3GTDA

2.4 angstrom crystal structure of fumarate hydratase from rickettsia prowazekii
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
455
structure length
455
Chain Sequence
NYRIESDSFGEIQIEEKFYWGAQTQRSLNNFKISKQKMPKILIRALAILKKCAAQVNYEFGDLEYKIATSIDKAIDRILAGEFEDNFPLVVWQTGSGTQTNMNMNEVIASIANEELTGKKGGKFPVHPNDHVNKGQSSNDSFPTAMHIATVLATKQQLIPALNNLLTYLQDKSKDWDKIIKIGRTHLQDATPLTLKQEFSGYITQIEYALERIEDALKKVYLLAQGGTAVGTGINSKIGFDIKFAQKVAEFTQQPFKTAPNKFESLAAHDALVEFSGTLNTIAVSLMKIANDIRLLGSGPRCGLGELHLPENEPGSSIMPGKVNPTQVEALTMVCTQVMGNHVTVTIAGSNGHLELNVFKPVIIYNILQSIELLSDSVNSFVTHCVKGLEPNIARINTLRDKSLMLVTVLNPHIGYDNAAKIAKEAHKYGITLKEAAKKLNFLSEEEFDKIVVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of fumarate hydratase from Rickettsia prowazekii, the agent of typhus and suspected relative of the mitochondria.
pubmed doi rcsb
source organism Rickettsia prowazekii
molecule tags Lyase
molecule keywords Fumarate hydratase class II
total genus 175
structure length 455
sequence length 455
chains with identical sequence B
ec nomenclature ec 4.2.1.2: Fumarate hydratase.
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF10415 FumaraseC_C Fumarase C C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 3gtdA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 3gtdA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 3gtdA02
1U15A 4NSLA 3R6QA 2QGAB 3OCFA 4EFCA 3UNVA 4C5RA 4BABA 1EB4A 2PTQA 2PFMA 1AUWA 4MX2A 1FUPA 2O78A 4FLCA 4APAA 4V2QA 3E04A 4ADLA 2O7EA 1T6PA 5F92A 2YIIA 5EYTA 4CQ5A 1GKJA 3R6YA 2O6YA 2X75A 2NYFA 1HY0A 1B8FA 1FUQA 2RJRA 1I0AA 3NO9A 1GK3A 2QVEA 2E9FA 4C5SA 1Y2MA 1TJVA 5D6BA 1JSWA 2FUSA 1GKMA 5HW2A 1XWOA 3OCEA 3GTDA 3KDYA 1K62A 2VD6A 1TJ7A 2NYNA 3BHGA 1YFEA 3QBPA 3TV2A 5F91A 4EEIA 1RE5A 4C5UA 3C8TA 4BAAA 2O7BA 2PTRA 1C3CA 4FFXA 4C6GA 2O7FA 4HGVA 1TJUA 3CZOA 1DCNA 1DOFA 1Q5NA 2OHYA 4V2RA 1HY1A 1KQ7A 2J91A 4NLEA 5EYVA 1FUOA 1T6JA 1YISA 1C3UA 1FURA 1GK2A 1U16A 3RRPA 1W27A 1TJWA 3RD8A 2O7DA 4APBA 2PTSA 1J3UA 1VDKA 3NZ4A 1K7WA 2RJSA 2HVGA 1YFMA 4ADMA 3KDZA 3GZHA 3R6VA
chains in the Genus database with same CATH superfamily
3CRW1 1U15A 4NSLA 3R6QA 2QGAB 3OCFA 1Z4MA 4EFCA 3UNVA 1XL8A 4C5RA 2YV5A 4BABA 5M0IA 1EB4A 2PTQA 2PFMA 1AUWA 4MX2A 1FUPA 4L6CA 2O78A 1Z4QA 4FLCA 1XMDA 4APAA 2VSFA 2JAOA 4YIKA 4V2QA 3E04A 4MUMA 4ADLA 2O7EA 4YIHA 1T6PA 1Z4JA 2D27A 5F92A 2YIIA 5EYTA 4CQ5A 1GKJA 3R6YA 4MWOA 4L57A 5H8WA 2O6YA 2X75A 3F4SA 1XMCA 2NYFA 1HY0A 1B8FA 1FUQA 2RJRA 3U19A 1I0AA 3NO9A 4E88A 1GK3A 2QVEA 2E9FA 4C5SA 1Y2MA 1TJVA 5D6BA 2JAWA 4A15A 1JSWA 3F4RA 2FUSA 2FELA 1GKMA 