1XWOA

Crystal structrue of goose delta crystallin
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
448
structure length
448
Chain Sequence
TDPIMQMLSTSMSTEQRLSEVDIQASIAYAKALEKAGILTKTELEKILSGLEKISEEWSKGVFVVTQSDEDIHTANERRLKELIGDIAGKLNTGRSRNEQVVTDLKLFMKNSLSVISTHLLQLIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKRRINVLPLGSGALAGNPLDIDREMLRSELDFASISLNSMDAISERDFVVEFLSVATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFSTGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALTPEMLSTDLALYLVRKGMPFRQAHTASGKAVHLAETKGITINNLTLEDLKSISPLFSSDVSQVFNFVNSVEQYTAMGGTAKSSVTTQIEHLRELMKKQKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Delta crystallin
publication title The effect of N-terminal truncation on double-dimer assembly of goose delta-crystallin
pubmed doi rcsb
molecule tags Lyase
total genus 169
structure length 448
sequence length 448
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.1: Argininosuccinate lyase.
pdb deposition date 2004-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF14698 ASL_C2 Argininosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 1xwoA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 1xwoA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 1xwoA02
1GKMA 1YFEA 1YFMA 4C6GA 1GK3A 2QGAB 2RJSA 1Q5NA 1TJVA 4EFCA 1Y2MA 3E04A 5F91A 3UNVA 1FUOA 4BABA 4C5UA 2QVEA 2FUSA 3RD8A 4V2QA 1GK2A 1W27A 4NSLA 2VD6A 1U15A 1XWOA 1I0AA 2O7BA 2J91A 3R6QA 2YIIA 1YISA 1C3CA 1C3UA 1RE5A 1KQ7A 2O6YA 4MX2A 5F92A 2E9FA 3R6YA 2HVGA 2PTSA 4FLCA 1JSWA 1FUPA 3RRPA 1U16A 1J3UA 4EEIA 3GZHA 3KDZA 1FURA 3OCEA 1HY1A 3NO9A 1AUWA 4BAAA 1T6JA 4C5RA 1DOFA 4C5SA 5EYTA 2RJRA 2O78A 1EB4A 1GKJA 5D6BA 1T6PA 1K62A 3OCFA 4ADMA 4V2RA 4FFXA 2PTQA 3R6VA 5HW2A 3QBPA 2O7DA 2PFMA 4CQ5A 3C8TA 4ADLA 3GTDA 2OHYA 3BHGA 1TJ7A 3NZ4A 1B8FA 4APBA 1HY0A 1FUQA 2X75A 2NYNA 2NYFA 1TJWA 3TV2A 2O7FA 4APAA 3KDYA 5EYVA 1TJUA 4NLEA 3CZOA 1DCNA 1VDKA 4HGVA 1K7WA 2PTRA 2O7EA
chains in the Genus database with same CATH superfamily
1GKMA 1YFEA 1YFMA 3F4RA 4C6GA 1GK3A 2QGAB 2RJSA 1Q91A 2I7DA 1Q5NA 1TJVA 4EFCA 1Y2MA 4L57A 3E04A 2JARA 3CRVA 5F91A 3UNVA 1FUOA 1Z4IA 2VSFA 4BABA 3U13A 2VL7A 2FENA 4C5UA 2QVEA 2FUSA 3RD8A 4V2QA 1Z4QA 1GK2A 1W27A 4NSLA 2VD6A 1Q92A 1U15A 1XWOA 1I0AA 1IW7D 2O7BA 2RCNA 3CI0K 2J91A 4YIKA 3R6QA 2YIIA 1YISA 1C3CA 1Z4LA 1C3UA 1RE5A 1KQ7A 2O6YA 5H8WA 4MX2A 5F92A 2E9FA 3R6YA 5M0JA 2HVGA 2PTSA 3F4TA 4L6CA 4YIHA 4FLCA 1JSWA 2D27A 1FUPA 3RRPA 2FELA 4MWOA 1U16A 1J3UA 4IQJM 4EEIA 3GZHA 1Z4JA 1FURA 1Z4PX 3KDZA 1T9HA 3OCEA 