1XWOA

Crystal structrue of goose delta crystallin
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
448
structure length
448
Chain Sequence
b'TDPIMQMLSTSMSTEQRLSEVDIQASIAYAKALEKAGILTKTELEKILSGLEKISEEWSKGVFVVTQSDEDIHTANERRLKELIGDIAGKLNTGRSRNEQVVTDLKLFMKNSLSVISTHLLQLIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKRRINVLPLGSGALAGNPLDIDREMLRSELDFASISLNSMDAISERDFVVEFLSVATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFSTGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALTPEMLSTDLALYLVRKGMPFRQAHTASGKAVHLAETKGITINNLTLEDLKSISPLFSSDVSQVFNFVNSVEQYTAMGGTAKSSVTTQIEHLRELMKKQKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Delta crystallin
publication title The effect of N-terminal truncation on double-dimer assembly of goose delta-crystallin
pubmed doi rcsb
molecule tags Lyase
total genus 169
structure length 448
sequence length 448
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.1: Argininosuccinate lyase.
pdb deposition date 2004-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF14698 ASL_C2 Argininosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 1xwoA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 1xwoA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 1xwoA02
1KQ7A 2VD6A 2O7DA 3OCEA 2PTRA 5F91A 3OCFA 4HGVA 5EYVA 1JSWA 4NSLA 1C3CA 1TJ7A 2QVEA 1EB4A 4ADMA 4BABA 4FFXA 1DCNA 1VDKA 4C5SA 4CQ5A 1FUPA 1B8FA 2NYFA 4EEIA 1Y2MA 2X75A 1FUOA 1GK2A 1Q5NA 2O7FA 1RE5A 3RD8A 1YISA 1HY0A 2FUSA 1HY1A 3KDZA 4FLCA 1DOFA 2NYNA 1GKJA 3RRPA 2O7EA 2O6YA 3GZHA 1FUQA 3R6QA 1FURA 1K7WA 3E04A 2E9FA 4ADLA 4NLEA 1GKMA 1T6JA 1TJVA 2RJSA 3CZOA 4APAA 2PTSA 1XWOA 1TJWA 1W27A 2O78A 3NZ4A 1AUWA 3GTDA 4V2RA 3BHGA 1TJUA 4C5UA 4V2QA 4APBA 5D6BA 3R6YA 2HVGA 4C6GA 1J3UA 4MX2A 1U15A 1U16A 2YIIA 5EYTA 3UNVA 1C3UA 3NO9A 1GK3A 3R6VA 2OHYA 2O7BA 2RJRA 4C5RA 1I0AA 3TV2A 2PTQA 5HW2A 3QBPA 4EFCA 4BAAA 1T6PA 1K62A 2QGAB 3KDYA 2J91A 1YFEA 2PFMA 3C8TA 5F92A 1YFMA
chains in the Genus database with same CATH superfamily
1KQ7A 2VD6A 2O7DA 3CRVA 2VL7A 1IW7D 3OCEA 2PTRA 5F91A 3OCFA 4HGVA 5EYVA 1JSWA 4A15A 4NSLA 1C3CA 1TJ7A 2QVEA 1XMCA 3CRW1 1EB4A 3CI0K 4ADMA 1XMDA 4BABA 4FFXA 1DCNA 1VDKA 4C5SA 1T9HA 1FUPA 4CQ5A 2FENA 5M0JA 1B8FA 2VSFA 2NYFA 1Z4JA 4EEIA 1Y2MA 2X75A 1FUOA 1GK2A 1Q5NA 2O7FA 4IQJM 1RE5A 3RD8A 1YISA 1U0LA 2FELA 1HY0A 2FUSA 1HY1A 3KDZA 4FLCA 1DOFA 1XL8A 2NYNA 2I7DA 1GKJA 2JAWA 4L57A 4MUMA 3RRPA 2O7EA 2O6YA 3GZHA 1FUQA 4YIKA 3R6QA 1FURA 1Z4QA 1Z4MA 1K7WA 3E04A 2JARA 1MH9A 2E9FA 4ADLA 4WNLA 4NLEA 2JAUA 1GKMA 4YIHA 