1XWOA

Crystal structrue of goose delta crystallin
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
448
structure length
448
Chain Sequence
TDPIMQMLSTSMSTEQRLSEVDIQASIAYAKALEKAGILTKTELEKILSGLEKISEEWSKGVFVVTQSDEDIHTANERRLKELIGDIAGKLNTGRSRNEQVVTDLKLFMKNSLSVISTHLLQLIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKRRINVLPLGSGALAGNPLDIDREMLRSELDFASISLNSMDAISERDFVVEFLSVATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFSTGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALTPEMLSTDLALYLVRKGMPFRQAHTASGKAVHLAETKGITINNLTLEDLKSISPLFSSDVSQVFNFVNSVEQYTAMGGTAKSSVTTQIEHLRELMKKQKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Delta crystallin
publication title The effect of N-terminal truncation on double-dimer assembly of goose delta-crystallin
pubmed doi rcsb
total genus 169
structure length 448
sequence length 448
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.1: Argininosuccinate lyase.
pdb deposition date 2004-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF14698 ASL_C2 Argininosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 1xwoA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 1xwoA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 1xwoA02
4C5UA 1HY1A 2QGAB 4C5RA 2O6YA 4HGVA 1Q5NA 1YFEA 2HVGA 3GTDA 2PTQA 1K7WA 1GK3A 5F92A 3RD8A 2NYFA 1VDKA 2YIIA 1Y2MA 1XWOA 1I0AA 1K62A 4EFCA 1FUPA 1TJ7A 4V2QA 2PTSA 2J91A 4FLCA 1HY0A 2RJRA 1EB4A 2O7DA 1GKJA 3NO9A 4APBA 2PFMA 1GKMA 4C5SA 4ADMA 2O7BA 3OCFA 2X75A 4APAA 4NSLA 3GZHA 1C3CA 3R6YA 5EYVA 1C3UA 3TV2A 4NLEA 2RJSA 3RRPA 4FFXA 1TJWA 2OHYA 2O78A 4EEIA 3E04A 2NYNA 3CZOA 2QVEA 1FUOA 3KDYA 3UNVA 3C8TA 4V2RA 1U15A 1DCNA 2E9FA 4BAAA 5HW2A 5F91A 1JSWA 1DOFA 1KQ7A 5EYTA 2VD6A 1GK2A 3KDZA 3NZ4A 2PTRA 1FURA 3R6QA 1YFMA 2O7FA 4MX2A 2FUSA 5D6BA 1T6JA 1FUQA 4C6GA 1B8FA 3BHGA 1TJUA 3QBPA 1AUWA 1RE5A 4CQ5A 2O7EA 1TJVA 1J3UA 1T6PA 1W27A 4BABA 1YISA 3OCEA 3R6VA 4ADLA 1U16A
chains in the Genus database with same CATH superfamily
1Z4MA 4C5UA 1HY1A 2JARA 2JAUA 2QGAB 4L57A 1MH9A 4C5RA 5M0IA 2O6YA 4HGVA 1Q5NA 1YFEA 2HVGA 3F4TA 3GTDA 2PTQA 1K7WA 4YIHA 1Z4PX 1GK3A 5F92A 3RD8A 2NYFA 1VDKA 2YIIA 1Y2MA 1XWOA 2VSFA 1I0AA 3U13A 1K62A 4A15A 3CRVA 4EFCA 1FUPA 1TJ7A 4V2QA 1Z4KA 3CI0K 2PTSA 2J91A 4FLCA 1HY0A 2RJRA 3F4RA 1EB4A 5M0JA 2O7DA 1GKJA 3NO9A 4APBA 2PFMA 1T9HA 1GKMA 4C5SA 3BWVA 4ADMA 2O7BA 4E88A 3OCFA 1IW7D 2X75A 4YIKA 2JAWA 4APAA 1XMCA 4NSLA 3GZHA 4IQJM 1C3CA 1XMDA 1XL7A 3R6YA 2D28C 5EYVA 1C3UA 3TV2A 4NLEA 2RJSA 2FELA 2YV5A 3RRPA 2RCNA 4MWOA 4FFXA 