3F4TA

Crystal structure of wolbachia pipientis alpha-dsba1 c97a/c146a
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
200
structure length
200
Chain Sequence
ITSNELLLPLPNDKLLGDPKAPILMIEYASLTCYHCSLFHRNVFPKIKEKYIDTGKMLYIFRHFPLDYRGLKAAMLSHAYEKQEDYFNFNKAVFNSIDSWNYYNLSDLTLLQRIAALSNLKQDAFNQAINDKKIMDKIVNDKSLAINKLGITATPIFFIKLNDDKSYIEHNKVKHGGYKELKYFTNVIDKLYGKAIVKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative uncharacterized protein
publication title Structural and Functional Characterization of the Oxidoreductase alpha-DsbA1 from Wolbachia pipientis
pubmed doi rcsb
source organism Wolbachia pipientis
total genus 75
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2008-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.80 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Ribonucleotide Reductase Protein R1; domain 1 3f4tA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3f4tA01
4L5OA 5B8BA 5IOWA 5J5NA 1GUKA 3DMLA 2H1DA 1ILOA 4QQ7A 3D21A 1T1VA 2L5LA 4L5LA 3D22A 1JLVA 1CQHA 1HD2A 2P5RA 2NPBA 1GLQA 3F4SA 4YH2A 3FY7A 1V9WA 4OFTA 1A8LA 1SYXA 1FG4A 4G9HA 3U5RE 3HJMA 3TOTA 4FO5A 4KW6A 2DBCA 2REMA 1XBSA 2CAIA 3O3TA 1AQVA 2X8CA 2Z9SA 6GSVA 3KGKA 3WT1A 1W89A 2JZSA 3KH7A 1ABAA 3F8UA 3VK9A 4MZWA 2WFCA 2JZRA 3NOFA 3VWWA 3ZMKA 4HS1A 4XTSA 1BQ7A 1V40A 2XPEA 2ZCTA 1A8YA 5CO3A 1UN2A 1JZOA 4GTUA 1T7PB 2H8LA 2I1UA 3UBKA 4ECIA 2H1AA 2PERA 3G7IA 3I9V2 3LJRA 3MDKA 4J56E 4L8EA 5F06A 4ZXGA 1OYJA 4MMMA 4JEDA 5ABRA 4PNGA 2B1KA 2G0FA 1GSFA 4QL7A 4N10A 5G5FA 2H6YA 4GCIA 1AW9A 4HDEA 7GSSA 3KH9A 2I9HA 4GSNA 4FIWA 1YF0A 3HDCA 4GSTA 3HA9A 2MMNA 2YV9A 2KHPA 1FO5A 3KMOA 2JU5A 3M9JA 5JWOB 2DIYA 3APOA 4EE0A 5DJMA 3N9JA 2IMKA 5DAKB 2QC7A 2AV4A 2H76A 2YZHA 1QUWA 3NZNA 3C7MA 2C1YA 1J08A 3M1GA 4MH2A 2PVOC 2H19A 1XWBA 3A2WA 2L5OA 4KX4A 20GSA 5CP1A 4AJ7A 4TR0A 2YJHA 3FR3A 3IV4A 1GTAA 3QFAC 1GUHA 3GN3A 2OA7A 1F3AA 1WRYA 3VLNA 3ZRDA 2RUFA 1H4OA 5E4WA 1AXDA 5INYA 4HEA2 1XOAA 2P5QA 4V2MA 3P7XA 5G30A 3ME7A 1K0OA 2HT9A 2C0GA 1V2AA 5IIZA 2M72A 1ON4A 3HYPA 4K7OA 3UVHA 1T4YA 4TXOB 1QXHA 1ERTA 2C3QA 2DMMA 2YN1A 2L4QA 3V1WA 1DUGA 2CX3A 2LNTA 2VCWA 4TVEA 4IJ3A 1BX9A 1SU9A 4POLA 3IXRA 3WGEA 2LJKA 4WBJA 4HQZA 4X43A 3JCML 3FEUA 2JACA 4OD7A 4XS1A 1MD4A 1QK8A 2GGTA 1YJ6A 4OCEA 3Q74A 2GQLA 3UMAA 3HVXA 5F0GA 1TK8B 4IBPA 1NSWA 4YAPA 2O87A 3LG6A 2E2GA 1YF1A 5F05A 2C80A 1K0BA 4ISDA 1GTIA 1GSEA 1R5AA 2JZTA 3BD2A 3IRAA 3SBCA 2P0GA 3ZVJA 3C71A 1F2EA 2XBQA 2ON5A 5G5EA 3DKSA 3ZYWA 2IMEA 1HNBA 3FK8A 2IWTA 3S9FA 3ZLPA 3GKMA 3KTBA 1W4VA 1SKWB 1O8XA 3CRUA 3GH9A 5AISA 1TI3A 2O7KA 2H6XA 1GRXA 2FWHA 2YWOA 4IN0A 4MDCA 3H8QA 4LMVA 5EPFA 3IOSA 1M0UA 2DJ0A 2VL9A 2FWFA 5D93A 2DIZA 5CRGA 3M8NA 2PU9C 1Z7PA 2I4AA 2TRXA 3LQ7A 4ZIJA 4IGJA 3MWHA 1HQOA 1O7UA 1T00A 4JR4A 2PPTA 3ED3A 2VL2A 2GQMA 3E3EA 2VIMA 4EF0A 4XHMA 4WKWA 4GSSA 2AYTA 2QGVA 3GL3A 4ECCA 4LLRA 5KN2A 3LFLA 2TRCP 2RUEA 4TR4A 1LJRA 3J7Yk 1PX7A 1Y6EA 5AGYA 3RHBA 2VO4A 2P31A 2CA8A 2AHEA 2YOIA 4POMA 4KUNA 1KNGA 2K8VA 3ZL5A 2IMDA 1M7TA 3F63A 3FYGA 2RLIA 2VL3A 2YANA 2NVLA 1HNAA 4L0WA 4PQIA 5D9VA 1AUCA 3HXSA 2XHFA 1RW1A 1VGLA 2HI7A 2VM1A 4MJBA 3CYNA 2DMLA 3QFBC 1ZMAA 4F9ZA 2HE3A 1MDIA 2V6KA 3PR8A 4DEJA 1QMVA 1A23A 2FGXA 3CSIA 14GSA 4AJ8A 1OKTA 2CT6A 5G31A 1FW1A 6GSYA 13GSA 2V32A 3EE2A 5ENUA 2H71A 3FRCA 2L59A 1OE7A 2B6MA 2XBIA 3BCIA 3UEMA 4LA1A 3GFKA 4KE3A 3UAPA 4ILFA 5ECSA 1PQNA 4EL1A 4LL4B 4MJCA 3LSZA 2A4VA 1R4WA 2IFQB 1JZDA 1G6WA 2LV3A 2HZFA 2MZCA 5ID2A 4FYCA 3GA4A 4IW9A 4DVCA 4V1Ag 4O7HA 1YEXA 4LL1B 4K9ZA 1S3AA 3ME8A 4V2NA 3O76A 4OMVA 4DSSA 1FHEA 3L4NA 5DCHA 3ZIJA 3D4MA 5DAKA 2KP2A 4TKYA 2HZEB 2VL2C 3F6DA 1K0DA 3A2VA 2IPAA 2OBIA 1MD3A 3LGCA 5DCGA 2OE3A 2O89A 2H0HA 4ULXA 1GNEA 3N5OA 4Q5FA 4OFNA 4YQVA 1XPVA 2JSZA 1G0TA 4F0BA 3EVIA 1E2YA 1U3AA 1EOGA 1V57A 3HZ8A 2H72A 2B1LA 16GSA 2PGTA 4KA0A 1Q4JA 1GSDA 5LD0A 3H79A 1F37A 4XS4B 2A2RA 5C04A 3WGDA 2EIQA 3M9KA 3C8EA 2C0DA 1NHOA 1M9AA 2QKEA 3TDGA 2LQOA 2VUPA 1TDIA 4MH3A 2V41A 4KDXA 3BJ5A 4JE1A 4N30A 5J3RA 1GULA 4K0GA 3L0HA 4D73A 4FYUA 1K3OA 3E0UA 2CVKA 4RQXA 3D4TA 2IMFA 3ZIVA 5CRDA 1GH2A 1T8EB 2C4JA 3GL5A 3FZAA 1TTZA 3DWVA 1J0FA 4TRXA 2CX4A 1YQ1A 3ZFLA 3KTLA 2OACA 4OFMA 4PUAA 4PQ1A 2LKUA 4TR1B 1EP8A 3LWAA 1GSUA 5H5QA 5ELGA 2I81A 5J9CA 2IN3A 5G1KA 2GQKA 5AIXA 1JHBA 4XCSA 4LMWA 4MF7A 2X8HA 1XWGA 1OC8A 5D73A 1I5GA 1X5DA 5HFGA 1K0AA 3TJBA 2EC4A 1BAYA 1M2DA 2LUSA 2B5XA 4JZQA 1G7EA 3VWUA 5D9TA 1KEBA 5D9WA 4KCEA 1SENA 1XW5A 2XC2A 2AAWA 2V1MA 4KNDA 2LQQA 4ZB6A 3APSA 2ON7A 4HI7A 5HQPA 1B4PA 1PL1A 1Z5YE 3IA1A 4RI6A 3IK9A 1SJZA 4V1Ap 3BBYA 2H0IA 3HY2A 4Z7XA 3UL3A 4NPBA 4HQSA 4KAEA 1I9DA 4KCAA 3APQA 5CAXA 5L71A 3KEBA 5DQSA 4MJAA 1ST9A 3UBLA 4IHUA 2OADA 5GSTA 4FH8A 5HR3A 4O5RA 1EZKA 5ECLB 2V2GA 3GHAA 1GSSA 5IMDA 2E0QA 4EDYA 4NXIA 1PGTA 4MK3A 1HNCA 2VLVA 5ECKB 3K8NA 2ALBA 3IBHA 3G7JA 1TU8A 1MEKA 2R37A 4WR5A 1XCCA 1B9YC 1GL8A 4GQCA 4JU5A 2YCDA 1M2AA 2NTOA 3ZVJD 1GTUA 3TKSE 5AIVA 3PINA 3NIVA 2FD3A 4BPYA 3FHKA 4ACSA 5ECIB 1K3YA 1SJIA 1JLWA 3HZ4A 5AN1A 1XFLA 3EYTA 1S3CA 1AC1A 3GNJA 1ERWA 3VWVA 3VPQA 4TXVA 3TRXA 2GS3A 3R2QA 1F9MA 1X0RA 2IIYA 4KSMA 2FCHA 4AJ6A 3TJFA 1OE8A 4CHSA 1S3DA 1ZL9A 12GSA 1SJ6A 3MAKA 4KDYA 3F4RA 1IYIA 1EV9A 1EV4A 5DALA 2VCQA 1U3IA 2RM5A 4XS6A 4JBBA 1AQXA 1ZZYA 3EURA 9GSSA 1AAZA 2K6VA 2FLSA 6GSUA 2YV7A 3VPTA 2J23A 22GSA 4GQFA 1K0MA 1TXXA 3ERWA 1EWXA 3GX8A 4NAXA 2DJJA 5IPHA 1TI1A 1U87A 1YY7A 4I2UA 1LBKA 2HNLA 1R7HA 3TKRA 2FNOA 1WOUA 2DJKA 4IVFA 4X1UA 1THOA 2DSAA 1TJDA 1WJKA 4MA9A 5GAPD 3KJYA 4J57E 5ECRB 2CAQA 2HZEA 3RHCA 4TW5A 2WDUA 2WJUA 