1TJVA

Crystal structure of t161d duck delta 2 crystallin mutant
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
449
structure length
449
Chain Sequence
TDPIMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLEKISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQLIKTLVERAAIEIDVILPGYDHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNPLDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFSTGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALTPEMLATDLALYLVRKGVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSISPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRELMKKQKEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Delta crystallin II
publication title Structural studies of duck delta2 crystallin mutants provide insight into the role of Thr161 and the 280s loop in catalysis
pubmed doi rcsb
source organism Anas platyrhynchos
total genus 184
structure length 449
sequence length 449
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.1: Argininosuccinate lyase.
pdb deposition date 2004-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF14698 ASL_C2 Argininosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 1tjvA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 1tjvA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 1tjvA02
4CQ5A 3BHGA 2HVGA 1HY1A 3R6VA 3QBPA 1GKJA 1TJWA 4HGVA 1DOFA 5EYTA 1FURA 2OHYA 2E9FA 4BABA 4FFXA 4APBA 2J91A 1RE5A 3KDZA 4V2RA 3UNVA 1T6PA 2NYFA 1U15A 1C3UA 4ADLA 2O7DA 2O6YA 2VD6A 1J3UA 3R6QA 1JSWA 4ADMA 4C5RA 1XWOA 1VDKA 3RRPA 2O7EA 2O7BA 1GK3A 2PTQA 3R6YA 1I0AA 1T6JA 3GZHA 1GKMA 1K62A 5F91A 2PTRA 4NSLA 5D6BA 4V2QA 2QVEA 1HY0A 3KDYA 1TJ7A 1YFMA 4C6GA 1FUPA 1TJUA 3C8TA 2NYNA 1AUWA 1EB4A 1U16A 3OCEA 1YISA 5HW2A 1DCNA 4C5SA 2RJRA 3NZ4A 1Y2MA 1KQ7A 1W27A 2QGAB 3NO9A 3CZOA 5EYVA 2O78A 4APAA 2YIIA 1B8FA 2PFMA 1YFEA 3OCFA 3RD8A 4BAAA 4MX2A 5F92A 1FUOA 4FLCA 1GK2A 1Q5NA 4EFCA 3GTDA 4EEIA 2X75A 2FUSA 1FUQA 4NLEA 1TJVA 4C5UA 1K7WA 3E04A 3TV2A 2PTSA 1C3CA 2RJSA 2O7FA
chains in the Genus database with same CATH superfamily
1XMCA 2FELA 4CQ5A 3BHGA 2HVGA 4L57A 1Q92A 1HY1A 3R6VA 3QBPA 1XL7A 2JAUA 1GKJA 2JAWA 2YV5A 1TJWA 3CRVA 4HGVA 1DOFA 4IQJM 5EYTA 1FURA 2OHYA 3F4SA 2VL7A 4YIKA 4A15A 2E9FA 4BABA 4FFXA 4APBA 2J91A 2JARA 1RE5A 1Z4LA 3KDZA 4V2RA 3CRW1 3UNVA 1T6PA 2NYFA 1U15A 1C3UA 4ADLA 3U19A 4L6AA 2O7DA 2O6YA 2VD6A 1J3UA 3R6QA 1JSWA 4ADMA 4C5RA 1XWOA 1Z4MA 1VDKA 2I7DA 3RRPA 2O7EA 5M0JA 2O7BA 1GK3A 2PTQA 1Z4KA 3F4RA 3R6YA 1I0AA 4MWOA 3GZHA 1GKMA 1T6JA 1K62A 5F91A 2PTRA 5H8WA 4NSLA 