1T6JA 1TJVA 2RJSA 3F4RA 3CZOA 4APAA 2PTSA 1XWOA 1TJWA 1W27A 1Q92A 2O78A 4NFLA 3NZ4A 1AUWA 3GTDA 4V2RA 3BHGA 1TJUA 4MWOA 4C5UA 2JAOA 4V2QA 4APBA 5D6BA 3R6YA 2D28C 1Z4KA 2HVGA 4C6GA 4L6CA 1J3UA 1U15A 1Q91A 1U16A 4MX2A 2YIIA 5EYTA 4L6AA 3UNVA 1C3UA 3NO9A 3U19A 1GK3A 2RCNA 3U13A 3R6VA 2OHYA 2O7BA 5M0IA 2RJRA 1Z4PX 4C5RA 3F4SA 1Z4IA 1I0AA 3BWVA 5H8WA 3TV2A 2PTQA 5HW2A 3QBPA 4EFCA 4BAAA 1T6PA 1K62A 2QGAB 3KDYA 2J91A 2D27A 1YFEA 1XL7A 2PFMA 1XLYA 3C8TA 3F4TA 5F92A 2YV5A 1Z4LA 4E88A 1YFMA
chains in the Genus database with same CATH topology
1KQ7A 2VD6A 2O7DA 3OCEA 2PTRA 5F91A 3OCFA 4HGVA 5EYVA 1JSWA 4NSLA 1C3CA 1TJ7A 2QVEA 1EB4A 4ADMA 4BABA 4FFXA 1DCNA 1VDKA 4C5SA 4CQ5A 1FUPA 1B8FA 2NYFA 4EEIA 1Y2MA 2X75A 1FUOA 1GK2A 1Q5NA 2O7FA 1RE5A 3RD8A 1YISA 1HY0A 2FUSA 1HY1A 3KDZA 4FLCA 1DOFA 2NYNA 1GKJA 3RRPA 2O7EA 2O6YA 3GZHA 1FUQA 3R6QA 1FURA 1K7WA 3E04A 2E9FA 4ADLA 4NLEA 1GKMA 1T6JA 1TJVA 2RJSA 3CZOA 4APAA 2PTSA 1XWOA 1TJWA 1W27A 2O78A 3NZ4A 1AUWA 3GTDA 4V2RA 3BHGA 1TJUA 4C5UA 4V2QA 4APBA 5D6BA 3R6YA 2HVGA 4C6GA 1J3UA 4MX2A 1U15A 1U16A 2YIIA 5EYTA 3UNVA 1C3UA 3NO9A 1GK3A 3R6VA 2OHYA 2O7BA 2RJRA 4C5RA 1I0AA 3TV2A 2PTQA 5HW2A 3QBPA 4EFCA 4BAAA 1T6PA 1K62A 2QGAB 3KDYA 2J91A 1YFEA 2PFMA 3C8TA 5F92A 1YFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQ7 A;  2VD6 A;  2O7D A;  3OCE A;  2PTR A;  5F91 A;  3OCF A;  4HGV A;  5EYV A;  1JSW A;  4NSL A;  1C3C A;  1TJ7 A;  2QVE A;  1EB4 A;  4ADM A;  4BAB A;  4FFX A;  1DCN A;  1VDK A;  4C5S A;  4CQ5 A;  1FUP A;  1B8F A;  2NYF A;  4EEI A;  1Y2M A;  2X75 A;  1FUO A;  1GK2 A;  1Q5N A;  2O7F A;  1RE5 A;  3RD8 A;  1YIS A;  1HY0 A;  2FUS A;  1HY1 A;  3KDZ A;  4FLC A;  1DOF A;  2NYN A;  1GKJ A;  3RRP A;  2O7E A;  2O6Y A;  3GZH A;  1FUQ A;  3R6Q A;  1FUR A;  1K7W A;  3E04 A;  2E9F A;  4ADL A;  4NLE A;  1GKM A;  1T6J A;  1TJV A;  2RJS A;  3CZO A;  4APA A;  2PTS A;  1XWO A;  1TJW A;  1W27 A;  2O78 A;  3NZ4 A;  1AUW A;  3GTD A;  4V2R A;  3BHG A;  1TJU A;  4C5U A;  4V2Q A;  4APB A;  5D6B A;  3R6Y A;  2HVG A;  4C6G A;  1J3U A;  4MX2 A;  1U15 A;  1U16 A;  2YII A;  5EYT A;  3UNV A;  1C3U A;  3NO9 A;  1GK3 A;  3R6V A;  2OHY A;  2O7B A;  2RJR A;  4C5R A;  1I0A A;  3TV2 A;  2PTQ A;  5HW2 A;  3QBP A;  4EFC A;  4BAA A;  1T6P A;  1K62 A;  2QGA B;  3KDY A;  2J91 A;  1YFE A;  2PFM A;  3C8T A;  5F92 A;  1YFM A; 
#chains in the Genus database with same CATH topology