2LRNA 5JCGA 2LSTA 2NBSA 2VCZA 4G10A 1C72A 2CQ9A 3TKQA 3A3TA 1O73A 4DSRA 3CBUA 1Z6NA 5G1LA 1V58A 3EC3A 2HRNA 3IAS2 1WMJA 3GTUA 2LJRA 2D2ZA 5IMAA 1CQGA 5JCWA 3Q18A 3H1NA 2GSQA 3LORA 2GDRA 4NHZA 2C3NA 1K3LA 3BOAA 3EMPA 3RPPA 1AIUA 2JL4A 1J9BA 1K0NA 4XIHA 4EDZA 4XS4A 4MZCA 2BMXA 1HYUA 1GUMA 4K7IA 5DQYA 2EIOA 4KDUA 3M0FA 2X99A 4N0VA 4WR4A 1OC9A 5G2ZA 2YP6A 6GSXA 2LRTA 2C0EA 2R4VA 4NV2A 5ECHB 2H73A 2AB6A 1XWKA 2ZUPA 2N5BA 3KXOA 5FT3A 2ES7A 2WRTA 3F3RA 1PSQA 4MCUA 2H0GA 4EC0A 4OO5A 3GH6A 1M9BA 2WZ9A 1FVKA 17GSA 2OBKA 1PX6A 2YPMA 2TIRA 3C1SA 4Q5NA 3CSHA 3GUSA 3TB2A 3US3A 4IP1A 1WWJA 4JRRA 4DSQA 5KN1A 3GYKA 3P2AA 5KN0A 3GV1A 1ZCPA 3QPMA 3L9SA 3IPZA 2C0FA 2VCVA 2MYGA 2BTOT 2L6DA 2OE1A 3TKSA 1K0CA 4HU7A 1Z9HA 4MJEA 2DJ2A 5ELAA 3KMNA 3D6IA 1ERUA 4IQAA 1PL2A 5IMCA 3VI5A 3GSSA 4IS0A 1DE1A 1XW6A 2LS5A 1U6TA 4EXJA 4TR3A 2GTUA 4MABA 2JADA 3LYPA 5ECQB 1THXA 1OVNA 1N8JA 3F3QA 1TW9A 4O32A 4K8MA 1OC3A 1DBYA 1E6BA 3WT2A 1GLPA 2FHEA 5IQYA 2YJ7A 4K0NA 4HUAA 3BCKA 4NMUA 4POBA 2DLXA 5ECNB 1YKAA 3VURA 1O85A 5IMZA 1FB6A 2MMZA 1R5PA 3P8WA 4CW9A 4ML1A 1GWCA 4ML6A 4RQRA 1MDKA 3SWLA 3I69A 3FR6A 3IAM2 1B4QA 3GKXA 2WGRA 5B6NA 1EEJA 4H86A 5LNKe 1B48A 1XZOA 1BEDA 1T4ZA 4GF0A 3GKNA 3C73A 1BJXA 5HR0A 3HVVA 3KP9A 2M80A 5J9BA 3MNGA 1X5EA 1YZXA 5DVBA 4RUVA 5CYYA 3IK7A 1SYRA 4PUFC 3W8SA 3IE3A 2F3MA 4IQ1A 3KCMA 3KP8A 2E7PA 4WETA 1RK4A 5KN3A 2B5YA 1KTEA 5HFKA 3F0IA 2B3SA 1WP0A 1U88A 1Z6MA 4TXOA 3ZMLA 4YQUA 2FA4A 2FY6A 3GIXA 3E9JB 2FUG2 1O6JA 5HR2A 4BL7A 2H30A 2MBSA 5KEJA 5F8BA 3QMXA 4N0ZA 1B8XA 3HVSA 2GZZA 3TKSC 2FA8A 1SKRB 3C1RA 4Q5RA 5IMVA 3HCZA 4J2FA 4ZL7A 1A24A 4HU9A 3IR4A 5CREA 1TKDB 4ZB8A 4QL9A 1X9WB 3FZ9A 1PMTA 3G9BA 4MP4A 3RDWA 4ZL9A 3LXZA 1VRSD 4I5QA 4MZBA 1V98A 4F82A 2H70A 4ZB9A 6GSSA 3ISOA 4YQMA 2R6KA 3DRNA 1FAAA 1XVWA 4HJ2A 3LYKA 3DVWA 4EO3A 4KGIA 2M46A 3VFIA 1SL0B 2VOCA 2VAFA 2RM6A 5HFIA 2KLXA 1EGRA 1ZYQB 4KH7A 2L57A 4ID0A 4ZL8A 3Q6OA 5ECOB 3W6GA 5B8AA 4N11A 4BVXA 4PQHA 3IDVA 3KIJA 2L4CA 4KB3A 1JZWA 3ZFBA 4I8BA 2K8SA 2YWNA 5COHA 2KOKA 4TN8A 1EGOA 2GZPA 2PUKC 1ERVA 2R3XA 4HZ2A 1ZGNA 3EMXA 2WS2A 1UC7A 1FB0A 1SK0A 2GSRA 1BYEA 2VLUA 3OR5A 3A2XA 5JCUA 2EIRA 3H4KA 5IPGA 1VF4A 1O81A 3MSZA 1PN9A 3QR6A 2I3YA 5IMFA 3DVXA 2K18A 4X0XA 2X8GA 5JWQB 1FVJA 2WB9A 5CNWA 2CZ3A 5CRHA 3D5JA 4F0CA 4GWRA 3CTGA 5ID2B 3HJOA 4NV5A 3QAGA 2LJAA 3TRQA 2IJYA 4DSSB 2PVQA 3F6FA 3P90A 1WIKA 3D0ZA 4KSOA 3TCOA 5IM9A 1DE2A 1TRUA 3UIWA 4PNFA 3TUEA 3L78A 1T3BA 5B7CA 2GT5A 4PX1A 3U6VA 2J9HA 3GRXA 5A5KA 1AQWA 4EUYA 3HHVA 2H6ZA 2OE0A 2N5FA 2YWMA 1A2MA 1TU7A 1GNWA 2LTKA 1OAZA 3DGQA 4I6XA 1SK1A 3GSTA 3FZ4A 1USBA 3TKPA 1DSBA 4IP6A 1RQMA 1SL1B 1F3BA 3CMIA 18GSA 2VCXA 4PXOA 1EEMA 5HR1A 1X9SB 4RI7A 4HOJA 3WYWA 1VF1A 1PKWA 2R2JA 2KP1A 5CRWA 2HLSA 5C00A 3QDNA 3KZQA 3CSJA 2LRCA 2HSYA 2VCTA 1TRVA 4D73B 2L6CA 3ZTLA 3GX0A 5E59A 2OJLA 3CXGA 1A0RP 3DD3A 3TGZA 1NM3A 1X5CA 3ERGA 1EP7A 1O8WA 2H74A 4OCFA 1N2AA 2IFQA 3KM6A 4WF5A 5EVOA 1TOFA 4O92A 5FHIA 2IMIA 1XIYA 2BJXA 5A4UA 2GSTA 2HRFA 2XPDA 4ZILA 4Q5QA 2NDOA 4FYBA 1ZOFA 1ACVA 4MPGA 2G2QA 3EU3A 3TJKA 2WULA 1NW2A 1M2BA 4ZBDA 1VF2A 3GURA 1XWCA 4OWYA 4MF6A 3TJJA 1YDKA 5EY6A 3FZ5A 5A4WA 3QOUA 3RAZA 2N5AA 3TRPA 4L0UA 1MDJA 3EINA 4PGTA 4AF2A 5GSSA 1PKZA 1PA3A 2PMTA 2CV4A 3KD0A 2C3TA 3EWLA 1X9MB 3O6TA 1GSQA 3TOUA 4CDOA 1R26A 1LU4A 2VM2A 4E8EA 2H1GA 3Q19A 2B7KA 3HD5A 3DIEA 3I6AA 3ZZXA 2O85A 2CVDA 2IL3A 3H93A 2QSIA 4AGSA 4K2DA 3QCPA 1GTBA 4WEYA 4ZBAA 1XW9A 4XRDA 3RBTA 2A2SA 2RIIA 4BWQA 4MF5A 3RPNA 3QAWA 4YAVA 1UVZA 5LCZA 3LXTA 1XXUA 1G7OA 1A0FA 2DC5A 3DXBA 4IELA 3GMFA 1KBNA 2F9SA 1FOVA 2AUVA 2MMAA 3FW2A 4IJIA 1M99A 3EU4A 4EVMA 4K1FA 1WPIA 3UVTA 1Y25A 2HXKA 3WGXA 2DJ1A 2YNXA 3QD9A 3M3MA 3L9UA 3DEXA 3VWXA 3UARA 1URMA 5J4UA 1H75A 3CRTA 5H5RA 4TR1A 2GLRA 1ZYEA 1B9XC 3VI7A 2V6OA 3A5WA 2E2MA 1SD9A 1A2JA 2ZNMA 2VLTA 1UA5A 4V2LA 4WBRD 1QFNA 3W8JA 5ECMB 4BWSA 3GKKA 2WCIA 1Z3EA 1XVQA 1XWAA 4BA7A 1TK0B 2GT6A 1TRWA 4GLTA 3TJGA 8GSSA 4WXTA 2C8UA 3L9VA 3FR9A 3J7Yb 1SL2B 3I43A 1YKCA 4PURA 1G6YA 4MPFA 11GSA 3HJPA 5D8IA 2CVBA 1TP9A 3ERFA 1GSYA 1SK2A 5B6MA 2HSHA 1SD8A 1JFUA 5EL8A 2H66A 5DALB 3UOMA 1BG5A 1MTCA 2HFDA 5A4VA 2GSSA 2O8VB 4OO4A 10GSA 3G7YA 3PGTA 5ECPB 1TRSA 2K9FA 1QGVA 2FWGA 4POKA 1Z7RA 4EKZA 2PWJA 3WD6A 1Q98A 1XOBA 4P3YB 1OKDA 4F2IA 5IOXA 4G19A 4GXZA 1VF3A 4F03A 2MMOA 2F51A 2F8FA 6GSTA 1PD21 2R5GA 4G2EA 1NHYA 3QAVA 2H01A 3LEFA 2AJQB 3ZREA 4JR6A 4HJMA 4WF4A 5D96A 2LNSA 2X64A 1YEPA 2OKAA 3AY8A 4I97A 5GZZB 2B7JA 2YWIA 4TOPA 5IO0A 1TK5B 2VD1A 4ZBBA 2PBJA 1SKSB 4XRAA 2F8AA 5J41A 4GRFA 5DDLA 3PH9A 1IYHA 2JSYA 5D9XA 4MLYA 4ECJA 4BVYA 4E8HA 5F07A 4K6XA 2DJ3A 3GTUB 3IC4A 1A2LA 2HYXA 2FWEA 2PN8A 2MBTA 19GSA 4K7NA 1QQ2A 5DJLA 2B5EA 5JWRB 2LEGA 1EOHA 4IKHA 5FWGA 2GVPA 4NWYA 1WE0A 1GP1A 2H1BA 5H5SA 3F4TA 2H75A 1ML6A 1JZRA 4HZ4A 4ECBA 1OC9B 3ZITA 2KUCA 4I2TA 1F6MC 5GAND 6GSWA 3DYRA 2GZYA 3F9UA 3CTFA 2YZUA 5DBQA 2CZ2A 3IHQA 4NHWA 1PRXA 3FKFA 3UJ1A 5IO2A 2VD0A 3HKRA
chains in the Genus database with same CATH superfamily
