3GTDA

2.4 angstrom crystal structure of fumarate hydratase from rickettsia prowazekii
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
455
structure length
455
Chain Sequence
NYRIESDSFGEIQIEEKFYWGAQTQRSLNNFKISKQKMPKILIRALAILKKCAAQVNYEFGDLEYKIATSIDKAIDRILAGEFEDNFPLVVWQTGSGTQTNMNMNEVIASIANEELTGKKGGKFPVHPNDHVNKGQSSNDSFPTAMHIATVLATKQQLIPALNNLLTYLQDKSKDWDKIIKIGRTHLQDATPLTLKQEFSGYITQIEYALERIEDALKKVYLLAQGGTAVGTGINSKIGFDIKFAQKVAEFTQQPFKTAPNKFESLAAHDALVEFSGTLNTIAVSLMKIANDIRLLGSGPRCGLGELHLPENEPGSSIMPGKVNPTQVEALTMVCTQVMGNHVTVTIAGSNGHLELNVFKPVIIYNILQSIELLSDSVNSFVTHCVKGLEPNIARINTLRDKSLMLVTVLNPHIGYDNAAKIAKEAHKYGITLKEAAKKLNFLSEEEFDKIVVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fumarate hydratase class II
publication title Structure of fumarate hydratase from Rickettsia prowazekii, the agent of typhus and suspected relative of the mitochondria.
pubmed doi rcsb
source organism Rickettsia prowazekii
molecule tags Lyase
total genus 175
structure length 455
sequence length 455
chains with identical sequence B
ec nomenclature ec 4.2.1.2: Fumarate hydratase.
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF10415 FumaraseC_C Fumarase C C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 3gtdA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 3gtdA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 3gtdA02
4BAAA 4NLEA 3R6VA 1DOFA 4CQ5A 5D6BA 3CZOA 1FUQA 4C5UA 3RRPA 4BABA 2FUSA 1FURA 1FUOA 3NO9A 2O7DA 1TJUA 3QBPA 2OHYA 2E9FA 3R6YA 1YFEA 2PTSA 3OCEA 4C5RA 1Q5NA 2O7EA 2YIIA 1EB4A 4NSLA 3GTDA 3KDZA 1KQ7A 1AUWA 1TJ7A 2PTRA 2O78A 1K7WA 5F92A 2RJSA 1XWOA 5EYTA 1T6JA 1HY1A 1VDKA 4EFCA 4MX2A 1TJVA 4HGVA 4C5SA 1C3CA 1TJWA 2RJRA 3OCFA 1JSWA 1YFMA 5EYVA 1J3UA 4V2QA 3NZ4A 1GKJA 2VD6A 1Y2MA 3TV2A 4V2RA 5HW2A 1RE5A 1U15A 4APBA 4EEIA 1GK3A 2HVGA 3BHGA 3KDYA 2O7FA 2O6YA 4FFXA 1T6PA 3RD8A 4ADMA 2QVEA 1W27A 4APAA 3R6QA 2NYNA 1GK2A 3E04A 5F91A 3C8TA 2QGAB 1K62A 3GZHA 1B8FA 2PFMA 1FUPA 1I0AA 1GKMA 4ADLA 4FLCA 1C3UA 4C6GA 1YISA 2NYFA 1U16A 2O7BA 1DCNA 3UNVA 2PTQA 2X75A 2J91A 1HY0A
chains in the Genus database with same CATH superfamily
4BAAA 1Z4IA 4L57A 4NLEA 3R6VA 1DOFA 4CQ5A 5D6BA 3F4SA 3CZOA 1FUQA 2FELA 4C5UA 3RRPA 4BABA 2FUSA 1FURA 1FUOA 3NO9A 4NFLA 2O7DA 2D28C 1XLYA 1Z4LA 1TJUA 3QBPA 2OHYA 1MH9A 5H8WA 4WNLA 2E9FA 3R6YA 1YFEA 2PTSA 3OCEA 4C5RA 2VL7A 1Q5NA 2O7EA 2YIIA 1Z4JA 1EB4A 4NSLA 2RCNA 3GTDA 3KDZA 1KQ7A 1AUWA 2JAWA 1TJ7A 2PTRA 2O78A 1K7WA 5F92A 1XMCA 2RJSA 1XWOA 5EYTA 3U13A 1T6JA 1HY1A 1VDKA 4EFCA 4MX2A 1TJVA 4HGVA 4C5SA 1C3CA 1TJWA 4YIKA 2RJRA 2D27A 1Z4MA 