 1KQ7 A;  2VD6 A;  2O7D A;  3CRV A;  2VL7 A;  1IW7 D;  3OCE A;  2PTR A;  5F91 A;  3OCF A;  4HGV A;  5EYV A;  1JSW A;  4A15 A;  4NSL A;  1C3C A;  1TJ7 A;  2QVE A;  1XMC A;  3CRW 1;  1EB4 A;  3CI0 K;  4ADM A;  1XMD A;  4BAB A;  4FFX A;  1DCN A;  1VDK A;  4C5S A;  1T9H A;  1FUP A;  4CQ5 A;  2FEN A;  5M0J A;  1B8F A;  2VSF A;  2NYF A;  1Z4J A;  4EEI A;  1Y2M A;  2X75 A;  1FUO A;  1GK2 A;  1Q5N A;  2O7F A;  4IQJ M;  1RE5 A;  3RD8 A;  1YIS A;  1U0L A;  2FEL A;  1HY0 A;  2FUS A;  1HY1 A;  3KDZ A;  4FLC A;  1DOF A;  1XL8 A;  2NYN A;  2I7D A;  1GKJ A;  2JAW A;  4L57 A;  4MUM A;  3RRP A;  2O7E A;  2O6Y A;  3GZH A;  1FUQ A;  4YIK A;  3R6Q A;  1FUR A;  1Z4Q A;  1Z4M A;  1K7W A;  3E04 A;  2JAR A;  1MH9 A;  2E9F A;  4ADL A;  4WNL A;  4NLE A;  2JAU A;  1GKM A;  4YIH A;  1T6J A;  1TJV A;  2RJS A;  3F4R A;  3CZO A;  4APA A;  2PTS A;  1XWO A;  1TJW A;  1W27 A;  1Q92 A;  2O78 A;  4NFL A;  3NZ4 A;  1AUW A;  3GTD A;  4V2R A;  3BHG A;  1TJU A;  4MWO A;  4C5U A;  2JAO A;  4V2Q A;  4APB A;  5D6B A;  3R6Y A;  2D28 C;  1Z4K A;  2HVG A;  4C6G A;  4L6C A;  1J3U A;  1U15 A;  1Q91 A;  1U16 A;  4MX2 A;  2YII A;  5EYT A;  4L6A A;  3UNV A;  1C3U A;  3NO9 A;  3U19 A;  1GK3 A;  2RCN A;  3U13 A;  3R6V A;  2OHY A;  2O7B A;  5M0I A;  2RJR A;  1Z4P X;  4C5R A;  3F4S A;  1Z4I A;  1I0A A;  3BWV A;  5H8W A;  3TV2 A;  2PTQ A;  5HW2 A;  3QBP A;  4EFC A;  4BAA A;  1T6P A;  1K62 A;  2QGA B;  3KDY A;  2J91 A;  2D27 A;  1YFE A;  1XL7 A;  2PFM A;  1XLY A;  3C8T A;  3F4T A;  5F92 A;  2YV5 A;  1Z4L A;  4E88 A;  1YFM A; 
#chains in the Genus database with same CATH homology
 1KQ7 A;  2VD6 A;  2O7D A;  3OCE A;  2PTR A;  5F91 A;  3OCF A;  4HGV A;  5EYV A;  1JSW A;  4NSL A;  1C3C A;  1TJ7 A;  2QVE A;  1EB4 A;  4ADM A;  4BAB A;  4FFX A;  1DCN A;  1VDK A;  4C5S A;  4CQ5 A;  1FUP A;  1B8F A;  2NYF A;  4EEI A;  1Y2M A;  2X75 A;  1FUO A;  1GK2 A;  1Q5N A;  2O7F A;  1RE5 A;  3RD8 A;  1YIS A;  1HY0 A;  2FUS A;  1HY1 A;  3KDZ A;  4FLC A;  1DOF A;  2NYN A;  1GKJ A;  3RRP A;  2O7E A;  2O6Y A;  3GZH A;  1FUQ A;  3R6Q A;  1FUR A;  1K7W A;  3E04 A;  2E9F A;  4ADL A;  4NLE A;  1GKM A;  1T6J A;  1TJV A;  2RJS A;  3CZO A;  4APA A;  2PTS A;  1XWO A;  1TJW A;  1W27 A;  2O78 A;  3NZ4 A;  1AUW A;  3GTD A;  4V2R A;  3BHG A;  1TJU A;  4C5U A;  4V2Q A;  4APB A;  5D6B A;  3R6Y A;  2HVG A;  4C6G A;  1J3U A;  4MX2 A;  1U15 A;  1U16 A;  2YII A;  5EYT A;  3UNV A;  1C3U A;  3NO9 A;  1GK3 A;  3R6V A;  2OHY A;  2O7B A;  2RJR A;  4C5R A;  1I0A A;  3TV2 A;  2PTQ A;  5HW2 A;  3QBP A;  4EFC A;  4BAA A;  1T6P A;  1K62 A;  2QGA B;  3KDY A;  2J91 A;  1YFE A;  2PFM A;  3C8T A;  5F92 A;  1YFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...