4L5OA 5B8BA 5IOWA 5J5NA 1GUKA 3DMLA 2H1DA 1ILOA 4QQ7A 3D21A 1T1VA 2L5LA 4L5LA 3D22A 1JLVA 1CQHA 1HD2A 2P5RA 2NPBA 1GLQA 3F4SA 4YH2A 3FY7A 1V9WA 4OFTA 1A8LA 3NO9A 1SYXA 1FG4A 1Z4IA 4G9HA 3U5RE 3HJMA 3TOTA 4FO5A 4KW6A 2DBCA 2REMA 1XBSA 2CAIA 3O3TA 1AQVA 2X8CA 2Z9SA 6GSVA 3KGKA 3WT1A 1W89A 2JZSA 3KH7A 1TJVA 1ABAA 3F8UA 3VK9A 4MZWA 2WFCA 1YFEA 2JZRA 3NOFA 3VWWA 3ZMKA 4HS1A 4XTSA 4G0LA 1BQ7A 1V40A 2XPEA 2ZCTA 1A8YA 5CO3A 1UN2A 1JZOA 4GTUA 1T7PB 2H8LA 2I1UA 3UBKA 1U16A 4ECIA 2H1AA 2PERA 1Z4LA 3G7IA 3I9V2 3LJRA 3MDKA 4J56E 4L8EA 5F06A 4ZXGA 1OYJA 4MMMA 4JEDA 5ABRA 4PNGA 2B1KA 2G0FA 1GSFA 4QL7A 4N10A 5G5FA 2H6YA 4GCIA 1AW9A 4HDEA 7GSSA 3KH9A 2I9HA 4GSNA 4FIWA 1YF0A 3HDCA 4GSTA 3HA9A 2MMNA 2YV9A 2KHPA 1FO5A 3KMOA 2JU5A 3M9JA 5JWOB 2DIYA 3APOA 4EE0A 4HSCX 5DJMA 3N9JA 2IMKA 5DAKB 2QC7A 2AV4A 2H76A 2YZHA 1QUWA 3NZNA 3C7MA 2C1YA 1J08A 2HRAA 3M1GA 4MH2A 2PVOC 2H19A 1XWBA 3A2WA 2L5OA 4KX4A 20GSA 5CP1A 4AJ7A 4TR0A 2YJHA 3R3EA 4L57A 3FR3A 3IV4A 1GTAA 3QFAC 1GUHA 3GN3A 2OA7A 1F3AA 1WRYA 3VLNA 3ZRDA 2RUFA 1H4OA 5E4WA 1AXDA 5INYA 1FUOA 4HEA2 1XOAA 2P5QA 4V2MA 3P7XA 5G30A 3ME7A 1K0OA 2HT9A 2C0GA 1V2AA 5IIZA 2X75A 2M72A 1ON4A 3HYPA 4K7OA 3UVHA 1T4YA 4TXOB 1QXHA 1ERTA 2C3QA 2DMMA 2YN1A 2L4QA 3V1WA 1DUGA 2CX3A 2LNTA 2VCWA 4BL7B 4TVEA 4IJ3A 1BX9A 1SU9A 4POLA 3IXRA 3WGEA 2LJKA 4WBJA 4HQZA 4X43A 3JCML 3FEUA 2JACA 4OD7A 4XS1A 4L6CA 1MD4A 1QK8A 2GGTA 1YJ6A 4OCEA 2D28C 3Q74A 2GQLA 4K5RA 3UMAA 3HVXA 5F0GA 1TK8B 4IBPA 4MWOA 1NSWA 4YAPA 2O87A 3LG6A 4USSA 1M3IA 2E2GA 1YF1A 5F05A 1FURA 2C80A 1K0BA 4MX2A 4ISDA 1GTIA 1GSEA 1R5AA 2JZTA 4A5PA 3IC8A 3BD2A 3IRAA 3SBCA 2P0GA 3ZVJA 3C71A 1F2EA 2XBQA 2ON5A 5G5EA 3DKSA 4BVXB 3ZYWA 2IMEA 1HNBA 1TJWA 3FK8A 2IWTA 3S9FA 3ZLPA 4ICYA 3GKMA 3KTBA 1W4VA 1SKWB 1O8XA 3CRUA 3GH9A 5AISA 1TI3A 2O7KA 2H6XA 1GRXA 1M3JA 2FWHA 2YWOA 1U15A 4IN0A 4CY6A 4MDCA 3H8QA 4LMVA 5EPFA 3IOSA 1M0UA 2DJ0A 2VL9A 2FWFA 5D93A 4NFLA 2DIZA 5CRGA 3M8NA 2PU9C 1Z7PA 2I4AA 2TRXA 3LQ7A 4ZIJA 4IGJA 3MWHA 1HQOA 3EPTA 1O7UA 1T00A 4JR4A 2PPTA 3ED3A 2VL2A 2GQMA 3E3EA 3RRPA 2VIMA 4EF0A 4XHMA 4WKWA 4GSSA 2AYTA 5KOWA 2QGVA 3GL3A 4ECCA 4LLRA 2RCNA 5KN2A 3LFLA 2TRCP 2RUEA 4TR4A 1LJRA 3J7Yk 1PX7A 1Y6EA 1MH9A 5AGYA 3RHBA 2VO4A 2P31A 2CA8A 2AHEA 2YOIA 4POMA 4Z2UA 4KUNA 1KNGA 2K8VA 3ZL5A 2IMDA 1M7TA 3F63A 3C8TA 3FYGA 4FQUA 2RLIA 2VL3A 2YANA 2NVLA 1HNAA 4L0WA 4PQIA 3QBPA 5D9VA 1AUCA 3HXSA 2XHFA 1RW1A 1VGLA 2HI7A 2VM1A 4MJBA 3CYNA 2DMLA 3QFBC 1ZMAA 4F9ZA 2HE3A 1MDIA 2V6KA 3PR8A 4DEJA 1IW7D 1QMVA 1A23A 2FGXA 3CSIA 14GSA 4AJ8A 1OKTA 2CT6A 5G31A 1FW1A 6GSYA 1K62A 13GSA 2V32A 3EE2A 5ENUA 2H71A 3FRCA 2L59A 1OE7A 2B6MA 2XBIA 3BCIA 3UEMA 4LA1A 5BMUA 3GFKA 1RE5A 4KE3A 3UAPA 4ILFA 5ECSA 1PQNA 4EL1A 4LL4B 4MJCA 4Z2TA 3LSZA 2A4VA 1R4WA 2IFQB 1JZDA 1G6WA 3E04A 2LV3A 1J3UA 2HZFA 2MZCA 5ID2A 4FYCA 2DKHA 3GA4A 4IW9A 4DVCA 4V1Ag 4O7HA 1YEXA 4LL1B 4K9ZA 1S3AA 3ME8A 4V2NA 3O76A 4OMVA 4DSSA 1FHEA 3L4NA 2PTRA 5DCHA 3ZIJA 4ADMA 3D4MA 5DAKA 2KP2A 4TKYA 2HZEB 2VL2C 3F6DA 1K0DA 3RD8A 3A2VA 2IPAA 3U19A 2OBIA 1MD3A 3LGCA 5DCGA 2OE3A 2O89A 2H0HA 4ULXA 1GNEA 3N5OA 4Q5FA 4OFNA 4YQVA 1XPVA 2JSZA 1G0TA 4F0BA 3EVIA 1E2YA 1U3AA 1EOGA 1V57A 3HZ8A 2H72A 2B1LA 16GSA 2PGTA 4KA0A 1Q4JA 1GSDA 5LD0A 4YIKA 3H79A 1F37A 4XS4B 2A2RA 5C04A 3WGDA 2EIQA 3M9KA 3C8EA 2C0DA 1NHOA 1M9AA 2QKEA 3TDGA 2LQOA 2VUPA 1TDIA 4MH3A 1Z4JA 2V41A 4KDXA 3BJ5A 4JE1A 4N30A 5J3RA 1GULA 4K0GA 3L0HA 4D73A 4FYUA 1K3OA 1FOHA 3E0UA 2CVKA 4RQXA 3D4TA 2IMFA 3ZIVA 5CRDA 4MNNA 2E9FA 1GH2A 1T8EB 2C4JA 3GL5A 3FZAA 1TTZA 3DWVA 1HY1A 4TRXA 1J0FA 2CX4A 3GZHA 1YQ1A 3ZFLA 5D6BA 3KTLA 2OACA 4OFMA 4PUAA 4PQ1A 1Z4MA 2LKUA 4TR1B 4PTSA 1EP8A 3LWAA 1GSUA 5H5QA 5ELGA 2I81A 5J9CA 2IN3A 5G1KA 2GQKA 5AIXA 1JHBA 4XCSA 4LMWA 4MF7A 2X4AA 2X8HA 1XWGA 1OC8A 4IQJM 5D73A 1I5GA 1X5DA 5HFGA 1K0AA 3TJBA 2EC4A 1BAYA 1M2DA 2LUSA 2B5XA 4JZQA 1G7EA 3VWUA 5D9TA 1KEBA 5D9WA 4KCEA 4G0KA 1SENA 1XW5A 2XC2A 1YFMA 2AAWA 2V1MA 4KNDA 2LQQA 4ZB6A 2A2PA 3APSA 2ON7A 4HI7A 5HQPA 1B4PA 1PL1A 1Z5YE 3IA1A 4RI6A 1HY0A 3IK9A 1SJZA 4V1Ap 3BBYA 2H0IA 3HY2A 4Z7XA 3UL3A 4NPBA 4HQSA 4KAEA 1I9DA 3CQFA 1AUWA 4KCAA 3APQA 5CAXA 5L71A 3KEBA 5DQSA 4MJAA 1ST9A 3UBLA 4IHUA 2QGAB 2OADA 5GSTA 4FH8A 5HR3A 4O5RA 1EZKA 2PTQA 5ECLB 2V2GA 3GHAA 1GSSA 5IMDA 3GTDA 2E0QA 4EDYA 4NXIA 1PGTA 4MK3A 1HNCA 2VLVA 4E88A 5ECKB 3K8NA 2ALBA 3IBHA 3G7JA 1TU8A 1MEKA 2R37A 4WR5A 1XCCA 1B9YC 1GL8A 4L6AA 4GQCA 4JU5A 2YCDA 1M2AA 1PN0A 2NTOA 3ZVJD 1GTUA 3TKSE 5AIVA 3PINA 3NIVA 2FD3A 4BPYA 1KQ7A 3FHKA 4ACSA 5ECIB 1K3YA 1SJIA 1JLWA 3HZ4A 5AN1A 1DCNA 1XFLA 3EYTA 1S3CA 1AC1A 3GNJA 1ERWA 3VWVA 2UZ8A 3VPQA 4TXVA 1C3UA 3TRXA 2GS3A 3R2QA 1F9MA 1X0RA 2IIYA 4KSMA 2FCHA 4AJ6A 3TJFA 1OE8A 4CHSA 1S3DA 1ZL9A 12GSA 2I7DA 1SJ6A 3MAKA 4KDYA 3F4RA 1IYIA 1EV9A 1EV4A 5DALA 2VCQA 1U3IA 2RM5A 5F91A 4XS6A 4JBBA 1AQXA 1ZZYA 3EURA 9GSSA 1AAZA 2K6VA 2FLSA 6GSUA 2YV7A 3VPTA 2J23A 22GSA 3R6VA 4GQFA 1K0MA 1TXXA 3ERWA 1EWXA 3GX8A 4NAXA 3PPUA 2DJJA 5IPHA 1TI1A 1U87A 1YY7A 4I2UA 1LBKA 2HNLA 1R7HA 3TKRA 2FNOA 1WOUA 2DJKA 4IVFA 4X1UA 1THOA 2DSAA 1TJDA 1WJKA 1Q5NA 4MA9A 5GAPD 3KJYA 4J57E 5ECRB 2CAQA 2HZEA 3RHCA 4TW5A 2WDUA 2WJUA 2LRNA 5JCGA 2LSTA 2NBSA 2VCZA 4G10A 1C72A 2CQ9A 3TKQA 3A3TA 2R0CA 1O73A 4DSRA 2JAWA 3CBUA 1Z6NA 5G1LA 2PTSA 1V58A 3EC3A 2HRNA 3IAS2 1WMJA 3GTUA 2LJRA 2D2ZA 5IMAA 1CQGA 5JCWA 3Q18A 3H1NA 2GSQA 3LORA 2GDRA 4NHZA 2C3NA 1K3LA 3BOAA 3EMPA 3RPPA 2D27A 1AIUA 2JL4A 1J9BA 1K0NA 4XIHA 4EDZA 4XS4A 4MZCA 2BMXA 1HYUA 1GUMA 4K7IA 5DQYA 2EIOA 4KDUA 3M0FA 2X99A 4N0VA 4WR4A 1OC9A 4G0IA 5G2ZA 2YP6A 6GSXA 2LRTA 2C0EA 2R4VA 4NV2A 5ECHB 4MUMA 2H73A 2AB6A 1XWKA 2ZUPA 2N5BA 3KXOA 5FT3A 2ES7A 2WRTA 4KF9A 3F3RA 1PSQA 4MCUA 4EIPA 2H0GA 4EC0A 4OO5A 3GH6A 1K7WA 1M9BA 1FVKA 2WZ9A 17GSA 2OBKA 1PX6A 2YPMA 2TIRA 3C1SA 4Q5NA 3CSHA 3GUSA 3TB2A 3US3A 5BRTA 4IP1A 1WWJA 4K5SA 4JRRA 4DSQA 5KN1A 3GYKA 3P2AA 5KN0A 3GV1A 1ZCPA 3QPMA 3L9SA 3IPZA 2C0FA 2VCVA 2YV5A 2MYGA 2BTOT 2L6DA 2OE1A 3TKSA 1K0CA 4HU7A 1Z9HA 4MJEA 2DJ2A 5ELAA 3KMNA 3D6IA 1ERUA 4IQAA 1PL2A 5IMCA 3VI5A 3GSSA 4IS0A 1DE1A 3R6QA 1XW6A 2LS5A 1U6TA 4EXJA 4TR3A 2GTUA 4MABA 2JADA 3LYPA 5ECQB 1THXA 1OVNA 