3F4TA

Crystal structure of wolbachia pipientis alpha-dsba1 c97a/c146a
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
200
structure length
200
Chain Sequence
ITSNELLLPLPNDKLLGDPKAPILMIEYASLTCYHCSLFHRNVFPKIKEKYIDTGKMLYIFRHFPLDYRGLKAAMLSHAYEKQEDYFNFNKAVFNSIDSWNYYNLSDLTLLQRIAALSNLKQDAFNQAINDKKIMDKIVNDKSLAINKLGITATPIFFIKLNDDKSYIEHNKVKHGGYKELKYFTNVIDKLYGKAIVKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structural and Functional Characterization of the Oxidoreductase alpha-DsbA1 from Wolbachia pipientis
pubmed doi rcsb
source organism Wolbachia pipientis
molecule tags Oxidoreductase
total genus 75
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2008-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.80 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Ribonucleotide Reductase Protein R1; domain 1 3f4tA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3f4tA01
3EE2A 3IR4A 2D2ZA 3VWUA 4D73A 4MH2A 4EUYA 1M0UA 3LWAA 1V98A 3QPMA 2O8VB 2C3NA 6GSSA 3G9BA 2JZRA 4RQRA 2GDRA 2FWHA 1ON4A 2AJQB 1PL1A 4EF0A 1JFUA 4KGIA 3TJGA 5COHA 4HZ4A 3D4TA 2PBJA 5JWOB 1HNBA 4GWRA 5LCZA 2AV4A 1EOHA 3ZL5A 4K9ZA 1ZZYA 5ENUA 2F8FA 1M7TA 3HHVA 3P90A 2VIMA 1QQ2A 2LSTA 3F3RA 3UEMA 4ZL8A 4F0CA 1AQWA 4I8BA 1XZOA 5ID2B 3GKMA 3TCOA 3OR5A 1XOBA 3QMXA 1O7UA 2C3QA 3EYTA 5ECKB 3M8NA 4ZXGA 3K8NA 2B5XA 1PA3A 1J08A 5DQSA 2NDOA 4K7OA 3KH7A 2DIYA 3AY8A 2LKUA 3MDKA 3CBUA 4MK3A 1K0NA 4CW9A 2PWJA 3Q18A 1V2AA 3FZ9A 2L59A 4ZIJA 3RPNA 5DALA 4LMVA 3IHQA 5FT3A 3CYNA 2YV7A 3D5JA 2HFDA 4LLRA 5AISA 4WF5A 2WGRA 7GSSA 3WT2A 3F4TA 4ID0A 3UBLA 1Z6MA 1DBYA 4G9HA 4ZBDA 3EINA 4EXJA 3GX8A 3FZ4A 4IBPA 4ZB8A 2OE0A 1FB6A 4X43A 4WETA 5GSSA 1F2EA 4POKA 1SENA 2B1KA 3NZNA 2RUFA 1T3BA 2H1GA 4J56E 2B5EA 4ECIA 4IVFA 4HOJA 2HYXA 4I97A 1JZWA 3G7YA 4EE0A 3DXBA 1OE8A 3VPQA 1TK5B 3ZIVA 3GSSA 4HDEA 2CVKA 2VAFA 2YOIA 4IW9A 4MLYA 4KAEA 3LXTA 6GSVA 5JWQB 1JLWA 2JL4A 3O76A 2RM5A 4MF7A 1ZOFA 5EY6A 3DGQA 4XS6A 3W8SA 4GSNA 2GQMA 4X1UA 5AIVA 5DJMA 1GUHA 2AYTA 5J9BA 5CAXA 5IMVA 2H71A 4L5OA 14GSA 5KN2A 1QGVA 3A2XA 2I4AA 2HE3A 1ERUA 1BJXA 4MMMA 5G5FA 4IQ1A 2VO4A 4I6XA 1TRUA 2R37A 4HS1A 4DEJA 2H0GA 4JR6A 3HKRA 5LD0A 1FOVA 2EIQA 3UVHA 3F4RA 6GSWA 3NIVA 1TRVA 2EC4A 4L5LA 3GKNA 5KEJA 4F2IA 4WR5A 1QK8A 1VF3A 2HZFA 2YWOA 4MP4A 3E3EA 5CNWA 1YEPA 3J7Yb 4IJIA 1X9MB 1F6MC 2IFQB 5CRHA 4HZ2A 1MDIA 2JSZA 5ECIB 1MEKA 1SYRA 2VD1A 1X0RA 1OKTA 3GH6A 4IP6A 1PD21 3CRTA 3N5OA 1J0FA 1GWCA 2R2JA 2JADA 1W4VA 2OE1A 1F3BA 3I43A 1YY7A 3KJYA 3EMXA 2GT6A 3VFIA 2DIZA 1O85A 2CVBA 2VCWA 2VL2C 3Q19A 2F8AA 1GSSA 3VWWA 2L5LA 5IPGA 2GSSA 1QXHA 2YJ7A 4O5RA 3G7JA 4BA7A 3GHAA 4MH3A 2H01A 1TI1A 1XWKA 2VLVA 1SKRB 4AGSA 2OJLA 2X99A 2P5QA 2RLIA 5ECNB 3KCMA 2GQLA 5GSTA 2YANA 2O7KA 18GSA 5IMZA 3QAVA 9GSSA 6GSTA 3BJ5A 3C71A 3ZRDA 1M9AA 2IPAA 1EZKA 3QOUA 5KN3A 3LFLA 1OC9B 2V2GA 4HU9A 1PN9A 1TRWA 4HQZA 2MMAA 3HJMA 2HI7A 5J5NA 5KN1A 4RI7A 3N9JA 2JZTA 3VI7A 3E0UA 4WBRD 4TR1B 2C0FA 2KLXA 4EC0A 3HXSA 4MJCA 1WMJA 5FHIA 1DSBA 1TP9A 2MMOA 1B9XC 3ZVJA 2V32A 1G0TA 5J9CA 1Z3EA 3WGXA 3F4SA 1SK2A 3ZVJD 2R3XA 5ECOB 2IIYA 2X8CA 3H79A 2CVDA 3WD6A 4Q5QA 3TRPA 3HY2A 3PH9A 1BYEA 1O73A 2REMA 1EV9A 4F0BA 3IK9A 3HD5A 3HVXA 3LGCA 1SK0A 1ZYEA 1MDKA 5B6NA 2IN3A 4GTUA 4CHSA 3CRUA 4WKWA 2VOCA 2H1BA 1U6TA 2FWEA 3ED3A 1S3DA 5ELGA 3ZMLA 3MNGA 3HJPA 4N10A 4NHZA 1GTUA 1HD2A 3VPTA 4BVYA 2RIIA 3F9UA 4OWYA 4BWQA 3L78A 1X5DA 2PMTA 4V2LA 2A4VA 3EWLA 1UC7A 5IMCA 3EURA 5HFIA 2FWGA 1AAZA 1X5CA 3I69A 2VL3A 2L57A 5CRWA 5KN0A 2A2RA 2EIOA 3J7Yk 4LA1A 4IGJA 1WJKA 2H6YA 4E8HA 1T1VA 1A2MA 1SJ6A 1A2LA 2VL9A 4RUVA 5C00A 3TKSA 2BMXA 4XS4B 4J2FA 1ERWA 2HLSA 4KSMA 2HZEA 3F3QA 5IMAA 1EEMA 2X8HA 5AGYA 4PX1A 1F37A 4MJBA 2CV4A 3EU4A 3GTUB 1Q4JA 4GCIA 3GL3A 3UIWA 3Q6OA 3D6IA 1FW1A 1UVZA 1M9BA 2G2QA 3DKSA 2YCDA 3KMNA 2WRTA 1URMA 2QC7A 2H66A 1XW5A 1TXXA 3IE3A 1N8JA 2GS3A 3CTFA 5ECHB 5HR0A 3GN3A 1U3IA 2PVQA 4PNFA 4GLTA 4KDUA 4ZILA 3WGDA 5JCGA 1XBSA 2H30A 5J41A 4MZCA 2V41A 3EVIA 4FIWA 1GLQA 4TXVA 2J23A 1DE2A 1T4ZA 4MA9A 3TJBA 2O87A 1NHOA 3KMOA 3GA4A 1AUCA 4KDYA 3VURA 3IAS2 4ULXA 1R4WA 1ZL9A 1EWXA 4O7HA 2DJKA 3LSZA 5CRGA 5B6MA 3KZQA 1TKDB 3ZFLA 2B1LA 2ZCTA 2KHPA 1FVJA 2LEGA 1KEBA 4WBJA 5D8IA 2GT5A 5G1KA 2C0GA 1TTZA 1J9BA 5IO2A 4TXOA 3HZ4A 4POMA 2FWFA 3O6TA 3LORA 1G7OA 2AUVA 2K8SA 3TJJA 3WYWA 3HJOA 5IPHA 2XBQA 3RBTA 4NAXA 5G31A 5J4UA 2TRCP 5AIXA 1PRXA 4XHMA 3EU3A 1XVWA 2YZHA 3HCZA 4F82A 3FHKA 1EP7A 2MBTA 2FNOA 4EL1A 2OA7A 4TKYA 1XWCA 3UBKA 2I3YA 2IMIA 4V1Ag 5DCHA 4FH8A 17GSA 4KNDA 2YPMA 5IO0A 1SL0B 4IKHA 5B8BA 5J3RA 1R5AA 3LJRA 1Z7RA 1KBNA 2K18A 5IOXA 1XCCA 4YQVA 1UA5A 1PX7A 1F3AA 2GSTA 2K8VA 3GMFA 3DEXA 3WGEA 3M1GA 1DE1A 5CREA 1B8XA 3TKQA 2KOKA 2B3SA 3US3A 4POLA 2P0GA 3KXOA 4NPBA 5IM9A 2QKEA 5IOWA 2H0IA 3TJFA 4N11A 1T8EB 5E4WA 3Q74A 3GFKA 4V2NA 4PURA 4D73B 4DSSA 2OBIA 2H0HA 3QFBC 2C80A 1N2AA 4EO3A 4ZB9A 1QUWA 3F6DA 1U3AA 4PNGA 1GULA 1M2BA 1X5EA 3HYPA 2K9FA 3V1WA 10GSA 4TR3A 3P7XA 4XTSA 3JCML 2YWMA 2YN1A 4KCEA 1AQVA 4NV5A 3PR8A 2IMFA 5EL8A 2LNTA 1O6JA 5G1LA 2NVLA 3C7MA 4ECCA 4IELA 2JU5A 4ML1A 2Z9SA 5ABRA 2DJ1A 4GRFA 3UARA 4MJAA 5HR3A 1OVNA 2E0QA 4OCFA 3ZTLA 5A4UA 2IMDA 4NMUA 4XS1A 4E8EA 1U87A 4HEA2 5ECRB 3FW2A 1T00A 1GNEA 2VCQA 4IHUA 3ZMKA 3FR3A 3LYPA 3IA1A 1XFLA 2WB9A 3UJ1A 4TRXA 1H4OA 1VGLA 2PN8A 2PPTA 2N5AA 3APSA 2GLRA 3GYKA 3VWVA 3QDNA 4YAPA 1PSQA 2FUG2 1PKWA 1YEXA 3L9VA 3FR9A 4IJ3A 1B9YC 1O8XA 4DSQA 3BOAA 3DVWA 3P8WA 3KM6A 4BVXA 5DALB 1XW6A 2PUKC 1X9WB 2X64A 5E59A 1AC1A 4V1Ap 5D9WA 4QL7A 4OD7A 2M80A 3ZREA 5IMDA 1UN2A 4WF4A 5HFKA 3GSTA 2M72A 2DBCA 4G10A 4NWYA 2MZCA 3HVVA 1G6YA 5H5SA 3ME8A 1SJIA 2ZNMA 2H72A 3TKSE 5DJLA 3D22A 2VLUA 1K0BA 3TRXA 4GF0A 2NTOA 19GSA 3TGZA 2I9HA 20GSA 6GSYA 4N30A 5D9VA 5B7CA 2FCHA 2F3MA 3M0FA 4TVEA 4ZBAA 3IC4A 5L71A 2HNLA 3EMPA 2G0FA 4K2DA 4QL9A 2OADA 1TU8A 3U5RE 3CSIA 2GZPA 4DSRA 2CZ3A 1CQHA 1GTIA 3FK8A 1A0FA 5C04A 2R5GA 1X9SB 3IRAA 1WIKA 3KP9A 1SU9A 1GSYA 4MF5A 4DVCA 2WJUA 2H70A 2H6XA 2L4CA 1EEJA 2DJ2A 4OO5A 1BX9A 2H75A 1TRSA 1VRSD 3MAKA 1A23A 4L0UA 4YQMA 1ABAA 1GSDA 1TJDA 4L0WA 4P3YB 4ZL9A 1WWJA 4HQSA 1GTAA 2GZZA 1TK8B 2MMZA 3LYKA 4ML6A 2E7PA 3C8EA 1TK0B 4NXIA 1SD9A 1R7HA 2GSRA 3HDCA 2I1UA 5DAKA 3CMIA 2H1AA 4XIHA 1AW9A 2J9HA 2XBIA 5HQPA 3TDGA 1BG5A 2LS5A 1OC3A 1AIUA 3KH9A 2NPBA 2VCVA 3MWHA 1FVKA 3H8QA 11GSA 1EOGA 16GSA 2V6KA 3GUSA 5IQYA 3IBHA 2CT6A 2DJJA 4Z7XA 3DIEA 3VWXA 2ON7A 4ECBA 2OBKA 4FYUA 4MJEA 3L9SA 1GLPA 2H19A 5A4WA 2X8GA 5CP1A 4PXOA 1EP8A 1M2DA 1NHYA 3GIXA 4N0ZA 3GH9A 1V40A 4KH7A 22GSA 3D4MA 3MSZA 1K3YA 4RQXA 4TR4A 2F9SA 4WXTA 5ECLB 1T4YA 1JHBA 3G7IA 1K0DA 2WCIA 1Z9HA 4OFTA 1Q98A 1G7EA 2FLSA 4K1FA 2B5YA 4MPFA 4I2UA 4BPYA 3FRCA 1FO5A 2QSIA 4K7NA 3TKSC 3KTBA 5D9XA 3GL5A 2HSHA 3BBYA 3ISOA 3KEBA 2OACA 3PINA 4QQ7A 3GV1A 8GSSA 1YKCA 2FA8A 2DJ0A 5G5EA 2YP6A 2B6MA 4HI7A 2H74A 2RUEA 5ID2A 2A2SA 1YDKA 2IJYA 3BCIA 3M9JA 5DCGA 2GTUA 1VF4A 1XWBA 3KTLA 1PMTA 1WP0A 2H73A 3ERFA 1YF1A 3ZFBA 1V57A 1NM3A 4K8MA 1GUKA 3TKRA 5GAND 1K0MA 5CO3A 2MMNA 2YJHA 5ECMB 1ST9A 4JRRA 1ZYQB 1TU7A 3TRQA 2C0EA 3VK9A 4G2EA 1LU4A 4L8EA 4LMWA 4IS0A 2LJAA 1SL1B 3GRXA 2YZUA 3TOTA 4GQFA 1EGRA 4YH2A 4FO5A 2LV3A 1RK4A 4OFMA 2MBSA 3CTGA 2LRNA 4IN0A 5HR2A 4I5QA 3I6AA 4BWSA 3A3TA 1OYJA 1JZOA 2N5FA 5INYA 3BCKA 5A4VA 4HJ2A 1R5PA 2V6OA 2FHEA 1XPVA 3TB2A 1SK1A 1WRYA 4J57E 3QAGA 3U6VA 2YV9A 5GAPD 2BJXA 2H8LA 1S3AA 1BAYA 4ZB6A 4K6XA 2HSYA 2XPEA 1GTBA 1Z6NA 2HRFA 2H6ZA 3UMAA 2FA4A 5GZZB 2I81A 4YAVA 3W8JA 2LJRA 1K0CA 2HZEB 5JCWA 1K0AA 5H5RA 2WS2A 3C73A 2IMEA 1QMVA 4AJ6A 5F8BA 1SD8A 3ME7A 3O3TA 1SJZA 3UVTA 1QFNA 2O85A 2CAQA 12GSA 4NHWA 3VLNA 3R2QA 2C3TA 1S3CA 3C1SA 1BEDA 2HXKA 3H4KA 3QD9A 2CAIA 3UAPA 3RHCA 4Q5RA 2DJ3A 1AXDA 3IAM2 1NSWA 3FZAA 1GRXA 3W6GA 1OC8A 2XPDA 2ALBA 4JEDA 4TOPA 2DMLA 2CZ2A 1MDJA 2IFQA 3LEFA 1OAZA 2PERA 3CXGA 1CQGA 3KP8A 4Q5NA 2LRCA 4ZBBA 1MD4A 2AAWA 1WPIA 1HYUA 3CSHA 3FYGA 3HA9A 4PQ1A 2ES7A 2VCTA 3SBCA 2RM6A 1NW2A 5D96A 1VF1A 4YQUA 4PQIA 5JWRB 1K3LA 3RHBA 1I5GA 1GH2A 1ACVA 1C72A 2YWNA 3GNJA 4OO4A 4H86A 1SYXA 1TOFA 1ERVA 3F8UA 3APQA 1T7PB 2KP1A 4MDCA 4AF2A 1HNAA 4MPGA 3L0HA 4TXOB 1TI3A 1ZMAA 4PUAA 3FR6A 3ERGA 3BD2A 1E6BA 2KP2A 2FD3A 4JBBA 3M9KA 4ECJA 2WZ9A 2OKAA 1TDIA 2DMMA 3S9FA 3M3MA 4X0XA 5IIZA 1V58A 4LL4B 5D93A 4EDZA 3LXZA 4TN8A 3ERWA 3TUEA 1E2YA 1OC9A 4CDOA 2L4QA 1SKWB 2DLXA 3FEUA 2QGVA 3DRNA 4HU7A 5F0GA 1THOA 2DSAA 2YNXA 5F07A 3WT1A 2L6CA 2JACA 3P2AA 1PKZA 3QFAC 1YQ1A 4TR1A 1HQOA 3IDVA 4PQHA 3LG6A 3F0IA 2O89A 2JZSA 1XOAA 3F63A 1OKDA 5CYYA 3GX0A 3TJKA 2MYGA 1GSUA 4TW5A 5ECSA 3KD0A 4GSTA 1A0RP 4IP1A 3A5WA 2WULA 4OMVA 4XRAA 3DVXA 2WFCA 4BL7A 2XC2A 1ERTA 1U88A 3ZZXA 2JSYA 1K0OA 1A8YA 2C4JA 5JCUA 4EVMA 3APOA 1ZGNA 2HT9A 4IQAA 2VUPA 2AB6A 4LL1B 4ZL7A 2CQ9A 4DSSB 3IPZA 4HJMA 1GP1A 2VM2A 4NV2A 3DWVA 4TR0A 1MD3A 2N5BA 5B8AA 1H75A 3D0ZA 4F03A 2FGXA 3LQ7A 3FY7A 4JZQA 1EV4A 2PVOC 3DMLA 4ISDA 13GSA 1YF0A 2PU9C 3H1NA 2EIRA 2AHEA 1XWAA 3F6FA 1WOUA 2GQKA 2TIRA 2F51A 1A24A 4KW6A 4ACSA 2VL2A 1YZXA 4F9ZA 1F9MA 3GKKA 4OFNA 2VD0A 2WDUA 1GL8A 3H93A 5LNKe 1TW9A 4Q5FA 1Z7PA 2PGTA 4KE3A 5D73A 1IYHA 5AN1A 3NOFA 2LQQA 3TOUA 3I9V2 5ECPB 4ILFA 4XRDA 4KSOA 4JR4A 1GSQA 3D21A 2R6KA 4K0GA 2GZYA 5D9TA 4JU5A 2IMKA 4G19A 4XS4A 2BTOT 3QCPA 1RQMA 4WEYA 2K6VA 4RI6A 1MTCA 1PQNA 1ZCPA 3IK7A 2LQOA 1OE7A 3SWLA 3ZITA 1YKAA 5HR1A 4O92A 3HVSA 3GTUA 1K3OA 4GSSA 2V1MA 6GSUA 2H76A 4V2MA 1SKSB 2B7KA 1XW9A 1Y25A 1JZDA 5ELAA 1HNCA 2LJKA 3FZ5A 1BQ7A 3GKXA 1VF2A 1PGTA 1Z5YE 4EKZA 3ZLPA 4EDYA 2LUSA 1GNWA 1B48A 3TKPA 3IXRA 4XCSA 1I9DA 1G6WA 1XXUA 5G30A 4FYBA 4FYCA 4K0NA 1R26A 1A2JA 3RAZA 5EVOA 2LNSA 1WE0A 2NBSA 3QR6A 3ZYWA 4GXZA 1XVQA 2KUCA 2ON5A 2VLTA 3KIJA 1XWGA 2ZUPA 1GSEA 2CX3A 2P5RA 4KA0A 6GSXA 3VI5A 1JLVA 1W89A 2L6DA 1RW1A 2P31A 2L5OA 5IMFA 1M99A 5F05A 4MZBA 1JZRA 5HFGA 1EGOA 4OCEA 1B4QA 3DYRA 1O81A 2CA8A 4MABA 1ILOA 2C1YA 1IYIA 5ECQB 1USBA 3DD3A 3CSJA 5DQYA 3RPPA 1B4PA 1YJ6A 5F06A 1Y6EA 3GURA 2FY6A 1GSFA 1FB0A 3IV4A 5CRDA 2YWIA 2TRXA 4JE1A 3L4NA 3QAWA 1O8WA 4KB3A 3RDWA 2GVPA 2DC5A 4KUNA 2B7JA 5H5QA 2LTKA 4AJ7A 2IL3A 1FHEA 1A8LA 4HUAA 2GSQA 2E2GA 3IOSA 5A5KA 5EPFA 4PUFC 4MF6A 1V9WA 2HRNA 2E2MA 1LJRA 1SL2B 1M2AA 4O32A 2OE3A 4I2TA 5DAKB 5DDLA 1LBKA 4MZWA 2C0DA 2IWTA 2XHFA 2VCZA 1FAAA 3A2WA 2C8UA 4GQCA 4AJ8A 4PGTA 2R4VA 5G2ZA 1XIYA 3FKFA 1FG4A 4K7IA 5DBQA 4MCUA 1KTEA 1ML6A 3HZ8A 1PL2A 2CX4A 5FWGA 1DUGA 4POBA 4KDXA 3L9UA 4KCAA 3UL3A 3C1RA 4WR4A 4N0VA 1KNGA 1THXA 3EC3A 1AQXA 2GGTA 1GUMA 3PGTA 2VM1A 5DVBA 3ZIJA 4KX4A 2VCXA 2H1DA 2LRTA 2M46A 1PX6A 3A2VA 3KGKA 3UOMA 3E9JB