3OCFA 4L6AA 3CRW1 1JSWA 1YFMA 5EYVA 1J3UA 4E88A 3F4RA 4V2QA 1Q92A 4YIHA 3NZ4A 1GKJA 2VD6A 1Y2MA 3TV2A 4V2RA 5HW2A 1RE5A 2I7DA 1XL8A 1IW7D 1XL7A 4IQJM 1XMDA 1U15A 4APBA 4EEIA 1GK3A 1Z4KA 1Q91A 2HVGA 3BHGA 2O7FA 2O6YA 3KDYA 4FFXA 1T6PA 3RD8A 2JAUA 4ADMA 2QVEA 1W27A 4APAA 4L6CA 3R6QA 2JAOA 2NYNA 3CI0K 1GK2A 3E04A 1Z4PX 1T9HA 3C8TA 5F91A 2QGAB 4MWOA 3CRVA 2VSFA 1K62A 1U0LA 3GZHA 4A15A 1B8FA 1Z4QA 2PFMA 1FUPA 3BWVA 3F4TA 2FENA 2JARA 1I0AA 1GKMA 4ADLA 5M0JA 4FLCA 3U19A 1C3UA 4C6GA 2YV5A 1YISA 2NYFA 1U16A 2O7BA 1DCNA 3UNVA 2PTQA 2X75A 2J91A 1HY0A 5M0IA 4MUMA
chains in the Genus database with same CATH topology
4BAAA 4NLEA 3R6VA 1DOFA 4CQ5A 5D6BA 3CZOA 1FUQA 4C5UA 3RRPA 4BABA 2FUSA 1FURA 1FUOA 3NO9A 2O7DA 1TJUA 3QBPA 2OHYA 2E9FA 3R6YA 1YFEA 2PTSA 3OCEA 4C5RA 1Q5NA 2O7EA 2YIIA 1EB4A 4NSLA 3GTDA 3KDZA 1KQ7A 1AUWA 1TJ7A 2PTRA 2O78A 1K7WA 5F92A 2RJSA 1XWOA 5EYTA 1T6JA 1HY1A 1VDKA 4EFCA 4MX2A 1TJVA 4HGVA 4C5SA 1C3CA 1TJWA 2RJRA 3OCFA 1JSWA 1YFMA 5EYVA 1J3UA 4V2QA 3NZ4A 1GKJA 2VD6A 1Y2MA 3TV2A 4V2RA 5HW2A 1RE5A 1U15A 4APBA 4EEIA 1GK3A 2HVGA 3BHGA 3KDYA 2O7FA 2O6YA 4FFXA 1T6PA 3RD8A 4ADMA 2QVEA 1W27A 4APAA 3R6QA 2NYNA 1GK2A 3E04A 5F91A 3C8TA 2QGAB 1K62A 3GZHA 1B8FA 2PFMA 1FUPA 1I0AA 1GKMA 4ADLA 4FLCA 1C3UA 4C6GA 1YISA 2NYFA 1U16A 2O7BA 1DCNA 3UNVA 2PTQA 2X75A 2J91A 1HY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BAA A;  4NLE A;  3R6V A;  1DOF A;  4CQ5 A;  5D6B A;  3CZO A;  1FUQ A;  4C5U A;  3RRP A;  4BAB A;  2FUS A;  1FUR A;  1FUO A;  3NO9 A;  2O7D A;  1TJU A;  3QBP A;  2OHY A;  2E9F A;  3R6Y A;  1YFE A;  2PTS A;  3OCE A;  4C5R A;  1Q5N A;  2O7E A;  2YII A;  1EB4 A;  4NSL A;  3GTD A;  3KDZ A;  1KQ7 A;  1AUW A;  1TJ7 A;  2PTR A;  2O78 A;  1K7W A;  5F92 A;  2RJS A;  1XWO A;  5EYT A;  1T6J A;  1HY1 A;  1VDK A;  4EFC A;  4MX2 A;  1TJV A;  4HGV A;  4C5S A;  1C3C A;  1TJW A;  2RJR A;  3OCF A;  1JSW A;  1YFM A;  5EYV A;  1J3U A;  4V2Q A;  3NZ4 A;  1GKJ A;  2VD6 A;  1Y2M A;  3TV2 A;  4V2R A;  5HW2 A;  1RE5 A;  1U15 A;  4APB A;  4EEI A;  1GK3 A;  2HVG A;  3BHG A;  3KDY A;  2O7F A;  2O6Y A;  4FFX A;  1T6P A;  3RD8 A;  4ADM A;  2QVE A;  1W27 A;  4APA A;  3R6Q A;  2NYN A;  1GK2 A;  3E04 A;  5F91 A;  3C8T A;  2QGA B;  1K62 A;  3GZH A;  1B8F A;  2PFM A;  1FUP A;  1I0A A;  1GKM A;  4ADL A;  4FLC A;  1C3U A;  4C6G A;  1YIS A;  2NYF A;  1U16 A;  2O7B A;  1DCN A;  3UNV A;  2PTQ A;  2X75 A;  2J91 A;  1HY0 A; 
#chains in the Genus database with same CATH topology