1MH9A 5D6BA 4V2QA 2QVEA 1HY0A 1Z4JA 3KDYA 1TJ7A 1YFMA 3BWVA 1XMDA 4C6GA 2FENA 1FUPA 1TJUA 3C8TA 4L6CA 2NYNA 1AUWA 1EB4A 1U16A 3OCEA 1YISA 1Q91A 5HW2A 1Z4IA 1DCNA 4C5SA 2RJRA 3NZ4A 1Y2MA 1KQ7A 1W27A 1Z4QA 1IW7D 2QGAB 3NO9A 1U0LA 4NFLA 3CZOA 4MUMA 5EYVA 5M0IA 3CI0K 2O78A 4APAA 2YIIA 3U13A 1B8FA 2PFMA 1YFEA 2D27A 3OCFA 3RD8A 4BAAA 4MX2A 1XLYA 4E88A 1FUOA 5F92A 4FLCA 1GK2A 1Q5NA 2VSFA 4EFCA 3GTDA 4EEIA 2X75A 2FUSA 2JAOA 2D28C 1FUQA 4NLEA 1TJVA 2RCNA 4C5UA 1Z4PX 1T9HA 1K7WA 3E04A 1XL8A 3TV2A 2PTSA 4WNLA 1C3CA 2RJSA 2O7FA 4YIHA 3F4TA
chains in the Genus database with same CATH topology
4CQ5A 3BHGA 2HVGA 1HY1A 3R6VA 3QBPA 1GKJA 1TJWA 4HGVA 1DOFA 5EYTA 1FURA 2OHYA 2E9FA 4BABA 4FFXA 4APBA 2J91A 1RE5A 3KDZA 4V2RA 3UNVA 1T6PA 2NYFA 1U15A 1C3UA 4ADLA 2O7DA 2O6YA 2VD6A 1J3UA 3R6QA 1JSWA 4ADMA 4C5RA 1XWOA 1VDKA 3RRPA 2O7EA 2O7BA 1GK3A 2PTQA 3R6YA 1I0AA 1T6JA 3GZHA 1GKMA 1K62A 5F91A 2PTRA 4NSLA 5D6BA 4V2QA 2QVEA 1HY0A 3KDYA 1TJ7A 1YFMA 4C6GA 1FUPA 1TJUA 3C8TA 2NYNA 1AUWA 1EB4A 1U16A 3OCEA 1YISA 5HW2A 1DCNA 4C5SA 2RJRA 3NZ4A 1Y2MA 1KQ7A 1W27A 2QGAB 3NO9A 3CZOA 5EYVA 2O78A 4APAA 2YIIA 1B8FA 2PFMA 1YFEA 3OCFA 3RD8A 4BAAA 4MX2A 5F92A 1FUOA 4FLCA 1GK2A 1Q5NA 4EFCA 3GTDA 4EEIA 2X75A 2FUSA 1FUQA 4NLEA 1TJVA 4C5UA 1K7WA 3E04A 3TV2A 2PTSA 1C3CA 2RJSA 2O7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CQ5 A;  3BHG A;  2HVG A;  1HY1 A;  3R6V A;  3QBP A;  1GKJ A;  1TJW A;  4HGV A;  1DOF A;  5EYT A;  1FUR A;  2OHY A;  2E9F A;  4BAB A;  4FFX A;  4APB A;  2J91 A;  1RE5 A;  3KDZ A;  4V2R A;  3UNV A;  1T6P A;  2NYF A;  1U15 A;  1C3U A;  4ADL A;  2O7D A;  2O6Y A;  2VD6 A;  1J3U A;  3R6Q A;  1JSW A;  4ADM A;  4C5R A;  1XWO A;  1VDK A;  3RRP A;  2O7E A;  2O7B A;  1GK3 A;  2PTQ A;  3R6Y A;  1I0A A;  1T6J A;  3GZH A;  1GKM A;  1K62 A;  5F91 A;  2PTR A;  4NSL A;  5D6B A;  4V2Q A;  2QVE A;  1HY0 A;  3KDY A;  1TJ7 A;  1YFM A;  4C6G A;  1FUP A;  1TJU A;  3C8T A;  2NYN A;  1AUW A;  1EB4 A;  1U16 A;  3OCE A;  1YIS A;  5HW2 A;  1DCN A;  4C5S A;  2RJR A;  3NZ4 A;  1Y2M A;  1KQ7 A;  1W27 A;  2QGA B;  3NO9 A;  3CZO A;  5EYV A;  2O78 A;  4APA A;  2YII A;  1B8F A;  2PFM A;  1YFE A;  3OCF A;  3RD8 A;  4BAA A;  4MX2 A;  5F92 A;  1FUO A;  4FLC A;  1GK2 A;  1Q5N A;  4EFC A;  3GTD A;  4EEI A;  2X75 A;  2FUS A;  1FUQ A;  4NLE A;  1TJV A;  4C5U A;  1K7W A;  3E04 A;  3TV2 A;  2PTS A;  1C3C A;  2RJS A;  2O7F A; 
#chains in the Genus database with same CATH topology