5HW2A 1XLYA 1XWOA 3OCEA 1Q91A 1Z4KA 3GTDA 3KDYA 1K62A 2VD6A 1TJ7A 2NYNA 3BHGA 1YFEA 3QBPA 3TV2A 5M0JA 4WNLA 5F91A 4EEIA 1RE5A 2JAUA 1U0LA 4C5UA 3CI0K 3C8TA 2VL7A 4BAAA 2FENA 2O7BA 2PTRA 1C3CA 4FFXA 1Z4PX 2JARA 4C6GA 2O7FA 1IW7D 4HGVA 1Z4IA 1TJUA 3CZOA 1DCNA 1DOFA 1Q5NA 2OHYA 1MH9A 4V2RA 3U13A 1HY1A 1T9HA 1KQ7A 4IQJM 2J91A 1Z4LA 4NLEA 5EYVA 1FUOA 1T6JA 1YISA 1C3UA 3F4TA 1FURA 1GK2A 1U16A 3RRPA 1XL7A 2RCNA 1Q92A 1W27A 1TJWA 4L6AA 3RD8A 2O7DA 2I7DA 4APBA 2PTSA 1J3UA 3BWVA 1VDKA 3NZ4A 1K7WA 2RJSA 3CRVA 2HVGA 1YFMA 4ADMA 3KDZA 3GZHA 2D28C 4NFLA 3R6VA
chains in the Genus database with same CATH topology
1U15A 4NSLA 3R6QA 2QGAB 3OCFA 4EFCA 3UNVA 4C5RA 4BABA 1EB4A 2PTQA 2PFMA 1AUWA 4MX2A 1FUPA 2O78A 4FLCA 4APAA 4V2QA 3E04A 4ADLA 2O7EA 1T6PA 5F92A 2YIIA 5EYTA 4CQ5A 1GKJA 3R6YA 2O6YA 2X75A 2NYFA 1HY0A 1B8FA 1FUQA 2RJRA 1I0AA 3NO9A 1GK3A 2QVEA 2E9FA 4C5SA 1Y2MA 1TJVA 5D6BA 1JSWA 2FUSA 1GKMA 5HW2A 1XWOA 3OCEA 3GTDA 3KDYA 1K62A 2VD6A 1TJ7A 2NYNA 3BHGA 1YFEA 3QBPA 3TV2A 5F91A 4EEIA 1RE5A 4C5UA 3C8TA 4BAAA 2O7BA 2PTRA 1C3CA 4FFXA 4C6GA 2O7FA 4HGVA 1TJUA 3CZOA 1DCNA 1DOFA 1Q5NA 2OHYA 4V2RA 1HY1A 1KQ7A 2J91A 4NLEA 5EYVA 1FUOA 1T6JA 1YISA 1C3UA 1FURA 1GK2A 1U16A 3RRPA 1W27A 1TJWA 3RD8A 2O7DA 4APBA 2PTSA 1J3UA 1VDKA 3NZ4A 1K7WA 2RJSA 2HVGA 1YFMA 4ADMA 3KDZA 3GZHA 3R6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U15 A;  4NSL A;  3R6Q A;  2QGA B;  3OCF A;  4EFC A;  3UNV A;  4C5R A;  4BAB A;  1EB4 A;  2PTQ A;  2PFM A;  1AUW A;  4MX2 A;  1FUP A;  2O78 A;  4FLC A;  4APA A;  4V2Q A;  3E04 A;  4ADL A;  2O7E A;  1T6P A;  5F92 A;  2YII A;  5EYT A;  4CQ5 A;  1GKJ A;  3R6Y A;  2O6Y A;  2X75 A;  2NYF A;  1HY0 A;  1B8F A;  1FUQ A;  2RJR A;  1I0A A;  3NO9 A;  1GK3 A;  2QVE A;  2E9F A;  4C5S A;  1Y2M A;  1TJV A;  5D6B A;  1JSW A;  2FUS A;  1GKM A;  5HW2 A;  1XWO A;  3OCE A;  3GTD A;  3KDY A;  1K62 A;  2VD6 A;  1TJ7 A;  2NYN A;  3BHG A;  1YFE A;  3QBP A;  3TV2 A;  5F91 A;  4EEI A;  1RE5 A;  4C5U A;  3C8T A;  4BAA A;  2O7B A;  2PTR A;  1C3C A;  4FFX A;  4C6G A;  2O7F A;  4HGV A;  1TJU A;  3CZO A;  1DCN A;  1DOF A;  1Q5N A;  2OHY A;  4V2R A;  1HY1 A;  1KQ7 A;  2J91 A;  4NLE A;  5EYV A;  1FUO A;  1T6J A;  1YIS A;  1C3U A;  1FUR A;  1GK2 A;  1U16 A;  3RRP A;  1W27 A;  1TJW A;  3RD8 A;  2O7D A;  4APB A;  2PTS A;  1J3U A;  1VDK A;  3NZ4 A;  1K7W A;  2RJS A;  2HVG A;  1YFM A;  4ADM A;  3KDZ A;  3GZH A;  3R6V A; 
#chains in the Genus database with same CATH topology