 4BAA A;  1Z4I A;  4L57 A;  4NLE A;  3R6V A;  1DOF A;  4CQ5 A;  5D6B A;  3F4S A;  3CZO A;  1FUQ A;  2FEL A;  4C5U A;  3RRP A;  4BAB A;  2FUS A;  1FUR A;  1FUO A;  3NO9 A;  4NFL A;  2O7D A;  2D28 C;  1XLY A;  1Z4L A;  1TJU A;  3QBP A;  2OHY A;  1MH9 A;  5H8W A;  4WNL A;  2E9F A;  3R6Y A;  1YFE A;  2PTS A;  3OCE A;  4C5R A;  2VL7 A;  1Q5N A;  2O7E A;  2YII A;  1Z4J A;  1EB4 A;  4NSL A;  2RCN A;  3GTD A;  3KDZ A;  1KQ7 A;  1AUW A;  2JAW A;  1TJ7 A;  2PTR A;  2O78 A;  1K7W A;  5F92 A;  1XMC A;  2RJS A;  1XWO A;  5EYT A;  3U13 A;  1T6J A;  1HY1 A;  1VDK A;  4EFC A;  4MX2 A;  1TJV A;  4HGV A;  4C5S A;  1C3C A;  1TJW A;  4YIK A;  2RJR A;  2D27 A;  1Z4M A;  3OCF A;  4L6A A;  3CRW 1;  1JSW A;  1YFM A;  5EYV A;  1J3U A;  4E88 A;  3F4R A;  4V2Q A;  1Q92 A;  4YIH A;  3NZ4 A;  1GKJ A;  2VD6 A;  1Y2M A;  3TV2 A;  4V2R A;  5HW2 A;  1RE5 A;  2I7D A;  1XL8 A;  1IW7 D;  1XL7 A;  4IQJ M;  1XMD A;  1U15 A;  4APB A;  4EEI A;  1GK3 A;  1Z4K A;  1Q91 A;  2HVG A;  3BHG A;  2O7F A;  2O6Y A;  3KDY A;  4FFX A;  1T6P A;  3RD8 A;  2JAU A;  4ADM A;  2QVE A;  1W27 A;  4APA A;  4L6C A;  3R6Q A;  2JAO A;  2NYN A;  3CI0 K;  1GK2 A;  3E04 A;  1Z4P X;  1T9H A;  3C8T A;  5F91 A;  2QGA B;  4MWO A;  3CRV A;  2VSF A;  1K62 A;  1U0L A;  3GZH A;  4A15 A;  1B8F A;  1Z4Q A;  2PFM A;  1FUP A;  3BWV A;  3F4T A;  2FEN A;  2JAR A;  1I0A A;  1GKM A;  4ADL A;  5M0J A;  4FLC A;  3U19 A;  1C3U A;  4C6G A;  2YV5 A;  1YIS A;  2NYF A;  1U16 A;  2O7B A;  1DCN A;  3UNV A;  2PTQ A;  2X75 A;  2J91 A;  1HY0 A;  5M0I A;  4MUM A; 
#chains in the Genus database with same CATH homology
 4BAA A;  4NLE A;  3R6V A;  1DOF A;  4CQ5 A;  5D6B A;  3CZO A;  1FUQ A;  4C5U A;  3RRP A;  4BAB A;  2FUS A;  1FUR A;  1FUO A;  3NO9 A;  2O7D A;  1TJU A;  3QBP A;  2OHY A;  2E9F A;  3R6Y A;  1YFE A;  2PTS A;  3OCE A;  4C5R A;  1Q5N A;  2O7E A;  2YII A;  1EB4 A;  4NSL A;  3GTD A;  3KDZ A;  1KQ7 A;  1AUW A;  1TJ7 A;  2PTR A;  2O78 A;  1K7W A;  5F92 A;  2RJS A;  1XWO A;  5EYT A;  1T6J A;  1HY1 A;  1VDK A;  4EFC A;  4MX2 A;  1TJV A;  4HGV A;  4C5S A;  1C3C A;  1TJW A;  2RJR A;  3OCF A;  1JSW A;  1YFM A;  5EYV A;  1J3U A;  4V2Q A;  3NZ4 A;  1GKJ A;  2VD6 A;  1Y2M A;  3TV2 A;  4V2R A;  5HW2 A;  1RE5 A;  1U15 A;  4APB A;  4EEI A;  1GK3 A;  2HVG A;  3BHG A;  3KDY A;  2O7F A;  2O6Y A;  4FFX A;  1T6P A;  3RD8 A;  4ADM A;  2QVE A;  1W27 A;  4APA A;  3R6Q A;  2NYN A;  1GK2 A;  3E04 A;  5F91 A;  3C8T A;  2QGA B;  1K62 A;  3GZH A;  1B8F A;  2PFM A;  1FUP A;  1I0A A;  1GKM A;  4ADL A;  4FLC A;  1C3U A;  4C6G A;  1YIS A;  2NYF A;  1U16 A;  2O7B A;  1DCN A;  3UNV A;  2PTQ A;  2X75 A;  2J91 A;  1HY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...