1N8JA 3F3QA 1TW9A 4O32A 4K8MA 1OC3A 1DBYA 1E6BA 3WT2A 1GLPA 2QA2A 2FHEA 5IQYA 2YJ7A 4K0NA 4HUAA 3BCKA 4NMUA 4POBA 2DLXA 5ECNB 1YKAA 3VURA 1O85A 5IMZA 1FB6A 2MMZA 4O5UA 1Q91A 1R5PA 3P8WA 4CW9A 4ML1A 1GWCA 4ML6A 4RQRA 1MDKA 3SWLA 3I69A 3FR6A 3IAM2 1B4QA 3GKXA 2A4HA 2HVGA 2WGRA 5B6NA 1EEJA 4H86A 5LNKe 1B48A 1XZOA 4X4JA 1BEDA 1T4ZA 4GF0A 3GKNA 3C73A 1BJXA 5HR0A 3HVVA 3KP9A 2M80A 5J9BA 3MNGA 4ADLA 1X5EA 1YZXA 5DVBA 4RUVA 5CYYA 3IK7A 1SYRA 4PUFC 3W8SA 3IE3A 2F3MA 4IQ1A 3KCMA 3KP8A 2E7PA 4WETA 1RK4A 5KN3A 2B5YA 1KTEA 5HFKA 3F0IA 2B3SA 1WP0A 1U88A 1Z6MA 3BWVA 4TXOA 3ZMLA 4YQUA 2FA4A 2FY6A 3GIXA 3E9JB 2FUG2 1O6JA 5HR2A 4BL7A 2H30A 2MBSA 1XWOA 5KEJA 2R0GA 5F8BA 3QMXA 4N0ZA 1B8XA 3HVSA 2GZZA 3TKSC 3MIXA 2FA8A 1SKRB 3C1RA 4Q5RA 5IMVA 3HCZA 1ZYPA 4J2FA 4ZL7A 1A24A 4HU9A 3LW9A 3IR4A 1PFOA 5CREA 1TKDB 4ZB8A 4QL9A 1X9WB 3FZ9A 1PMTA 3G9BA 4MP4A 3RDWA 4ZL9A 3LXZA 1VRSD 4I5QA 4MZBA 1V98A 1Z4PX 4HGVA 4F82A 2H70A 4ZB9A 3HVNA 6GSSA 3ISOA 4YQMA 2R6KA 3DRNA 1FAAA 1XVWA 4HJ2A 3LYKA 1ZYNA 3DVWA 4EO3A 4KGIA 2M46A 3VFIA 1SL0B 2VOCA 2VAFA 2RM6A 5HFIA 1Z4QA 2KLXA 1EGRA 1ZYQB 4YIHA 4KH7A 2L57A 4ID0A 4ZL8A 3Q6OA 5ECOB 3W6GA 5B8AA 4N11A 2JAUA 4BVXA 4PQHA 3IDVA 3KIJA 2L4CA 4KB3A 1JZWA 3ZFBA 4I8BA 2HRKA 2K8SA 2YWNA 5COHA 2KOKA 4TN8A 1EGOA 2GZPA 5F92A 2PUKC 1ERVA 2R3XA 4HZ2A 1ZGNA 3EMXA 2WS2A 1UC7A 1FB0A 2DKIA 3BHGA 1SK0A 2GSRA 1BYEA 2VLUA 3OR5A 3A2XA 5JCUA 2EIRA 3H4KA 5IPGA 1VF4A 1O81A 3MSZA 1PN9A 3QR6A 2I3YA 1VDKA 5IMFA 3DVXA 2K18A 4X0XA 2X8GA 2R0PA 5JWQB 1FVJA 2WB9A 5CNWA 2CZ3A 5CRHA 2HSMA 4NSLA 3D5JA 4F0CA 4GWRA 3CTGA 5KOXA 5ID2B 3HJOA 4NV5A 3QAGA 2LJAA 3TRQA 2IJYA 4DSSB 2PVQA 3F6FA 3P90A 1WIKA 3D0ZA 4KSOA 3TCOA 5IM9A 4EEIA 1DE2A 1TRUA 3UIWA 4APBA 4PNFA 3TUEA 3L78A 1T3BA 5B7CA 2GT5A 4PX1A 3U6VA 2J9HA 3GRXA 5A5KA 1AQWA 4EUYA 3HHVA 3FMWA 2H6ZA 2OE0A 2N5FA 2YWMA 1A2MA 4BVYB 1TU7A 1GNWA 2LTKA 1Q92A 1OAZA 4O5QA 3DGQA 4I6XA 1TJ7A 1SK1A 3GSTA 3FZ4A 1USBA 3TKPA 1DSBA 4IP6A 1RQMA 1SL1B 1F3BA 3CMIA 1DOFA 18GSA 2VCXA 4PXOA 1EEMA 5HR1A 1X9SB 4RI7A 1FUPA 4HOJA 3WYWA 1VF1A 1PKWA 2R2JA 2KP1A 5CRWA 3IHGA 2HLSA 5C00A 3QDNA 3KZQA 3TV2A 2LRCA 3CSJA 1C3CA 4NLEA 2HSYA 2VCTA 1TRVA 4D73B 2L6CA 3ZTLA 3GX0A 5E59A 2OJLA 3CXGA 1A0RP 3DD3A 1Z4KA 3TGZA 1NM3A 1X5CA 3ERGA 1EP7A 1O8WA 2H74A 4OCFA 4APAA 1N2AA 2IFQA 3KM6A 4WF5A 5EVOA 1TOFA 4O92A 5FHIA 2IMIA 4CY8A 1XIYA 2BJXA 5A4UA 2GSTA 2HRFA 2XPDA 4ZILA 4Q5QA 2NDOA 4FYBA 1ZOFA 1ACVA 4MPGA 2G2QA 3EU3A 3TJKA 2WULA 1NW2A 1M2BA 4ZBDA 2JARA 1VF2A 3GURA 1XWCA 4OWYA 1TJUA 4MF6A 3TJJA 1YDKA 5EY6A 3FZ5A 5A4WA 3QOUA 3RAZA 1FUQA 2N5AA 3TRPA 4L0UA 1MDJA 3EINA 3OCFA 4PGTA 4AF2A 5GSSA 1PKZA 1PA3A 2PMTA 2CV4A 3KD0A 2C3TA 3EWLA 1X9MB 3O6TA 1GSQA 3TOUA 4CDOA 1R26A 1LU4A 2VM2A 4E8EA 2H1GA 3Q19A 2B7KA 3HD5A 3DIEA 3I6AA 3ZZXA 2O85A 2CVDA 2IL3A 3H93A 2QSIA 4AGSA 4K2DA 3QCPA 4BIKA 1GTBA 4WEYA 4ZBAA 1XW9A 4XRDA 3RBTA 2A2SA 2RIIA 4BWQA 4MF5A 3RPNA 2QA1A 3QAWA 4YAVA 1UVZA 5LCZA 1S3RA 3LXTA 1XXUA 1G7OA 1A0FA 2DC5A 4EFCA 3DXBA 4IELA 3GMFA 1KBNA 2F9SA 1FOVA 2AUVA 2MMAA 1JSWA 3FW2A 4IJIA 1M99A 3EU4A 4EVMA 4K1FA 1WPIA 3UVTA 1Y25A 5HW2A 2HXKA 3WGXA 2DJ1A 2YNXA 3QD9A 3M3MA 3L9UA 3DEXA 3VWXA 3UARA 1URMA 5J4UA 1H75A 3CRTA 5H5RA 4TR1A 2GLRA 1ZYEA 1B9XC 3VI7A 2V6OA 3A5WA 2E2MA 1SD9A 1A2JA 2ZNMA 2VLTA 1UA5A 4V2LA 4WBRD 1QFNA 3W8JA 5ECMB 3OCEA 4BWSA 3GKKA 2WCIA 1Z3EA 1XVQA 1XWAA 4BA7A 1TK0B 2GT6A 1TRWA 4GLTA 3TJGA 8GSSA 4WXTA 2C8UA 3L9VA 4YKFA 3FR9A 3J7Yb 1SL2B 3I43A 1YKCA 4PURA 1G6YA 4MPFA 11GSA 3HJPA 5D8IA 2CVBA 1TP9A 3ERFA 1GSYA 1SK2A 5B6MA 2HSHA 1SD8A 1JFUA 5EL8A 2H66A 5DALB 3UOMA 1BG5A 1MTCA 2HFDA 5A4VA 3CI0K 2GSSA 2O8VB 4OO4A 10GSA 3G7YA 3PGTA 5ECPB 1TRSA 2K9FA 1QGVA 2FWGA 2X49A 4POKA 1Z7RA 4EKZA 2PWJA 3WD6A 4EIQA 1Q98A 1XOBA 4P3YB 1OKDA 4F2IA 1I0AA 5IOXA 2JAOA 4G19A 4GXZA 1VF3A 4F03A 2MMOA 2F51A 2F8FA 6GSTA 1T9HA 3MYDA 1PD21 2R5GA 4G2EA 1NHYA 3QAVA 2H01A 3LEFA 2AJQB 3ZREA 4JR6A 4HJMA 4Z2RA 4WF4A 5D96A 2X64A 2LNSA 1YEPA 2OKAA 3AY8A 4I97A 5GZZB 2B7JA 2YWIA 4TOPA 5IO0A 4K2XA 1TK5B 2VD1A 4ZBBA 2PBJA 1SKSB 4XRAA 2F8AA 5J41A 4GRFA 5DDLA 3PH9A 1IYHA 2JSYA 5D9XA 4MLYA 4ECJA 1XG8A 4BVYA 4YKGA 4E8HA 5F07A 4K6XA 2DJ3A 3GTUB 3U13A 3IC4A 1U0LA 1A2LA 2HYXA 2FWEA 2PN8A 2MBTA 2PFMA 19GSA 4K7NA 1QQ2A 5DJLA 2B5EA 5JWRB 2LEGA 1EOHA 4IKHA 5FWGA 2GVPA 4NWYA 1WE0A 1GP1A 2H1BA 5H5SA 3F4TA 2H75A 1ML6A 1JZRA 4HZ4A 4ECBA 1OC9B 3ZITA 2KUCA 3A5IA 4I2TA 1F6MC 2FUSA 5GAND 6GSWA 3DYRA 2GZYA 3F9UA 3CTFA 2YZUA 5DBQA 2CZ2A 3IHQA 4NHWA 1PRXA 3FKFA 3UJ1A 5IO2A 2VD0A 3HKRA
chains in the Genus database with same CATH topology
4L5OA 5B8BA 5IOWA 5J5NA 1GUKA 3DMLA 2H1DA 1ILOA 4QQ7A 3D21A 1T1VA 2L5LA 4L5LA 3D22A 1JLVA 1CQHA 1HD2A 2P5RA 2NPBA 1GLQA 3F4SA 4YH2A 3FY7A 1V9WA 4OFTA 1A8LA 1SYXA 1FG4A 4G9HA 3U5RE 3HJMA 3TOTA 4FO5A 4KW6A 2DBCA 2REMA 1XBSA 2CAIA 3O3TA 1AQVA 2X8CA 2Z9SA 6GSVA 3KGKA 3WT1A 1W89A 2JZSA 3KH7A 1ABAA 3F8UA 3VK9A 4MZWA 2WFCA 2JZRA 3NOFA 3VWWA 3ZMKA 4HS1A 4XTSA 4G0LA 1BQ7A 1V40A 2XPEA 2ZCTA 1A8YA 5CO3A 1UN2A 1JZOA 4GTUA 1T7PB 2H8LA 2I1UA 3UBKA 4ECIA 2H1AA 2PERA 3G7IA 3I9V2 3LJRA 3MDKA 4J56E 4L8EA 5F06A 4ZXGA 1OYJA 4MMMA 4JEDA 5ABRA 4PNGA 2B1KA 2G0FA 1GSFA 4QL7A 4N10A 5G5FA 2H6YA 4GCIA 1AW9A 4HDEA 7GSSA 3KH9A 2I9HA 4GSNA 4FIWA 1YF0A 3HDCA 4GSTA 3HA9A 2MMNA 2YV9A 2KHPA 1FO5A 3KMOA 2JU5A 3M9JA 5JWOB 2DIYA 3APOA 4EE0A 5DJMA 3N9JA 2IMKA 5DAKB 2QC7A 2AV4A 2H76A 2YZHA 1QUWA 3NZNA 3C7MA 2C1YA 1J08A 2HRAA 3M1GA 4MH2A 2PVOC 2H19A 1XWBA 3A2WA 2L5OA 4KX4A 20GSA 5CP1A 4AJ7A 4TR0A 2YJHA 3R3EA 3FR3A 3IV4A 1GTAA 3QFAC 1GUHA 3GN3A 2OA7A 1F3AA 1WRYA 3VLNA 3ZRDA 2RUFA 