4MUMA 1TJWA 2OHYA 2D27A 1Z4JA 2O78A 1Q91A 1Z4IA 4EEIA 3E04A 2NYNA 1XL8A 3CZOA 2QVEA 1FUOA 3KDYA 2FENA 1Q92A 3UNVA 3C8TA 3U19A 4V2RA 1Z4LA 1U15A 1DCNA 2E9FA 4BAAA 5HW2A 4WNLA 5F91A 1JSWA 1DOFA 1KQ7A 5EYTA 2VD6A 1U0LA 4NFLA 1GK2A 3KDZA 3NZ4A 2JAOA 2PTRA 1FURA 3R6QA 1YFMA 3F4SA 4L6CA 1Z4QA 2O7FA 4MX2A 2I7DA 2FUSA 5D6BA 1T6JA 1FUQA 4L6AA 4C6GA 1B8FA 3BHGA 5H8WA 1TJUA 3QBPA 1XLYA 1AUWA 1RE5A 3CRW1 4CQ5A 2O7EA 1TJVA 1J3UA 1T6PA 1W27A 4BABA 2VL7A 1YISA 3OCEA 3R6VA 4ADLA 1U16A
chains in the Genus database with same CATH topology
4C5UA 1HY1A 2QGAB 4C5RA 2O6YA 4HGVA 1Q5NA 1YFEA 2HVGA 3GTDA 2PTQA 1K7WA 1GK3A 5F92A 3RD8A 2NYFA 1VDKA 2YIIA 1Y2MA 1XWOA 1I0AA 1K62A 4EFCA 1FUPA 1TJ7A 4V2QA 2PTSA 2J91A 4FLCA 1HY0A 2RJRA 1EB4A 2O7DA 1GKJA 3NO9A 4APBA 2PFMA 1GKMA 4C5SA 4ADMA 2O7BA 3OCFA 2X75A 4APAA 4NSLA 3GZHA 1C3CA 3R6YA 5EYVA 1C3UA 3TV2A 4NLEA 2RJSA 3RRPA 4FFXA 1TJWA 2OHYA 2O78A 4EEIA 3E04A 2NYNA 3CZOA 2QVEA 1FUOA 3KDYA 3UNVA 3C8TA 4V2RA 1U15A 1DCNA 2E9FA 4BAAA 5HW2A 5F91A 1JSWA 1DOFA 1KQ7A 5EYTA 2VD6A 1GK2A 3KDZA 3NZ4A 2PTRA 1FURA 3R6QA 1YFMA 2O7FA 4MX2A 2FUSA 5D6BA 1T6JA 1FUQA 4C6GA 1B8FA 3BHGA 1TJUA 3QBPA 1AUWA 1RE5A 4CQ5A 2O7EA 1TJVA 1J3UA 1T6PA 1W27A 4BABA 1YISA 3OCEA 3R6VA 4ADLA 1U16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C5U A;  1HY1 A;  2QGA B;  4C5R A;  2O6Y A;  4HGV A;  1Q5N A;  1YFE A;  2HVG A;  3GTD A;  2PTQ A;  1K7W A;  1GK3 A;  5F92 A;  3RD8 A;  2NYF A;  1VDK A;  2YII A;  1Y2M A;  1XWO A;  1I0A A;  1K62 A;  4EFC A;  1FUP A;  1TJ7 A;  4V2Q A;  2PTS A;  2J91 A;  4FLC A;  1HY0 A;  2RJR A;  1EB4 A;  2O7D A;  1GKJ A;  3NO9 A;  4APB A;  2PFM A;  1GKM A;  4C5S A;  4ADM A;  2O7B A;  3OCF A;  2X75 A;  4APA A;  4NSL A;  3GZH A;  1C3C A;  3R6Y A;  5EYV A;  1C3U A;  3TV2 A;  4NLE A;  2RJS A;  3RRP A;  4FFX A;  1TJW A;  2OHY A;  2O78 A;  4EEI A;  3E04 A;  2NYN A;  3CZO A;  2QVE A;  1FUO A;  3KDY A;  3UNV A;  3C8T A;  4V2R A;  1U15 A;  1DCN A;  2E9F A;  4BAA A;  5HW2 A;  5F91 A;  1JSW A;  1DOF A;  1KQ7 A;  5EYT A;  2VD6 A;  1GK2 A;  3KDZ A;  3NZ4 A;  2PTR A;  1FUR A;  3R6Q A;  1YFM A;  2O7F A;  4MX2 A;  2FUS A;  5D6B A;  1T6J A;  1FUQ A;  4C6G A;  1B8F A;  3BHG A;  1TJU A;  3QBP A;  1AUW A;  1RE5 A;  4CQ5 A;  2O7E A;  1TJV A;  1J3U A;  1T6P A;  1W27 A;  4BAB A;  1YIS A;  3OCE A;  3R6V A;  4ADL A;  1U16 A; 
#chains in the Genus database with same CATH topology
