1TJVA

Crystal structure of t161d duck delta 2 crystallin mutant
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
449
structure length
449
Chain Sequence
TDPIMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLEKISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQLIKTLVERAAIEIDVILPGYDHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNPLDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFSTGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALTPEMLATDLALYLVRKGVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSISPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRELMKKQKEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Delta crystallin II
publication title Structural studies of duck delta2 crystallin mutants provide insight into the role of Thr161 and the 280s loop in catalysis
pubmed doi rcsb
source organism Anas platyrhynchos
molecule tags Lyase
total genus 184
structure length 449
sequence length 449
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.1: Argininosuccinate lyase.
pdb deposition date 2004-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF14698 ASL_C2 Argininosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 1tjvA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 1tjvA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 1tjvA02
1TJWA 4C6GA 2RJSA 2NYNA 1T6JA 1YISA 1FUQA 1Y2MA 1GKJA 1KQ7A 4APAA 3R6QA 1T6PA 1U16A 1DCNA 3E04A 1HY1A 1YFMA 4MX2A 1GKMA 5EYTA 5F92A 3R6VA 3TV2A 1J3UA 3GTDA 1K62A 2HVGA 1C3UA 1JSWA 2OHYA 2QGAB 4V2RA 1RE5A 2PFMA 2O6YA 1TJVA 4ADLA 1W27A 1K7WA 3CZOA 4V2QA 2QVEA 2FUSA 2E9FA 3KDZA 2VD6A 1FURA 2O7EA 4NSLA 2NYFA 2YIIA 5F91A 3NZ4A 4BABA 2O7BA 4ADMA 1Q5NA 1GK3A 1HY0A 4HGVA 3OCEA 1B8FA 4CQ5A 3R6YA 3RRPA 3GZHA 3KDYA 1FUOA 5D6BA 3OCFA 2X75A 1AUWA 4BAAA 2O78A 1C3CA 4C5SA 2PTRA 4EEIA 5HW2A 1DOFA 4APBA 2J91A 1FUPA 1I0AA 4FFXA 1EB4A 3BHGA 1YFEA 2RJRA 1U15A 2PTSA 1TJUA 4NLEA 3UNVA 4C5RA 2O7FA 1GK2A 2O7DA 4FLCA 1VDKA 5EYVA 3QBPA 3RD8A 1TJ7A 3NO9A 4EFCA 2PTQA 1XWOA 4C5UA 3C8TA
chains in the Genus database with same CATH superfamily
1TJWA 4YIHA 2RCNA 4C6GA 2RJSA 1Z4MA 2NYNA 1T6JA 3U19A 3CRW1 1YISA 1FUQA 4A15A 3BWVA 4L57A 1Y2MA 1GKJA 1KQ7A 4APAA 3R6QA 1T6PA 1IW7D 1U16A 1DCNA 3E04A 2VSFA 1HY1A 2FELA 1YFMA 2D28C 4MX2A 4WNLA 1GKMA 5EYTA 2FENA 5F92A 3R6VA 1Q91A 3TV2A 1Z4PX 1XL8A 3CI0K 1J3UA 1Z4IA 2JAUA 3GTDA 1K62A 2HVGA 5H8WA 1C3UA 1JSWA 1XMCA 2OHYA 2QGAB 4V2RA 5M0IA 1RE5A 2PFMA 2O6YA 1TJVA 1U0LA 1Z4KA 4ADLA 1W27A 1K7WA 2I7DA 4E88A 2JAWA 3CZOA 4V2QA 2QVEA 2FUSA 3F4SA 2E9FA 4YIKA 