chains in the Genus database with same CATH superfamily
3EE2A 3IR4A 2D2ZA 3VWUA 4D73A 4MH2A 4EUYA 1M0UA 3LWAA 1V98A 3QPMA 2O8VB 2C3NA 6GSSA 3G9BA 2JZRA 4RQRA 2GDRA 2FWHA 1ON4A 2AJQB 1PL1A 4EF0A 1JFUA 4KGIA 3TJGA 5COHA 4HZ4A 3D4TA 2PBJA 5JWOB 1HNBA 4GWRA 5LCZA 2AV4A 1EOHA 3ZL5A 4K9ZA 1ZZYA 5ENUA 3NO9A 2F8FA 1M7TA 3HHVA 3P90A 2VIMA 1XG8A 1QQ2A 2LSTA 3F3RA 3UEMA 4ZL8A 4F0CA 1AQWA 4I8BA 1XZOA 5ID2B 3GKMA 3TCOA 3OR5A 1XOBA 3QMXA 1O7UA 2C3QA 3EYTA 5ECKB 3M8NA 4ZXGA 3K8NA 2B5XA 1PA3A 1J08A 5DQSA 2NDOA 5HW2A 4K7OA 3KH7A 2DIYA 3AY8A 2LKUA 3MDKA 3CBUA 4MK3A 1K0NA 4CW9A 2PWJA 3Q18A 1V2AA 3FZ9A 2L59A 4ZIJA 3RPNA 5DALA 4LMVA 2DKIA 3IHQA 5FT3A 3CYNA 1DCNA 2YV7A 3D5JA 4MUMA 2HFDA 4LLRA 5AISA 4YKFA 4YIHA 4WF5A 2WGRA 7GSSA 3WT2A 3F4TA 4ID0A 3UBLA 1Z6MA 5KOXA 1DBYA 4G9HA 4ZBDA 3EINA 4EXJA 3RD8A 3GX8A 3FZ4A 4K5SA 4IBPA 4ZB8A 2OE0A 1FB6A 4X43A 1U15A 4WETA 5GSSA 1F2EA 4POKA 1SENA 2B1KA 3NZNA 2RUFA 1T3BA 2H1GA 1VDKA 4J56E 2B5EA 4ECIA 4IVFA 4HOJA 2HYXA 4I97A 1JZWA 3G7YA 4EE0A 3DXBA 1OE8A 3VPQA 1TK5B 3ZIVA 3GSSA 4HDEA 2CVKA 2VAFA 2YOIA 4IW9A 4MLYA 4KAEA 3LXTA 6GSVA 5JWQB 1JLWA 2JL4A 1Z4JA 3O76A 2RM5A 4MF7A 1ZOFA 5EY6A 3DGQA 4XS6A 3W8SA 4GSNA 2GQMA 4X1UA 5AIVA 5DJMA 1GUHA 2AYTA 1Q92A 5J9BA 5CAXA 5IMVA 2H71A 4L5OA 14GSA 5KN2A 1QGVA 3A2XA 2I4AA 2HE3A 3MIXA 1ERUA 1BJXA 4MMMA 5G5FA 4IQ1A 2VO4A 3RRPA 4I6XA 1TRUA 2R37A 4HS1A 1Z4QA 4DEJA 2H0GA 4JR6A 3HKRA 5LD0A 1FOVA 2HRKA 2EIQA 3UVHA 3F4RA 6GSWA 3NIVA 1TRVA 2EC4A 4L5LA 1HY0A 3GKNA 5KEJA 4F2IA 4WR5A 1QK8A 1VF3A 2HZFA 2YWOA 4MP4A 3E3EA 5CNWA 1YEPA 3J7Yb 4IJIA 1X9MB 1F6MC 2IFQB 5CRHA 3R3EA 4HZ2A 1MDIA 2JSZA 5ECIB 5D6BA 1MEKA 1SYRA 2VD1A 1X0RA 1OKTA 3GH6A 4IP6A 1PD21 3CRTA 3N5OA 1J0FA 1GWCA 2R2JA 2JADA 1W4VA 2OE1A 1F3BA 3I43A 1YY7A 3KJYA 3EMXA 2GT6A 2YV5A 3VFIA 2DIZA 1O85A 2CVBA 2VCWA 2VL2C 3Q19A 2F8AA 1GSSA 3VWWA 2L5LA 5IPGA 2GSSA 1QXHA 2YJ7A 4O5RA 3G7JA 4BA7A 3GHAA 2QGAB 2D27A 4MH3A 2H01A 1TI1A 1XWKA 2VLVA 1SKRB 4AGSA 2OJLA 2X99A 2P5QA 2RLIA 5ECNB 3KCMA 2GQLA 5GSTA 2YANA 2O7KA 18GSA 5IMZA 3QAVA 9GSSA 4A5PA 6GSTA 3BJ5A 3C71A 3ZRDA 1M9AA 2IPAA 1EZKA 3QOUA 5KN3A 3LFLA 1OC9B 2V2GA 4HU9A 1PN9A 1TRWA 4HQZA 2MMAA 1Z4IA 3HJMA 2HI7A 5J5NA 5KN1A 4RI7A 3N9JA 2JZTA 3VI7A 3E0UA 4WBRD 1TJVA 4TR1B 2C0FA 2KLXA 4EC0A 4E88A 3HXSA 4MJCA 1WMJA 5FHIA 1DSBA 1TP9A 2MMOA 1B9XC 3ZVJA 2V32A 1G0TA 5J9CA 3LW9A 1Z3EA 3WGXA 3F4SA 1SK2A 3ZVJD 2R3XA 4BL7B 5ECOB 2IIYA 3OCFA 2X8CA 3H79A 2CVDA 3WD6A 4Q5QA 3TRPA 3HY2A 3PH9A 4ADLA 1BYEA 1O73A 2REMA 1EV9A 4F0BA 3IK9A 3HD5A 3HVXA 3LGCA 2A4HA 1SK0A 1ZYEA 1MDKA 5B6NA 2IN3A 4GTUA 4CHSA 3CRUA 4WKWA 2VOCA 2H1BA 1U6TA 2FWEA 3ED3A 1S3DA 1FUQA 5ELGA 3ZMLA 3MNGA 3HJPA 4N10A 4NHZA 1GTUA 1HD2A 3VPTA 4BVYA 2RIIA 3F9UA 4OWYA 4BWQA 3L78A 1X5DA 2PMTA 4V2LA 2A4VA 3EWLA 1UC7A 5IMCA 3EURA 5HFIA 2FWGA 1AAZA 1X5CA 1XWOA 3I69A 2E9FA 2VL3A 2L57A 5CRWA 1J3UA 5KN0A 2A2RA 2EIOA 4USSA 3J7Yk 4LA1A 4IGJA 1WJKA 2H6YA 4E8HA 1T1VA 1A2MA 1SJ6A 3GTDA 1A2LA 2VL9A 4RUVA 5C00A 3TKSA 2BMXA 4XS4B 4J2FA 1ERWA 2X4AA 2HLSA 4KSMA 2HZEA 4FQUA 3F3QA 5IMAA 1EEMA 2X8HA 5AGYA 4PX1A 1F37A 4MJBA 2CV4A 4G0KA 3EU4A 4HGVA 3GTUB 1Q4JA 4GCIA 3GL3A 3UIWA 3Q6OA 2R0GA 3D6IA 1FW1A 1UVZA 1M9BA 2G2QA 3DKSA 2YCDA 3KMNA 2WRTA 1URMA 2QC7A 2H66A 1XW5A 1TXXA 3IE3A 1N8JA 2GS3A 3CTFA 5ECHB 5HR0A 3GN3A 1U3IA 2PVQA 4PNFA 4GLTA 4KDUA 4ZILA 3WGDA 4NFLA 5JCGA 1XBSA 2H30A 5J41A 4MZCA 2V41A 3EVIA 4FIWA 2PTQA 1GLQA 4APAA 4TXVA 2J23A 1DE2A 1T4ZA 4MA9A 3TJBA 2O87A 1NHOA 3KMOA 3GA4A 1AUCA 4KDYA 3VURA 3IAS2 4ULXA 1R4WA 1ZL9A 1EWXA 4O7HA 2DJKA 3LSZA 5CRGA 5B6MA 3KZQA 1TKDB 2FUSA 1Z4PX 3ZFLA 2B1LA 2ZCTA 2KHPA 1FVJA 2LEGA 1KEBA 4WBJA 5D8IA 2GT5A 5G1KA 2C0GA 1TTZA 1J9BA 5IO2A 4TXOA 3HZ4A 4POMA 2FWFA 3O6TA 3LORA 1G7OA 2AUVA 2K8SA 3TJJA 3WYWA 3HJOA 5IPHA 2XBQA 3GZHA 3RBTA 4NAXA 3BHGA 5G31A 5J4UA 3TV2A 2TRCP 5AIXA 1PRXA 4XHMA 3EU3A 1XVWA 2YZHA 3HCZA 4F82A 3FHKA 1EP7A 2MBTA 2FNOA 4EL1A 2OA7A 4TKYA 1XWCA 3UBKA 1PFOA 2I3YA 2IMIA 4V1Ag 5DCHA 3A5IA 4FH8A 17GSA 4KNDA 2YPMA 5IO0A 1SL0B 4IKHA 5B8BA 3FMWA 1R5AA 3LJRA 5J3RA 1Z7RA 1KBNA 2K18A 5IOXA 1XCCA 4YQVA 1UA5A 1PX7A 1F3AA 2GSTA 2K8VA 3GMFA 3DEXA 3WGEA 3M1GA 1DE1A 5CREA 1B8XA 3TKQA 2KOKA 2B3SA 1FUPA 3US3A 4POLA 2P0GA 4MWOA 3KXOA 4NPBA 4L6AA 5IM9A 2QKEA 5IOWA 2H0IA 3TJFA 4N11A 1T8EB 3CI0K 5E4WA 3Q74A 3GFKA 4V2NA 4PURA 2A2PA 4D73B 4DSSA 2PFMA 2OBIA 2H0HA 3QFBC 2C80A 1N2AA 4EO3A 4ZB9A 1IW7D 1QUWA 3F6DA 1U3AA 3CQFA 4PNGA 1GULA 1I0AA 1M2BA 1X5EA 2HSMA 3HYPA 2K9FA 3V1WA 10GSA 4TR3A 3P7XA 4XTSA 3JCML 2X75A 2YWMA 2YN1A 4KCEA 1AQVA 4NV5A 3PR8A 2IMFA 5EL8A 2LNTA 1O6JA 5G1LA 2NVLA 3C7MA 4ECCA 4IELA 2JU5A 1Z4KA 4ML1A 2Z9SA 5ABRA 2DJ1A 4GRFA 3UARA 4MJAA 5HR3A 1OVNA 2E0QA 4OCFA 3ZTLA 2JARA 5A4UA 2IMDA 4NMUA 4XS1A 4E8EA 1U87A 4HEA2 5ECRB 3FW2A 1T00A 1M3JA 1GNEA 2DKHA 2VCQA 4IHUA 3ZMKA 3FR3A 3LYPA 3IA1A 1XFLA 2WB9A 3UJ1A 4TRXA 1H4OA 1U0LA 1VGLA 2PN8A 2PPTA 2N5AA 3APSA 2GLRA 3GYKA 3VWVA 3QDNA 4YAPA 1PSQA 2FUG2 1PKWA 1YEXA 3L9VA 3FR9A 4IJ3A 1B9YC 1O8XA 4DSQA 3BOAA 3DVWA 3P8WA 3KM6A 4BVXA 5DALB 1XW6A 2PUKC 1X9WB 2X64A 5E59A 1AC1A 4V1Ap 5D9WA 4QL7A 4OD7A 2M80A 3ZREA 1C3CA 5IMDA 1UN2A 4WF4A 5HFKA 3GSTA 2QA2A 2M72A 4APBA 1C3UA 2DBCA 4G10A 4NWYA 2MZCA 3HVVA 1G6YA 2HVGA 5H5SA 3ME8A 1KQ7A 1SJIA 2ZNMA 2H72A 3TKSE 5DJLA 3D22A 2VLUA 1K0BA 3TRXA 4GF0A 2NTOA 19GSA 3TGZA 2I9HA 20GSA 6GSYA 4N30A 5D9VA 5B7CA 2FCHA 2F3MA 3M0FA 4TVEA 4ZBAA 3IC4A 5L71A 2HNLA 3EMPA 2G0FA 4K2DA 4QL9A 2OADA 1TU8A 3U5RE 3CSIA 2GZPA 4DSRA 2CZ3A 1CQHA 1GTIA 3FK8A 1A0FA 5C04A 2R5GA 4Z2UA 1X9SB 3IRAA 1WIKA 3KP9A 1SU9A 1Z4MA 1GSYA 4MF5A 4DVCA 2WJUA 2H70A 2H6XA 2L4CA 3R6QA 1EEJA 2DJ2A 4OO5A 1BX9A 3BWVA 1TRSA 1VRSD 2H75A 3MAKA 1A23A 4L0UA 4YQMA 1ABAA 1GSDA 1TJDA 4L0WA 4P3YB 4ZL9A 1WWJA 4HQSA 1GTAA 2GZZA 1TK8B 2MMZA 3LYKA 4ML6A 2E7PA 3C8EA 1TK0B 4NXIA 1SD9A 1R7HA 2GSRA 3HDCA 2I1UA 5DAKA 3CMIA 2H1AA 4XIHA 1AW9A 4L57A 2J9HA 2XBIA 5HQPA 4PTSA 3EPTA 3TDGA 1BG5A 2LS5A 1OC3A 1AIUA 3KH9A 2NPBA 2VCVA 3MWHA 1FVKA 3H8QA 11GSA 1EOGA 16GSA 2V6KA 3GUSA 5IQYA 3IBHA 2CT6A 2DJJA 4Z7XA 2JAOA 3DIEA 3VWXA 2ON7A 4ECBA 2OBKA 4FYUA 4MJEA 3L9SA 1GLPA 2H19A 4HSCX 4K2XA 5A4WA 2X8GA 5CP1A 4PXOA 4YIKA 1EP8A 1M2DA 1NHYA 3GIXA 4N0ZA 3GH9A 1V40A 4KH7A 1TJWA 22GSA 3D4MA 3MSZA 1DOFA 1K3YA 1TJUA 4RQXA 2F9SA 4TR4A 4WXTA 5ECLB 1T4YA 1JHBA 3G7IA 1K0DA 3U13A 2WCIA 1Z9HA 4OFTA 1Q98A 1G7EA 4BIKA 2FLSA 4K1FA 2B5YA 4MPFA 4I2UA 4BPYA 3FRCA 1FO5A 2QSIA 4K7NA 3TKSC 3KTBA 5D9XA 4ICYA 3GL5A 4EFCA 2HSHA 3BBYA 3ISOA 3KEBA 2OACA 4O5QA 3PINA 4QQ7A 3GV1A 1FURA 8GSSA 1YKCA 2FA8A 4EEIA 2DJ0A 5G5EA 2YP6A 2B6MA 4HI7A 2H74A 2RUEA 5ID2A 2A2SA 1YDKA 4MX2A 2IJYA 3BCIA 3M9JA 3PPUA 5DCGA 4NSLA 2GTUA 1VF4A 1XWBA 3KTLA 1PMTA 1WP0A 2H73A 4K5RA 5F92A 3ERFA 1YF1A 4L6CA 4YKGA 3ZFBA 1V57A 1NM3A 4K8MA 1GUKA 5BMUA 3TKRA 5GAND 1K0MA 5CO3A 2MMNA 2YJHA 5ECMB 1ST9A 4JRRA 1ZYQB 1TU7A 3TRQA 2C0EA 3VK9A 4G2EA 1LU4A 4L8EA 4LMWA 4IS0A 2LJAA 1SL1B 3GRXA 2YZUA 3TOTA 4GQFA 1EGRA 4YH2A 4FO5A 2LV3A 1RK4A 4OFMA 2MBSA 3CTGA 2LRNA 4IN0A 3HVNA 4Z2TA 5HR2A 1RE5A 2RCNA 4I5QA 3I6AA 4BWSA 3A3TA 1OYJA 1JZOA 2N5FA 5INYA 1Q5NA 3BCKA 5A4VA 4BVYB 4HJ2A 1R5PA 2V6OA 2FHEA 1XPVA 3TB2A 1SK1A 1WRYA 4J57E 1YFMA 3QAGA 3U6VA 2YV9A 5GAPD 4O5UA 2BJXA 2H8LA 2X49A 1S3AA 1BAYA 4ZB6A 4K6XA 2HSYA 2XPEA 1GTBA 1Z6NA 2HRFA 2H6ZA 3UMAA 2FA4A 5GZZB 2I81A 4YAVA 3W8JA 2HRAA 2LJRA 1K0CA 2HZEB 5JCWA 1K0AA 5H5RA 2WS2A 3C73A 2IMEA 1QMVA 4AJ6A 5F8BA 4NLEA 1SD8A 3ME7A 3O3TA 1SJZA 3UVTA 1QFNA 2O85A 2CAQA 12GSA 3MYDA 4NHWA 3VLNA 3R2QA 2C3TA 1S3CA 3C1SA 1BEDA 2HXKA 3H4KA 3QD9A 2CAIA 3UAPA 3RHCA 4Q5RA 2DJ3A 1AXDA 3IAM2 1NSWA 3FZAA 1GRXA 3W6GA 1OC8A 2XPDA 2ALBA 4JEDA 4TOPA 2DMLA 2CZ2A 1MDJA 2IFQA 3LEFA 1OAZA 2PTRA 2PERA 4G0IA 3CXGA 1CQGA 5KOWA 3KP8A 2R0PA 4Q5NA 2LRCA 4ZBBA 1MD4A 2AAWA 1WPIA 1HYUA 3CSHA 3FYGA 3HA9A 4PQ1A 2ES7A 2VCTA 3SBCA 2RM6A 1NW2A 5D96A 1VF1A 4YQUA 4PQIA 5JWRB 1K3LA 3RHBA 1I5GA 1GH2A 3OCEA 1ACVA 1C72A 2YWNA 3GNJA 4OO4A 4H86A 1SYXA 1TOFA 1ERVA 3F8UA 3APQA 1T7PB 2KP1A 4MDCA 4AF2A 1YFEA 1HNAA 4MPGA 3L0HA 4TXOB 1TI3A 4CY6A 1ZMAA 4PUAA 3FR6A 1FUOA 3ERGA 3BD2A 1E6BA 2KP2A 2FD3A 4JBBA 3M9KA 4ECJA 2WZ9A 2OKAA 3E04A 1TDIA 2DMMA 3S9FA 3M3MA 4X0XA 5IIZA 1V58A 4LL4B 5D93A 4EDZA 3LXZA 4TN8A 3ERWA 3TUEA 1E2YA 1OC9A 4CDOA 1FOHA 2L4QA 1SKWB 2DLXA 3FEUA 2QGVA 1M3IA 3DRNA 2JAWA 4HU7A 5F0GA 1THOA 2DSAA 1PN0A 2YNXA 5F07A 2JAUA 2I7DA 3WT1A 2L6CA 2JACA 3P2AA 1PKZA 3QFAC 1YQ1A 4TR1A 1HQOA 3IDVA 4PQHA 3LG6A 3F0IA 2O89A 2JZSA 1XOAA 3F63A 1OKDA 5CYYA 3GX0A 3TJKA 2MYGA 1GSUA 4TW5A 2R0CA 5ECSA 3KD0A 4GSTA 1A0RP 4IP1A 3A5WA 2WULA 4OMVA 4XRAA 3DVXA 2WFCA 4BL7A 2XC2A 1ERTA 1U88A 3ZZXA 2JSYA 1K0OA 1A8YA 2C4JA 5JCUA 1T9HA 3APOA 4EVMA 1S3RA 1ZGNA 2HT9A 4IQAA 2VUPA 1Z4LA 2AB6A 