1H4OA 5E4WA 1AXDA 5INYA 4HEA2 1XOAA 2P5QA 4V2MA 3P7XA 5G30A 3ME7A 1K0OA 2HT9A 2C0GA 1V2AA 5IIZA 2M72A 1ON4A 3HYPA 4K7OA 3UVHA 1T4YA 4TXOB 1QXHA 1ERTA 2C3QA 2DMMA 2YN1A 2L4QA 3V1WA 1DUGA 2CX3A 2LNTA 2VCWA 4BL7B 4TVEA 4IJ3A 1BX9A 1SU9A 4POLA 3IXRA 3WGEA 2LJKA 4WBJA 4HQZA 4X43A 3JCML 3FEUA 2JACA 4OD7A 4XS1A 1MD4A 1QK8A 2GGTA 1YJ6A 4OCEA 2D28C 3Q74A 2GQLA 4K5RA 3UMAA 3HVXA 5F0GA 1TK8B 4IBPA 1NSWA 4YAPA 2O87A 3LG6A 4USSA 2E2GA 1YF1A 5F05A 2C80A 1K0BA 4ISDA 1GTIA 1GSEA 1R5AA 2JZTA 4A5PA 3IC8A 3BD2A 3IRAA 3SBCA 2P0GA 3ZVJA 3C71A 1F2EA 2XBQA 2ON5A 5G5EA 3DKSA 4BVXB 3ZYWA 2IMEA 1HNBA 3FK8A 2IWTA 3S9FA 3ZLPA 4ICYA 3GKMA 3KTBA 1W4VA 1SKWB 1O8XA 3CRUA 3GH9A 5AISA 1TI3A 2O7KA 2H6XA 1GRXA 2FWHA 2YWOA 4IN0A 4CY6A 4MDCA 3H8QA 4LMVA 5EPFA 3IOSA 1M0UA 2DJ0A 2VL9A 2FWFA 5D93A 2DIZA 5CRGA 3M8NA 2PU9C 1Z7PA 2I4AA 2TRXA 3LQ7A 4ZIJA 4IGJA 3MWHA 1HQOA 3EPTA 1O7UA 1T00A 4JR4A 2PPTA 3ED3A 2VL2A 2GQMA 3E3EA 2VIMA 4EF0A 4XHMA 4WKWA 4GSSA 2AYTA 5KOWA 2QGVA 3GL3A 4ECCA 4LLRA 5KN2A 3LFLA 2TRCP 2RUEA 4TR4A 1LJRA 3J7Yk 1PX7A 1Y6EA 5AGYA 3RHBA 2VO4A 2P31A 2CA8A 2AHEA 2YOIA 4POMA 4Z2UA 4KUNA 1KNGA 2K8VA 3ZL5A 2IMDA 1M7TA 3F63A 3FYGA 4FQUA 2RLIA 2VL3A 2YANA 2NVLA 1HNAA 4L0WA 4PQIA 5D9VA 1AUCA 3HXSA 2XHFA 1RW1A 1VGLA 2HI7A 2VM1A 4MJBA 3CYNA 2DMLA 3QFBC 1ZMAA 4F9ZA 2HE3A 1MDIA 2V6KA 3PR8A 4DEJA 1IW7D 1QMVA 1A23A 2FGXA 3CSIA 14GSA 4AJ8A 1OKTA 2CT6A 5G31A 1FW1A 6GSYA 13GSA 2V32A 3EE2A 5ENUA 2H71A 3FRCA 2L59A 1OE7A 2B6MA 2XBIA 3BCIA 3UEMA 4LA1A 5BMUA 3GFKA 4KE3A 3UAPA 4ILFA 5ECSA 1PQNA 4EL1A 4LL4B 4MJCA 4Z2TA 3LSZA 2A4VA 1R4WA 2IFQB 1JZDA 1G6WA 2LV3A 2HZFA 2MZCA 5ID2A 4FYCA 2DKHA 3GA4A 4IW9A 4DVCA 4V1Ag 4O7HA 1YEXA 4LL1B 4K9ZA 1S3AA 3ME8A 4V2NA 3O76A 4OMVA 4DSSA 1FHEA 3L4NA 5DCHA 3ZIJA 3D4MA 5DAKA 2KP2A 4TKYA 2HZEB 2VL2C 3F6DA 1K0DA 3A2VA 2IPAA 2OBIA 1MD3A 3LGCA 5DCGA 2OE3A 2O89A 2H0HA 4ULXA 1GNEA 3N5OA 4Q5FA 4OFNA 4YQVA 1XPVA 2JSZA 1G0TA 4F0BA 3EVIA 1E2YA 1U3AA 1EOGA 1V57A 3HZ8A 2H72A 2B1LA 16GSA 2PGTA 4KA0A 1Q4JA 1GSDA 5LD0A 3H79A 1F37A 4XS4B 2A2RA 5C04A 3WGDA 2EIQA 3M9KA 3C8EA 2C0DA 1NHOA 1M9AA 2QKEA 3TDGA 2LQOA 2VUPA 1TDIA 4MH3A 2V41A 4KDXA 3BJ5A 4JE1A 4N30A 5J3RA 1GULA 4K0GA 3L0HA 4D73A 4FYUA 1K3OA 1FOHA 3E0UA 2CVKA 4RQXA 3D4TA 2IMFA 3ZIVA 5CRDA 4MNNA 1GH2A 1T8EB 2C4JA 3GL5A 3FZAA 1TTZA 3DWVA 1J0FA 4TRXA 2CX4A 1YQ1A 3ZFLA 3KTLA 2OACA 4OFMA 4PUAA 4PQ1A 2LKUA 4TR1B 4PTSA 1EP8A 3LWAA 1GSUA 5H5QA 5ELGA 2I81A 5J9CA 2IN3A 5G1KA 2GQKA 5AIXA 1JHBA 4XCSA 4LMWA 4MF7A 2X4AA 2X8HA 1XWGA 1OC8A 4IQJM 5D73A 1I5GA 1X5DA 5HFGA 1K0AA 3TJBA 2EC4A 1BAYA 1M2DA 2LUSA 2B5XA 4JZQA 1G7EA 3VWUA 5D9TA 1KEBA 5D9WA 4KCEA 4G0KA 1SENA 1XW5A 2XC2A 2AAWA 2V1MA 4KNDA 2LQQA 4ZB6A 2A2PA 3APSA 2ON7A 4HI7A 5HQPA 1B4PA 1PL1A 1Z5YE 3IA1A 4RI6A 3IK9A 1SJZA 4V1Ap 3BBYA 2H0IA 3HY2A 4Z7XA 3UL3A 4NPBA 4HQSA 4KAEA 1I9DA 4KCAA 3APQA 5CAXA 5L71A 3KEBA 5DQSA 4MJAA 1ST9A 3UBLA 4IHUA 2OADA 5GSTA 4FH8A 5HR3A 4O5RA 1EZKA 5ECLB 2V2GA 3GHAA 1GSSA 5IMDA 2E0QA 4EDYA 4NXIA 1PGTA 4MK3A 1HNCA 2VLVA 5ECKB 3K8NA 2ALBA 3IBHA 3G7JA 1TU8A 1MEKA 2R37A 4WR5A 1XCCA 1B9YC 1GL8A 4GQCA 4JU5A 2YCDA 1M2AA 1PN0A 2NTOA 3ZVJD 1GTUA 3TKSE 5AIVA 3PINA 3NIVA 2FD3A 4BPYA 3FHKA 4ACSA 5ECIB 1K3YA 1SJIA 1JLWA 3HZ4A 5AN1A 1XFLA 3EYTA 1S3CA 1AC1A 3GNJA 1ERWA 3VWVA 2UZ8A 3VPQA 4TXVA 3TRXA 2GS3A 3R2QA 1F9MA 1X0RA 2IIYA 4KSMA 2FCHA 4AJ6A 3TJFA 1OE8A 4CHSA 1S3DA 1ZL9A 12GSA 1SJ6A 3MAKA 4KDYA 3F4RA 1IYIA 1EV9A 1EV4A 5DALA 2VCQA 1U3IA 2RM5A 4XS6A 4JBBA 1AQXA 1ZZYA 3EURA 9GSSA 1AAZA 2K6VA 2FLSA 6GSUA 2YV7A 3VPTA 2J23A 22GSA 4GQFA 1K0MA 1TXXA 3ERWA 1EWXA 3GX8A 4NAXA 3PPUA 2DJJA 5IPHA 1TI1A 1U87A 1YY7A 4I2UA 1LBKA 2HNLA 1R7HA 3TKRA 2FNOA 1WOUA 2DJKA 4IVFA 4X1UA 1THOA 2DSAA 1TJDA 1WJKA 4MA9A 5GAPD 3KJYA 4J57E 5ECRB 2CAQA 2HZEA 3RHCA 4TW5A 2WDUA 2WJUA 2LRNA 5JCGA 2LSTA 2NBSA 2VCZA 4G10A 1C72A 2CQ9A 3TKQA 3A3TA 2R0CA 1O73A 4DSRA 3CBUA 1Z6NA 5G1LA 1V58A 3EC3A 2HRNA 3IAS2 1WMJA 3GTUA 2LJRA 2D2ZA 5IMAA 1CQGA 5JCWA 3Q18A 3H1NA 2GSQA 3LORA 2GDRA 4NHZA 2C3NA 1K3LA 3BOAA 3EMPA 3RPPA 2D27A 1AIUA 2JL4A 1J9BA 1K0NA 4XIHA 4EDZA 4XS4A 4MZCA 2BMXA 1HYUA 1GUMA 4K7IA 5DQYA 2EIOA 4KDUA 3M0FA 2X99A 4N0VA 4WR4A 1OC9A 4G0IA 5G2ZA 2YP6A 6GSXA 2LRTA 2C0EA 2R4VA 4NV2A 5ECHB 2H73A 2AB6A 1XWKA 2ZUPA 2N5BA 3KXOA 5FT3A 2ES7A 2WRTA 4KF9A 3F3RA 1PSQA 4MCUA 4EIPA 2H0GA 4EC0A 4OO5A 3GH6A 1M9BA 2WZ9A 1FVKA 17GSA 2OBKA 1PX6A 2YPMA 2TIRA 3C1SA 4Q5NA 3CSHA 3GUSA 3TB2A 3US3A 5BRTA 4IP1A 1WWJA 4K5SA 4JRRA 4DSQA 5KN1A 3GYKA 3P2AA 5KN0A 3GV1A 1ZCPA 3QPMA 3L9SA 3IPZA 2C0FA 2VCVA 2MYGA 2BTOT 2L6DA 2OE1A 3TKSA 1K0CA 4HU7A 1Z9HA 4MJEA 2DJ2A 5ELAA 3KMNA 3D6IA 1ERUA 4IQAA 1PL2A 5IMCA 3VI5A 3GSSA 4IS0A 1DE1A 1XW6A 2LS5A 1U6TA 4EXJA 4TR3A 2GTUA 4MABA 2JADA 3LYPA 5ECQB 1THXA 1OVNA 1N8JA 3F3QA 1TW9A 4O32A 4K8MA 1OC3A 1DBYA 1E6BA 3WT2A 1GLPA 2QA2A 2FHEA 5IQYA 2YJ7A 4K0NA 4HUAA 3BCKA 4NMUA 4POBA 2DLXA 5ECNB 1YKAA 3VURA 1O85A 5IMZA 1FB6A 2MMZA 4O5UA 1R5PA 3P8WA 4CW9A 4ML1A 1GWCA 4ML6A 4RQRA 1MDKA 3SWLA 3I69A 3FR6A 3IAM2 1B4QA 3GKXA 2A4HA 2WGRA 5B6NA 1EEJA 4H86A 5LNKe 1B48A 1XZOA 4X4JA 1BEDA 1T4ZA 4GF0A 3GKNA 3C73A 1BJXA 5HR0A 3HVVA 3KP9A 2M80A 5J9BA 3MNGA 1X5EA 1YZXA 5DVBA 4RUVA 5CYYA 3IK7A 1SYRA 4PUFC 3W8SA 3IE3A 2F3MA 4IQ1A 3KCMA 3KP8A 2E7PA 4WETA 1RK4A 5KN3A 2B5YA 1KTEA 5HFKA 3F0IA 2B3SA 1WP0A 1U88A 1Z6MA 4TXOA 3ZMLA 4YQUA 2FA4A 2FY6A 3GIXA 3E9JB 2FUG2 1O6JA 5HR2A 4BL7A 2H30A 2MBSA 5KEJA 2R0GA 5F8BA 3QMXA 4N0ZA 1B8XA 3HVSA 2GZZA 3TKSC 3MIXA 2FA8A 1SKRB 3C1RA 4Q5RA 5IMVA 3HCZA 1ZYPA 4J2FA 4ZL7A 1A24A 4HU9A 3LW9A 3IR4A 5CREA 1TKDB 4ZB8A 4QL9A 1X9WB 3FZ9A 