3KDZA 1XLYA 2VD6A 1FURA 2O7EA 4NSLA 2NYFA 2JARA 2YIIA 5F91A 3NZ4A 4BABA 2O7BA 1Z4QA 4ADMA 1Q5NA 1GK3A 1HY0A 4HGVA 3OCEA 1B8FA 4CQ5A 3R6YA 5M0JA 4IQJM 3RRPA 3F4RA 3GZHA 3KDYA 1FUOA 5D6BA 2JAOA 3OCFA 2X75A 1AUWA 4BAAA 1XL7A 2O78A 2YV5A 1Z4LA 1C3CA 4NFLA 4C5SA 2PTRA 4EEIA 2D27A 1Q92A 5HW2A 1DOFA 4APBA 2J91A 1FUPA 3CRVA 1I0AA 4FFXA 2VL7A 1EB4A 4L6CA 3BHGA 1YFEA 3U13A 2RJRA 1U15A 2PTSA 1TJUA 4NLEA 3UNVA 4C5RA 3F4TA 1GK2A 2O7FA 2O7DA 1T9HA 1VDKA 4FLCA 1XMDA 5EYVA 4L6AA 3QBPA 3RD8A 4MWOA 1TJ7A 3NO9A 1MH9A 4MUMA 4EFCA 2PTQA 1XWOA 4C5UA 1Z4JA 3C8TA
chains in the Genus database with same CATH topology
1TJWA 4C6GA 2RJSA 2NYNA 1T6JA 1YISA 1FUQA 1Y2MA 1GKJA 1KQ7A 4APAA 3R6QA 1T6PA 1U16A 1DCNA 3E04A 1HY1A 1YFMA 4MX2A 1GKMA 5EYTA 5F92A 3R6VA 3TV2A 1J3UA 3GTDA 1K62A 2HVGA 1C3UA 1JSWA 2OHYA 2QGAB 4V2RA 1RE5A 2PFMA 2O6YA 1TJVA 4ADLA 1W27A 1K7WA 3CZOA 4V2QA 2QVEA 2FUSA 2E9FA 3KDZA 2VD6A 1FURA 2O7EA 4NSLA 2NYFA 2YIIA 5F91A 3NZ4A 4BABA 2O7BA 4ADMA 1Q5NA 1GK3A 1HY0A 4HGVA 3OCEA 1B8FA 4CQ5A 3R6YA 3RRPA 3GZHA 3KDYA 1FUOA 5D6BA 3OCFA 2X75A 1AUWA 4BAAA 2O78A 1C3CA 4C5SA 2PTRA 4EEIA 5HW2A 1DOFA 4APBA 2J91A 1FUPA 1I0AA 4FFXA 1EB4A 3BHGA 1YFEA 2RJRA 1U15A 2PTSA 1TJUA 4NLEA 3UNVA 4C5RA 2O7FA 1GK2A 2O7DA 4FLCA 1VDKA 5EYVA 3QBPA 3RD8A 1TJ7A 3NO9A 4EFCA 2PTQA 1XWOA 4C5UA 3C8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TJW A;  4C6G A;  2RJS A;  2NYN A;  1T6J A;  1YIS A;  1FUQ A;  1Y2M A;  1GKJ A;  1KQ7 A;  4APA A;  3R6Q A;  1T6P A;  1U16 A;  1DCN A;  3E04 A;  1HY1 A;  1YFM A;  4MX2 A;  1GKM A;  5EYT A;  5F92 A;  3R6V A;  3TV2 A;  1J3U A;  3GTD A;  1K62 A;  2HVG A;  1C3U A;  1JSW A;  2OHY A;  2QGA B;  4V2R A;  1RE5 A;  2PFM A;  2O6Y A;  1TJV A;  4ADL A;  1W27 A;  1K7W A;  3CZO A;  4V2Q A;  2QVE A;  2FUS A;  2E9F A;  3KDZ A;  2VD6 A;  1FUR A;  2O7E A;  4NSL A;  2NYF A;  2YII A;  5F91 A;  3NZ4 A;  4BAB A;  2O7B A;  4ADM A;  1Q5N A;  1GK3 A;  1HY0 A;  4HGV A;  3OCE A;  1B8F A;  4CQ5 A;  3R6Y A;  3RRP A;  3GZH A;  3KDY A;  1FUO A;  5D6B A;  3OCF A;  2X75 A;  1AUW A;  4BAA A;  2O78 A;  1C3C A;  4C5S A;  2PTR A;  4EEI A;  5HW2 A;  1DOF A;  4APB A;  2J91 A;  1FUP A;  1I0A A;  4FFX A;  1EB4 A;  3BHG A;  1YFE A;  2RJR A;  1U15 A;  2PTS A;  1TJU A;  4NLE A;  3UNV A;  4C5R A;  2O7F A;  1GK2 A;  2O7D A;  4FLC A;  1VDK A;  5EYV A;  3QBP A;  3RD8 A;  1TJ7 A;  3NO9 A;  4EFC A;  2PTQ A;  1XWO A;  4C5U A;  3C8T A; 
#chains in the Genus database with same CATH topology