4LL1B 4ZL7A 2CQ9A 4DSSB 3IPZA 4HJMA 1GP1A 2VM2A 4NV2A 3DWVA 4TR0A 1MD3A 2N5BA 5B8AA 1H75A 3D0ZA 3C8TA 4F03A 1K62A 2FGXA 3LQ7A 3FY7A 4JZQA 3QBPA 1EV4A 5F91A 4ADMA 2PVOC 3DMLA 4ISDA 13GSA 1YF0A 2PU9C 4G0LA 3H1NA 2EIRA 2AHEA 1XWAA 3F6FA 1WOUA 2GQKA 2TIRA 2F51A 1A24A 4KW6A 4ACSA 2VL2A 1YZXA 4X4JA 1F9MA 4F9ZA 3GKKA 4OFNA 2VD0A 2WDUA 1GL8A 3H93A 5LNKe 1TW9A 4Q5FA 1Z7PA 2PGTA 4KE3A 5D73A 1IYHA 5AN1A 3NOFA 2LQQA 3TOUA 3I9V2 5ECPB 4ILFA 4XRDA 4KSOA 4JR4A 1GSQA 3D21A 2R6KA 4K0GA 2GZYA 4KF9A 5D9TA 4JU5A 2IMKA 1U16A 4G19A 4XS4A 2BTOT 3QCPA 1RQMA 4WEYA 2K6VA 4RI6A 1MTCA 1PQNA 1ZCPA 3IK7A 2LQOA 1K7WA 1OE7A 1ZYNA 3SWLA 3ZITA 1YKAA 5HR1A 4O92A 3HVSA 3GTUA 1K3OA 4GSSA 1Q91A 2V1MA 6GSUA 2H76A 4V2MA 1MH9A 4BVXB 1SKSB 2B7KA 1XW9A 1Y25A 1JZDA 5ELAA 1HNCA 2D28C 2LJKA 3FZ5A 1BQ7A 3GKXA 1VF2A 1PGTA 1Z5YE 4EKZA 4CY8A 3ZLPA 4EDYA 2LUSA 1GNWA 1B48A 4Z2RA 3TKPA 3IXRA 4XCSA 1I9DA 1G6WA 1XXUA 1ZYPA 5G30A 4FYBA 4FYCA 4K0NA 2PTSA 1R26A 1A2JA 3RAZA 5EVOA 2LNSA 1WE0A 2NBSA 2QA1A 3QR6A 3ZYWA 4GXZA 1XVQA 2KUCA 2ON5A 2VLTA 3KIJA 1XWGA 2ZUPA 1AUWA 1GSEA 2CX3A 2P5RA 4KA0A 3R6VA 6GSXA 3VI5A 1JLVA 1W89A 2L6DA 1RW1A 2P31A 2L5OA 5IMFA 1M99A 5F05A 4MZBA 1JZRA 5HFGA 1EGOA 4OCEA 1B4QA 3DYRA 1O81A 2CA8A 4MABA 1ILOA 2C1YA 1IYIA 5ECQB 1USBA 3DD3A 3CSJA 5DQYA 3RPPA 1B4PA 1YJ6A 5F06A 1Y6EA 3GURA 2FY6A 1GSFA 1FB0A 3IV4A 5CRDA 2YWIA 1TJ7A 2TRXA 4JE1A 3L4NA 3QAWA 1O8WA 4KB3A 3RDWA 2GVPA 2DC5A 4KUNA 2B7JA 5H5QA 2LTKA 4AJ7A 2IL3A 1FHEA 1A8LA 4MNNA 4HUAA 4IQJM 2GSQA 2E2GA 3IOSA 5A5KA 5EPFA 4PUFC 4MF6A 1V9WA 2HRNA 2E2MA 1LJRA 5BRTA 1SL2B 1HY1A 1M2AA 4O32A 2OE3A 4I2TA 5DAKB 5DDLA 1LBKA 4MZWA 2C0DA 2IWTA 2XHFA 2VCZA 1FAAA 3A2WA 1JSWA 2C8UA 4GQCA 4AJ8A 4PGTA 4EIQA 2R4VA 5G2ZA 2UZ8A 1XIYA 3FKFA 1FG4A 4K7IA 5DBQA 4MCUA 1KTEA 1ML6A 3HZ8A 1PL2A 2CX4A 5FWGA 1DUGA 3IHGA 4POBA 4KDXA 3L9UA 4KCAA 3UL3A 3C1RA 4WR4A 4N0VA 1KNGA 1THXA 3EC3A 1AQXA 2GGTA 1GUMA 3PGTA 2VM1A 5DVBA 3ZIJA 3U19A 3IC8A 4KX4A 4EIPA 2VCXA 2H1DA 2LRTA 2M46A 1PX6A 3A2VA 3KGKA 3UOMA 3E9JB
chains in the Genus database with same CATH topology
3EE2A 3IR4A 2D2ZA 3VWUA 4D73A 4MH2A 4EUYA 1M0UA 3LWAA 1V98A 3QPMA 2O8VB 2C3NA 6GSSA 3G9BA 2JZRA 4RQRA 2GDRA 2FWHA 1ON4A 2AJQB 1PL1A 4EF0A 1JFUA 4KGIA 3TJGA 5COHA 4HZ4A 3D4TA 2PBJA 5JWOB 1HNBA 4GWRA 5LCZA 2AV4A 1EOHA 3ZL5A 4K9ZA 1ZZYA 5ENUA 2F8FA 1M7TA 3HHVA 3P90A 2VIMA 1QQ2A 2LSTA 3F3RA 3UEMA 4ZL8A 4F0CA 1AQWA 4I8BA 1XZOA 5ID2B 3GKMA 3TCOA 3OR5A 1XOBA 3QMXA 1O7UA 2C3QA 3EYTA 5ECKB 3M8NA 4ZXGA 3K8NA 2B5XA 1PA3A 1J08A 5DQSA 2NDOA 4K7OA 3KH7A 2DIYA 3AY8A 2LKUA 3MDKA 3CBUA 4MK3A 1K0NA 4CW9A 2PWJA 3Q18A 1V2AA 3FZ9A 2L59A 4ZIJA 3RPNA 5DALA 4LMVA 2DKIA 3IHQA 5FT3A 3CYNA 2YV7A 3D5JA 2HFDA 4LLRA 5AISA 4YKFA 4WF5A 2WGRA 7GSSA 3WT2A 3F4TA 4ID0A 3UBLA 1Z6MA 5KOXA 1DBYA 4G9HA 4ZBDA 3EINA 4EXJA 3GX8A 3FZ4A 4K5SA 4IBPA 4ZB8A 2OE0A 1FB6A 4X43A 4WETA 5GSSA 1F2EA 4POKA 1SENA 2B1KA 3NZNA 2RUFA 1T3BA 2H1GA 4J56E 2B5EA 4ECIA 4IVFA 4HOJA 2HYXA 4I97A 1JZWA 3G7YA 4EE0A 3DXBA 1OE8A 3VPQA 1TK5B 3ZIVA 3GSSA 4HDEA 2CVKA 2VAFA 2YOIA 4IW9A 4MLYA 4KAEA 3LXTA 6GSVA 5JWQB 1JLWA 2JL4A 3O76A 2RM5A 4MF7A 1ZOFA 5EY6A 3DGQA 4XS6A 3W8SA 4GSNA 2GQMA 4X1UA 5AIVA 5DJMA 1GUHA 2AYTA 5J9BA 5CAXA 5IMVA 2H71A 4L5OA 14GSA 5KN2A 1QGVA 3A2XA 2I4AA 2HE3A 3MIXA 1ERUA 1BJXA 4MMMA 5G5FA 4IQ1A 2VO4A 4I6XA 1TRUA 2R37A 4HS1A 4DEJA 2H0GA 4JR6A 3HKRA 5LD0A 1FOVA 2HRKA 2EIQA 3UVHA 3F4RA 6GSWA 3NIVA 1TRVA 2EC4A 4L5LA 3GKNA 5KEJA 4F2IA 4WR5A 1QK8A 1VF3A 2HZFA 2YWOA 4MP4A 3E3EA 5CNWA 1YEPA 3J7Yb 4IJIA 1X9MB 1F6MC 2IFQB 5CRHA 3R3EA 4HZ2A 1MDIA 2JSZA 5ECIB 1MEKA 1SYRA 2VD1A 1X0RA 1OKTA 3GH6A 4IP6A 1PD21 3CRTA 3N5OA 1J0FA 1GWCA 2R2JA 2JADA 1W4VA 2OE1A 1F3BA 3I43A 1YY7A 3KJYA 3EMXA 2GT6A 3VFIA 2DIZA 1O85A 2CVBA 2VCWA 2VL2C 3Q19A 2F8AA 1GSSA 3VWWA 2L5LA 5IPGA 2GSSA 1QXHA 2YJ7A 4O5RA 3G7JA 4BA7A 3GHAA 2D27A 4MH3A 2H01A 1TI1A 1XWKA 2VLVA 1SKRB 4AGSA 2OJLA 2X99A 2P5QA 2RLIA 5ECNB 3KCMA 2GQLA 5GSTA 2YANA 2O7KA 18GSA 5IMZA 3QAVA 9GSSA 4A5PA 6GSTA 3BJ5A 3C71A 3ZRDA 1M9AA 2IPAA 1EZKA 3QOUA 5KN3A 3LFLA 1OC9B 2V2GA 4HU9A 1PN9A 1TRWA 4HQZA 2MMAA 3HJMA 2HI7A 5J5NA 5KN1A 4RI7A 3N9JA 2JZTA 3VI7A 3E0UA 4WBRD 4TR1B 2C0FA 2KLXA 4EC0A 3HXSA 4MJCA 1WMJA 5FHIA 1DSBA 1TP9A 2MMOA 1B9XC 3ZVJA 2V32A 1G0TA 5J9CA 3LW9A 1Z3EA 3WGXA 3F4SA 1SK2A 3ZVJD 2R3XA 4BL7B 5ECOB 2IIYA 2X8CA 3H79A 2CVDA 3WD6A 4Q5QA 3TRPA 3HY2A 3PH9A 1BYEA 1O73A 2REMA 1EV9A 4F0BA 3IK9A 3HD5A 3HVXA 3LGCA 2A4HA 1SK0A 1ZYEA 1MDKA 5B6NA 2IN3A 4GTUA 4CHSA 3CRUA 4WKWA 2VOCA 2H1BA 1U6TA 2FWEA 3ED3A 1S3DA 5ELGA 3ZMLA 3MNGA 3HJPA 4N10A 4NHZA 1GTUA 1HD2A 3VPTA 4BVYA 2RIIA 3F9UA 4OWYA 4BWQA 3L78A 1X5DA 2PMTA 4V2LA 2A4VA 3EWLA 1UC7A 5IMCA 3EURA 5HFIA 2FWGA 1AAZA 1X5CA 3I69A 2VL3A 2L57A 5CRWA 5KN0A 2A2RA 2EIOA 4USSA 3J7Yk 4LA1A 4IGJA 1WJKA 2H6YA 4E8HA 1T1VA 1A2MA 1SJ6A 1A2LA 2VL9A 4RUVA 5C00A 3TKSA 2BMXA 4XS4B 4J2FA 1ERWA 2X4AA 2HLSA 4KSMA 2HZEA 4FQUA 3F3QA 5IMAA 1EEMA 2X8HA 5AGYA 4PX1A 1F37A 4MJBA 2CV4A 4G0KA 3EU4A 3GTUB 1Q4JA 4GCIA 3GL3A 3UIWA 3Q6OA 2R0GA 3D6IA 1FW1A 1UVZA 1M9BA 2G2QA 3DKSA 2YCDA 3KMNA 2WRTA 1URMA 2QC7A 2H66A 1XW5A 1TXXA 3IE3A 1N8JA 2GS3A 3CTFA 5ECHB 5HR0A 3GN3A 1U3IA 2PVQA 4PNFA 4GLTA 4KDUA 4ZILA 3WGDA 5JCGA 1XBSA 2H30A 5J41A 4MZCA 2V41A 3EVIA 4FIWA 1GLQA 4TXVA 2J23A 1DE2A 1T4ZA 4MA9A 3TJBA 2O87A 1NHOA 3KMOA 3GA4A 1AUCA 4KDYA 3VURA 3IAS2 4ULXA 1R4WA 1ZL9A 1EWXA 4O7HA 2DJKA 3LSZA 5CRGA 5B6MA 3KZQA 1TKDB 3ZFLA 2B1LA 2ZCTA 2KHPA 1FVJA 2LEGA 1KEBA 4WBJA 5D8IA 2GT5A 5G1KA 2C0GA 1TTZA 1J9BA 5IO2A 4TXOA 3HZ4A 4POMA 2FWFA 3O6TA 3LORA 1G7OA 2AUVA 2K8SA 3TJJA 3WYWA 3HJOA 5IPHA 2XBQA 3RBTA 4NAXA 5G31A 5J4UA 2TRCP 5AIXA 1PRXA 4XHMA 3EU3A 1XVWA 2YZHA 3HCZA 4F82A 3FHKA 1EP7A 2MBTA 2FNOA 4EL1A 2OA7A 4TKYA 1XWCA 3UBKA 2I3YA 2IMIA 4V1Ag 5DCHA 3A5IA 4FH8A 17GSA 4KNDA 2YPMA 5IO0A 1SL0B 4IKHA 5B8BA 3FMWA 1R5AA 3LJRA 5J3RA 1Z7RA 1KBNA 2K18A 5IOXA 1XCCA 4YQVA 1UA5A 1PX7A 1F3AA 2GSTA 2K8VA 3GMFA 3DEXA 3WGEA 3M1GA 1DE1A 5CREA 1B8XA 3TKQA 2KOKA 2B3SA 3US3A 4POLA 2P0GA 3KXOA 4NPBA 5IM9A 2QKEA 5IOWA 2H0IA 3TJFA 4N11A 1T8EB 5E4WA 3Q74A 3GFKA 4V2NA 4PURA 2A2PA 4D73B 4DSSA 2OBIA 2H0HA 3QFBC 2C80A 1N2AA 4EO3A 4ZB9A 1IW7D 1QUWA 3F6DA 1U3AA 4PNGA 1GULA 1M2BA 1X5EA 2HSMA 3HYPA 2K9FA 3V1WA 10GSA 4TR3A 3P7XA 4XTSA 3JCML 2YWMA 2YN1A 4KCEA 1AQVA 4NV5A 3PR8A 2IMFA 5EL8A 2LNTA 1O6JA 5G1LA 2NVLA 3C7MA 4ECCA 4IELA 2JU5A 4ML1A 2Z9SA 5ABRA 2DJ1A 4GRFA 3UARA 4MJAA 5HR3A 1OVNA 2E0QA 4OCFA 3ZTLA 5A4UA 2IMDA 4NMUA 4XS1A 4E8EA 1U87A 4HEA2 5ECRB 3FW2A 1T00A 1GNEA 2DKHA 2VCQA 4IHUA 3ZMKA 3FR3A 3LYPA 3IA1A 1XFLA 2WB9A 3UJ1A 4TRXA 1H4OA 1VGLA 2PN8A 2PPTA 2N5AA 3APSA 2GLRA 3GYKA 3VWVA 3QDNA 4YAPA 1PSQA 2FUG2 1PKWA 1YEXA 3L9VA 3FR9A 4IJ3A 1B9YC 1O8XA 4DSQA 3BOAA 3DVWA 3P8WA 3KM6A 4BVXA 5DALB 1XW6A 2PUKC 1X9WB 2X64A 5E59A 1AC1A 4V1Ap 5D9WA 4QL7A 4OD7A 2M80A 3ZREA 5IMDA 1UN2A 4WF4A 5HFKA 3GSTA 2QA2A 2M72A 2DBCA 4G10A 4NWYA 2MZCA 3HVVA 1G6YA 5H5SA 3ME8A 1SJIA 2ZNMA 2H72A 3TKSE 5DJLA 3D22A 2VLUA 1K0BA 3TRXA 4GF0A 2NTOA 19GSA 3TGZA 2I9HA 20GSA 6GSYA 4N30A 5D9VA 5B7CA 2FCHA 2F3MA 3M0FA 4TVEA 4ZBAA 3IC4A 5L71A 2HNLA 3EMPA 2G0FA 4K2DA 4QL9A 2OADA 1TU8A 3U5RE 3CSIA 2GZPA 4DSRA 2CZ3A 1CQHA 1GTIA 3FK8A 1A0FA 5C04A 2R5GA 4Z2UA 1X9SB 3IRAA 1WIKA 3KP9A 1SU9A 1GSYA 4MF5A 4DVCA 2WJUA 2H70A 2H6XA 2L4CA 1EEJA 2DJ2A 4OO5A 1BX9A 2H75A 1TRSA 1VRSD 3MAKA 1A23A 4L0UA 4YQMA 1ABAA 1GSDA 1TJDA 4L0WA 4P3YB 4ZL9A 1WWJA 4HQSA 1GTAA 2GZZA 1TK8B 2MMZA 3LYKA 4ML6A 2E7PA 3C8EA 1TK0B 4NXIA 1SD9A 1R7HA 2GSRA 3HDCA 2I1UA 5DAKA 3CMIA 2H1AA 4XIHA 1AW9A 2J9HA 2XBIA 5HQPA 4PTSA 3EPTA 3TDGA 1BG5A 2LS5A 1OC3A 1AIUA 3KH9A 2NPBA 2VCVA 3MWHA 1FVKA 3H8QA 11GSA 1EOGA 16GSA 2V6KA 3GUSA 5IQYA 3IBHA 2CT6A 2DJJA 4Z7XA 3DIEA 3VWXA 2ON7A 4ECBA 2OBKA 4FYUA 4MJEA 3L9SA 1GLPA 2H19A 4K2XA 5A4WA 2X8GA 5CP1A 4PXOA 1EP8A 1M2DA 1NHYA 3GIXA 4N0ZA 3GH9A 1V40A 4KH7A 22GSA 3D4MA 3MSZA 1K3YA 4RQXA 4TR4A 2F9SA 4WXTA 5ECLB 1T4YA 1JHBA 3G7IA 1K0DA 2WCIA 1Z9HA 4OFTA 1Q98A 1G7EA 2FLSA 4K1FA 2B5YA 4MPFA 4I2UA 4BPYA 3FRCA 1FO5A 2QSIA 4K7NA 3TKSC 3KTBA 5D9XA 4ICYA 3GL5A 2HSHA 3BBYA 3ISOA 3KEBA 2OACA 4O5QA 3PINA 4QQ7A 3GV1A 8GSSA 1YKCA 2FA8A 2DJ0A 5G5EA 2YP6A 2B6MA 4HI7A 2H74A 2RUEA 5ID2A 2A2SA 1YDKA 2IJYA 3BCIA 3M9JA 3PPUA 5DCGA 2GTUA 1VF4A 1XWBA 3KTLA 1PMTA 1WP0A 2H73A 4K5RA 3ERFA 1YF1A 4YKGA 3ZFBA 1V57A 1NM3A 4K8MA 1GUKA 5BMUA 3TKRA 5GAND 1K0MA 5CO3A 2MMNA 2YJHA 5ECMB 1ST9A 4JRRA 1ZYQB 1TU7A 3TRQA 2C0EA 3VK9A 4G2EA 1LU4A 4L8EA 4LMWA 4IS0A 2LJAA 1SL1B 3GRXA 2YZUA 3TOTA 4GQFA 1EGRA 4YH2A 4FO5A 2LV3A 1RK4A 4OFMA 2MBSA 3CTGA 2LRNA 4IN0A 4Z2TA 5HR2A 4I5QA 3I6AA 4BWSA 3A3TA 1OYJA 1JZOA 2N5FA 5INYA 3BCKA 5A4VA 4BVYB 4HJ2A 1R5PA 2V6OA 2FHEA 1XPVA 3TB2A 1SK1A 1WRYA 4J57E 3QAGA 3U6VA 2YV9A 5GAPD 4O5UA 2BJXA 2H8LA 2X49A 1S3AA 1BAYA 4ZB6A 4K6XA 2HSYA 2XPEA 1GTBA 1Z6NA 2HRFA 2H6ZA 3UMAA 2FA4A 5GZZB 2I81A 4YAVA 3W8JA 2HRAA 2LJRA 1K0CA 2HZEB 5JCWA 1K0AA 5H5RA 2WS2A 3C73A 2IMEA 1QMVA 4AJ6A 5F8BA 1SD8A 3ME7A 3O3TA 1SJZA 3UVTA 1QFNA 2O85A 2CAQA 12GSA 3MYDA 4NHWA 3VLNA 3R2QA 2C3TA 1S3CA 3C1SA 1BEDA 2HXKA 3H4KA 3QD9A 2CAIA 3UAPA 3RHCA 4Q5RA 2DJ3A 1AXDA 3IAM2 1NSWA 3FZAA 1GRXA 3W6GA 1OC8A 2XPDA 2ALBA 4JEDA 4TOPA 2DMLA 2CZ2A 1MDJA 2IFQA 3LEFA 1OAZA 2PERA 4G0IA 3CXGA 1CQGA 5KOWA 3KP8A 2R0PA 4Q5NA 2LRCA 4ZBBA 1MD4A 2AAWA 1WPIA 1HYUA 3CSHA 3FYGA 3HA9A 4PQ1A 2ES7A 2VCTA 3SBCA 2RM6A 1NW2A 5D96A 1VF1A 4YQUA 4PQIA 5JWRB 1K3LA 3RHBA 1I5GA 1GH2A 1ACVA 1C72A 2YWNA 3GNJA 4OO4A 4H86A 1SYXA 1TOFA 1ERVA 3F8UA 3APQA 1T7PB 2KP1A 4MDCA 4AF2A 1HNAA 4MPGA 3L0HA 4TXOB 1TI3A 4CY6A 1ZMAA 4PUAA 3FR6A 3ERGA 3BD2A 1E6BA 2KP2A 2FD3A 4JBBA 3M9KA 4ECJA 2WZ9A 