NSL A;  1W27 A;  1XMC A;  4WNL A;  3RRP A;  4ADM A;  2YII A;  1U15 A;  4IQJ M;  5M0I A;  4EFC A;  2VD6 A;  4BAB A;  2YV5 A;  4YIH A;  1GKJ A;  1T6P A;  1FUR A;  1XL7 A;  1C3U A;  3UNV A;  1KQ7 A;  1J3U A;  2JAW A;  3U13 A;  2QVE A;  4C5S A;  1XWO A;  4BAA A;  4L6A A;  1T6J A;  5D6B A; 
#chains in the Genus database with same CATH homology
 3GZH A;  3OCE A;  2NYF A;  2O78 A;  2O7D A;  2OHY A;  1C3C A;  1EB4 A;  1DCN A;  1YFM A;  1Q5N A;  2O7B A;  1RE5 A;  5HW2 A;  1B8F A;  3R6V A;  2RJR A;  3CZO A;  3R6Y A;  1Y2M A;  3NO9 A;  4APB A;  1GK2 A;  5EYT A;  2X75 A;  2FUS A;  1DOF A;  1HY0 A;  1TJW A;  3BHG A;  3KDY A;  1FUO A;  2PTS A;  2NYN A;  1TJ7 A;  4ADL A;  2HVG A;  1FUP A;  4HGV A;  1FUQ A;  5F92 A;  2O7E A;  1YFE A;  3KDZ A;  3GTD A;  5F91 A;  4V2Q A;  1U16 A;  1HY1 A;  1AUW A;  4NLE A;  1I0A A;  4MX2 A;  2RJS A;  2PTR A;  4FFX A;  1YIS A;  5EYV A;  4EEI A;  2O7F A;  2QGA B;  1JSW A;  1TJU A;  3QBP A;  4APA A;  4V2R A;  3C8T A;  2PTQ A;  3TV2 A;  1K62 A;  4C5U A;  3R6Q A;  4FLC A;  1TJV A;  3OCF A;  1K7W A;  4C6G A;  1VDK A;  1GKM A;  2PFM A;  3E04 A;  2E9F A;  2J91 A;  3RD8 A;  4C5R A;  1GK3 A;  2O6Y A;  3NZ4 A;  4CQ5 A;  4NSL A;  1W27 A;  3RRP A;  4ADM A;  2YII A;  1U15 A;  4EFC A;  2VD6 A;  4BAB A;  1GKJ A;  1T6P A;  1FUR A;  1C3U A;  3UNV A;  1KQ7 A;  1J3U A;  2QVE A;  4C5S A;  1XWO A;  4BAA A;  1T6J A;  5D6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...