1TJVA

Crystal structure of t161d duck delta 2 crystallin mutant
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
449
structure length
449
Chain Sequence
b'TDPIMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLEKISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQLIKTLVERAAIEIDVILPGYDHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNPLDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFSTGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALTPEMLATDLALYLVRKGVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSISPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRELMKKQKEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Delta crystallin II
publication title Structural studies of duck delta2 crystallin mutants provide insight into the role of Thr161 and the 280s loop in catalysis
pubmed doi rcsb
source organism Anas platyrhynchos
molecule tags Lyase
total genus 184
structure length 449
sequence length 449
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.1: Argininosuccinate lyase.
pdb deposition date 2004-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF14698 ASL_C2 Argininosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 1tjvA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 1tjvA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 1tjvA02
2O78A 3R6YA 3RRPA 1EB4A 2PTQA 3R6VA 1DCNA 2QGAB 3E04A 4NSLA 2O7FA 2QVEA 1K62A 2PTSA 1HY0A 2NYNA 2VD6A 1AUWA 4NLEA 2O7DA 4C5RA 4ADLA 4MX2A 4ADMA 1DOFA 1T6PA 1GK2A 2PFMA 4HGVA 3UNVA 5F91A 4APBA 3OCEA 3OCFA 2O6YA 2OHYA 3NO9A 2RJSA 1YFMA 5D6BA 1TJWA 1I0AA 3KDZA 1GKJA 1JSWA 1Q5NA 2NYFA 1RE5A 3QBPA 4V2RA 3C8TA 4EFCA 2E9FA 2J91A 1U16A 1VDKA 4C5SA 2RJRA 1U15A 1T6JA 3NZ4A 1YFEA 2HVGA 1HY1A 1FURA 5F92A 2X75A 4FLCA 1C3UA 5EYTA 1XWOA 4C5UA 1GK3A 1W27A 4BAAA 1C3CA 1TJ7A 1FUPA 1B8FA 4V2QA 3BHGA 1YISA 1J3UA 3RD8A 1TJUA 4FFXA 2PTRA 5EYVA 2O7BA 3KDYA 4APAA 1FUOA 2FUSA 2O7EA 3GZHA 1TJVA 1KQ7A 1Y2MA 3R6QA 2YIIA 1K7WA 1FUQA 4C6GA 5HW2A 4BABA 4EEIA 3GTDA 3TV2A 4CQ5A 3CZOA 1GKMA
chains in the Genus database with same CATH superfamily
2O78A 2D27A 1IW7D 4YIKA 2JAUA 3RRPA 3R6YA 1Z4JA 1EB4A 2PTQA 3R6VA 1DCNA 2JARA 2QGAB 1MH9A 3E04A 4NSLA 3F4TA 2O7FA 2QVEA 1K62A 2PTSA 1HY0A 1Z4LA 2NYNA 4A15A 4L6AA 2VD6A 1AUWA 4NLEA 2O7DA 4C5RA 4ADLA 4MUMA 4MX2A 4ADMA 1DOFA 1XL8A 3BWVA 1T6PA 2PFMA 4HGVA 3U13A 1GK2A 3UNVA 5F91A 4APBA 3OCEA 3OCFA 2O6YA 1XMDA 3CI0K 2OHYA 3NO9A 3CRW1 2RJSA 1YFMA 5D6BA 4L6CA 2VSFA 2FENA 1TJWA 4E88A 1I0AA 3KDZA 1GKJA 1JSWA 2VL7A 1Z4KA 1Q5NA 2NYFA 1RE5A 3QBPA 2I7DA 4V2RA 