2OKAA 1TDIA 2DMMA 3S9FA 3M3MA 4X0XA 5IIZA 1V58A 4LL4B 5D93A 4EDZA 3LXZA 4TN8A 3ERWA 3TUEA 1E2YA 1OC9A 4CDOA 1FOHA 2L4QA 1SKWB 2DLXA 3FEUA 2QGVA 3DRNA 4HU7A 5F0GA 1THOA 2DSAA 1PN0A 2YNXA 5F07A 3WT1A 2L6CA 2JACA 3P2AA 1PKZA 3QFAC 1YQ1A 4TR1A 1HQOA 3IDVA 4PQHA 3LG6A 3F0IA 2O89A 2JZSA 1XOAA 3F63A 1OKDA 5CYYA 3GX0A 3TJKA 2MYGA 1GSUA 4TW5A 2R0CA 5ECSA 3KD0A 4GSTA 1A0RP 4IP1A 3A5WA 2WULA 4OMVA 4XRAA 3DVXA 2WFCA 4BL7A 2XC2A 1ERTA 1U88A 3ZZXA 2JSYA 1K0OA 1A8YA 2C4JA 5JCUA 4EVMA 3APOA 1ZGNA 2HT9A 4IQAA 2VUPA 2AB6A 4LL1B 4ZL7A 2CQ9A 4DSSB 3IPZA 4HJMA 1GP1A 2VM2A 4NV2A 3DWVA 4TR0A 1MD3A 2N5BA 5B8AA 1H75A 3D0ZA 4F03A 2FGXA 3LQ7A 3FY7A 4JZQA 1EV4A 2PVOC 3DMLA 4ISDA 13GSA 1YF0A 2PU9C 4G0LA 3H1NA 2EIRA 2AHEA 1XWAA 3F6FA 1WOUA 2GQKA 2TIRA 2F51A 1A24A 4KW6A 4ACSA 2VL2A 1YZXA 4X4JA 1F9MA 4F9ZA 3GKKA 4OFNA 2VD0A 2WDUA 1GL8A 3H93A 5LNKe 1TW9A 4Q5FA 1Z7PA 2PGTA 4KE3A 5D73A 1IYHA 5AN1A 3NOFA 2LQQA 3TOUA 3I9V2 5ECPB 4ILFA 4XRDA 4KSOA 4JR4A 1GSQA 3D21A 2R6KA 4K0GA 2GZYA 4KF9A 5D9TA 4JU5A 2IMKA 4G19A 4XS4A 2BTOT 3QCPA 1RQMA 4WEYA 2K6VA 4RI6A 1MTCA 1PQNA 1ZCPA 3IK7A 2LQOA 1ZYNA 1OE7A 3SWLA 3ZITA 1YKAA 5HR1A 4O92A 3HVSA 3GTUA 1K3OA 4GSSA 2V1MA 6GSUA 2H76A 4V2MA 4BVXB 1SKSB 2B7KA 1XW9A 1Y25A 1JZDA 5ELAA 1HNCA 2D28C 2LJKA 3FZ5A 1BQ7A 3GKXA 1VF2A 1PGTA 1Z5YE 4EKZA 4CY8A 3ZLPA 4EDYA 2LUSA 1GNWA 1B48A 4Z2RA 3TKPA 3IXRA 4XCSA 1I9DA 1G6WA 1XXUA 1ZYPA 5G30A 4FYBA 4FYCA 4K0NA 1R26A 1A2JA 3RAZA 5EVOA 2LNSA 1WE0A 2NBSA 2QA1A 3QR6A 3ZYWA 4GXZA 1XVQA 2KUCA 2ON5A 2VLTA 3KIJA 1XWGA 2ZUPA 1GSEA 2CX3A 2P5RA 4KA0A 6GSXA 3VI5A 1JLVA 1W89A 2L6DA 1RW1A 2P31A 2L5OA 5IMFA 1M99A 5F05A 4MZBA 1JZRA 5HFGA 1EGOA 4OCEA 1B4QA 3DYRA 1O81A 2CA8A 4MABA 1ILOA 2C1YA 1IYIA 5ECQB 1USBA 3DD3A 3CSJA 5DQYA 3RPPA 1B4PA 1YJ6A 5F06A 1Y6EA 3GURA 2FY6A 1GSFA 1FB0A 3IV4A 5CRDA 2YWIA 2TRXA 4JE1A 3L4NA 3QAWA 1O8WA 4KB3A 3RDWA 2GVPA 2DC5A 4KUNA 2B7JA 5H5QA 2LTKA 4AJ7A 2IL3A 1FHEA 1A8LA 4MNNA 4HUAA 4IQJM 2GSQA 2E2GA 3IOSA 5A5KA 5EPFA 4PUFC 4MF6A 1V9WA 2HRNA 2E2MA 1LJRA 5BRTA 1SL2B 1M2AA 4O32A 2OE3A 4I2TA 5DAKB 5DDLA 1LBKA 4MZWA 2C0DA 2IWTA 2XHFA 2VCZA 1FAAA 3A2WA 2C8UA 4GQCA 4AJ8A 4PGTA 4EIQA 2R4VA 5G2ZA 2UZ8A 1XIYA 3FKFA 1FG4A 4K7IA 5DBQA 4MCUA 1KTEA 1ML6A 3HZ8A 1PL2A 2CX4A 5FWGA 1DUGA 3IHGA 4POBA 4KDXA 3L9UA 4KCAA 3UL3A 3C1RA 4WR4A 4N0VA 1KNGA 1THXA 3EC3A 1AQXA 2GGTA 1GUMA 3PGTA 2VM1A 5DVBA 3ZIJA 3IC8A 4KX4A 4EIPA 2VCXA 2H1DA 2LRTA 2M46A 1PX6A 3A2VA 3KGKA 3UOMA 3E9JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EE2 A;  3IR4 A;  2D2Z A;  3VWU A;  4D73 A;  4MH2 A;  4EUY A;  1M0U A;  3LWA A;  1V98 A;  3QPM A;  2O8V B;  2C3N A;  6GSS A;  3G9B A;  2JZR A;  4RQR A;  2GDR A;  2FWH A;  1ON4 A;  2AJQ B;  1PL1 A;  4EF0 A;  1JFU A;  4KGI A;  3TJG A;  5COH A;  4HZ4 A;  3D4T A;  2PBJ A;  5JWO B;  1HNB A;  4GWR A;  5LCZ A;  2AV4 A;  1EOH A;  3ZL5 A;  4K9Z A;  1ZZY A;  5ENU A;  2F8F A;  1M7T A;  3HHV A;  3P90 A;  2VIM A;  1QQ2 A;  2LST A;  3F3R A;  3UEM A;  4ZL8 A;  4F0C A;  1AQW A;  4I8B A;  1XZO A;  5ID2 B;  3GKM A;  3TCO A;  3OR5 A;  1XOB A;  3QMX A;  1O7U A;  2C3Q A;  3EYT A;  5ECK B;  3M8N A;  4ZXG A;  3K8N A;  2B5X A;  1PA3 A;  1J08 A;  5DQS A;  2NDO A;  4K7O A;  3KH7 A;  2DIY A;  3AY8 A;  2LKU A;  3MDK A;  3CBU A;  4MK3 A;  1K0N A;  4CW9 A;  2PWJ A;  3Q18 A;  1V2A A;  3FZ9 A;  2L59 A;  4ZIJ A;  3RPN A;  5DAL A;  4LMV A;  3IHQ A;  5FT3 A;  3CYN A;  2YV7 A;  3D5J A;  2HFD A;  4LLR A;  5AIS A;  4WF5 A;  2WGR A;  7GSS A;  3WT2 A;  3F4T A;  4ID0 A;  3UBL A;  1Z6M A;  1DBY A;  4G9H A;  4ZBD A;  3EIN A;  4EXJ A;  3GX8 A;  3FZ4 A;  4IBP A;  4ZB8 A;  2OE0 A;  1FB6 A;  4X43 A;  4WET A;  5GSS A;  1F2E A;  4POK A;  1SEN A;  2B1K A;  3NZN A;  2RUF A;  1T3B A;  2H1G A;  4J56 E;  2B5E A;  4ECI A;  4IVF A;  4HOJ A;  2HYX A;  4I97 A;  1JZW A;  3G7Y A;  4EE0 A;  3DXB A;  1OE8 A;  3VPQ A;  1TK5 B;  3ZIV A;  3GSS A;  4HDE A;  2CVK A;  2VAF A;  2YOI A;  4IW9 A;  4MLY A;  4KAE A;  3LXT A;  6GSV A;  5JWQ B;  1JLW A;  2JL4 A;  3O76 A;  2RM5 A;  4MF7 A;  1ZOF A;  5EY6 A;  3DGQ A;  4XS6 A;  3W8S A;  4GSN A;  2GQM A;  4X1U A;  5AIV A;  5DJM A;  1GUH A;  2AYT A;  5J9B A;  5CAX A;  5IMV A;  2H71 A;  4L5O A;  14GS A;  5KN2 A;  1QGV A;  3A2X A;  2I4A A;  2HE3 A;  1ERU A;  1BJX A;  4MMM A;  5G5F A;  4IQ1 A;  2VO4 A;  4I6X A;  1TRU A;  2R37 A;  4HS1 A;  4DEJ A;  2H0G A;  4JR6 A;  3HKR A;  5LD0 A;  1FOV A;  2EIQ A;  3UVH A;  3F4R A;  6GSW A;  3NIV A;  1TRV A;  2EC4 A;  4L5L A;  3GKN A;  5KEJ A;  4F2I A;  4WR5 A;  1QK8 A;  1VF3 A;  2HZF A;  2YWO A;  4MP4 A;  3E3E A;  5CNW A;  1YEP A;  3J7Y b;  4IJI A;  1X9M B;  1F6M C;  2IFQ B;  5CRH A;  4HZ2 A;  1MDI A;  2JSZ A;  5ECI B;  1MEK A;  1SYR A;  2VD1 A;  1X0R A;  1OKT A;  3GH6 A;  4IP6 A;  1PD2 1;  3CRT A;  3N5O A;  1J0F A;  1GWC A;  2R2J A;  2JAD A;  1W4V A;  2OE1 A;  1F3B A;  3I43 A;  1YY7 A;  3KJY A;  3EMX A;  2GT6 A;  3VFI A;  2DIZ A;  1O85 A;  2CVB A;  2VCW A;  2VL2 C;  3Q19 A;  2F8A A;  1GSS A;  3VWW A;  2L5L A;  5IPG A;  2GSS A;  1QXH A;  2YJ7 A;  4O5R A;  3G7J A;  4BA7 A;  3GHA A;  4MH3 A;  2H01 A;  1TI1 A;  1XWK A;  2VLV A;  1SKR B;  4AGS A;  2OJL A;  2X99 A;  2P5Q A;  2RLI A;  5ECN B;  3KCM A;  2GQL A;  5GST A;  2YAN A;  2O7K A;  18GS A;  5IMZ A;  3QAV A;  9GSS A;  6GST A;  3BJ5 A;  3C71 A;  3ZRD A;  1M9A A;  2IPA A;  1EZK A;  3QOU A;  5KN3 A;  3LFL A;  1OC9 B;  2V2G A;  4HU9 A;  1PN9 A;  1TRW A;  4HQZ A;  2MMA A;  3HJM A;  2HI7 A;  5J5N A;  5KN1 A;  4RI7 A;  3N9J A;  2JZT A;  3VI7 A;  3E0U A;  4WBR D;  4TR1 B;  2C0F A;  2KLX A;  4EC0 A;  3HXS A;  4MJC A;  1WMJ A;  5FHI A;  1DSB A;  1TP9 A;  2MMO A;  1B9X C;  3ZVJ A;  2V32 A;  1G0T A;  5J9C A;  1Z3E A;  3WGX A;  3F4S A;  1SK2 A;  3ZVJ D;  2R3X A;  5ECO B;  2IIY A;  2X8C A;  3H79 A;  2CVD A;  3WD6 A;  4Q5Q A;  3TRP A;  3HY2 A;  3PH9 A;  1BYE A;  1O73 A;  2REM A;  1EV9 A;  4F0B A;  3IK9 A;  3HD5 A;  3HVX A;  3LGC A;  1SK0 A;  1ZYE A;  1MDK A;  5B6N A;  2IN3 A;  4GTU A;  4CHS A;  3CRU A;  4WKW A;  2VOC A;  2H1B A;  1U6T A;  2FWE A;  3ED3 A;  1S3D A;  5ELG A;  3ZML A;  3MNG A;  3HJP A;  4N10 A;  4NHZ A;  1GTU A;  1HD2 A;  3VPT A;  4BVY A;  2RII A;  3F9U A;  4OWY A;  4BWQ A;  3L78 A;  1X5D A;  2PMT A;  4V2L A;  2A4V A;  3EWL A;  1UC7 A;  5IMC A;  3EUR A;  5HFI A;  2FWG A;  1AAZ A;  1X5C A;  3I69 A;  2VL3 A;  2L57 A;  5CRW A;  5KN0 A;  2A2R A;  2EIO A;  3J7Y k;  4LA1 A;  4IGJ A;  1WJK A;  2H6Y A;  4E8H A;  1T1V A;  1A2M A;  1SJ6 A;  1A2L A;  2VL9 A;  4RUV A;  5C00 A;  3TKS A;  2BMX A;  4XS4 B;  4J2F A;  1ERW A;  2HLS A;  4KSM A;  2HZE A;  3F3Q A;  5IMA A;  1EEM A;  2X8H A;  5AGY A;  4PX1 A;  1F37 A;  4MJB A;  2CV4 A;  3EU4 A;  3GTU B;  1Q4J A;  4GCI A;  3GL3 A;  3UIW A;  3Q6O A;  3D6I A;  1FW1 A;  1UVZ A;  1M9B A;  2G2Q A;  3DKS A;  2YCD A;  3KMN A;  2WRT A;  1URM A;  2QC7 A;  2H66 A;  1XW5 A;  1TXX A;  3IE3 A;  1N8J A;  2GS3 A;  3CTF A;  5ECH B;  5HR0 A;  3GN3 A;  1U3I A;  2PVQ A;  4PNF A;  4GLT A;  4KDU A;  4ZIL A;  3WGD A;  5JCG A;  1XBS A;  2H30 A;  5J41 A;  4MZC A;  2V41 A;  3EVI A;  4FIW A;  1GLQ A;  4TXV A;  2J23 A;  1DE2 A;  1T4Z A;  4MA9 A;  3TJB A;  2O87 A;  1NHO A;  3KMO A;  3GA4 A;  1AUC A;  4KDY A;  3VUR A;  3IAS 2;  4ULX A;  1R4W A;  1ZL9 A;  1EWX A;  4O7H A;  2DJK A;  3LSZ A;  5CRG A;  5B6M A;  3KZQ A;  1TKD B;  3ZFL A;  2B1L A;  2ZCT A;  2KHP A;  1FVJ A;  2LEG A;  1KEB A;  4WBJ A;  5D8I A;  2GT5 A;  5G1K A;  2C0G A;  1TTZ A;  1J9B A;  5IO2 A;  4TXO A;  3HZ4 A;  4POM A;  2FWF A;  3O6T A;  3LOR A;  1G7O A;  2AUV A;  2K8S A;  3TJJ A;  3WYW A;  3HJO A;  5IPH A;  2XBQ A;  3RBT A;  4NAX A;  5G31 A;  5J4U A;  2TRC P;  5AIX A;  1PRX A;  4XHM A;  3EU3 A;  1XVW A;  2YZH A;  3HCZ A;  4F82 A;  3FHK A;  1EP7 A;  2MBT A;  2FNO A;  4EL1 A;  2OA7 A;  4TKY A;  1XWC A;  3UBK A;  2I3Y A;  2IMI A;  4V1A g;  5DCH A;  4FH8 A;  17GS A;  4KND A;  2YPM A;  5IO0 A;  1SL0 B;  4IKH A;  5B8B A;  5J3R A;  1R5A A;  3LJR A;  1Z7R A;  1KBN A;  2K18 A;  5IOX A;  1XCC A;  4YQV A;  1UA5 A;  1PX7 A;  1F3A A;  2GST A;  2K8V A;  3GMF A;  3DEX A;  3WGE A;  3M1G A;  1DE1 A;  5CRE A;  1B8X A;  3TKQ A;  2KOK A;  2B3S A;  3US3 A;  4POL A;  2P0G A;  3KXO A;  4NPB A;  5IM9 A;  2QKE A;  5IOW A;  2H0I A;  3TJF A;  4N11 A;  1T8E B;  5E4W A;  3Q74 A;  3GFK A;  4V2N A;  4PUR A;  4D73 B;  4DSS A;  2OBI A;  2H0H A;  3QFB C;  2C80 A;  1N2A A;  4EO3 A;  4ZB9 A;  1QUW A;  3F6D A;  1U3A A;  4PNG A;  1GUL A;  1M2B A;  1X5E A;  3HYP A;  2K9F A;  3V1W A;  10GS A;  4TR3 A;  3P7X A;  4XTS A;  3JCM L;  2YWM A;  2YN1 A;  4KCE A;  1AQV A;  4NV5 A;  3PR8 A;  2IMF A;  5EL8 A;  2LNT A;  1O6J A;  5G1L A;  2NVL A;  3C7M A;  4ECC A;  4IEL A;  2JU5 A;  4ML1 A;  2Z9S A;  5ABR A;  2DJ1 A;  4GRF A;  3UAR A;  4MJA A;  5HR3 A;  1OVN A;  2E0Q A;  4OCF A;  3ZTL A;  5A4U A;  2IMD A;  4NMU A;  4XS1 A;  4E8E A;  1U87 A;  4HEA 2;  5ECR B;  3FW2 A;  1T00 A;  1GNE A;  2VCQ A;  4IHU A;  3ZMK A;  3FR3 A;  3LYP A;  3IA1 A;  1XFL A;  2WB9 A;  3UJ1 A;  4TRX A;  1H4O A;  1VGL A;  2PN8 A;  2PPT A;  2N5A A;  3APS A;  2GLR A;  3GYK A;  3VWV A;  3QDN A;  4YAP A;  1PSQ A;  2FUG 2;  1PKW A;  1YEX A;  3L9V A;  3FR9 A;  4IJ3 A;  1B9Y C;  1O8X A;  4DSQ A;  3BOA A;  3DVW A;  3P8W A;  3KM6 A;  4BVX A;  5DAL B;  1XW6 A;  2PUK C;  1X9W B;  2X64 A;  5E59 A;  1AC1 A;  4V1A p;  5D9W A;  4QL7 A;  4OD7 A;  2M80 A;  3ZRE A;  5IMD A;  1UN2 A;  4WF4 A;  5HFK A;  3GST A;  2M72 A;  2DBC A;  4G10 A;  4NWY A;  2MZC A;  3HVV A;  1G6Y A;  5H5S A;  3ME8 A;  1SJI A;  2ZNM A;  2H72 A;  3TKS E;  5DJL A;  3D22 A;  2VLU A;  