 3CRW 1;  1U15 A;  4NSL A;  3R6Q A;  2QGA B;  3OCF A;  1Z4M A;  4EFC A;  3UNV A;  1XL8 A;  4C5R A;  2YV5 A;  4BAB A;  5M0I A;  1EB4 A;  2PTQ A;  2PFM A;  1AUW A;  4MX2 A;  1FUP A;  4L6C A;  2O78 A;  1Z4Q A;  4FLC A;  1XMD A;  4APA A;  2VSF A;  2JAO A;  4YIK A;  4V2Q A;  3E04 A;  4MUM A;  4ADL A;  2O7E A;  4YIH A;  1T6P A;  1Z4J A;  2D27 A;  5F92 A;  2YII A;  5EYT A;  4CQ5 A;  1GKJ A;  3R6Y A;  4MWO A;  4L57 A;  5H8W A;  2O6Y A;  2X75 A;  3F4S A;  1XMC A;  2NYF A;  1HY0 A;  1B8F A;  1FUQ A;  2RJR A;  3U19 A;  1I0A A;  3NO9 A;  4E88 A;  1GK3 A;  2QVE A;  2E9F A;  4C5S A;  1Y2M A;  1TJV A;  5D6B A;  2JAW A;  4A15 A;  1JSW A;  3F4R A;  2FUS A;  2FEL A;  1GKM A;  5HW2 A;  1XLY A;  1XWO A;  3OCE A;  1Q91 A;  1Z4K A;  3GTD A;  3KDY A;  1K62 A;  2VD6 A;  1TJ7 A;  2NYN A;  3BHG A;  1YFE A;  3QBP A;  3TV2 A;  5M0J A;  4WNL A;  5F91 A;  4EEI A;  1RE5 A;  2JAU A;  1U0L A;  4C5U A;  3CI0 K;  3C8T A;  2VL7 A;  4BAA A;  2FEN A;  2O7B A;  2PTR A;  1C3C A;  4FFX A;  1Z4P X;  2JAR A;  4C6G A;  2O7F A;  1IW7 D;  4HGV A;  1Z4I A;  1TJU A;  3CZO A;  1DCN A;  1DOF A;  1Q5N A;  2OHY A;  1MH9 A;  4V2R A;  3U13 A;  1HY1 A;  1T9H A;  1KQ7 A;  4IQJ M;  2J91 A;  1Z4L A;  4NLE A;  5EYV A;  1FUO A;  1T6J A;  1YIS A;  1C3U A;  3F4T A;  1FUR A;  1GK2 A;  1U16 A;  3RRP A;  1XL7 A;  2RCN A;  1Q92 A;  1W27 A;  1TJW A;  4L6A A;  3RD8 A;  2O7D A;  2I7D A;  4APB A;  2PTS A;  1J3U A;  3BWV A;  1VDK A;  3NZ4 A;  1K7W A;  2RJS A;  3CRV A;  2HVG A;  1YFM A;  4ADM A;  3KDZ A;  3GZH A;  2D28 C;  4NFL A;  3R6V A; 
#chains in the Genus database with same CATH homology
 1U15 A;  4NSL A;  3R6Q A;  2QGA B;  3OCF A;  4EFC A;  3UNV A;  4C5R A;  4BAB A;  1EB4 A;  2PTQ A;  2PFM A;  1AUW A;  4MX2 A;  1FUP A;  2O78 A;  4FLC A;  4APA A;  4V2Q A;  3E04 A;  4ADL A;  2O7E A;  1T6P A;  5F92 A;  2YII A;  5EYT A;  4CQ5 A;  1GKJ A;  3R6Y A;  2O6Y A;  2X75 A;  2NYF A;  1HY0 A;  1B8F A;  1FUQ A;  2RJR A;  1I0A A;  3NO9 A;  1GK3 A;  2QVE A;  2E9F A;  4C5S A;  1Y2M A;  1TJV A;  5D6B A;  1JSW A;  2FUS A;  1GKM A;  5HW2 A;  1XWO A;  3OCE A;  3GTD A;  3KDY A;  1K62 A;  2VD6 A;  1TJ7 A;  2NYN A;  3BHG A;  1YFE A;  3QBP A;  3TV2 A;  5F91 A;  4EEI A;  1RE5 A;  4C5U A;  3C8T A;  4BAA A;  2O7B A;  2PTR A;  1C3C A;  4FFX A;  4C6G A;  2O7F A;  4HGV A;  1TJU A;  3CZO A;  1DCN A;  1DOF A;  1Q5N A;  2OHY A;  4V2R A;  1HY1 A;  1KQ7 A;  2J91 A;  4NLE A;  5EYV A;  1FUO A;  1T6J A;  1YIS A;  1C3U A;  1FUR A;  1GK2 A;  1U16 A;  3RRP A;  1W27 A;  1TJW A;  3RD8 A;  2O7D A;  4APB A;  2PTS A;  1J3U A;  1VDK A;  3NZ4 A;  1K7W A;  2RJS A;  2HVG A;  1YFM A;  4ADM A;  3KDZ A;  3GZH A;  3R6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...