 1Z4M A;  4C5U A;  1HY1 A;  2JAR A;  2JAU A;  2QGA B;  4L57 A;  1MH9 A;  4C5R A;  5M0I A;  2O6Y A;  4HGV A;  1Q5N A;  1YFE A;  2HVG A;  3F4T A;  3GTD A;  2PTQ A;  1K7W A;  4YIH A;  1Z4P X;  1GK3 A;  5F92 A;  3RD8 A;  2NYF A;  1VDK A;  2YII A;  1Y2M A;  1XWO A;  2VSF A;  1I0A A;  3U13 A;  1K62 A;  4A15 A;  3CRV A;  4EFC A;  1FUP A;  1TJ7 A;  4V2Q A;  1Z4K A;  3CI0 K;  2PTS A;  2J91 A;  4FLC A;  1HY0 A;  2RJR A;  3F4R A;  1EB4 A;  5M0J A;  2O7D A;  1GKJ A;  3NO9 A;  4APB A;  2PFM A;  1T9H A;  1GKM A;  4C5S A;  3BWV A;  4ADM A;  2O7B A;  4E88 A;  3OCF A;  1IW7 D;  2X75 A;  4YIK A;  2JAW A;  4APA A;  1XMC A;  4NSL A;  3GZH A;  4IQJ M;  1C3C A;  1XMD A;  1XL7 A;  3R6Y A;  2D28 C;  5EYV A;  1C3U A;  3TV2 A;  4NLE A;  2RJS A;  2FEL A;  2YV5 A;  3RRP A;  2RCN A;  4MWO A;  4FFX A;  4MUM A;  1TJW A;  2OHY A;  2D27 A;  1Z4J A;  2O78 A;  1Q91 A;  1Z4I A;  4EEI A;  3E04 A;  2NYN A;  1XL8 A;  3CZO A;  2QVE A;  1FUO A;  3KDY A;  2FEN A;  1Q92 A;  3UNV A;  3C8T A;  3U19 A;  4V2R A;  1Z4L A;  1U15 A;  1DCN A;  2E9F A;  4BAA A;  5HW2 A;  4WNL A;  5F91 A;  1JSW A;  1DOF A;  1KQ7 A;  5EYT A;  2VD6 A;  1U0L A;  4NFL A;  1GK2 A;  3KDZ A;  3NZ4 A;  2JAO A;  2PTR A;  1FUR A;  3R6Q A;  1YFM A;  3F4S A;  4L6C A;  1Z4Q A;  2O7F A;  4MX2 A;  2I7D A;  2FUS A;  5D6B A;  1T6J A;  1FUQ A;  4L6A A;  4C6G A;  1B8F A;  3BHG A;  5H8W A;  1TJU A;  3QBP A;  1XLY A;  1AUW A;  1RE5 A;  3CRW 1;  4CQ5 A;  2O7E A;  1TJV A;  1J3U A;  1T6P A;  1W27 A;  4BAB A;  2VL7 A;  1YIS A;  3OCE A;  3R6V A;  4ADL A;  1U16 A; 
#chains in the Genus database with same CATH homology
 4C5U A;  1HY1 A;  2QGA B;  4C5R A;  2O6Y A;  4HGV A;  1Q5N A;  1YFE A;  2HVG A;  3GTD A;  2PTQ A;  1K7W A;  1GK3 A;  5F92 A;  3RD8 A;  2NYF A;  1VDK A;  2YII A;  1Y2M A;  1XWO A;  1I0A A;  1K62 A;  4EFC A;  1FUP A;  1TJ7 A;  4V2Q A;  2PTS A;  2J91 A;  4FLC A;  1HY0 A;  2RJR A;  1EB4 A;  2O7D A;  1GKJ A;  3NO9 A;  4APB A;  2PFM A;  1GKM A;  4C5S A;  4ADM A;  2O7B A;  3OCF A;  2X75 A;  4APA A;  4NSL A;  3GZH A;  1C3C A;  3R6Y A;  5EYV A;  1C3U A;  3TV2 A;  4NLE A;  2RJS A;  3RRP A;  4FFX A;  1TJW A;  2OHY A;  2O78 A;  4EEI A;  3E04 A;  2NYN A;  3CZO A;  2QVE A;  1FUO A;  3KDY A;  3UNV A;  3C8T A;  4V2R A;  1U15 A;  1DCN A;  2E9F A;  4BAA A;  5HW2 A;  5F91 A;  1JSW A;  1DOF A;  1KQ7 A;  5EYT A;  2VD6 A;  1GK2 A;  3KDZ A;  3NZ4 A;  2PTR A;  1FUR A;  3R6Q A;  1YFM A;  2O7F A;  4MX2 A;  2FUS A;  5D6B A;  1T6J A;  1FUQ A;  4C6G A;  1B8F A;  3BHG A;  1TJU A;  3QBP A;  1AUW A;  1RE5 A;  4CQ5 A;  2O7E A;  1TJV A;  1J3U A;  1T6P A;  1W27 A;  4BAB A;  1YIS A;  3OCE A;  3R6V A;  4ADL A;  1U16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...