1K0B A;  3TRX A;  4GF0 A;  2NTO A;  19GS A;  3TGZ A;  2I9H A;  20GS A;  6GSY A;  4N30 A;  5D9V A;  5B7C A;  2FCH A;  2F3M A;  3M0F A;  4TVE A;  4ZBA A;  3IC4 A;  5L71 A;  2HNL A;  3EMP A;  2G0F A;  4K2D A;  4QL9 A;  2OAD A;  1TU8 A;  3U5R E;  3CSI A;  2GZP A;  4DSR A;  2CZ3 A;  1CQH A;  1GTI A;  3FK8 A;  1A0F A;  5C04 A;  2R5G A;  1X9S B;  3IRA A;  1WIK A;  3KP9 A;  1SU9 A;  1GSY A;  4MF5 A;  4DVC A;  2WJU A;  2H70 A;  2H6X A;  2L4C A;  1EEJ A;  2DJ2 A;  4OO5 A;  1BX9 A;  2H75 A;  1TRS A;  1VRS D;  3MAK A;  1A23 A;  4L0U A;  4YQM A;  1ABA A;  1GSD A;  1TJD A;  4L0W A;  4P3Y B;  4ZL9 A;  1WWJ A;  4HQS A;  1GTA A;  2GZZ A;  1TK8 B;  2MMZ A;  3LYK A;  4ML6 A;  2E7P A;  3C8E A;  1TK0 B;  4NXI A;  1SD9 A;  1R7H A;  2GSR A;  3HDC A;  2I1U A;  5DAK A;  3CMI A;  2H1A A;  4XIH A;  1AW9 A;  2J9H A;  2XBI A;  5HQP A;  3TDG A;  1BG5 A;  2LS5 A;  1OC3 A;  1AIU A;  3KH9 A;  2NPB A;  2VCV A;  3MWH A;  1FVK A;  3H8Q A;  11GS A;  1EOG A;  16GS A;  2V6K A;  3GUS A;  5IQY A;  3IBH A;  2CT6 A;  2DJJ A;  4Z7X A;  3DIE A;  3VWX A;  2ON7 A;  4ECB A;  2OBK A;  4FYU A;  4MJE A;  3L9S A;  1GLP A;  2H19 A;  5A4W A;  2X8G A;  5CP1 A;  4PXO A;  1EP8 A;  1M2D A;  1NHY A;  3GIX A;  4N0Z A;  3GH9 A;  1V40 A;  4KH7 A;  22GS A;  3D4M A;  3MSZ A;  1K3Y A;  4RQX A;  4TR4 A;  2F9S A;  4WXT A;  5ECL B;  1T4Y A;  1JHB A;  3G7I A;  1K0D A;  2WCI A;  1Z9H A;  4OFT A;  1Q98 A;  1G7E A;  2FLS A;  4K1F A;  2B5Y A;  4MPF A;  4I2U A;  4BPY A;  3FRC A;  1FO5 A;  2QSI A;  4K7N A;  3TKS C;  3KTB A;  5D9X A;  3GL5 A;  2HSH A;  3BBY A;  3ISO A;  3KEB A;  2OAC A;  3PIN A;  4QQ7 A;  3GV1 A;  8GSS A;  1YKC A;  2FA8 A;  2DJ0 A;  5G5E A;  2YP6 A;  2B6M A;  4HI7 A;  2H74 A;  2RUE A;  5ID2 A;  2A2S A;  1YDK A;  2IJY A;  3BCI A;  3M9J A;  5DCG A;  2GTU A;  1VF4 A;  1XWB A;  3KTL A;  1PMT A;  1WP0 A;  2H73 A;  3ERF A;  1YF1 A;  3ZFB A;  1V57 A;  1NM3 A;  4K8M A;  1GUK A;  3TKR A;  5GAN D;  1K0M A;  5CO3 A;  2MMN A;  2YJH A;  5ECM B;  1ST9 A;  4JRR A;  1ZYQ B;  1TU7 A;  3TRQ A;  2C0E A;  3VK9 A;  4G2E A;  1LU4 A;  4L8E A;  4LMW A;  4IS0 A;  2LJA A;  1SL1 B;  3GRX A;  2YZU A;  3TOT A;  4GQF A;  1EGR A;  4YH2 A;  4FO5 A;  2LV3 A;  1RK4 A;  4OFM A;  2MBS A;  3CTG A;  2LRN A;  4IN0 A;  5HR2 A;  4I5Q A;  3I6A A;  4BWS A;  3A3T A;  1OYJ A;  1JZO A;  2N5F A;  5INY A;  3BCK A;  5A4V A;  4HJ2 A;  1R5P A;  2V6O A;  2FHE A;  1XPV A;  3TB2 A;  1SK1 A;  1WRY A;  4J57 E;  3QAG A;  3U6V A;  2YV9 A;  5GAP D;  2BJX A;  2H8L A;  1S3A A;  1BAY A;  4ZB6 A;  4K6X A;  2HSY A;  2XPE A;  1GTB A;  1Z6N A;  2HRF A;  2H6Z A;  3UMA A;  2FA4 A;  5GZZ B;  2I81 A;  4YAV A;  3W8J A;  2LJR A;  1K0C A;  2HZE B;  5JCW A;  1K0A A;  5H5R A;  2WS2 A;  3C73 A;  2IME A;  1QMV A;  4AJ6 A;  5F8B A;  1SD8 A;  3ME7 A;  3O3T A;  1SJZ A;  3UVT A;  1QFN A;  2O85 A;  2CAQ A;  12GS A;  4NHW A;  3VLN A;  3R2Q A;  2C3T A;  1S3C A;  3C1S A;  1BED A;  2HXK A;  3H4K A;  3QD9 A;  2CAI A;  3UAP A;  3RHC A;  4Q5R A;  2DJ3 A;  1AXD A;  3IAM 2;  1NSW A;  3FZA A;  1GRX A;  3W6G A;  1OC8 A;  2XPD A;  2ALB A;  4JED A;  4TOP A;  2DML A;  2CZ2 A;  1MDJ A;  2IFQ A;  3LEF A;  1OAZ A;  2PER A;  3CXG A;  1CQG A;  3KP8 A;  4Q5N A;  2LRC A;  4ZBB A;  1MD4 A;  2AAW A;  1WPI A;  1HYU A;  3CSH A;  3FYG A;  3HA9 A;  4PQ1 A;  2ES7 A;  2VCT A;  3SBC A;  2RM6 A;  1NW2 A;  5D96 A;  1VF1 A;  4YQU A;  4PQI A;  5JWR B;  1K3L A;  3RHB A;  1I5G A;  1GH2 A;  1ACV A;  1C72 A;  2YWN A;  3GNJ A;  4OO4 A;  4H86 A;  1SYX A;  1TOF A;  1ERV A;  3F8U A;  3APQ A;  1T7P B;  2KP1 A;  4MDC A;  4AF2 A;  1HNA A;  4MPG A;  3L0H A;  4TXO B;  1TI3 A;  1ZMA A;  4PUA A;  3FR6 A;  3ERG A;  3BD2 A;  1E6B A;  2KP2 A;  2FD3 A;  4JBB A;  3M9K A;  4ECJ A;  2WZ9 A;  2OKA A;  1TDI A;  2DMM A;  3S9F A;  3M3M A;  4X0X A;  5IIZ A;  1V58 A;  4LL4 B;  5D93 A;  4EDZ A;  3LXZ A;  4TN8 A;  3ERW A;  3TUE A;  1E2Y A;  1OC9 A;  4CDO A;  2L4Q A;  1SKW B;  2DLX A;  3FEU A;  2QGV A;  3DRN A;  4HU7 A;  5F0G A;  1THO A;  2DSA A;  2YNX A;  5F07 A;  3WT1 A;  2L6C A;  2JAC A;  3P2A A;  1PKZ A;  3QFA C;  1YQ1 A;  4TR1 A;  1HQO A;  3IDV A;  4PQH A;  3LG6 A;  3F0I A;  2O89 A;  2JZS A;  1XOA A;  3F63 A;  1OKD A;  5CYY A;  3GX0 A;  3TJK A;  2MYG A;  1GSU A;  4TW5 A;  5ECS A;  3KD0 A;  4GST A;  1A0R P;  4IP1 A;  3A5W A;  2WUL A;  4OMV A;  4XRA A;  3DVX A;  2WFC A;  4BL7 A;  2XC2 A;  1ERT A;  1U88 A;  3ZZX A;  2JSY A;  1K0O A;  1A8Y A;  2C4J A;  5JCU A;  4EVM A;  3APO A;  1ZGN A;  2HT9 A;  4IQA A;  2VUP A;  2AB6 A;  4LL1 B;  4ZL7 A;  2CQ9 A;  4DSS B;  3IPZ A;  4HJM A;  1GP1 A;  2VM2 A;  4NV2 A;  3DWV A;  4TR0 A;  1MD3 A;  2N5B A;  5B8A A;  1H75 A;  3D0Z A;  4F03 A;  2FGX A;  3LQ7 A;  3FY7 A;  4JZQ A;  1EV4 A;  2PVO C;  3DML A;  4ISD A;  13GS A;  1YF0 A;  2PU9 C;  3H1N A;  2EIR A;  2AHE A;  1XWA A;  3F6F A;  1WOU A;  2GQK A;  2TIR A;  2F51 A;  1A24 A;  4KW6 A;  4ACS A;  2VL2 A;  1YZX A;  4F9Z A;  1F9M A;  3GKK A;  4OFN A;  2VD0 A;  2WDU A;  1GL8 A;  3H93 A;  5LNK e;  1TW9 A;  4Q5F A;  1Z7P A;  2PGT A;  4KE3 A;  5D73 A;  1IYH A;  5AN1 A;  3NOF A;  2LQQ A;  3TOU A;  3I9V 2;  5ECP B;  4ILF A;  4XRD A;  4KSO A;  4JR4 A;  1GSQ A;  3D21 A;  2R6K A;  4K0G A;  2GZY A;  5D9T A;  4JU5 A;  2IMK A;  4G19 A;  4XS4 A;  2BTO T;  3QCP A;  1RQM A;  4WEY A;  2K6V A;  4RI6 A;  1MTC A;  1PQN A;  1ZCP A;  3IK7 A;  2LQO A;  1OE7 A;  3SWL A;  3ZIT A;  1YKA A;  5HR1 A;  4O92 A;  3HVS A;  3GTU A;  1K3O A;  4GSS A;  2V1M A;  6GSU A;  2H76 A;  4V2M A;  1SKS B;  2B7K A;  1XW9 A;  1Y25 A;  1JZD A;  5ELA A;  1HNC A;  2LJK A;  3FZ5 A;  1BQ7 A;  3GKX A;  1VF2 A;  1PGT A;  1Z5Y E;  4EKZ A;  3ZLP A;  4EDY A;  2LUS A;  1GNW A;  1B48 A;  3TKP A;  3IXR A;  4XCS A;  1I9D A;  1G6W A;  1XXU A;  5G30 A;  4FYB A;  4FYC A;  4K0N A;  1R26 A;  1A2J A;  3RAZ A;  5EVO A;  2LNS A;  1WE0 A;  2NBS A;  3QR6 A;  3ZYW A;  4GXZ A;  1XVQ A;  2KUC A;  2ON5 A;  2VLT A;  3KIJ A;  1XWG A;  2ZUP A;  1GSE A;  2CX3 A;  2P5R A;  4KA0 A;  6GSX A;  3VI5 A;  1JLV A;  1W89 A;  2L6D A;  1RW1 A;  2P31 A;  2L5O A;  5IMF A;  1M99 A;  5F05 A;  4MZB A;  1JZR A;  5HFG A;  1EGO A;  4OCE A;  1B4Q A;  3DYR A;  1O81 A;  2CA8 A;  4MAB A;  1ILO A;  2C1Y A;  1IYI A;  5ECQ B;  1USB A;  3DD3 A;  3CSJ A;  5DQY A;  3RPP A;  1B4P A;  1YJ6 A;  5F06 A;  1Y6E A;  3GUR A;  2FY6 A;  1GSF A;  1FB0 A;  3IV4 A;  5CRD A;  2YWI A;  2TRX A;  4JE1 A;  3L4N A;  3QAW A;  1O8W A;  4KB3 A;  3RDW A;  2GVP A;  2DC5 A;  4KUN A;  2B7J A;  5H5Q A;  2LTK A;  4AJ7 A;  2IL3 A;  1FHE A;  1A8L A;  4HUA A;  2GSQ A;  2E2G A;  3IOS A;  5A5K A;  5EPF A;  4PUF C;  4MF6 A;  1V9W A;  2HRN A;  2E2M A;  1LJR A;  1SL2 B;  1M2A A;  4O32 A;  2OE3 A;  4I2T A;  5DAK B;  5DDL A;  1LBK A;  4MZW A;  2C0D A;  2IWT A;  2XHF A;  2VCZ A;  1FAA A;  3A2W A;  2C8U A;  4GQC A;  4AJ8 A;  4PGT A;  2R4V A;  5G2Z A;  1XIY A;  3FKF A;  1FG4 A;  4K7I A;  5DBQ A;  4MCU A;  1KTE A;  1ML6 A;  3HZ8 A;  1PL2 A;  2CX4 A;  5FWG A;  1DUG A;  4POB A;  4KDX A;  3L9U A;  4KCA A;  3UL3 A;  3C1R A;  4WR4 A;  4N0V A;  1KNG A;  1THX A;  3EC3 A;  1AQX A;  2GGT A;  1GUM A;  3PGT A;  2VM1 A;  5DVB A;  3ZIJ A;  4KX4 A;  2VCX A;  2H1D A;  2LRT A;  2M46 A;  1PX6 A;  3A2V A;  3KGK A;  3UOM A;  3E9J B; 
#chains in the Genus database with same CATH topology
 3EE2 A;  3IR4 A;  2D2Z A;  3VWU A;  4D73 A;  4MH2 A;  4EUY A;  1M0U A;  3LWA A;  1V98 A;  3QPM A;  2O8V B;  2C3N A;  6GSS A;  3G9B A;  2JZR A;  4RQR A;  2GDR A;  2FWH A;  1ON4 A;  2AJQ B;  1PL1 A;  4EF0 A;  1JFU A;  4KGI A;  3TJG A;  5COH A;  4HZ4 A;  3D4T A;  2PBJ A;  5JWO B;  1HNB A;  4GWR A;  5LCZ A;  2AV4 A;  1EOH A;  3ZL5 A;  4K9Z A;  1ZZY A;  5ENU A;  3NO9 A;  2F8F A;  1M7T A;  3HHV A;  3P90 A;  2VIM A;  1XG8 A;  1QQ2 A;  2LST A;  3F3R A;  3UEM A;  4ZL8 A;  4F0C A;  1AQW A;  4I8B A;  1XZO A;  5ID2 B;  3GKM A;  3TCO A;  3OR5 A;  1XOB A;  3QMX A;  1O7U A;  2C3Q A;  3EYT A;  5ECK B;  3M8N A;  4ZXG A;  3K8N A;  2B5X A;  1PA3 A;  1J08 A;  5DQS A;  2NDO A;  5HW2 A;  4K7O A;  3KH7 A;  2DIY A;  3AY8 A;  2LKU A;  3MDK A;  3CBU A;  4MK3 A;  1K0N A;  4CW9 A;  2PWJ A;  3Q18 A;  1V2A A;  3FZ9 A;  2L59 A;  4ZIJ A;  3RPN A;  5DAL A;  4LMV A;  2DKI A;  3IHQ A;  5FT3 A;  3CYN A;  1DCN A;  2YV7 A;  3D5J A;  4MUM A;  2HFD A;  4LLR A;  5AIS A;  4YKF A;  4YIH A;  4WF5 A;  2WGR A;  7GSS A;  3WT2 A;  3F4T A;  4ID0 A;  3UBL A;  1Z6M A;  5KOX A;  1DBY A;  4G9H A;  4ZBD A;  3EIN A;  4EXJ A;  3RD8 A;  3GX8 A;  3FZ4 A;  4K5S A;  4IBP A;  4ZB8 A;  2OE0 A;  1FB6 A;  4X43 A;  1U15 A;  4WET A;  5GSS A;  1F2E A;  4POK A;  1SEN A;  2B1K A;  3NZN A;  2RUF A;  1T3B A;  2H1G A;  1VDK A;  4J56 E;  2B5E A;  4ECI A;  4IVF A;  4HOJ A;  2HYX A;  4I97 A;  1JZW A;  3G7Y A;  4EE0 A;  3DXB A;  1OE8 A;  3VPQ A;  1TK5 B;  3ZIV A;  3GSS A;  4HDE A;  2CVK A;  2VAF A;  2YOI A;  4IW9 A;  4MLY A;  4KAE A;  3LXT A;  6GSV A;  5JWQ B;  1JLW A;  2JL4 A;  1Z4J A;  3O76 A;  2RM5 A;  4MF7 A;  1ZOF A;  5EY6 A;  3DGQ A;  4XS6 A;  3W8S A;  4GSN A;  2GQM A;  4X1U A;  5AIV A;  5DJM A;  1GUH A;  2AYT A;  1Q92 A;  5J9B A;  5CAX A;  5IMV A;  2H71 A;  4L5O A;  14GS A;  5KN2 A;  1QGV A;  3A2X A;  2I4A A;  2HE3 A;  3MIX A;  1ERU A;  1BJX A;  4MMM A;  5G5F A;  4IQ1 A;  2VO4 A;  3RRP A;  4I6X A;  1TRU A;  2R37 A;  4HS1 A;  1Z4Q A;  4DEJ A;  2H0G A;  4JR6 A;  3HKR A;  5LD0 A;  1FOV A;  2HRK A;  2EIQ A;  3UVH A;  3F4R A;  6GSW A;  3NIV A;  1TRV A;  2EC4 A;  4L5L A;  1HY0 A;  3GKN A;  5KEJ A;  4F2I A;  4WR5 A;  1QK8 A;  1VF3 A;  2HZF A;  2YWO A;  4MP4 A;  3E3E A;  5CNW A;  1YEP