1PMTA 3G9BA 4MP4A 3RDWA 4ZL9A 3LXZA 1VRSD 4I5QA 4MZBA 1V98A 4F82A 2H70A 4ZB9A 6GSSA 3ISOA 4YQMA 2R6KA 3DRNA 1FAAA 1XVWA 4HJ2A 3LYKA 1ZYNA 3DVWA 4EO3A 4KGIA 2M46A 3VFIA 1SL0B 2VOCA 2VAFA 2RM6A 5HFIA 2KLXA 1EGRA 1ZYQB 4KH7A 2L57A 4ID0A 4ZL8A 3Q6OA 5ECOB 3W6GA 5B8AA 4N11A 4BVXA 4PQHA 3IDVA 3KIJA 2L4CA 4KB3A 1JZWA 3ZFBA 4I8BA 2HRKA 2K8SA 2YWNA 5COHA 2KOKA 4TN8A 1EGOA 2GZPA 2PUKC 1ERVA 2R3XA 4HZ2A 1ZGNA 3EMXA 2WS2A 1UC7A 1FB0A 2DKIA 1SK0A 2GSRA 1BYEA 2VLUA 3OR5A 3A2XA 5JCUA 2EIRA 3H4KA 5IPGA 1VF4A 1O81A 3MSZA 1PN9A 3QR6A 2I3YA 5IMFA 3DVXA 2K18A 4X0XA 2X8GA 2R0PA 5JWQB 1FVJA 2WB9A 5CNWA 2CZ3A 5CRHA 2HSMA 3D5JA 4F0CA 4GWRA 3CTGA 5KOXA 5ID2B 3HJOA 4NV5A 3QAGA 2LJAA 3TRQA 2IJYA 4DSSB 2PVQA 3F6FA 3P90A 1WIKA 3D0ZA 4KSOA 3TCOA 5IM9A 1DE2A 1TRUA 3UIWA 4PNFA 3TUEA 3L78A 1T3BA 5B7CA 2GT5A 4PX1A 3U6VA 2J9HA 3GRXA 5A5KA 1AQWA 4EUYA 3HHVA 3FMWA 2H6ZA 2OE0A 2N5FA 2YWMA 1A2MA 4BVYB 1TU7A 1GNWA 2LTKA 1OAZA 4O5QA 3DGQA 4I6XA 1SK1A 3GSTA 3FZ4A 1USBA 3TKPA 1DSBA 4IP6A 1RQMA 1SL1B 1F3BA 3CMIA 18GSA 2VCXA 4PXOA 1EEMA 5HR1A 1X9SB 4RI7A 4HOJA 3WYWA 1VF1A 1PKWA 2R2JA 2KP1A 5CRWA 3IHGA 2HLSA 5C00A 3QDNA 3KZQA 3CSJA 2LRCA 2HSYA 2VCTA 1TRVA 4D73B 2L6CA 3ZTLA 3GX0A 5E59A 2OJLA 3CXGA 1A0RP 3DD3A 3TGZA 1NM3A 1X5CA 3ERGA 1EP7A 1O8WA 2H74A 4OCFA 1N2AA 2IFQA 3KM6A 4WF5A 5EVOA 1TOFA 4O92A 5FHIA 2IMIA 4CY8A 1XIYA 2BJXA 5A4UA 2GSTA 2HRFA 2XPDA 4ZILA 4Q5QA 2NDOA 4FYBA 1ZOFA 1ACVA 4MPGA 2G2QA 3EU3A 3TJKA 2WULA 1NW2A 1M2BA 4ZBDA 1VF2A 3GURA 1XWCA 4OWYA 4MF6A 3TJJA 1YDKA 5EY6A 3FZ5A 5A4WA 3QOUA 3RAZA 2N5AA 3TRPA 4L0UA 1MDJA 3EINA 4PGTA 4AF2A 5GSSA 1PKZA 1PA3A 2PMTA 2CV4A 3KD0A 2C3TA 3EWLA 1X9MB 3O6TA 1GSQA 3TOUA 4CDOA 1R26A 1LU4A 2VM2A 4E8EA 2H1GA 3Q19A 2B7KA 3HD5A 3DIEA 3I6AA 3ZZXA 2O85A 2CVDA 2IL3A 3H93A 2QSIA 4AGSA 4K2DA 3QCPA 1GTBA 4WEYA 4ZBAA 1XW9A 4XRDA 3RBTA 2A2SA 2RIIA 4BWQA 4MF5A 3RPNA 2QA1A 3QAWA 4YAVA 1UVZA 5LCZA 3LXTA 1XXUA 1G7OA 1A0FA 2DC5A 3DXBA 4IELA 3GMFA 1KBNA 2F9SA 1FOVA 2AUVA 2MMAA 3FW2A 4IJIA 1M99A 3EU4A 4EVMA 4K1FA 1WPIA 3UVTA 1Y25A 2HXKA 3WGXA 2DJ1A 2YNXA 3QD9A 3M3MA 3L9UA 3DEXA 3VWXA 3UARA 1URMA 5J4UA 1H75A 3CRTA 5H5RA 4TR1A 2GLRA 1ZYEA 1B9XC 3VI7A 2V6OA 3A5WA 2E2MA 1SD9A 1A2JA 2ZNMA 2VLTA 1UA5A 4V2LA 4WBRD 1QFNA 3W8JA 5ECMB 4BWSA 3GKKA 2WCIA 1Z3EA 1XVQA 1XWAA 4BA7A 1TK0B 2GT6A 1TRWA 4GLTA 3TJGA 8GSSA 4WXTA 2C8UA 3L9VA 4YKFA 3FR9A 3J7Yb 1SL2B 3I43A 1YKCA 4PURA 1G6YA 4MPFA 11GSA 3HJPA 5D8IA 2CVBA 1TP9A 3ERFA 1GSYA 1SK2A 5B6MA 2HSHA 1SD8A 1JFUA 5EL8A 2H66A 5DALB 3UOMA 1BG5A 1MTCA 2HFDA 5A4VA 2GSSA 2O8VB 4OO4A 10GSA 3G7YA 3PGTA 5ECPB 1TRSA 2K9FA 1QGVA 2FWGA 2X49A 4POKA 1Z7RA 4EKZA 2PWJA 3WD6A 4EIQA 1Q98A 1XOBA 4P3YB 1OKDA 4F2IA 5IOXA 4G19A 4GXZA 1VF3A 4F03A 2MMOA 2F51A 2F8FA 6GSTA 3MYDA 1PD21 2R5GA 4G2EA 1NHYA 3QAVA 2H01A 3LEFA 2AJQB 3ZREA 4JR6A 4HJMA 4Z2RA 4WF4A 5D96A 2LNSA 2X64A 1YEPA 2OKAA 3AY8A 4I97A 5GZZB 2B7JA 2YWIA 4TOPA 5IO0A 4K2XA 1TK5B 2VD1A 4ZBBA 2PBJA 1SKSB 4XRAA 2F8AA 5J41A 4GRFA 5DDLA 3PH9A 1IYHA 2JSYA 5D9XA 4MLYA 4ECJA 4BVYA 4YKGA 4E8HA 5F07A 4K6XA 2DJ3A 3GTUB 3IC4A 1A2LA 2HYXA 2FWEA 2PN8A 2MBTA 19GSA 4K7NA 1QQ2A 5DJLA 2B5EA 5JWRB 2LEGA 1EOHA 4IKHA 5FWGA 2GVPA 4NWYA 1WE0A 1GP1A 2H1BA 5H5SA 3F4TA 2H75A 1ML6A 1JZRA 4HZ4A 4ECBA 1OC9B 3ZITA 2KUCA 3A5IA 4I2TA 1F6MC 5GAND 6GSWA 3DYRA 2GZYA 3F9UA 3CTFA 2YZUA 5DBQA 2CZ2A 3IHQA 4NHWA 1PRXA 3FKFA 3UJ1A 5IO2A 2VD0A 3HKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L5O A;  5B8B A;  5IOW A;  5J5N A;  1GUK A;  3DML A;  2H1D A;  1ILO A;  4QQ7 A;  3D21 A;  1T1V A;  2L5L A;  4L5L A;  3D22 A;  1JLV A;  1CQH A;  1HD2 A;  2P5R A;  2NPB A;  1GLQ A;  3F4S A;  4YH2 A;  3FY7 A;  1V9W A;  4OFT A;  1A8L A;  1SYX A;  1FG4 A;  4G9H A;  3U5R E;  3HJM A;  3TOT A;  4FO5 A;  4KW6 A;  2DBC A;  2REM A;  1XBS A;  2CAI A;  3O3T A;  1AQV A;  2X8C A;  2Z9S A;  6GSV A;  3KGK A;  3WT1 A;  1W89 A;  2JZS A;  3KH7 A;  1ABA A;  3F8U A;  3VK9 A;  4MZW A;  2WFC A;  2JZR A;  3NOF A;  3VWW A;  3ZMK A;  4HS1 A;  4XTS A;  1BQ7 A;  1V40 A;  2XPE A;  2ZCT A;  1A8Y A;  5CO3 A;  1UN2 A;  1JZO A;  4GTU A;  1T7P B;  2H8L A;  2I1U A;  3UBK A;  4ECI A;  2H1A A;  2PER A;  3G7I A;  3I9V 2;  3LJR A;  3MDK A;  4J56 E;  4L8E A;  5F06 A;  4ZXG A;  1OYJ A;  4MMM A;  4JED A;  5ABR A;  4PNG A;  2B1K A;  2G0F A;  1GSF A;  4QL7 A;  4N10 A;  5G5F A;  2H6Y A;  4GCI A;  1AW9 A;  4HDE A;  7GSS A;  3KH9 A;  2I9H A;  4GSN A;  4FIW A;  1YF0 A;  3HDC A;  4GST A;  3HA9 A;  2MMN A;  2YV9 A;  2KHP A;  1FO5 A;  3KMO A;  2JU5 A;  3M9J A;  5JWO B;  2DIY A;  3APO A;  4EE0 A;  5DJM A;  3N9J A;  2IMK A;  5DAK B;  2QC7 A;  2AV4 A;  2H76 A;  2YZH A;  1QUW A;  3NZN A;  3C7M A;  2C1Y A;  1J08 A;  3M1G A;  4MH2 A;  2PVO C;  2H19 A;  1XWB A;  3A2W A;  2L5O A;  4KX4 A;  20GS A;  5CP1 A;  4AJ7 A;  4TR0 A;  2YJH A;  3FR3 A;  3IV4 A;  1GTA A;  3QFA C;  1GUH A;  3GN3 A;  2OA7 A;  1F3A A;  1WRY A;  3VLN A;  3ZRD A;  2RUF A;  1H4O A;  5E4W A;  1AXD A;  5INY A;  4HEA 2;  1XOA A;  2P5Q A;  4V2M A;  3P7X A;  5G30 A;  3ME7 A;  1K0O A;  2HT9 A;  2C0G A;  1V2A A;  5IIZ A;  2M72 A;  1ON4 A;  3HYP A;  4K7O A;  3UVH A;  1T4Y A;  4TXO B;  1QXH A;  1ERT A;  2C3Q A;  2DMM A;  2YN1 A;  2L4Q A;  3V1W A;  1DUG A;  2CX3 A;  2LNT A;  2VCW A;  4TVE A;  4IJ3 A;  1BX9 A;  1SU9 A;  4POL A;  3IXR A;  3WGE A;  2LJK A;  4WBJ A;  4HQZ A;  4X43 A;  3JCM L;  3FEU A;  2JAC A;  4OD7 A;  4XS1 A;  1MD4 A;  1QK8 A;  2GGT A;  1YJ6 A;  4OCE A;  3Q74 A;  2GQL A;  3UMA A;  3HVX A;  5F0G A;  1TK8 B;  4IBP A;  1NSW A;  4YAP A;  2O87 A;  3LG6 A;  2E2G A;  1YF1 A;  5F05 