3GTDA

2.4 angstrom crystal structure of fumarate hydratase from rickettsia prowazekii
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
455
structure length
455
Chain Sequence
NYRIESDSFGEIQIEEKFYWGAQTQRSLNNFKISKQKMPKILIRALAILKKCAAQVNYEFGDLEYKIATSIDKAIDRILAGEFEDNFPLVVWQTGSGTQTNMNMNEVIASIANEELTGKKGGKFPVHPNDHVNKGQSSNDSFPTAMHIATVLATKQQLIPALNNLLTYLQDKSKDWDKIIKIGRTHLQDATPLTLKQEFSGYITQIEYALERIEDALKKVYLLAQGGTAVGTGINSKIGFDIKFAQKVAEFTQQPFKTAPNKFESLAAHDALVEFSGTLNTIAVSLMKIANDIRLLGSGPRCGLGELHLPENEPGSSIMPGKVNPTQVEALTMVCTQVMGNHVTVTIAGSNGHLELNVFKPVIIYNILQSIELLSDSVNSFVTHCVKGLEPNIARINTLRDKSLMLVTVLNPHIGYDNAAKIAKEAHKYGITLKEAAKKLNFLSEEEFDKIVVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of fumarate hydratase from Rickettsia prowazekii, the agent of typhus and suspected relative of the mitochondria.
pubmed doi rcsb
source organism Rickettsia prowazekii
molecule tags Lyase
molecule keywords Fumarate hydratase class II
total genus 175
structure length 455
sequence length 455
chains with identical sequence B
ec nomenclature ec 4.2.1.2: Fumarate hydratase.
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF10415 FumaraseC_C Fumarase C C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 3gtdA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 3gtdA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 3gtdA02
1FUPA 1GKJA 5F91A 1T6JA 4NSLA 1DCNA 1YFMA 4APAA 3OCFA 2OHYA 4FFXA 3KDYA 2O78A 1JSWA 3NZ4A 1Q5NA 1HY1A 2PFMA 1FUQA 4EFCA 1K7WA 1AUWA 2NYFA 2PTQA 4C5RA 2PTSA 1TJUA 1U16A 1U15A 2QGAB 2FUSA 1GK3A 1TJ7A 1B8FA 2O7BA 4HGVA 1FURA 4APBA 2E9FA 5F92A 4C5UA 2J91A 2X75A 4NLEA 5D6BA 1RE5A 4FLCA 4EEIA 1W27A 4MX2A 2PTRA 1Y2MA 1GKMA 3CZOA 1C3CA 3GZHA 1I0AA 3BHGA 4BABA 4C5SA 2NYNA 1GK2A 3OCEA 5EYVA 4C6GA 4ADMA 5EYTA 3UNVA 3NO9A 3KDZA 1XWOA 1DOFA 1HY0A 2O7EA 1YFEA 3R6YA 3RD8A 2O6YA 2VD6A 3E04A 2O7DA 3GTDA 3TV2A 2O7FA 2RJRA 2QVEA 2HVGA 4BAAA 2RJSA 1YISA 4CQ5A 1K62A 1TJVA 1TJWA 3QBPA 1FUOA 4ADLA 2YIIA 1EB4A 1C3UA 1T6PA 1VDKA 3R6QA 3RRPA 4V2RA 1J3UA 4V2QA 5HW2A 3R6VA 1KQ7A 3C8TA
chains in the Genus database with same CATH superfamily
1FUPA 2D27A 4MUMA 2VSFA 4YIHA 3F4TA 1GKJA 5F91A 1XMDA 1T6JA 4NSLA 1Z4QA 1DCNA 1YFMA 4YIKA 4APAA 3OCFA 2OHYA 4FFXA 3CRW1 1Q92A 3KDYA 1Z4MA 4WNLA 5M0IA 2O78A 3U13A 4A15A 1XLYA 1JSWA 3NZ4A 1Q5NA 1HY1A 1T9HA 2PFMA 1XL8A 1FUQA 4NFLA 4EFCA 1Z4PX 1K7WA 4L6AA 1AUWA 3F4RA 2D28C 2NYFA 2PTQA 4C5RA 2PTSA 1TJUA 1U16A 1Z4JA 1U15A 2QGAB 2FUSA 1GK3A 2JAUA 1U0LA 1TJ7A 1B8FA 2O7BA 2JAOA 4HGVA 1Z4LA 3U19A 1FURA 4APBA 2E9FA 5F92A 4C5UA 2J91A 2X75A 4NLEA 5D6BA 