 1XMC A;  2FEL A;  4CQ5 A;  3BHG A;  2HVG A;  4L57 A;  1Q92 A;  1HY1 A;  3R6V A;  3QBP A;  1XL7 A;  2JAU A;  1GKJ A;  2JAW A;  2YV5 A;  1TJW A;  3CRV A;  4HGV A;  1DOF A;  4IQJ M;  5EYT A;  1FUR A;  2OHY A;  3F4S A;  2VL7 A;  4YIK A;  4A15 A;  2E9F A;  4BAB A;  4FFX A;  4APB A;  2J91 A;  2JAR A;  1RE5 A;  1Z4L A;  3KDZ A;  4V2R A;  3CRW 1;  3UNV A;  1T6P A;  2NYF A;  1U15 A;  1C3U A;  4ADL A;  3U19 A;  4L6A A;  2O7D A;  2O6Y A;  2VD6 A;  1J3U A;  3R6Q A;  1JSW A;  4ADM A;  4C5R A;  1XWO A;  1Z4M A;  1VDK A;  2I7D A;  3RRP A;  2O7E A;  5M0J A;  2O7B A;  1GK3 A;  2PTQ A;  1Z4K A;  3F4R A;  3R6Y A;  1I0A A;  4MWO A;  3GZH A;  1GKM A;  1T6J A;  1K62 A;  5F91 A;  2PTR A;  5H8W A;  4NSL A;  1MH9 A;  5D6B A;  4V2Q A;  2QVE A;  1HY0 A;  1Z4J A;  3KDY A;  1TJ7 A;  1YFM A;  3BWV A;  1XMD A;  4C6G A;  2FEN A;  1FUP A;  1TJU A;  3C8T A;  4L6C A;  2NYN A;  1AUW A;  1EB4 A;  1U16 A;  3OCE A;  1YIS A;  1Q91 A;  5HW2 A;  1Z4I A;  1DCN A;  4C5S A;  2RJR A;  3NZ4 A;  1Y2M A;  1KQ7 A;  1W27 A;  1Z4Q A;  1IW7 D;  2QGA B;  3NO9 A;  1U0L A;  4NFL A;  3CZO A;  4MUM A;  5EYV A;  5M0I A;  3CI0 K;  2O78 A;  4APA A;  2YII A;  3U13 A;  1B8F A;  2PFM A;  1YFE A;  2D27 A;  3OCF A;  3RD8 A;  4BAA A;  4MX2 A;  1XLY A;  4E88 A;  1FUO A;  5F92 A;  4FLC A;  1GK2 A;  1Q5N A;  2VSF A;  4EFC A;  3GTD A;  4EEI A;  2X75 A;  2FUS A;  2JAO A;  2D28 C;  1FUQ A;  4NLE A;  1TJV A;  2RCN A;  4C5U A;  1Z4P X;  1T9H A;  1K7W A;  3E04 A;  1XL8 A;  3TV2 A;  2PTS A;  4WNL A;  1C3C A;  2RJS A;  2O7F A;  4YIH A;  3F4T A; 
#chains in the Genus database with same CATH homology
 4CQ5 A;  3BHG A;  2HVG A;  1HY1 A;  3R6V A;  3QBP A;  1GKJ A;  1TJW A;  4HGV A;  1DOF A;  5EYT A;  1FUR A;  2OHY A;  2E9F A;  4BAB A;  4FFX A;  4APB A;  2J91 A;  1RE5 A;  3KDZ A;  4V2R A;  3UNV A;  1T6P A;  2NYF A;  1U15 A;  1C3U A;  4ADL A;  2O7D A;  2O6Y A;  2VD6 A;  1J3U A;  3R6Q A;  1JSW A;  4ADM A;  4C5R A;  1XWO A;  1VDK A;  3RRP A;  2O7E A;  2O7B A;  1GK3 A;  2PTQ A;  3R6Y A;  1I0A A;  1T6J A;  3GZH A;  1GKM A;  1K62 A;  5F91 A;  2PTR A;  4NSL A;  5D6B A;  4V2Q A;  2QVE A;  1HY0 A;  3KDY A;  1TJ7 A;  1YFM A;  4C6G A;  1FUP A;  1TJU A;  3C8T A;  2NYN A;  1AUW A;  1EB4 A;  1U16 A;  3OCE A;  1YIS A;  5HW2 A;  1DCN A;  4C5S A;  2RJR A;  3NZ4 A;  1Y2M A;  1KQ7 A;  1W27 A;  2QGA B;  3NO9 A;  3CZO A;  5EYV A;  2O78 A;  4APA A;  2YII A;  1B8F A;  2PFM A;  1YFE A;  3OCF A;  3RD8 A;  4BAA A;  4MX2 A;  5F92 A;  1FUO A;  4FLC A;  1GK2 A;  1Q5N A;  4EFC A;  3GTD A;  4EEI A;  2X75 A;  2FUS A;  1FUQ A;  4NLE A;  1TJV A;  4C5U A;  1K7W A;  3E04 A;  3TV2 A;  2PTS A;  1C3C A;  2RJS A;  2O7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...