A;  3J7Y b;  4IJI A;  1X9M B;  1F6M C;  2IFQ B;  5CRH A;  3R3E A;  4HZ2 A;  1MDI A;  2JSZ A;  5ECI B;  5D6B A;  1MEK A;  1SYR A;  2VD1 A;  1X0R A;  1OKT A;  3GH6 A;  4IP6 A;  1PD2 1;  3CRT A;  3N5O A;  1J0F A;  1GWC A;  2R2J A;  2JAD A;  1W4V A;  2OE1 A;  1F3B A;  3I43 A;  1YY7 A;  3KJY A;  3EMX A;  2GT6 A;  2YV5 A;  3VFI A;  2DIZ A;  1O85 A;  2CVB A;  2VCW A;  2VL2 C;  3Q19 A;  2F8A A;  1GSS A;  3VWW A;  2L5L A;  5IPG A;  2GSS A;  1QXH A;  2YJ7 A;  4O5R A;  3G7J A;  4BA7 A;  3GHA A;  2QGA B;  2D27 A;  4MH3 A;  2H01 A;  1TI1 A;  1XWK A;  2VLV A;  1SKR B;  4AGS A;  2OJL A;  2X99 A;  2P5Q A;  2RLI A;  5ECN B;  3KCM A;  2GQL A;  5GST A;  2YAN A;  2O7K A;  18GS A;  5IMZ A;  3QAV A;  9GSS A;  4A5P A;  6GST A;  3BJ5 A;  3C71 A;  3ZRD A;  1M9A A;  2IPA A;  1EZK A;  3QOU A;  5KN3 A;  3LFL A;  1OC9 B;  2V2G A;  4HU9 A;  1PN9 A;  1TRW A;  4HQZ A;  2MMA A;  1Z4I A;  3HJM A;  2HI7 A;  5J5N A;  5KN1 A;  4RI7 A;  3N9J A;  2JZT A;  3VI7 A;  3E0U A;  4WBR D;  1TJV A;  4TR1 B;  2C0F A;  2KLX A;  4EC0 A;  4E88 A;  3HXS A;  4MJC A;  1WMJ A;  5FHI A;  1DSB A;  1TP9 A;  2MMO A;  1B9X C;  3ZVJ A;  2V32 A;  1G0T A;  5J9C A;  3LW9 A;  1Z3E A;  3WGX A;  3F4S A;  1SK2 A;  3ZVJ D;  2R3X A;  4BL7 B;  5ECO B;  2IIY A;  3OCF A;  2X8C A;  3H79 A;  2CVD A;  3WD6 A;  4Q5Q A;  3TRP A;  3HY2 A;  3PH9 A;  4ADL A;  1BYE A;  1O73 A;  2REM A;  1EV9 A;  4F0B A;  3IK9 A;  3HD5 A;  3HVX A;  3LGC A;  2A4H A;  1SK0 A;  1ZYE A;  1MDK A;  5B6N A;  2IN3 A;  4GTU A;  4CHS A;  3CRU A;  4WKW A;  2VOC A;  2H1B A;  1U6T A;  2FWE A;  3ED3 A;  1S3D A;  1FUQ A;  5ELG A;  3ZML A;  3MNG A;  3HJP A;  4N10 A;  4NHZ A;  1GTU A;  1HD2 A;  3VPT A;  4BVY A;  2RII A;  3F9U A;  4OWY A;  4BWQ A;  3L78 A;  1X5D A;  2PMT A;  4V2L A;  2A4V A;  3EWL A;  1UC7 A;  5IMC A;  3EUR A;  5HFI A;  2FWG A;  1AAZ A;  1X5C A;  1XWO A;  3I69 A;  2E9F A;  2VL3 A;  2L57 A;  5CRW A;  1J3U A;  5KN0 A;  2A2R A;  2EIO A;  4USS A;  3J7Y k;  4LA1 A;  4IGJ A;  1WJK A;  2H6Y A;  4E8H A;  1T1V A;  1A2M A;  1SJ6 A;  3GTD A;  1A2L A;  2VL9 A;  4RUV A;  5C00 A;  3TKS A;  2BMX A;  4XS4 B;  4J2F A;  1ERW A;  2X4A A;  2HLS A;  4KSM A;  2HZE A;  4FQU A;  3F3Q A;  5IMA A;  1EEM A;  2X8H A;  5AGY A;  4PX1 A;  1F37 A;  4MJB A;  2CV4 A;  4G0K A;  3EU4 A;  4HGV A;  3GTU B;  1Q4J A;  4GCI A;  3GL3 A;  3UIW A;  3Q6O A;  2R0G A;  3D6I A;  1FW1 A;  1UVZ A;  1M9B A;  2G2Q A;  3DKS A;  2YCD A;  3KMN A;  2WRT A;  1URM A;  2QC7 A;  2H66 A;  1XW5 A;  1TXX A;  3IE3 A;  1N8J A;  2GS3 A;  3CTF A;  5ECH B;  5HR0 A;  3GN3 A;  1U3I A;  2PVQ A;  4PNF A;  4GLT A;  4KDU A;  4ZIL A;  3WGD A;  4NFL A;  5JCG A;  1XBS A;  2H30 A;  5J41 A;  4MZC A;  2V41 A;  3EVI A;  4FIW A;  2PTQ A;  1GLQ A;  4APA A;  4TXV A;  2J23 A;  1DE2 A;  1T4Z A;  4MA9 A;  3TJB A;  2O87 A;  1NHO A;  3KMO A;  3GA4 A;  1AUC A;  4KDY A;  3VUR A;  3IAS 2;  4ULX A;  1R4W A;  1ZL9 A;  1EWX A;  4O7H A;  2DJK A;  3LSZ A;  5CRG A;  5B6M A;  3KZQ A;  1TKD B;  2FUS A;  1Z4P X;  3ZFL A;  2B1L A;  2ZCT A;  2KHP A;  1FVJ A;  2LEG A;  1KEB A;  4WBJ A;  5D8I A;  2GT5 A;  5G1K A;  2C0G A;  1TTZ A;  1J9B A;  5IO2 A;  4TXO A;  3HZ4 A;  4POM A;  2FWF A;  3O6T A;  3LOR A;  1G7O A;  2AUV A;  2K8S A;  3TJJ A;  3WYW A;  3HJO A;  5IPH A;  2XBQ A;  3GZH A;  3RBT A;  4NAX A;  3BHG A;  5G31 A;  5J4U A;  3TV2 A;  2TRC P;  5AIX A;  1PRX A;  4XHM A;  3EU3 A;  1XVW A;  2YZH A;  3HCZ A;  4F82 A;  3FHK A;  1EP7 A;  2MBT A;  2FNO A;  4EL1 A;  2OA7 A;  4TKY A;  1XWC A;  3UBK A;  1PFO A;  2I3Y A;  2IMI A;  4V1A g;  5DCH A;  3A5I A;  4FH8 A;  17GS A;  4KND A;  2YPM A;  5IO0 A;  1SL0 B;  4IKH A;  5B8B A;  3FMW A;  1R5A A;  3LJR A;  5J3R A;  1Z7R A;  1KBN A;  2K18 A;  5IOX A;  1XCC A;  4YQV A;  1UA5 A;  1PX7 A;  1F3A A;  2GST A;  2K8V A;  3GMF A;  3DEX A;  3WGE A;  3M1G A;  1DE1 A;  5CRE A;  1B8X A;  3TKQ A;  2KOK A;  2B3S A;  1FUP A;  3US3 A;  4POL A;  2P0G A;  4MWO A;  3KXO A;  4NPB A;  4L6A A;  5IM9 A;  2QKE A;  5IOW A;  2H0I A;  3TJF A;  4N11 A;  1T8E B;  3CI0 K;  5E4W A;  3Q74 A;  3GFK A;  4V2N A;  4PUR A;  2A2P A;  4D73 B;  4DSS A;  2PFM A;  2OBI A;  2H0H A;  3QFB C;  2C80 A;  1N2A A;  4EO3 A;  4ZB9 A;  1IW7 D;  1QUW A;  3F6D A;  1U3A A;  3CQF A;  4PNG A;  1GUL A;  1I0A A;  1M2B A;  1X5E A;  2HSM A;  3HYP A;  2K9F A;  3V1W A;  10GS A;  4TR3 A;  3P7X A;  4XTS A;  3JCM L;  2X75 A;  2YWM A;  2YN1 A;  4KCE A;  1AQV A;  4NV5 A;  3PR8 A;  2IMF A;  5EL8 A;  2LNT A;  1O6J A;  5G1L A;  2NVL A;  3C7M A;  4ECC A;  4IEL A;  2JU5 A;  1Z4K A;  4ML1 A;  2Z9S A;  5ABR A;  2DJ1 A;  4GRF A;  3UAR A;  4MJA A;  5HR3 A;  1OVN A;  2E0Q A;  4OCF A;  3ZTL A;  2JAR A;  5A4U A;  2IMD A;  4NMU A;  4XS1 A;  4E8E A;  1U87 A;  4HEA 2;  5ECR B;  3FW2 A;  1T00 A;  1M3J A;  1GNE A;  2DKH A;  2VCQ A;  4IHU A;  3ZMK A;  3FR3 A;  3LYP A;  3IA1 A;  1XFL A;  2WB9 A;  3UJ1 A;  4TRX A;  1H4O A;  1U0L A;  1VGL A;  2PN8 A;  2PPT A;  2N5A A;  3APS A;  2GLR A;  3GYK A;  3VWV A;  3QDN A;  4YAP A;  1PSQ A;  2FUG 2;  1PKW A;  1YEX A;  3L9V A;  3FR9 A;  4IJ3 A;  1B9Y C;  1O8X A;  4DSQ A;  3BOA A;  3DVW A;  3P8W A;  3KM6 A;  4BVX A;  5DAL B;  1XW6 A;  2PUK C;  1X9W B;  2X64 A;  5E59 A;  1AC1 A;  4V1A p;  5D9W A;  4QL7 A;  4OD7 A;  2M80 A;  3ZRE A;  1C3C A;  5IMD A;  1UN2 A;  4WF4 A;  5HFK A;  3GST A;  2QA2 A;  2M72 A;  4APB A;  1C3U A;  2DBC A;  4G10 A;  4NWY A;  2MZC A;  3HVV A;  1G6Y A;  2HVG A;  5H5S A;  3ME8 A;  1KQ7 A;  1SJI A;  2ZNM A;  2H72 A;  3TKS E;  5DJL A;  3D22 A;  2VLU A;  1K0B A;  3TRX A;  4GF0 A;  2NTO A;  19GS A;  3TGZ A;  2I9H A;  20GS A;  6GSY A;  4N30 A;  5D9V A;  5B7C A;  2FCH A;  2F3M A;  3M0F A;  4TVE A;  4ZBA A;  3IC4 A;  5L71 A;  2HNL A;  3EMP A;  2G0F A;  4K2D A;  4QL9 A;  2OAD A;  1TU8 A;  3U5R E;  3CSI A;  2GZP A;  4DSR A;  2CZ3 A;  1CQH A;  1GTI A;  3FK8 A;  1A0F A;  5C04 A;  2R5G A;  4Z2U A;  1X9S B;  3IRA A;  1WIK A;  3KP9 A;  1SU9 A;  1Z4M A;  1GSY A;  4MF5 A;  4DVC A;  2WJU A;  2H70 A;  2H6X A;  2L4C A;  3R6Q A;  1EEJ A;  2DJ2 A;  4OO5 A;  1BX9 A;  3BWV A;  1TRS A;  1VRS D;  2H75 A;  3MAK A;  1A23 A;  4L0U A;  4YQM A;  1ABA A;  1GSD A;  1TJD A;  4L0W A;  4P3Y B;  4ZL9 A;  1WWJ A;  4HQS A;  1GTA A;  2GZZ A;  1TK8 B;  2MMZ A;  3LYK A;  4ML6 A;  2E7P A;  3C8E A;  1TK0 B;  4NXI A;  1SD9 A;  1R7H A;  2GSR A;  3HDC A;  2I1U A;  5DAK A;  3CMI A;  2H1A A;  4XIH A;  1AW9 A;  4L57 A;  2J9H A;  2XBI A;  5HQP A;  4PTS A;  3EPT A;  3TDG A;  1BG5 A;  2LS5 A;  1OC3 A;  1AIU A;  3KH9 A;  2NPB A;  2VCV A;  3MWH A;  1FVK A;  3H8Q A;  11GS A;  1EOG A;  16GS A;  2V6K A;  3GUS A;  5IQY A;  3IBH A;  2CT6 A;  2DJJ A;  4Z7X A;  2JAO A;  3DIE A;  3VWX A;  2ON7 A;  4ECB A;  2OBK A;  4FYU A;  4MJE A;  3L9S A;  1GLP A;  2H19 A;  4HSC X;  4K2X A;  5A4W A;  2X8G A;  5CP1 A;  4PXO A;  4YIK A;  1EP8 A;  1M2D A;  1NHY A;  3GIX A;  4N0Z A;  3GH9 A;  1V40 A;  4KH7 A;  1TJW A;  22GS A;  3D4M A;  3MSZ A;  1DOF A;  1K3Y A;  1TJU A;  4RQX A;  2F9S A;  4TR4 A;  4WXT A;  5ECL B;  1T4Y A;  1JHB A;  3G7I A;  1K0D A;  3U13 A;  2WCI A;  1Z9H A;  4OFT A;  1Q98 A;  1G7E A;  4BIK A;  2FLS A;  4K1F A;  2B5Y A;  4MPF A;  4I2U A;  4BPY A;  3FRC A;  1FO5 A;  2QSI A;  4K7N A;  3TKS C;  3KTB A;  5D9X A;  4ICY A;  3GL5 A;  4EFC A;  2HSH A;  3BBY A;  3ISO A;  3KEB A;  2OAC A;  4O5Q A;  3PIN A;  4QQ7 A;  3GV1 A;  1FUR A;  8GSS A;  1YKC A;  2FA8 A;  4EEI A;  2DJ0 A;  5G5E A;  2YP6 A;  2B6M A;  4HI7 A;  2H74 A;  2RUE A;  5ID2 A;  2A2S A;  1YDK A;  4MX2 A;  2IJY A;  3BCI A;  3M9J A;  3PPU A;  5DCG A;  4NSL A;  2GTU A;  1VF4 A;  1XWB A;  3KTL A;  1PMT A;  1WP0 A;  2H73 A;  4K5R A;  5F92 A;  3ERF A;  1YF1 A;  4L6C A;  4YKG A;  3ZFB A;  1V57 A;  1NM3 A;  4K8M A;  1GUK A;  5BMU A;  3TKR A;  5GAN D;  1K0M A;  5CO3 A;  2MMN A;  2YJH A;  5ECM B;  1ST9 A;  4JRR A;  1ZYQ B;  1TU7 A;  3TRQ A;  2C0E A;  3VK9 A;  4G2E A;  1LU4 A;  4L8E A;  4LMW A;  4IS0 A;  2LJA A;  1SL1 B;  3GRX A;  2YZU A;  3TOT A;  4GQF A;  1EGR A;  4YH2 A;  4FO5 A;  2LV3 A;  1RK4 A;  4OFM A;  2MBS A;  3CTG A;  2LRN A;  4IN0 A;  3HVN A;  4Z2T A;  5HR2 A;  1RE5 A;  2RCN A;  4I5Q A;  3I6A A;  4BWS A;  3A3T A;  1OYJ A;  1JZO A;  2N5F A;  5INY A;  1Q5N A;  3BCK A;  5A4V A;  4BVY B;  4HJ2 A;  1R5P A;  2V6O A;  2FHE A;  1XPV A;  3TB2 A;  1SK1 A;  1WRY A;  4J57 E;  1YFM A;  3QAG A;  3U6V A;  2YV9 A;  5GAP D;  4O5U A;  2BJX A;  2H8L A;  2X49 A;  1S3A A;  1BAY A;  4ZB6 A;  4K6X A;  2HSY A;  2XPE A;  1GTB A;  1Z6N A;  2HRF A;  2H6Z A;  3UMA A;  2FA4 A;  5GZZ B;  2I81 A;  4YAV A;  3W8J A;  2HRA A;  2LJR A;  1K0C A;  2HZE B;  5JCW A;  1K0A A;  5H5R A;  2WS2 A;  3C73 A;  2IME A;  1QMV A;  4AJ6 A;  5F8B A;  4NLE A;  1SD8 A;  3ME7 A;  3O3T A;  1SJZ A;  3UVT A;  1QFN A;  2O85 A;  2CAQ A;  12GS A;  3MYD A;  4NHW A;  3VLN A;  3R2Q A;  2C3T A;  1S3C A;  3C1S A;  1BED A;  2HXK A;  3H4K A;  3QD9 A;  2CAI A;  3UAP A;  3RHC A;  4Q5R A;  2DJ3 A;  1AXD A;  3IAM 2;  1NSW A;  3FZA A;  1GRX A;  3W6G A;  1OC8 A;  2XPD A;  2ALB A;  4JED A;  4TOP A;  2DML A;  2CZ2 A;  1MDJ A;  2IFQ A;  3LEF A;  1OAZ A;  2PTR A;  2PER A;  4G0I A;  3CXG A;  1CQG A;  5KOW A;  3KP8 A;  2R0P A;  4Q5N A;  2LRC A;  4ZBB A;  1MD4 A;  2AAW A;  1WPI A;  1HYU A;  3CSH A;  3FYG A;  3HA9 A;  4PQ1 A;  2ES7 A;  2VCT A;  3SBC A;  2RM6 A;  1NW2 A;  5D96 A;  1VF1 A;  4YQU A;  4PQI A;  5JWR B;  1K3L A;  3RHB A;  1I5G A;  1GH2 A;  3OCE A;  1ACV A;  1C72 A;  2YWN A;  3GNJ A;  4OO4 A;  4H86 A;  1SYX A;  1TOF A;  1ERV A;  3F8U A;  3APQ A;  1T7P B;  2KP1 A;  4MDC A;  4AF2 A;  1YFE