3C8TA 4EFCA 2E9FA 2J91A 1U16A 1XLYA 1VDKA 4C5SA 2RJRA 5H8WA 1U15A 2JAWA 1T6JA 3NZ4A 1YFEA 2HVGA 1HY1A 1FURA 2RCNA 5F92A 2X75A 3F4SA 4FLCA 1C3UA 1Z4MA 5EYTA 1XWOA 4C5UA 1GK3A 1W27A 4BAAA 4YIHA 1C3CA 4MWOA 1TJ7A 3CRVA 1FUPA 4IQJM 1B8FA 1Z4IA 1Q92A 1U0LA 4V2QA 1Q91A 3BHGA 1YISA 5M0IA 1XL7A 1J3UA 3RD8A 1TJUA 4FFXA 2PTRA 2FELA 1T9HA 5EYVA 1XMCA 2O7BA 3KDYA 1Z4QA 4APAA 1FUOA 2FUSA 2O7EA 3GZHA 3U19A 1TJVA 1KQ7A 1Y2MA 3R6QA 4NFLA 3F4RA 2YV5A 2JAOA 5M0JA 2YIIA 1K7WA 4L57A 1FUQA 4C6GA 5HW2A 4BABA 4EEIA 3GTDA 3TV2A 4CQ5A 2D28C 1Z4PX 3CZOA 4WNLA 1GKMA
chains in the Genus database with same CATH topology
2O78A 3R6YA 3RRPA 1EB4A 2PTQA 3R6VA 1DCNA 2QGAB 3E04A 4NSLA 2O7FA 2QVEA 1K62A 2PTSA 1HY0A 2NYNA 2VD6A 1AUWA 4NLEA 2O7DA 4C5RA 4ADLA 4MX2A 4ADMA 1DOFA 1T6PA 1GK2A 2PFMA 4HGVA 3UNVA 5F91A 4APBA 3OCEA 3OCFA 2O6YA 2OHYA 3NO9A 2RJSA 1YFMA 5D6BA 1TJWA 1I0AA 3KDZA 1GKJA 1JSWA 1Q5NA 2NYFA 1RE5A 3QBPA 4V2RA 3C8TA 4EFCA 2E9FA 2J91A 1U16A 1VDKA 4C5SA 2RJRA 1U15A 1T6JA 3NZ4A 1YFEA 2HVGA 1HY1A 1FURA 5F92A 2X75A 4FLCA 1C3UA 5EYTA 1XWOA 4C5UA 1GK3A 1W27A 4BAAA 1C3CA 1TJ7A 1FUPA 1B8FA 4V2QA 3BHGA 1YISA 1J3UA 3RD8A 1TJUA 4FFXA 2PTRA 5EYVA 2O7BA 3KDYA 4APAA 1FUOA 2FUSA 2O7EA 3GZHA 1TJVA 1KQ7A 1Y2MA 3R6QA 2YIIA 1K7WA 1FUQA 4C6GA 5HW2A 4BABA 4EEIA 3GTDA 3TV2A 4CQ5A 3CZOA 1GKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O78 A;  3R6Y A;  3RRP A;  1EB4 A;  2PTQ A;  3R6V A;  1DCN A;  2QGA B;  3E04 A;  4NSL A;  2O7F A;  2QVE A;  1K62 A;  2PTS A;  1HY0 A;  2NYN A;  2VD6 A;  1AUW A;  4NLE A;  2O7D A;  4C5R A;  4ADL A;  4MX2 A;  4ADM A;  1DOF A;  1T6P A;  1GK2 A;  2PFM A;  4HGV A;  3UNV A;  5F91 A;  4APB A;  3OCE A;  3OCF A;  2O6Y A;  2OHY A;  3NO9 A;  2RJS A;  1YFM A;  5D6B A;  1TJW A;  1I0A A;  3KDZ A;  1GKJ A;  1JSW A;  1Q5N A;  2NYF A;  1RE5 A;  3QBP A;  4V2R A;  3C8T A;  4EFC A;  2E9F A;  2J91 A;  1U16 A;  1VDK A;  4C5S A;  2RJR A;  1U15 A;  1T6J A;  3NZ4 A;  1YFE A;  2HVG A;  1HY1 A;  1FUR A;  5F92 A;  2X75 A;  4FLC A;  1C3U A;  5EYT A;  1XWO A;  4C5U A;  1GK3 A;  1W27 A;  4BAA A;  1C3C A;  1TJ7 A;  1FUP A;  1B8F A;  4V2Q A;  3BHG A;  1YIS A;  1J3U A;  3RD8 A;  1TJU A;  4FFX A;  2PTR A;  5EYV A;  2O7B A;  3KDY A;  4APA A;  1FUO A;  2FUS A;  2O7E A;  3GZH A;  1TJV A;  1KQ7 A;  1Y2M A;  3R6Q A;  2YII A;  1K7W A;  1FUQ A;  4C6G A;  5HW2 A;  4BAB A;  4EEI A;  3GTD A;  3TV2 A;  4CQ5 A;  3CZO A;  1GKM A; 
#chains in the Genus database with same CATH topology