1HY1A 3NO9A 4A15A 1AUWA 4BAAA 1T6JA 4C5RA 1DOFA 4NFLA 1XLYA 4C5SA 4L6AA 5EYTA 2RJRA 1Z4KA 2O78A 1EB4A 2D28C 1GKJA 5D6BA 1XMDA 1T6PA 2YV5A 1Z4MA 1U0LA 1K62A 3OCFA 4ADMA 4V2RA 4FFXA 2PTQA 3R6VA 5HW2A 3QBPA 1XL7A 2O7DA 2PFMA 1XMCA 2JAWA 3U19A 4CQ5A 3C8TA 4ADLA 3GTDA 2OHYA 3BHGA 2JAUA 1TJ7A 3F4SA 3NZ4A 1B8FA 5M0IA 1MH9A 4APBA 1HY0A 1FUQA 1XL8A 3CRW1 4WNLA 2X75A 4E88A 2NYNA 2NYFA 1TJWA 2JAOA 3TV2A 2O7FA 4APAA 3KDYA 5EYVA 1TJUA 4NLEA 3CZOA 1DCNA 4MUMA 1VDKA 4HGVA 3BWVA 1K7WA 2PTRA 2O7EA
chains in the Genus database with same CATH topology
1GKMA 1YFEA 1YFMA 4C6GA 1GK3A 2QGAB 2RJSA 1Q5NA 1TJVA 4EFCA 1Y2MA 3E04A 5F91A 3UNVA 1FUOA 4BABA 4C5UA 2QVEA 2FUSA 3RD8A 4V2QA 1GK2A 1W27A 4NSLA 2VD6A 1U15A 1XWOA 1I0AA 2O7BA 2J91A 3R6QA 2YIIA 1YISA 1C3CA 1C3UA 1RE5A 1KQ7A 2O6YA 4MX2A 5F92A 2E9FA 3R6YA 2HVGA 2PTSA 4FLCA 1JSWA 1FUPA 3RRPA 1U16A 1J3UA 4EEIA 3GZHA 3KDZA 1FURA 3OCEA 1HY1A 3NO9A 1AUWA 4BAAA 1T6JA 4C5RA 1DOFA 4C5SA 5EYTA 2RJRA 2O78A 1EB4A 1GKJA 5D6BA 1T6PA 1K62A 3OCFA 4ADMA 4V2RA 4FFXA 2PTQA 3R6VA 5HW2A 3QBPA 2O7DA 2PFMA 4CQ5A 3C8TA 4ADLA 3GTDA 2OHYA 3BHGA 1TJ7A 3NZ4A 1B8FA 4APBA 1HY0A 1FUQA 2X75A 2NYNA 2NYFA 1TJWA 3TV2A 2O7FA 4APAA 3KDYA 5EYVA 1TJUA 4NLEA 3CZOA 1DCNA 1VDKA 4HGVA 1K7WA 2PTRA 2O7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GKM A;  1YFE A;  1YFM A;  4C6G A;  1GK3 A;  2QGA B;  2RJS A;  1Q5N A;  1TJV A;  4EFC A;  1Y2M A;  3E04 A;  5F91 A;  3UNV A;  1FUO A;  4BAB A;  4C5U A;  2QVE A;  2FUS A;  3RD8 A;  4V2Q A;  1GK2 A;  1W27 A;  4NSL A;  2VD6 A;  1U15 A;  1XWO A;  1I0A A;  2O7B A;  2J91 A;  3R6Q A;  2YII A;  1YIS A;  1C3C A;  1C3U A;  1RE5 A;  1KQ7 A;  2O6Y A;  4MX2 A;  5F92 A;  2E9F A;  3R6Y A;  2HVG A;  2PTS A;  4FLC A;  1JSW A;  1FUP A;  3RRP A;  1U16 A;  1J3U A;  4EEI A;  3GZH A;  3KDZ A;  1FUR A;  3OCE A;  1HY1 A;  3NO9 A;  1AUW A;  4BAA A;  1T6J A;  4C5R A;  1DOF A;  4C5S A;  5EYT A;  2RJR A;  2O78 A;  1EB4 A;  1GKJ A;  5D6B A;  1T6P A;  1K62 A;  3OCF A;  4ADM A;  4V2R A;  4FFX A;  2PTQ A;  3R6V A;  5HW2 A;  3QBP A;  2O7D A;  2PFM A;  4CQ5 A;  3C8T A;  4ADL A;  3GTD A;  2OHY A;  3BHG A;  1TJ7 A;  3NZ4 A;  1B8F A;  4APB A;  1HY0 A;  1FUQ A;  2X75 A;  2NYN A;  2NYF A;  1TJW A;  3TV2 A;  2O7F A;  4APA A;  3KDY A;  5EYV A;  1TJU A;  4NLE A;  3CZO A;  1DCN A;  1VDK A;  4HGV A;  1K7W A;  2PTR A;  2O7E A; 
#chains in the Genus database with same CATH topology