A;  2C80 A;  1K0B A;  4ISD A;  1GTI A;  1GSE A;  1R5A A;  2JZT A;  3BD2 A;  3IRA A;  3SBC A;  2P0G A;  3ZVJ A;  3C71 A;  1F2E A;  2XBQ A;  2ON5 A;  5G5E A;  3DKS A;  3ZYW A;  2IME A;  1HNB A;  3FK8 A;  2IWT A;  3S9F A;  3ZLP A;  3GKM A;  3KTB A;  1W4V A;  1SKW B;  1O8X A;  3CRU A;  3GH9 A;  5AIS A;  1TI3 A;  2O7K A;  2H6X A;  1GRX A;  2FWH A;  2YWO A;  4IN0 A;  4MDC A;  3H8Q A;  4LMV A;  5EPF A;  3IOS A;  1M0U A;  2DJ0 A;  2VL9 A;  2FWF A;  5D93 A;  2DIZ A;  5CRG A;  3M8N A;  2PU9 C;  1Z7P A;  2I4A A;  2TRX A;  3LQ7 A;  4ZIJ A;  4IGJ A;  3MWH A;  1HQO A;  1O7U A;  1T00 A;  4JR4 A;  2PPT A;  3ED3 A;  2VL2 A;  2GQM A;  3E3E A;  2VIM A;  4EF0 A;  4XHM A;  4WKW A;  4GSS A;  2AYT A;  2QGV A;  3GL3 A;  4ECC A;  4LLR A;  5KN2 A;  3LFL A;  2TRC P;  2RUE A;  4TR4 A;  1LJR A;  3J7Y k;  1PX7 A;  1Y6E A;  5AGY A;  3RHB A;  2VO4 A;  2P31 A;  2CA8 A;  2AHE A;  2YOI A;  4POM A;  4KUN A;  1KNG A;  2K8V A;  3ZL5 A;  2IMD A;  1M7T A;  3F63 A;  3FYG A;  2RLI A;  2VL3 A;  2YAN A;  2NVL A;  1HNA A;  4L0W A;  4PQI A;  5D9V A;  1AUC A;  3HXS A;  2XHF A;  1RW1 A;  1VGL A;  2HI7 A;  2VM1 A;  4MJB A;  3CYN A;  2DML A;  3QFB C;  1ZMA A;  4F9Z A;  2HE3 A;  1MDI A;  2V6K A;  3PR8 A;  4DEJ A;  1QMV A;  1A23 A;  2FGX A;  3CSI A;  14GS A;  4AJ8 A;  1OKT A;  2CT6 A;  5G31 A;  1FW1 A;  6GSY A;  13GS A;  2V32 A;  3EE2 A;  5ENU A;  2H71 A;  3FRC A;  2L59 A;  1OE7 A;  2B6M A;  2XBI A;  3BCI A;  3UEM A;  4LA1 A;  3GFK A;  4KE3 A;  3UAP A;  4ILF A;  5ECS A;  1PQN A;  4EL1 A;  4LL4 B;  4MJC A;  3LSZ A;  2A4V A;  1R4W A;  2IFQ B;  1JZD A;  1G6W A;  2LV3 A;  2HZF A;  2MZC A;  5ID2 A;  4FYC A;  3GA4 A;  4IW9 A;  4DVC A;  4V1A g;  4O7H A;  1YEX A;  4LL1 B;  4K9Z A;  1S3A A;  3ME8 A;  4V2N A;  3O76 A;  4OMV A;  4DSS A;  1FHE A;  3L4N A;  5DCH A;  3ZIJ A;  3D4M A;  5DAK A;  2KP2 A;  4TKY A;  2HZE B;  2VL2 C;  3F6D A;  1K0D A;  3A2V A;  2IPA A;  2OBI A;  1MD3 A;  3LGC A;  5DCG A;  2OE3 A;  2O89 A;  2H0H A;  4ULX A;  1GNE A;  3N5O A;  4Q5F A;  4OFN A;  4YQV A;  1XPV A;  2JSZ A;  1G0T A;  4F0B A;  3EVI A;  1E2Y A;  1U3A A;  1EOG A;  1V57 A;  3HZ8 A;  2H72 A;  2B1L A;  16GS A;  2PGT A;  4KA0 A;  1Q4J A;  1GSD A;  5LD0 A;  3H79 A;  1F37 A;  4XS4 B;  2A2R A;  5C04 A;  3WGD A;  2EIQ A;  3M9K A;  3C8E A;  2C0D A;  1NHO A;  1M9A A;  2QKE A;  3TDG A;  2LQO A;  2VUP A;  1TDI A;  4MH3 A;  2V41 A;  4KDX A;  3BJ5 A;  4JE1 A;  4N30 A;  5J3R A;  1GUL A;  4K0G A;  3L0H A;  4D73 A;  4FYU A;  1K3O A;  3E0U A;  2CVK A;  4RQX A;  3D4T A;  2IMF A;  3ZIV A;  5CRD A;  1GH2 A;  1T8E B;  2C4J A;  3GL5 A;  3FZA A;  1TTZ A;  3DWV A;  1J0F A;  4TRX A;  2CX4 A;  1YQ1 A;  3ZFL A;  3KTL A;  2OAC A;  4OFM A;  4PUA A;  4PQ1 A;  2LKU A;  4TR1 B;  1EP8 A;  3LWA A;  1GSU A;  5H5Q A;  5ELG A;  2I81 A;  5J9C A;  2IN3 A;  5G1K A;  2GQK A;  5AIX A;  1JHB A;  4XCS A;  4LMW A;  4MF7 A;  2X8H A;  1XWG A;  1OC8 A;  5D73 A;  1I5G A;  1X5D A;  5HFG A;  1K0A A;  3TJB A;  2EC4 A;  1BAY A;  1M2D A;  2LUS A;  2B5X A;  4JZQ A;  1G7E A;  3VWU A;  5D9T A;  1KEB A;  5D9W A;  4KCE A;  1SEN A;  1XW5 A;  2XC2 A;  2AAW A;  2V1M A;  4KND A;  2LQQ A;  4ZB6 A;  3APS A;  2ON7 A;  4HI7 A;  5HQP A;  1B4P A;  1PL1 A;  1Z5Y E;  3IA1 A;  4RI6 A;  3IK9 A;  1SJZ A;  4V1A p;  3BBY A;  2H0I A;  3HY2 A;  4Z7X A;  3UL3 A;  4NPB A;  4HQS A;  4KAE A;  1I9D A;  4KCA A;  3APQ A;  5CAX A;  5L71 A;  3KEB A;  5DQS A;  4MJA A;  1ST9 A;  3UBL A;  4IHU A;  2OAD A;  5GST A;  4FH8 A;  5HR3 A;  4O5R A;  1EZK A;  5ECL B;  2V2G A;  3GHA A;  1GSS A;  5IMD A;  2E0Q A;  4EDY A;  4NXI A;  1PGT A;  4MK3 A;  1HNC A;  2VLV A;  5ECK B;  3K8N A;  2ALB A;  3IBH A;  3G7J A;  1TU8 A;  1MEK A;  2R37 A;  4WR5 A;  1XCC A;  1B9Y C;  1GL8 A;  4GQC A;  4JU5 A;  2YCD A;  1M2A A;  2NTO A;  3ZVJ D;  1GTU A;  3TKS E;  5AIV A;  3PIN A;  3NIV A;  2FD3 A;  4BPY A;  3FHK A;  4ACS A;  5ECI B;  1K3Y A;  1SJI A;  1JLW A;  3HZ4 A;  5AN1 A;  1XFL A;  3EYT A;  1S3C A;  1AC1 A;  3GNJ A;  1ERW A;  3VWV A;  3VPQ A;  4TXV A;  3TRX A;  2GS3 A;  3R2Q A;  1F9M A;  1X0R A;  2IIY A;  4KSM A;  2FCH A;  4AJ6 A;  3TJF A;  1OE8 A;  4CHS A;  1S3D A;  1ZL9 A;  12GS A;  1SJ6 A;  3MAK A;  4KDY A;  3F4R A;  1IYI A;  1EV9 A;  1EV4 A;  5DAL A;  2VCQ A;  1U3I A;  2RM5 A;  4XS6 A;  4JBB A;  1AQX A;  1ZZY A;  3EUR A;  9GSS A;  1AAZ A;  2K6V A;  2FLS A;  6GSU A;  2YV7 A;  3VPT A;  2J23 A;  22GS A;  4GQF A;  1K0M A;  1TXX A;  3ERW A;  1EWX A;  3GX8 A;  4NAX A;  2DJJ A;  5IPH A;  1TI1 A;  1U87 A;  1YY7 A;  4I2U A;  1LBK A;  2HNL A;  1R7H A;  3TKR A;  2FNO A;  1WOU A;  2DJK A;  4IVF A;  4X1U A;  1THO A;  2DSA A;  1TJD A;  1WJK A;  4MA9 A;  5GAP D;  3KJY A;  4J57 E;  5ECR B;  2CAQ A;  2HZE A;  3RHC A;  4TW5 A;  2WDU A;  2WJU A;  2LRN A;  5JCG A;  2LST A;  2NBS A;  2VCZ A;  4G10 A;  1C72 A;  2CQ9 A;  3TKQ A;  3A3T A;  1O73 A;  4DSR A;  3CBU A;  1Z6N A;  5G1L A;  1V58 A;  3EC3 A;  2HRN A;  3IAS 2;  1WMJ A;  3GTU A;  2LJR A;  2D2Z A;  5IMA A;  1CQG A;  5JCW A;  3Q18 A;  3H1N A;  2GSQ A;  3LOR A;  2GDR A;  4NHZ A;  2C3N A;  1K3L A;  3BOA A;  3EMP A;  3RPP A;  1AIU A;  2JL4 A;  1J9B A;  1K0N A;  4XIH A;  4EDZ A;  4XS4 A;  4MZC A;  2BMX A;  1HYU A;  1GUM A;  4K7I A;  5DQY A;  2EIO A;  4KDU A;  3M0F A;  2X99 A;  4N0V A;  4WR4 A;  1OC9 A;  5G2Z A;  2YP6 A;  6GSX A;  2LRT A;  2C0E A;  2R4V A;  4NV2 A;  5ECH B;  2H73 A;  2AB6 A;  1XWK A;  2ZUP A;  2N5B A;  3KXO A;  5FT3 A;  2ES7 A;  2WRT A;  3F3R A;  1PSQ A;  4MCU A;  2H0G A;  4EC0 A;  4OO5 A;  3GH6 A;  1M9B A;  2WZ9 A;  1FVK