1RE5A 4E88A 4FLCA 4EEIA 1Z4KA 1W27A 4MX2A 2PTRA 3F4SA 4IQJM 3BWVA 1Y2MA 1IW7D 1GKMA 3CZOA 1C3CA 4MWOA 3GZHA 1I0AA 3BHGA 2YV5A 4BABA 2FELA 4C5SA 2NYNA 1GK2A 1Q91A 3OCEA 5EYVA 4C6GA 4ADMA 5EYTA 3UNVA 3NO9A 2JAWA 3KDZA 1XWOA 1Z4IA 1DOFA 2VL7A 1HY0A 2JARA 1XL7A 2O7EA 1YFEA 3R6YA 4L6CA 2FENA 5M0JA 3RD8A 2O6YA 2VD6A 3CI0K 3E04A 2O7DA 3GTDA 3TV2A 2O7FA 2RJRA 2QVEA 2HVGA 4BAAA 2RJSA 1MH9A 5H8WA 1YISA 4CQ5A 1K62A 1TJVA 2I7DA 1TJWA 1XMCA 2RCNA 3QBPA 1FUOA 3CRVA 4ADLA 2YIIA 1EB4A 1C3UA 1VDKA 1T6PA 3R6QA 3RRPA 4V2RA 1J3UA 4L57A 4V2QA 5HW2A 3R6VA 1KQ7A 3C8TA
chains in the Genus database with same CATH topology
1FUPA 1GKJA 5F91A 1T6JA 4NSLA 1DCNA 1YFMA 4APAA 3OCFA 2OHYA 4FFXA 3KDYA 2O78A 1JSWA 3NZ4A 1Q5NA 1HY1A 2PFMA 1FUQA 4EFCA 1K7WA 1AUWA 2NYFA 2PTQA 4C5RA 2PTSA 1TJUA 1U16A 1U15A 2QGAB 2FUSA 1GK3A 1TJ7A 1B8FA 2O7BA 4HGVA 1FURA 4APBA 2E9FA 5F92A 4C5UA 2J91A 2X75A 4NLEA 5D6BA 1RE5A 4FLCA 4EEIA 1W27A 4MX2A 2PTRA 1Y2MA 1GKMA 3CZOA 1C3CA 3GZHA 1I0AA 3BHGA 4BABA 4C5SA 2NYNA 1GK2A 3OCEA 5EYVA 4C6GA 4ADMA 5EYTA 3UNVA 3NO9A 3KDZA 1XWOA 1DOFA 1HY0A 2O7EA 1YFEA 3R6YA 3RD8A 2O6YA 2VD6A 3E04A 2O7DA 3GTDA 3TV2A 2O7FA 2RJRA 2QVEA 2HVGA 4BAAA 2RJSA 1YISA 4CQ5A 1K62A 1TJVA 1TJWA 3QBPA 1FUOA 4ADLA 2YIIA 1EB4A 1C3UA 1T6PA 1VDKA 3R6QA 3RRPA 4V2RA 1J3UA 4V2QA 5HW2A 3R6VA 1KQ7A 3C8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FUP A;  1GKJ A;  5F91 A;  1T6J A;  4NSL A;  1DCN A;  1YFM A;  4APA A;  3OCF A;  2OHY A;  4FFX A;  3KDY A;  2O78 A;  1JSW A;  3NZ4 A;  1Q5N A;  1HY1 A;  2PFM A;  1FUQ A;  4EFC A;  1K7W A;  1AUW A;  2NYF A;  2PTQ A;  4C5R A;  2PTS A;  1TJU A;  1U16 A;  1U15 A;  2QGA B;  2FUS A;  1GK3 A;  1TJ7 A;  1B8F A;  2O7B A;  4HGV A;  1FUR A;  4APB A;  2E9F A;  5F92 A;  4C5U A;  2J91 A;  2X75 A;  4NLE A;  5D6B A;  1RE5 A;  4FLC A;  4EEI A;  1W27 A;  4MX2 A;  2PTR A;  1Y2M A;  1GKM A;  3CZO A;  1C3C A;  3GZH A;  1I0A A;  3BHG A;  4BAB A;  4C5S A;  2NYN A;  1GK2 A;  3OCE A;  5EYV A;  4C6G A;  4ADM A;  5EYT A;  3UNV A;  3NO9 A;  3KDZ A;  1XWO A;  1DOF A;  1HY0 A;  2O7E A;  1YFE A;  3R6Y A;  3RD8 A;  2O6Y A;  2VD6 A;  3E04 A;  2O7D A;  3GTD A;  3TV2 A;  2O7F A;  2RJR A;  2QVE A;  2HVG A;  4BAA A;  2RJS A;  1YIS A;  4CQ5 A;  1K62 A;  1TJV A;  1TJW A;  3QBP A;  1FUO A;  4ADL A;  2YII A;  1EB4 A;  1C3U A;  1T6P A;  1VDK A;  3R6Q A;  3RRP A;  4V2R A;  1J3U A;  4V2Q A;  5HW2 A;  3R6V A;  1KQ7 A;  3C8T A; 
#chains in the Genus database with same CATH topology