 1TJW A;  4YIH A;  2RCN A;  4C6G A;  2RJS A;  1Z4M A;  2NYN A;  1T6J A;  3U19 A;  3CRW 1;  1YIS A;  1FUQ A;  4A15 A;  3BWV A;  4L57 A;  1Y2M A;  1GKJ A;  1KQ7 A;  4APA A;  3R6Q A;  1T6P A;  1IW7 D;  1U16 A;  1DCN A;  3E04 A;  2VSF A;  1HY1 A;  2FEL A;  1YFM A;  2D28 C;  4MX2 A;  4WNL A;  1GKM A;  5EYT A;  2FEN A;  5F92 A;  3R6V A;  1Q91 A;  3TV2 A;  1Z4P X;  1XL8 A;  3CI0 K;  1J3U A;  1Z4I A;  2JAU A;  3GTD A;  1K62 A;  2HVG A;  5H8W A;  1C3U A;  1JSW A;  1XMC A;  2OHY A;  2QGA B;  4V2R A;  5M0I A;  1RE5 A;  2PFM A;  2O6Y A;  1TJV A;  1U0L A;  1Z4K A;  4ADL A;  1W27 A;  1K7W A;  2I7D A;  4E88 A;  2JAW A;  3CZO A;  4V2Q A;  2QVE A;  2FUS A;  3F4S A;  2E9F A;  4YIK A;  3KDZ A;  1XLY A;  2VD6 A;  1FUR A;  2O7E A;  4NSL A;  2NYF A;  2JAR A;  2YII A;  5F91 A;  3NZ4 A;  4BAB A;  2O7B A;  1Z4Q A;  4ADM A;  1Q5N A;  1GK3 A;  1HY0 A;  4HGV A;  3OCE A;  1B8F A;  4CQ5 A;  3R6Y A;  5M0J A;  4IQJ M;  3RRP A;  3F4R A;  3GZH A;  3KDY A;  1FUO A;  5D6B A;  2JAO A;  3OCF A;  2X75 A;  1AUW A;  4BAA A;  1XL7 A;  2O78 A;  2YV5 A;  1Z4L A;  1C3C A;  4NFL A;  4C5S A;  2PTR A;  4EEI A;  2D27 A;  1Q92 A;  5HW2 A;  1DOF A;  4APB A;  2J91 A;  1FUP A;  3CRV A;  1I0A A;  4FFX A;  2VL7 A;  1EB4 A;  4L6C A;  3BHG A;  1YFE A;  3U13 A;  2RJR A;  1U15 A;  2PTS A;  1TJU A;  4NLE A;  3UNV A;  4C5R A;  3F4T A;  1GK2 A;  2O7F A;  2O7D A;  1T9H A;  1VDK A;  4FLC A;  1XMD A;  5EYV A;  4L6A A;  3QBP A;  3RD8 A;  4MWO A;  1TJ7 A;  3NO9 A;  1MH9 A;  4MUM A;  4EFC A;  2PTQ A;  1XWO A;  4C5U A;  1Z4J A;  3C8T A; 
#chains in the Genus database with same CATH homology
 1TJW A;  4C6G A;  2RJS A;  2NYN A;  1T6J A;  1YIS A;  1FUQ A;  1Y2M A;  1GKJ A;  1KQ7 A;  4APA A;  3R6Q A;  1T6P A;  1U16 A;  1DCN A;  3E04 A;  1HY1 A;  1YFM A;  4MX2 A;  1GKM A;  5EYT A;  5F92 A;  3R6V A;  3TV2 A;  1J3U A;  3GTD A;  1K62 A;  2HVG A;  1C3U A;  1JSW A;  2OHY A;  2QGA B;  4V2R A;  1RE5 A;  2PFM A;  2O6Y A;  1TJV A;  4ADL A;  1W27 A;  1K7W A;  3CZO A;  4V2Q A;  2QVE A;  2FUS A;  2E9F A;  3KDZ A;  2VD6 A;  1FUR A;  2O7E A;  4NSL A;  2NYF A;  2YII A;  5F91 A;  3NZ4 A;  4BAB A;  2O7B A;  4ADM A;  1Q5N A;  1GK3 A;  1HY0 A;  4HGV A;  3OCE A;  1B8F A;  4CQ5 A;  3R6Y A;  3RRP A;  3GZH A;  3KDY A;  1FUO A;  5D6B A;  3OCF A;  2X75 A;  1AUW A;  4BAA A;  2O78 A;  1C3C A;  4C5S A;  2PTR A;  4EEI A;  5HW2 A;  1DOF A;  4APB A;  2J91 A;  1FUP A;  1I0A A;  4FFX A;  1EB4 A;  3BHG A;  1YFE A;  2RJR A;  1U15 A;  2PTS A;  1TJU A;  4NLE A;  3UNV A;  4C5R A;  2O7F A;  1GK2 A;  2O7D A;  4FLC A;  1VDK A;  5EYV A;  3QBP A;  3RD8 A;  1TJ7 A;  3NO9 A;  4EFC A;  2PTQ A;  1XWO A;  4C5U A;  3C8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...