A;  1HNA A;  4MPG A;  3L0H A;  4TXO B;  1TI3 A;  4CY6 A;  1ZMA A;  4PUA A;  3FR6 A;  1FUO A;  3ERG A;  3BD2 A;  1E6B A;  2KP2 A;  2FD3 A;  4JBB A;  3M9K A;  4ECJ A;  2WZ9 A;  2OKA A;  3E04 A;  1TDI A;  2DMM A;  3S9F A;  3M3M A;  4X0X A;  5IIZ A;  1V58 A;  4LL4 B;  5D93 A;  4EDZ A;  3LXZ A;  4TN8 A;  3ERW A;  3TUE A;  1E2Y A;  1OC9 A;  4CDO A;  1FOH A;  2L4Q A;  1SKW B;  2DLX A;  3FEU A;  2QGV A;  1M3I A;  3DRN A;  2JAW A;  4HU7 A;  5F0G A;  1THO A;  2DSA A;  1PN0 A;  2YNX A;  5F07 A;  2JAU A;  2I7D A;  3WT1 A;  2L6C A;  2JAC A;  3P2A A;  1PKZ A;  3QFA C;  1YQ1 A;  4TR1 A;  1HQO A;  3IDV A;  4PQH A;  3LG6 A;  3F0I A;  2O89 A;  2JZS A;  1XOA A;  3F63 A;  1OKD A;  5CYY A;  3GX0 A;  3TJK A;  2MYG A;  1GSU A;  4TW5 A;  2R0C A;  5ECS A;  3KD0 A;  4GST A;  1A0R P;  4IP1 A;  3A5W A;  2WUL A;  4OMV A;  4XRA A;  3DVX A;  2WFC A;  4BL7 A;  2XC2 A;  1ERT A;  1U88 A;  3ZZX A;  2JSY A;  1K0O A;  1A8Y A;  2C4J A;  5JCU A;  1T9H A;  3APO A;  4EVM A;  1S3R A;  1ZGN A;  2HT9 A;  4IQA A;  2VUP A;  1Z4L A;  2AB6 A;  4LL1 B;  4ZL7 A;  2CQ9 A;  4DSS B;  3IPZ A;  4HJM A;  1GP1 A;  2VM2 A;  4NV2 A;  3DWV A;  4TR0 A;  1MD3 A;  2N5B A;  5B8A A;  1H75 A;  3D0Z A;  3C8T A;  4F03 A;  1K62 A;  2FGX A;  3LQ7 A;  3FY7 A;  4JZQ A;  3QBP A;  1EV4 A;  5F91 A;  4ADM A;  2PVO C;  3DML A;  4ISD A;  13GS A;  1YF0 A;  2PU9 C;  4G0L A;  3H1N A;  2EIR A;  2AHE A;  1XWA A;  3F6F A;  1WOU A;  2GQK A;  2TIR A;  2F51 A;  1A24 A;  4KW6 A;  4ACS A;  2VL2 A;  1YZX A;  4X4J A;  1F9M A;  4F9Z A;  3GKK A;  4OFN A;  2VD0 A;  2WDU A;  1GL8 A;  3H93 A;  5LNK e;  1TW9 A;  4Q5F A;  1Z7P A;  2PGT A;  4KE3 A;  5D73 A;  1IYH A;  5AN1 A;  3NOF A;  2LQQ A;  3TOU A;  3I9V 2;  5ECP B;  4ILF A;  4XRD A;  4KSO A;  4JR4 A;  1GSQ A;  3D21 A;  2R6K A;  4K0G A;  2GZY A;  4KF9 A;  5D9T A;  4JU5 A;  2IMK A;  1U16 A;  4G19 A;  4XS4 A;  2BTO T;  3QCP A;  1RQM A;  4WEY A;  2K6V A;  4RI6 A;  1MTC A;  1PQN A;  1ZCP A;  3IK7 A;  2LQO A;  1K7W A;  1OE7 A;  1ZYN A;  3SWL A;  3ZIT A;  1YKA A;  5HR1 A;  4O92 A;  3HVS A;  3GTU A;  1K3O A;  4GSS A;  1Q91 A;  2V1M A;  6GSU A;  2H76 A;  4V2M A;  1MH9 A;  4BVX B;  1SKS B;  2B7K A;  1XW9 A;  1Y25 A;  1JZD A;  5ELA A;  1HNC A;  2D28 C;  2LJK A;  3FZ5 A;  1BQ7 A;  3GKX A;  1VF2 A;  1PGT A;  1Z5Y E;  4EKZ A;  4CY8 A;  3ZLP A;  4EDY A;  2LUS A;  1GNW A;  1B48 A;  4Z2R A;  3TKP A;  3IXR A;  4XCS A;  1I9D A;  1G6W A;  1XXU A;  1ZYP A;  5G30 A;  4FYB A;  4FYC A;  4K0N A;  2PTS A;  1R26 A;  1A2J A;  3RAZ A;  5EVO A;  2LNS A;  1WE0 A;  2NBS A;  2QA1 A;  3QR6 A;  3ZYW A;  4GXZ A;  1XVQ A;  2KUC A;  2ON5 A;  2VLT A;  3KIJ A;  1XWG A;  2ZUP A;  1AUW A;  1GSE A;  2CX3 A;  2P5R A;  4KA0 A;  3R6V A;  6GSX A;  3VI5 A;  1JLV A;  1W89 A;  2L6D A;  1RW1 A;  2P31 A;  2L5O A;  5IMF A;  1M99 A;  5F05 A;  4MZB A;  1JZR A;  5HFG A;  1EGO A;  4OCE A;  1B4Q A;  3DYR A;  1O81 A;  2CA8 A;  4MAB A;  1ILO A;  2C1Y A;  1IYI A;  5ECQ B;  1USB A;  3DD3 A;  3CSJ A;  5DQY A;  3RPP A;  1B4P A;  1YJ6 A;  5F06 A;  1Y6E A;  3GUR A;  2FY6 A;  1GSF A;  1FB0 A;  3IV4 A;  5CRD A;  2YWI A;  1TJ7 A;  2TRX A;  4JE1 A;  3L4N A;  3QAW A;  1O8W A;  4KB3 A;  3RDW A;  2GVP A;  2DC5 A;  4KUN A;  2B7J A;  5H5Q A;  2LTK A;  4AJ7 A;  2IL3 A;  1FHE A;  1A8L A;  4MNN A;  4HUA A;  4IQJ M;  2GSQ A;  2E2G A;  3IOS A;  5A5K A;  5EPF A;  4PUF C;  4MF6 A;  1V9W A;  2HRN A;  2E2M A;  1LJR A;  5BRT A;  1SL2 B;  1HY1 A;  1M2A A;  4O32 A;  2OE3 A;  4I2T A;  5DAK B;  5DDL A;  1LBK A;  4MZW A;  2C0D A;  2IWT A;  2XHF A;  2VCZ A;  1FAA A;  3A2W A;  1JSW A;  2C8U A;  4GQC A;  4AJ8 A;  4PGT A;  4EIQ A;  2R4V A;  5G2Z A;  2UZ8 A;  1XIY A;  3FKF A;  1FG4 A;  4K7I A;  5DBQ A;  4MCU A;  1KTE A;  1ML6 A;  3HZ8 A;  1PL2 A;  2CX4 A;  5FWG A;  1DUG A;  3IHG A;  4POB A;  4KDX A;  3L9U A;  4KCA A;  3UL3 A;  3C1R A;  4WR4 A;  4N0V A;  1KNG A;  1THX A;  3EC3 A;  1AQX A;  2GGT A;  1GUM A;  3PGT A;  2VM1 A;  5DVB A;  3ZIJ A;  3U19 A;  3IC8 A;  4KX4 A;  4EIP A;  2VCX A;  2H1D A;  2LRT A;  2M46 A;  1PX6 A;  3A2V A;  3KGK A;  3UOM A;  3E9J B; 
#chains in the Genus database with same CATH homology
 3EE2 A;  3IR4 A;  2D2Z A;  3VWU A;  4D73 A;  4MH2 A;  4EUY A;  1M0U A;  3LWA A;  1V98 A;  3QPM A;  2O8V B;  2C3N A;  6GSS A;  3G9B A;  2JZR A;  4RQR A;  2GDR A;  2FWH A;  1ON4 A;  2AJQ B;  1PL1 A;  4EF0 A;  1JFU A;  4KGI A;  3TJG A;  5COH A;  4HZ4 A;  3D4T A;  2PBJ A;  5JWO B;  1HNB A;  4GWR A;  5LCZ A;  2AV4 A;  1EOH A;  3ZL5 A;  4K9Z A;  1ZZY A;  5ENU A;  2F8F A;  1M7T A;  3HHV A;  3P90 A;  2VIM A;  1QQ2 A;  2LST A;  3F3R A;  3UEM A;  4ZL8 A;  4F0C A;  1AQW A;  4I8B A;  1XZO A;  5ID2 B;  3GKM A;  3TCO A;  3OR5 A;  1XOB A;  3QMX A;  1O7U A;  2C3Q A;  3EYT A;  5ECK B;  3M8N A;  4ZXG A;  3K8N A;  2B5X A;  1PA3 A;  1J08 A;  5DQS A;  2NDO A;  4K7O A;  3KH7 A;  2DIY A;  3AY8 A;  2LKU A;  3MDK A;  3CBU A;  4MK3 A;  1K0N A;  4CW9 A;  2PWJ A;  3Q18 A;  1V2A A;  3FZ9 A;  2L59 A;  4ZIJ A;  3RPN A;  5DAL A;  4LMV A;  2DKI A;  3IHQ A;  5FT3 A;  3CYN A;  2YV7 A;  3D5J A;  2HFD A;  4LLR A;  5AIS A;  4YKF A;  4WF5 A;  2WGR A;  7GSS A;  3WT2 A;  3F4T A;  4ID0 A;  3UBL A;  1Z6M A;  5KOX A;  1DBY A;  4G9H A;  4ZBD A;  3EIN A;  4EXJ A;  3GX8 A;  3FZ4 A;  4K5S A;  4IBP A;  4ZB8 A;  2OE0 A;  1FB6 A;  4X43 A;  4WET A;  5GSS A;  1F2E A;  4POK A;  1SEN A;  2B1K A;  3NZN A;  2RUF A;  1T3B A;  2H1G A;  4J56 E;  2B5E A;  4ECI A;  4IVF A;  4HOJ A;  2HYX A;  4I97 A;  1JZW A;  3G7Y A;  4EE0 A;  3DXB A;  1OE8 A;  3VPQ A;  1TK5 B;  3ZIV A;  3GSS A;  4HDE A;  2CVK A;  2VAF A;  2YOI A;  4IW9 A;  4MLY A;  4KAE A;  3LXT A;  6GSV A;  5JWQ B;  1JLW A;  2JL4 A;  3O76 A;  2RM5 A;  4MF7 A;  1ZOF A;  5EY6 A;  3DGQ A;  4XS6 A;  3W8S A;  4GSN A;  2GQM A;  4X1U A;  5AIV A;  5DJM A;  1GUH A;  2AYT A;  5J9B A;  5CAX A;  5IMV A;  2H71 A;  4L5O A;  14GS A;  5KN2 A;  1QGV A;  3A2X A;  2I4A A;  2HE3 A;  3MIX A;  1ERU A;  1BJX A;  4MMM A;  5G5F A;  4IQ1 A;  2VO4 A;  4I6X A;  1TRU A;  2R37 A;  4HS1 A;  4DEJ A;  2H0G A;  4JR6 A;  3HKR A;  5LD0 A;  1FOV A;  2HRK A;  2EIQ A;  3UVH A;  3F4R A;  6GSW A;  3NIV A;  1TRV A;  2EC4 A;  4L5L A;  3GKN A;  5KEJ A;  4F2I A;  4WR5 A;  1QK8 A;  1VF3 A;  2HZF A;  2YWO A;  4MP4 A;  3E3E A;  5CNW A;  1YEP A;  3J7Y b;  4IJI A;  1X9M B;  1F6M C;  2IFQ B;  5CRH A;  3R3E A;  4HZ2 A;  1MDI A;  2JSZ A;  5ECI B;  1MEK A;  1SYR A;  2VD1 A;  1X0R A;  1OKT A;  3GH6 A;  4IP6 A;  1PD2 1;  3CRT A;  3N5O A;  1J0F A;  1GWC A;  2R2J A;  2JAD A;  1W4V A;  2OE1 A;  1F3B A;  3I43 A;  1YY7 A;  3KJY A;  3EMX A;  2GT6 A;  3VFI A;  2DIZ A;  1O85 A;  2CVB A;  2VCW A;  2VL2 C;  3Q19 A;  2F8A A;  1GSS A;  3VWW A;  2L5L A;  5IPG A;  2GSS A;  1QXH A;  2YJ7 A;  4O5R A;  3G7J A;  4BA7 A;  3GHA A;  2D27 A;  4MH3 A;  2H01 A;  1TI1 A;  1XWK A;  2VLV A;  1SKR B;  4AGS A;  2OJL A;  2X99 A;  2P5Q A;  2RLI A;  5ECN B;  3KCM A;  2GQL A;  5GST A;  2YAN A;  2O7K A;  18GS A;  5IMZ A;  3QAV A;  9GSS A;  4A5P A;  6GST A;  3BJ5 A;  3C71 A;  3ZRD A;  1M9A A;  2IPA A;  1EZK A;  3QOU A;  5KN3 A;  3LFL A;  1OC9 B;  2V2G A;  4HU9 A;  1PN9 A;  1TRW A;  4HQZ A;  2MMA A;  3HJM A;  2HI7 A;  5J5N A;  5KN1 A;  4RI7 A;  3N9J A;  2JZT A;  3VI7 A;  3E0U A;  4WBR D;  4TR1 B;  2C0F A;  2KLX A;  4EC0 A;  3HXS A;  4MJC A;  1WMJ A;  5FHI A;  1DSB A;  1TP9 A;  2MMO A;  1B9X C;  3ZVJ A;  2V32 A;  1G0T A;  5J9C A;  3LW9 A;  1Z3E A;  3WGX A;  3F4S A;  1SK2 A;  3ZVJ D;  2R3X A;  4BL7 B;  5ECO B;  2IIY A;  2X8C A;  3H79 A;  2CVD A;  3WD6 A;  4Q5Q A;  3TRP A;  3HY2 A;  3PH9 A;  1BYE A;  1O73 A;  2REM A;  1EV9 A;  4F0B A;  3IK9 A;  3HD5 A;  3HVX A;  3LGC A;  2A4H A;  1SK0 A;  1ZYE A;  1MDK A;  5B6N A;  2IN3 A;  4GTU A;  4CHS A;  3CRU A;  4WKW A;  2VOC A;  2H1B A;  1U6T A;  2FWE A;  3ED3 A;  1S3D A;  5ELG A;  3ZML A;  3MNG A;  3HJP A;  4N10 A;  4NHZ A;  1GTU A;  1HD2 A;  3VPT A;  4BVY A;  2RII A;  3F9U A;  4OWY A;  4BWQ A;  3L78 A;  1X5D A;  2PMT A;  4V2L A;  2A4V A;  3EWL A;  1UC7 A;  5IMC A;  3EUR A;  5HFI A;  2FWG A;  1AAZ A;  1X5C A;  3I69 A;  2VL3 A;  2L57 A;  5CRW A;  5KN0 A;  2A2R A;  2EIO A;  4USS A;  3J7Y k;  4LA1 A;  4IGJ A;  1WJK A;  2H6Y A;  4E8H A;  1T1V A;  1A2M A;  1SJ6 A;  1A2L A;  2VL9 A;  4RUV A;  5C00 A;  3TKS A;  2BMX A;  4XS4 B;  4J2F A;  1ERW A;  2X4A A;  2HLS A;  4KSM A;  2HZE A;  4FQU A;  3F3Q A;  5IMA A;  1EEM A;  2X8H A;  5AGY A;  4PX1 A;  1F37 A;  4MJB A;  2CV4 A;  4G0K A;  3EU4 A;  3GTU B;  1Q4J A;  4GCI A;  3GL3 A;  3UIW A;  3Q6O A;  2R0G A;  3D6I A;  1FW1 A;  1UVZ A;  1M9B A;  2G2Q A;  3DKS A;  2YCD A;  3KMN A;  2WRT A;  1URM A;  2QC7 A;  2H66 A;  1XW5 A;  1TXX A;  3IE3 A;  1N8J A;  2GS3 A;  3CTF A;  5ECH B;  5HR0 A;  3GN3 A;  1U3I A;  2PVQ A;  4PNF A;  4GLT A;  4KDU A;  4ZIL A;  3WGD A;  5JCG A;  1XBS A;  2H30 A;  5J41 A;  4MZC A;  2V41 A;  3EVI A;  4FIW A;  1GLQ A;  4TXV A;  2J23 A;  1DE2 A;  1T4Z A;  4MA9 A;  3TJB A;  2O87 A;  1NHO A;  3KMO A;  3GA4 A;  1AUC A;  4KDY A;  3VUR A;  3IAS 2;  4ULX A;  1R4W A;  1ZL9 A;  1EWX A;  4O7H A;  2DJK A;  3LSZ A;  5CRG A;  5B6M A;  3KZQ A;  1TKD B;  3ZFL A;  2B1L A;  2ZCT A;  2KHP A;  1FVJ A;  2LEG A;  1KEB A;  4WBJ A;  5D8I A;  2GT5 A;  5G1K A;  2C0G A;  1TTZ A;  1J9B A;  5IO2 A;  4TXO A;  3HZ4 A;  4POM A;  2FWF A;  3O6T A;  3LOR A;  1G7O A;  2AUV A;  2K8S A;  3TJJ A;  3WYW A;  3HJO A;  5IPH A;  2XBQ A;  3RBT A;  4NAX A;  5G31 A;  5J4U A;  2TRC P;  5AIX A;  1PRX A;  4XHM A;  3EU3 A;  1XVW A;  2YZH A;  3HCZ A;  4F82 A;  3FHK A;  1EP7 A;  2MBT A;  2FNO A;  