 2O78 A;  2D27 A;  1IW7 D;  4YIK A;  2JAU A;  3RRP A;  3R6Y A;  1Z4J A;  1EB4 A;  2PTQ A;  3R6V A;  1DCN A;  2JAR A;  2QGA B;  1MH9 A;  3E04 A;  4NSL A;  3F4T A;  2O7F A;  2QVE A;  1K62 A;  2PTS A;  1HY0 A;  1Z4L A;  2NYN A;  4A15 A;  4L6A A;  2VD6 A;  1AUW A;  4NLE A;  2O7D A;  4C5R A;  4ADL A;  4MUM A;  4MX2 A;  4ADM A;  1DOF A;  1XL8 A;  3BWV A;  1T6P A;  2PFM A;  4HGV A;  3U13 A;  1GK2 A;  3UNV A;  5F91 A;  4APB A;  3OCE A;  3OCF A;  2O6Y A;  1XMD A;  3CI0 K;  2OHY A;  3NO9 A;  3CRW 1;  2RJS A;  1YFM A;  5D6B A;  4L6C A;  2VSF A;  2FEN A;  1TJW A;  4E88 A;  1I0A A;  3KDZ A;  1GKJ A;  1JSW A;  2VL7 A;  1Z4K A;  1Q5N A;  2NYF A;  1RE5 A;  3QBP A;  2I7D A;  4V2R A;  3C8T A;  4EFC A;  2E9F A;  2J91 A;  1U16 A;  1XLY A;  1VDK A;  4C5S A;  2RJR A;  5H8W A;  1U15 A;  2JAW A;  1T6J A;  3NZ4 A;  1YFE A;  2HVG A;  1HY1 A;  1FUR A;  2RCN A;  5F92 A;  2X75 A;  3F4S A;  4FLC A;  1C3U A;  1Z4M A;  5EYT A;  1XWO A;  4C5U A;  1GK3 A;  1W27 A;  4BAA A;  4YIH A;  1C3C A;  4MWO A;  1TJ7 A;  3CRV A;  1FUP A;  4IQJ M;  1B8F A;  1Z4I A;  1Q92 A;  1U0L A;  4V2Q A;  1Q91 A;  3BHG A;  1YIS A;  5M0I A;  1XL7 A;  1J3U A;  3RD8 A;  1TJU A;  4FFX A;  2PTR A;  2FEL A;  1T9H A;  5EYV A;  1XMC A;  2O7B A;  3KDY A;  1Z4Q A;  4APA A;  1FUO A;  2FUS A;  2O7E A;  3GZH A;  3U19 A;  1TJV A;  1KQ7 A;  1Y2M A;  3R6Q A;  4NFL A;  3F4R A;  2YV5 A;  2JAO A;  5M0J A;  2YII A;  1K7W A;  4L57 A;  1FUQ A;  4C6G A;  5HW2 A;  4BAB A;  4EEI A;  3GTD A;  3TV2 A;  4CQ5 A;  2D28 C;  1Z4P X;  3CZO A;  4WNL A;  1GKM A; 
#chains in the Genus database with same CATH homology
 2O78 A;  3R6Y A;  3RRP A;  1EB4 A;  2PTQ A;  3R6V A;  1DCN A;  2QGA B;  3E04 A;  4NSL A;  2O7F A;  2QVE A;  1K62 A;  2PTS A;  1HY0 A;  2NYN A;  2VD6 A;  1AUW A;  4NLE A;  2O7D A;  4C5R A;  4ADL A;  4MX2 A;  4ADM A;  1DOF A;  1T6P A;  1GK2 A;  2PFM A;  4HGV A;  3UNV A;  5F91 A;  4APB A;  3OCE A;  3OCF A;  2O6Y A;  2OHY A;  3NO9 A;  2RJS A;  1YFM A;  5D6B A;  1TJW A;  1I0A A;  3KDZ A;  1GKJ A;  1JSW A;  1Q5N A;  2NYF A;  1RE5 A;  3QBP A;  4V2R A;  3C8T A;  4EFC A;  2E9F A;  2J91 A;  1U16 A;  1VDK A;  4C5S A;  2RJR A;  1U15 A;  1T6J A;  3NZ4 A;  1YFE A;  2HVG A;  1HY1 A;  1FUR A;  5F92 A;  2X75 A;  4FLC A;  1C3U A;  5EYT A;  1XWO A;  4C5U A;  1GK3 A;  1W27 A;  4BAA A;  1C3C A;  1TJ7 A;  1FUP A;  1B8F A;  4V2Q A;  3BHG A;  1YIS A;  1J3U A;  3RD8 A;  1TJU A;  4FFX A;  2PTR A;  5EYV A;  2O7B A;  3KDY A;  4APA A;  1FUO A;  2FUS A;  2O7E A;  3GZH A;  1TJV A;  1KQ7 A;  1Y2M A;  3R6Q A;  2YII A;  1K7W A;  1FUQ A;  4C6G A;  5HW2 A;  4BAB A;  4EEI A;  3GTD A;  3TV2 A;  4CQ5 A;  3CZO A;  1GKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...