 1GKM A;  1YFE A;  1YFM A;  3F4R A;  4C6G A;  1GK3 A;  2QGA B;  2RJS A;  1Q91 A;  2I7D A;  1Q5N A;  1TJV A;  4EFC A;  1Y2M A;  4L57 A;  3E04 A;  2JAR A;  3CRV A;  5F91 A;  3UNV A;  1FUO A;  1Z4I A;  2VSF A;  4BAB A;  3U13 A;  2VL7 A;  2FEN A;  4C5U A;  2QVE A;  2FUS A;  3RD8 A;  4V2Q A;  1Z4Q A;  1GK2 A;  1W27 A;  4NSL A;  2VD6 A;  1Q92 A;  1U15 A;  1XWO A;  1I0A A;  1IW7 D;  2O7B A;  2RCN A;  3CI0 K;  2J91 A;  4YIK A;  3R6Q A;  2YII A;  1YIS A;  1C3C A;  1Z4L A;  1C3U A;  1RE5 A;  1KQ7 A;  2O6Y A;  5H8W A;  4MX2 A;  5F92 A;  2E9F A;  3R6Y A;  5M0J A;  2HVG A;  2PTS A;  3F4T A;  4L6C A;  4YIH A;  4FLC A;  1JSW A;  2D27 A;  1FUP A;  3RRP A;  2FEL A;  4MWO A;  1U16 A;  1J3U A;  4IQJ M;  4EEI A;  3GZH A;  1Z4J A;  1FUR A;  1Z4P X;  3KDZ A;  1T9H A;  3OCE A;  1HY1 A;  3NO9 A;  4A15 A;  1AUW A;  4BAA A;  1T6J A;  4C5R A;  1DOF A;  4NFL A;  1XLY A;  4C5S A;  4L6A A;  5EYT A;  2RJR A;  1Z4K A;  2O78 A;  1EB4 A;  2D28 C;  1GKJ A;  5D6B A;  1XMD A;  1T6P A;  2YV5 A;  1Z4M A;  1U0L A;  1K62 A;  3OCF A;  4ADM A;  4V2R A;  4FFX A;  2PTQ A;  3R6V A;  5HW2 A;  3QBP A;  1XL7 A;  2O7D A;  2PFM A;  1XMC A;  2JAW A;  3U19 A;  4CQ5 A;  3C8T A;  4ADL A;  3GTD A;  2OHY A;  3BHG A;  2JAU A;  1TJ7 A;  3F4S A;  3NZ4 A;  1B8F A;  5M0I A;  1MH9 A;  4APB A;  1HY0 A;  1FUQ A;  1XL8 A;  3CRW 1;  4WNL A;  2X75 A;  4E88 A;  2NYN A;  2NYF A;  1TJW A;  2JAO A;  3TV2 A;  2O7F A;  4APA A;  3KDY A;  5EYV A;  1TJU A;  4NLE A;  3CZO A;  1DCN A;  4MUM A;  1VDK A;  4HGV A;  3BWV A;  1K7W A;  2PTR A;  2O7E A; 
#chains in the Genus database with same CATH homology
 1GKM A;  1YFE A;  1YFM A;  4C6G A;  1GK3 A;  2QGA B;  2RJS A;  1Q5N A;  1TJV A;  4EFC A;  1Y2M A;  3E04 A;  5F91 A;  3UNV A;  1FUO A;  4BAB A;  4C5U A;  2QVE A;  2FUS A;  3RD8 A;  4V2Q A;  1GK2 A;  1W27 A;  4NSL A;  2VD6 A;  1U15 A;  1XWO A;  1I0A A;  2O7B A;  2J91 A;  3R6Q A;  2YII A;  1YIS A;  1C3C A;  1C3U A;  1RE5 A;  1KQ7 A;  2O6Y A;  4MX2 A;  5F92 A;  2E9F A;  3R6Y A;  2HVG A;  2PTS A;  4FLC A;  1JSW A;  1FUP A;  3RRP A;  1U16 A;  1J3U A;  4EEI A;  3GZH A;  3KDZ A;  1FUR A;  3OCE A;  1HY1 A;  3NO9 A;  1AUW A;  4BAA A;  1T6J A;  4C5R A;  1DOF A;  4C5S A;  5EYT A;  2RJR A;  2O78 A;  1EB4 A;  1GKJ A;  5D6B A;  1T6P A;  1K62 A;  3OCF A;  4ADM A;  4V2R A;  4FFX A;  2PTQ A;  3R6V A;  5HW2 A;  3QBP A;  2O7D A;  2PFM A;  4CQ5 A;  3C8T A;  4ADL A;  3GTD A;  2OHY A;  3BHG A;  1TJ7 A;  3NZ4 A;  1B8F A;  4APB A;  1HY0 A;  1FUQ A;  2X75 A;  2NYN A;  2NYF A;  1TJW A;  3TV2 A;  2O7F A;  4APA A;  3KDY A;  5EYV A;  1TJU A;  4NLE A;  3CZO A;  1DCN A;  1VDK A;  4HGV A;  1K7W A;  2PTR A;  2O7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...