 1FUP A;  2D27 A;  4MUM A;  2VSF A;  4YIH A;  3F4T A;  1GKJ A;  5F91 A;  1XMD A;  1T6J A;  4NSL A;  1Z4Q A;  1DCN A;  1YFM A;  4YIK A;  4APA A;  3OCF A;  2OHY A;  4FFX A;  3CRW 1;  1Q92 A;  3KDY A;  1Z4M A;  4WNL A;  5M0I A;  2O78 A;  3U13 A;  4A15 A;  1XLY A;  1JSW A;  3NZ4 A;  1Q5N A;  1HY1 A;  1T9H A;  2PFM A;  1XL8 A;  1FUQ A;  4NFL A;  4EFC A;  1Z4P X;  1K7W A;  4L6A A;  1AUW A;  3F4R A;  2D28 C;  2NYF A;  2PTQ A;  4C5R A;  2PTS A;  1TJU A;  1U16 A;  1Z4J A;  1U15 A;  2QGA B;  2FUS A;  1GK3 A;  2JAU A;  1U0L A;  1TJ7 A;  1B8F A;  2O7B A;  2JAO A;  4HGV A;  1Z4L A;  3U19 A;  1FUR A;  4APB A;  2E9F A;  5F92 A;  4C5U A;  2J91 A;  2X75 A;  4NLE A;  5D6B A;  1RE5 A;  4E88 A;  4FLC A;  4EEI A;  1Z4K A;  1W27 A;  4MX2 A;  2PTR A;  3F4S A;  4IQJ M;  3BWV A;  1Y2M A;  1IW7 D;  1GKM A;  3CZO A;  1C3C A;  4MWO A;  3GZH A;  1I0A A;  3BHG A;  2YV5 A;  4BAB A;  2FEL A;  4C5S A;  2NYN A;  1GK2 A;  1Q91 A;  3OCE A;  5EYV A;  4C6G A;  4ADM A;  5EYT A;  3UNV A;  3NO9 A;  2JAW A;  3KDZ A;  1XWO A;  1Z4I A;  1DOF A;  2VL7 A;  1HY0 A;  2JAR A;  1XL7 A;  2O7E A;  1YFE A;  3R6Y A;  4L6C A;  2FEN A;  5M0J A;  3RD8 A;  2O6Y A;  2VD6 A;  3CI0 K;  3E04 A;  2O7D A;  3GTD A;  3TV2 A;  2O7F A;  2RJR A;  2QVE A;  2HVG A;  4BAA A;  2RJS A;  1MH9 A;  5H8W A;  1YIS A;  4CQ5 A;  1K62 A;  1TJV A;  2I7D A;  1TJW A;  1XMC A;  2RCN A;  3QBP A;  1FUO A;  3CRV A;  4ADL A;  2YII A;  1EB4 A;  1C3U A;  1VDK A;  1T6P A;  3R6Q A;  3RRP A;  4V2R A;  1J3U A;  4L57 A;  4V2Q A;  5HW2 A;  3R6V A;  1KQ7 A;  3C8T A; 
#chains in the Genus database with same CATH homology
 1FUP A;  1GKJ A;  5F91 A;  1T6J A;  4NSL A;  1DCN A;  1YFM A;  4APA A;  3OCF A;  2OHY A;  4FFX A;  3KDY A;  2O78 A;  1JSW A;  3NZ4 A;  1Q5N A;  1HY1 A;  2PFM A;  1FUQ A;  4EFC A;  1K7W A;  1AUW A;  2NYF A;  2PTQ A;  4C5R A;  2PTS A;  1TJU A;  1U16 A;  1U15 A;  2QGA B;  2FUS A;  1GK3 A;  1TJ7 A;  1B8F A;  2O7B A;  4HGV A;  1FUR A;  4APB A;  2E9F A;  5F92 A;  4C5U A;  2J91 A;  2X75 A;  4NLE A;  5D6B A;  1RE5 A;  4FLC A;  4EEI A;  1W27 A;  4MX2 A;  2PTR A;  1Y2M A;  1GKM A;  3CZO A;  1C3C A;  3GZH A;  1I0A A;  3BHG A;  4BAB A;  4C5S A;  2NYN A;  1GK2 A;  3OCE A;  5EYV A;  4C6G A;  4ADM A;  5EYT A;  3UNV A;  3NO9 A;  3KDZ A;  1XWO A;  1DOF A;  1HY0 A;  2O7E A;  1YFE A;  3R6Y A;  3RD8 A;  2O6Y A;  2VD6 A;  3E04 A;  2O7D A;  3GTD A;  3TV2 A;  2O7F A;  2RJR A;  2QVE A;  2HVG A;  4BAA A;  2RJS A;  1YIS A;  4CQ5 A;  1K62 A;  1TJV A;  1TJW A;  3QBP A;  1FUO A;  4ADL A;  2YII A;  1EB4 A;  1C3U A;  1T6P A;  1VDK A;  3R6Q A;  3RRP A;  4V2R A;  1J3U A;  4V2Q A;  5HW2 A;  3R6V A;  1KQ7 A;  3C8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...