4EL1 A;  2OA7 A;  4TKY A;  1XWC A;  3UBK A;  2I3Y A;  2IMI A;  4V1A g;  5DCH A;  3A5I A;  4FH8 A;  17GS A;  4KND A;  2YPM A;  5IO0 A;  1SL0 B;  4IKH A;  5B8B A;  3FMW A;  1R5A A;  3LJR A;  5J3R A;  1Z7R A;  1KBN A;  2K18 A;  5IOX A;  1XCC A;  4YQV A;  1UA5 A;  1PX7 A;  1F3A A;  2GST A;  2K8V A;  3GMF A;  3DEX A;  3WGE A;  3M1G A;  1DE1 A;  5CRE A;  1B8X A;  3TKQ A;  2KOK A;  2B3S A;  3US3 A;  4POL A;  2P0G A;  3KXO A;  4NPB A;  5IM9 A;  2QKE A;  5IOW A;  2H0I A;  3TJF A;  4N11 A;  1T8E B;  5E4W A;  3Q74 A;  3GFK A;  4V2N A;  4PUR A;  2A2P A;  4D73 B;  4DSS A;  2OBI A;  2H0H A;  3QFB C;  2C80 A;  1N2A A;  4EO3 A;  4ZB9 A;  1IW7 D;  1QUW A;  3F6D A;  1U3A A;  4PNG A;  1GUL A;  1M2B A;  1X5E A;  2HSM A;  3HYP A;  2K9F A;  3V1W A;  10GS A;  4TR3 A;  3P7X A;  4XTS A;  3JCM L;  2YWM A;  2YN1 A;  4KCE A;  1AQV A;  4NV5 A;  3PR8 A;  2IMF A;  5EL8 A;  2LNT A;  1O6J A;  5G1L A;  2NVL A;  3C7M A;  4ECC A;  4IEL A;  2JU5 A;  4ML1 A;  2Z9S A;  5ABR A;  2DJ1 A;  4GRF A;  3UAR A;  4MJA A;  5HR3 A;  1OVN A;  2E0Q A;  4OCF A;  3ZTL A;  5A4U A;  2IMD A;  4NMU A;  4XS1 A;  4E8E A;  1U87 A;  4HEA 2;  5ECR B;  3FW2 A;  1T00 A;  1GNE A;  2DKH A;  2VCQ A;  4IHU A;  3ZMK A;  3FR3 A;  3LYP A;  3IA1 A;  1XFL A;  2WB9 A;  3UJ1 A;  4TRX A;  1H4O A;  1VGL A;  2PN8 A;  2PPT A;  2N5A A;  3APS A;  2GLR A;  3GYK A;  3VWV A;  3QDN A;  4YAP A;  1PSQ A;  2FUG 2;  1PKW A;  1YEX A;  3L9V A;  3FR9 A;  4IJ3 A;  1B9Y C;  1O8X A;  4DSQ A;  3BOA A;  3DVW A;  3P8W A;  3KM6 A;  4BVX A;  5DAL B;  1XW6 A;  2PUK C;  1X9W B;  2X64 A;  5E59 A;  1AC1 A;  4V1A p;  5D9W A;  4QL7 A;  4OD7 A;  2M80 A;  3ZRE A;  5IMD A;  1UN2 A;  4WF4 A;  5HFK A;  3GST A;  2QA2 A;  2M72 A;  2DBC A;  4G10 A;  4NWY A;  2MZC A;  3HVV A;  1G6Y A;  5H5S A;  3ME8 A;  1SJI A;  2ZNM A;  2H72 A;  3TKS E;  5DJL A;  3D22 A;  2VLU A;  1K0B A;  3TRX A;  4GF0 A;  2NTO A;  19GS A;  3TGZ A;  2I9H A;  20GS A;  6GSY A;  4N30 A;  5D9V A;  5B7C A;  2FCH A;  2F3M A;  3M0F A;  4TVE A;  4ZBA A;  3IC4 A;  5L71 A;  2HNL A;  3EMP A;  2G0F A;  4K2D A;  4QL9 A;  2OAD A;  1TU8 A;  3U5R E;  3CSI A;  2GZP A;  4DSR A;  2CZ3 A;  1CQH A;  1GTI A;  3FK8 A;  1A0F A;  5C04 A;  2R5G A;  4Z2U A;  1X9S B;  3IRA A;  1WIK A;  3KP9 A;  1SU9 A;  1GSY A;  4MF5 A;  4DVC A;  2WJU A;  2H70 A;  2H6X A;  2L4C A;  1EEJ A;  2DJ2 A;  4OO5 A;  1BX9 A;  2H75 A;  1TRS A;  1VRS D;  3MAK A;  1A23 A;  4L0U A;  4YQM A;  1ABA A;  1GSD A;  1TJD A;  4L0W A;  4P3Y B;  4ZL9 A;  1WWJ A;  4HQS A;  1GTA A;  2GZZ A;  1TK8 B;  2MMZ A;  3LYK A;  4ML6 A;  2E7P A;  3C8E A;  1TK0 B;  4NXI A;  1SD9 A;  1R7H A;  2GSR A;  3HDC A;  2I1U A;  5DAK A;  3CMI A;  2H1A A;  4XIH A;  1AW9 A;  2J9H A;  2XBI A;  5HQP A;  4PTS A;  3EPT A;  3TDG A;  1BG5 A;  2LS5 A;  1OC3 A;  1AIU A;  3KH9 A;  2NPB A;  2VCV A;  3MWH A;  1FVK A;  3H8Q A;  11GS A;  1EOG A;  16GS A;  2V6K A;  3GUS A;  5IQY A;  3IBH A;  2CT6 A;  2DJJ A;  4Z7X A;  3DIE A;  3VWX A;  2ON7 A;  4ECB A;  2OBK A;  4FYU A;  4MJE A;  3L9S A;  1GLP A;  2H19 A;  4K2X A;  5A4W A;  2X8G A;  5CP1 A;  4PXO A;  1EP8 A;  1M2D A;  1NHY A;  3GIX A;  4N0Z A;  3GH9 A;  1V40 A;  4KH7 A;  22GS A;  3D4M A;  3MSZ A;  1K3Y A;  4RQX A;  4TR4 A;  2F9S A;  4WXT A;  5ECL B;  1T4Y A;  1JHB A;  3G7I A;  1K0D A;  2WCI A;  1Z9H A;  4OFT A;  1Q98 A;  1G7E A;  2FLS A;  4K1F A;  2B5Y A;  4MPF A;  4I2U A;  4BPY A;  3FRC A;  1FO5 A;  2QSI A;  4K7N A;  3TKS C;  3KTB A;  5D9X A;  4ICY A;  3GL5 A;  2HSH A;  3BBY A;  3ISO A;  3KEB A;  2OAC A;  4O5Q A;  3PIN A;  4QQ7 A;  3GV1 A;  8GSS A;  1YKC A;  2FA8 A;  2DJ0 A;  5G5E A;  2YP6 A;  2B6M A;  4HI7 A;  2H74 A;  2RUE A;  5ID2 A;  2A2S A;  1YDK A;  2IJY A;  3BCI A;  3M9J A;  3PPU A;  5DCG A;  2GTU A;  1VF4 A;  1XWB A;  3KTL A;  1PMT A;  1WP0 A;  2H73 A;  4K5R A;  3ERF A;  1YF1 A;  4YKG A;  3ZFB A;  1V57 A;  1NM3 A;  4K8M A;  1GUK A;  5BMU A;  3TKR A;  5GAN D;  1K0M A;  5CO3 A;  2MMN A;  2YJH A;  5ECM B;  1ST9 A;  4JRR A;  1ZYQ B;  1TU7 A;  3TRQ A;  2C0E A;  3VK9 A;  4G2E A;  1LU4 A;  4L8E A;  4LMW A;  4IS0 A;  2LJA A;  1SL1 B;  3GRX A;  2YZU A;  3TOT A;  4GQF A;  1EGR A;  4YH2 A;  4FO5 A;  2LV3 A;  1RK4 A;  4OFM A;  2MBS A;  3CTG A;  2LRN A;  4IN0 A;  4Z2T A;  5HR2 A;  4I5Q A;  3I6A A;  4BWS A;  3A3T A;  1OYJ A;  1JZO A;  2N5F A;  5INY A;  3BCK A;  5A4V A;  4BVY B;  4HJ2 A;  1R5P A;  2V6O A;  2FHE A;  1XPV A;  3TB2 A;  1SK1 A;  1WRY A;  4J57 E;  3QAG A;  3U6V A;  2YV9 A;  5GAP D;  4O5U A;  2BJX A;  2H8L A;  2X49 A;  1S3A A;  1BAY A;  4ZB6 A;  4K6X A;  2HSY A;  2XPE A;  1GTB A;  1Z6N A;  2HRF A;  2H6Z A;  3UMA A;  2FA4 A;  5GZZ B;  2I81 A;  4YAV A;  3W8J A;  2HRA A;  2LJR A;  1K0C A;  2HZE B;  5JCW A;  1K0A A;  5H5R A;  2WS2 A;  3C73 A;  2IME A;  1QMV A;  4AJ6 A;  5F8B A;  1SD8 A;  3ME7 A;  3O3T A;  1SJZ A;  3UVT A;  1QFN A;  2O85 A;  2CAQ A;  12GS A;  3MYD A;  4NHW A;  3VLN A;  3R2Q A;  2C3T A;  1S3C A;  3C1S A;  1BED A;  2HXK A;  3H4K A;  3QD9 A;  2CAI A;  3UAP A;  3RHC A;  4Q5R A;  2DJ3 A;  1AXD A;  3IAM 2;  1NSW A;  3FZA A;  1GRX A;  3W6G A;  1OC8 A;  2XPD A;  2ALB A;  4JED A;  4TOP A;  2DML A;  2CZ2 A;  1MDJ A;  2IFQ A;  3LEF A;  1OAZ A;  2PER A;  4G0I A;  3CXG A;  1CQG A;  5KOW A;  3KP8 A;  2R0P A;  4Q5N A;  2LRC A;  4ZBB A;  1MD4 A;  2AAW A;  1WPI A;  1HYU A;  3CSH A;  3FYG A;  3HA9 A;  4PQ1 A;  2ES7 A;  2VCT A;  3SBC A;  2RM6 A;  1NW2 A;  5D96 A;  1VF1 A;  4YQU A;  4PQI A;  5JWR B;  1K3L A;  3RHB A;  1I5G A;  1GH2 A;  1ACV A;  1C72 A;  2YWN A;  3GNJ A;  4OO4 A;  4H86 A;  1SYX A;  1TOF A;  1ERV A;  3F8U A;  3APQ A;  1T7P B;  2KP1 A;  4MDC A;  4AF2 A;  1HNA A;  4MPG A;  3L0H A;  4TXO B;  1TI3 A;  4CY6 A;  1ZMA A;  4PUA A;  3FR6 A;  3ERG A;  3BD2 A;  1E6B A;  2KP2 A;  2FD3 A;  4JBB A;  3M9K A;  4ECJ A;  2WZ9 A;  2OKA A;  1TDI A;  2DMM A;  3S9F A;  3M3M A;  4X0X A;  5IIZ A;  1V58 A;  4LL4 B;  5D93 A;  4EDZ A;  3LXZ A;  4TN8 A;  3ERW A;  3TUE A;  1E2Y A;  1OC9 A;  4CDO A;  1FOH A;  2L4Q A;  1SKW B;  2DLX A;  3FEU A;  2QGV A;  3DRN A;  4HU7 A;  5F0G A;  1THO A;  2DSA A;  1PN0 A;  2YNX A;  5F07 A;  3WT1 A;  2L6C A;  2JAC A;  3P2A A;  1PKZ A;  3QFA C;  1YQ1 A;  4TR1 A;  1HQO A;  3IDV A;  4PQH A;  3LG6 A;  3F0I A;  2O89 A;  2JZS A;  1XOA A;  3F63 A;  1OKD A;  5CYY A;  3GX0 A;  3TJK A;  2MYG A;  1GSU A;  4TW5 A;  2R0C A;  5ECS A;  3KD0 A;  4GST A;  1A0R P;  4IP1 A;  3A5W A;  2WUL A;  4OMV A;  4XRA A;  3DVX A;  2WFC A;  4BL7 A;  2XC2 A;  1ERT A;  1U88 A;  3ZZX A;  2JSY A;  1K0O A;  1A8Y A;  2C4J A;  5JCU A;  4EVM A;  3APO A;  1ZGN A;  2HT9 A;  4IQA A;  2VUP A;  2AB6 A;  4LL1 B;  4ZL7 A;  2CQ9 A;  4DSS B;  3IPZ A;  4HJM A;  1GP1 A;  2VM2 A;  4NV2 A;  3DWV A;  4TR0 A;  1MD3 A;  2N5B A;  5B8A A;  1H75 A;  3D0Z A;  4F03 A;  2FGX A;  3LQ7 A;  3FY7 A;  4JZQ A;  1EV4 A;  2PVO C;  3DML A;  4ISD A;  13GS A;  1YF0 A;  2PU9 C;  4G0L A;  3H1N A;  2EIR A;  2AHE A;  1XWA A;  3F6F A;  1WOU A;  2GQK A;  2TIR A;  2F51 A;  1A24 A;  4KW6 A;  4ACS A;  2VL2 A;  1YZX A;  4X4J A;  1F9M A;  4F9Z A;  3GKK A;  4OFN A;  2VD0 A;  2WDU A;  1GL8 A;  3H93 A;  5LNK e;  1TW9 A;  4Q5F A;  1Z7P A;  2PGT A;  4KE3 A;  5D73 A;  1IYH A;  5AN1 A;  3NOF A;  2LQQ A;  3TOU A;  3I9V 2;  5ECP B;  4ILF A;  4XRD A;  4KSO A;  4JR4 A;  1GSQ A;  3D21 A;  2R6K A;  4K0G A;  2GZY A;  4KF9 A;  5D9T A;  4JU5 A;  2IMK A;  4G19 A;  4XS4 A;  2BTO T;  3QCP A;  1RQM A;  4WEY A;  2K6V A;  4RI6 A;  1MTC A;  1PQN A;  1ZCP A;  3IK7 A;  2LQO A;  1ZYN A;  1OE7 A;  3SWL A;  3ZIT A;  1YKA A;  5HR1 A;  4O92 A;  3HVS A;  3GTU A;  1K3O A;  4GSS A;  2V1M A;  6GSU A;  2H76 A;  4V2M A;  4BVX B;  1SKS B;  2B7K A;  1XW9 A;  1Y25 A;  1JZD A;  5ELA A;  1HNC A;  2D28 C;  2LJK A;  3FZ5 A;  1BQ7 A;  3GKX A;  1VF2 A;  1PGT A;  1Z5Y E;  4EKZ A;  4CY8 A;  3ZLP A;  4EDY A;  2LUS A;  1GNW A;  1B48 A;  4Z2R A;  3TKP A;  3IXR A;  4XCS A;  1I9D A;  1G6W A;  1XXU A;  1ZYP A;  5G30 A;  4FYB A;  4FYC A;  4K0N A;  1R26 A;  1A2J A;  3RAZ A;  5EVO A;  2LNS A;  1WE0 A;  2NBS A;  2QA1 A;  3QR6 A;  3ZYW A;  4GXZ A;  1XVQ A;  2KUC A;  2ON5 A;  2VLT A;  3KIJ A;  1XWG A;  2ZUP A;  1GSE A;  2CX3 A;  2P5R A;  4KA0 A;  6GSX A;  3VI5 A;  1JLV A;  1W89 A;  2L6D A;  1RW1 A;  2P31 A;  2L5O A;  5IMF A;  1M99 A;  5F05 A;  4MZB A;  1JZR A;  5HFG A;  1EGO A;  4OCE A;  1B4Q A;  3DYR A;  1O81 A;  2CA8 A;  4MAB A;  1ILO A;  2C1Y A;  1IYI A;  5ECQ B;  1USB A;  3DD3 A;  3CSJ A;  5DQY A;  3RPP A;  1B4P A;  1YJ6 A;  5F06 A;  1Y6E A;  3GUR A;  2FY6 A;  1GSF A;  1FB0 A;  3IV4 A;  5CRD A;  2YWI A;  2TRX A;  4JE1 A;  3L4N A;  3QAW A;  1O8W A;  4KB3 A;  3RDW A;  2GVP A;  2DC5 A;  4KUN A;  2B7J A;  5H5Q A;  2LTK A;  4AJ7 A;  2IL3 A;  1FHE A;  1A8L A;  4MNN A;  4HUA A;  4IQJ M;  2GSQ A;  2E2G A;  3IOS A;  5A5K A;  5EPF A;  4PUF C;  4MF6 A;  1V9W A;  2HRN A;  2E2M A;  1LJR A;  5BRT A;  1SL2 B;  1M2A A;  4O32 A;  2OE3 A;  4I2T A;  5DAK B;  5DDL A;  1LBK A;  4MZW A;  2C0D A;  2IWT A;  2XHF A;  2VCZ A;  1FAA A;  3A2W A;  2C8U A;  4GQC A;  4AJ8 A;  4PGT A;  4EIQ A;  2R4V A;  5G2Z A;  2UZ8 A;  1XIY A;  3FKF A;  1FG4 A;  4K7I A;  5DBQ A;  4MCU A;  1KTE A;  1ML6 A;  3HZ8 A;  1PL2 A;  2CX4 A;  5FWG A;  1DUG A;  3IHG A;  4POB A;  4KDX A;  3L9U A;  4KCA A;  3UL3 A;  3C1R A;  4WR4 A;  4N0V A;  1KNG A;  1THX A;  3EC3 A;  1AQX A;  2GGT A;  1GUM A;  3PGT A;  2VM1 A;  5DVB A;  3ZIJ A;  3IC8 A;  4KX4 A;  4EIP A;  2VCX A;  2H1D A;  2LRT A;  2M46 A;  1PX6 A;  3A2V A;  3KGK A;  3UOM A;  3E9J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...