A;  17GS A;  2OBK A;  1PX6 A;  2YPM A;  2TIR A;  3C1S A;  4Q5N A;  3CSH A;  3GUS A;  3TB2 A;  3US3 A;  4IP1 A;  1WWJ A;  4JRR A;  4DSQ A;  5KN1 A;  3GYK A;  3P2A A;  5KN0 A;  3GV1 A;  1ZCP A;  3QPM A;  3L9S A;  3IPZ A;  2C0F A;  2VCV A;  2MYG A;  2BTO T;  2L6D A;  2OE1 A;  3TKS A;  1K0C A;  4HU7 A;  1Z9H A;  4MJE A;  2DJ2 A;  5ELA A;  3KMN A;  3D6I A;  1ERU A;  4IQA A;  1PL2 A;  5IMC A;  3VI5 A;  3GSS A;  4IS0 A;  1DE1 A;  1XW6 A;  2LS5 A;  1U6T A;  4EXJ A;  4TR3 A;  2GTU A;  4MAB A;  2JAD A;  3LYP A;  5ECQ B;  1THX A;  1OVN A;  1N8J A;  3F3Q A;  1TW9 A;  4O32 A;  4K8M A;  1OC3 A;  1DBY A;  1E6B A;  3WT2 A;  1GLP A;  2FHE A;  5IQY A;  2YJ7 A;  4K0N A;  4HUA A;  3BCK A;  4NMU A;  4POB A;  2DLX A;  5ECN B;  1YKA A;  3VUR A;  1O85 A;  5IMZ A;  1FB6 A;  2MMZ A;  1R5P A;  3P8W A;  4CW9 A;  4ML1 A;  1GWC A;  4ML6 A;  4RQR A;  1MDK A;  3SWL A;  3I69 A;  3FR6 A;  3IAM 2;  1B4Q A;  3GKX A;  2WGR A;  5B6N A;  1EEJ A;  4H86 A;  5LNK e;  1B48 A;  1XZO A;  1BED A;  1T4Z A;  4GF0 A;  3GKN A;  3C73 A;  1BJX A;  5HR0 A;  3HVV A;  3KP9 A;  2M80 A;  5J9B A;  3MNG A;  1X5E A;  1YZX A;  5DVB A;  4RUV A;  5CYY A;  3IK7 A;  1SYR A;  4PUF C;  3W8S A;  3IE3 A;  2F3M A;  4IQ1 A;  3KCM A;  3KP8 A;  2E7P A;  4WET A;  1RK4 A;  5KN3 A;  2B5Y A;  1KTE A;  5HFK A;  3F0I A;  2B3S A;  1WP0 A;  1U88 A;  1Z6M A;  4TXO A;  3ZML A;  4YQU A;  2FA4 A;  2FY6 A;  3GIX A;  3E9J B;  2FUG 2;  1O6J A;  5HR2 A;  4BL7 A;  2H30 A;  2MBS A;  5KEJ A;  5F8B A;  3QMX A;  4N0Z A;  1B8X A;  3HVS A;  2GZZ A;  3TKS C;  2FA8 A;  1SKR B;  3C1R A;  4Q5R A;  5IMV A;  3HCZ A;  4J2F A;  4ZL7 A;  1A24 A;  4HU9 A;  3IR4 A;  5CRE A;  1TKD B;  4ZB8 A;  4QL9 A;  1X9W B;  3FZ9 A;  1PMT A;  3G9B A;  4MP4 A;  3RDW A;  4ZL9 A;  3LXZ A;  1VRS D;  4I5Q A;  4MZB A;  1V98 A;  4F82 A;  2H70 A;  4ZB9 A;  6GSS A;  3ISO A;  4YQM A;  2R6K A;  3DRN A;  1FAA A;  1XVW A;  4HJ2 A;  3LYK A;  3DVW A;  4EO3 A;  4KGI A;  2M46 A;  3VFI A;  1SL0 B;  2VOC A;  2VAF A;  2RM6 A;  5HFI A;  2KLX A;  1EGR A;  1ZYQ B;  4KH7 A;  2L57 A;  4ID0 A;  4ZL8 A;  3Q6O A;  5ECO B;  3W6G A;  5B8A A;  4N11 A;  4BVX A;  4PQH A;  3IDV A;  3KIJ A;  2L4C A;  4KB3 A;  1JZW A;  3ZFB A;  4I8B A;  2K8S A;  2YWN A;  5COH A;  2KOK A;  4TN8 A;  1EGO A;  2GZP A;  2PUK C;  1ERV A;  2R3X A;  4HZ2 A;  1ZGN A;  3EMX A;  2WS2 A;  1UC7 A;  1FB0 A;  1SK0 A;  2GSR A;  1BYE A;  2VLU A;  3OR5 A;  3A2X A;  5JCU A;  2EIR A;  3H4K A;  5IPG A;  1VF4 A;  1O81 A;  3MSZ A;  1PN9 A;  3QR6 A;  2I3Y A;  5IMF A;  3DVX A;  2K18 A;  4X0X A;  2X8G A;  5JWQ B;  1FVJ A;  2WB9 A;  5CNW A;  2CZ3 A;  5CRH A;  3D5J A;  4F0C A;  4GWR A;  3CTG A;  5ID2 B;  3HJO A;  4NV5 A;  3QAG A;  2LJA A;  3TRQ A;  2IJY A;  4DSS B;  2PVQ A;  3F6F A;  3P90 A;  1WIK A;  3D0Z A;  4KSO A;  3TCO A;  5IM9 A;  1DE2 A;  1TRU A;  3UIW A;  4PNF A;  3TUE A;  3L78 A;  1T3B A;  5B7C A;  2GT5 A;  4PX1 A;  3U6V A;  2J9H A;  3GRX A;  5A5K A;  1AQW A;  4EUY A;  3HHV A;  2H6Z A;  2OE0 A;  2N5F A;  2YWM A;  1A2M A;  1TU7 A;  1GNW A;  2LTK A;  1OAZ A;  3DGQ A;  4I6X A;  1SK1 A;  3GST A;  3FZ4 A;  1USB A;  3TKP A;  1DSB A;  4IP6 A;  1RQM A;  1SL1 B;  1F3B A;  3CMI A;  18GS A;  2VCX A;  4PXO A;  1EEM A;  5HR1 A;  1X9S B;  4RI7 A;  4HOJ A;  3WYW A;  1VF1 A;  1PKW A;  2R2J A;  2KP1 A;  5CRW A;  2HLS A;  5C00 A;  3QDN A;  3KZQ A;  3CSJ A;  2LRC A;  2HSY A;  2VCT A;  1TRV A;  4D73 B;  2L6C A;  3ZTL A;  3GX0 A;  5E59 A;  2OJL A;  3CXG A;  1A0R P;  3DD3 A;  3TGZ A;  1NM3 A;  1X5C A;  3ERG A;  1EP7 A;  1O8W A;  2H74 A;  4OCF A;  1N2A A;  2IFQ A;  3KM6 A;  4WF5 A;  5EVO A;  1TOF A;  4O92 A;  5FHI A;  2IMI A;  1XIY A;  2BJX A;  5A4U A;  2GST A;  2HRF A;  2XPD A;  4ZIL A;  4Q5Q A;  2NDO A;  4FYB A;  1ZOF A;  1ACV A;  4MPG A;  2G2Q A;  3EU3 A;  3TJK A;  2WUL A;  1NW2 A;  1M2B A;  4ZBD A;  1VF2 A;  3GUR A;  1XWC A;  4OWY A;  4MF6 A;  3TJJ A;  1YDK A;  5EY6 A;  3FZ5 A;  5A4W A;  3QOU A;  3RAZ A;  2N5A A;  3TRP A;  4L0U A;  1MDJ A;  3EIN A;  4PGT A;  4AF2 A;  5GSS A;  1PKZ A;  1PA3 A;  2PMT A;  2CV4 A;  3KD0 A;  2C3T A;  3EWL A;  1X9M B;  3O6T A;  1GSQ A;  3TOU A;  4CDO A;  1R26 A;  1LU4 A;  2VM2 A;  4E8E A;  2H1G A;  3Q19 A;  2B7K A;  3HD5 A;  3DIE A;  3I6A A;  3ZZX A;  2O85 A;  2CVD A;  2IL3 A;  3H93 A;  2QSI A;  4AGS A;  4K2D A;  3QCP A;  1GTB A;  4WEY A;  4ZBA A;  1XW9 A;  4XRD A;  3RBT A;  2A2S A;  2RII A;  4BWQ A;  4MF5 A;  3RPN A;  3QAW A;  4YAV A;  1UVZ A;  5LCZ A;  3LXT A;  1XXU A;  1G7O A;  1A0F A;  2DC5 A;  3DXB A;  4IEL A;  3GMF A;  1KBN A;  2F9S A;  1FOV A;  2AUV A;  2MMA A;  3FW2 A;  4IJI A;  1M99 A;  3EU4 A;  4EVM A;  4K1F A;  1WPI A;  3UVT A;  1Y25 A;  2HXK A;  3WGX A;  2DJ1 A;  2YNX A;  3QD9 A;  3M3M A;  3L9U A;  3DEX A;  3VWX A;  3UAR A;  1URM A;  5J4U A;  1H75 A;  3CRT A;  5H5R A;  4TR1 A;  2GLR A;  1ZYE A;  1B9X C;  3VI7 A;  2V6O A;  3A5W A;  2E2M A;  1SD9 A;  1A2J A;  2ZNM A;  2VLT A;  1UA5 A;  4V2L A;  4WBR D;  1QFN A;  3W8J A;  5ECM B;  4BWS A;  3GKK A;  2WCI A;  1Z3E A;  1XVQ A;  1XWA A;  4BA7 A;  1TK0 B;  2GT6 A;  1TRW A;  4GLT A;  3TJG A;  8GSS A;  4WXT A;  2C8U A;  3L9V A;  3FR9 A;  3J7Y b;  1SL2 B;  3I43 A;  1YKC A;  4PUR A;  1G6Y A;  4MPF A;  11GS A;  3HJP A;  5D8I A;  2CVB A;  1TP9 A;  3ERF A;  1GSY A;  1SK2 A;  5B6M A;  2HSH A;  1SD8 A;  1JFU A;  5EL8 A;  2H66 A;  5DAL B;  3UOM A;  1BG5 A;  1MTC A;  2HFD A;  5A4V A;  2GSS A;  2O8V B;  4OO4 A;  10GS A;  3G7Y A;  3PGT A;  5ECP B;  1TRS A;  2K9F A;  1QGV A;  2FWG A;  4POK A;  1Z7R A;  4EKZ A;  2PWJ A;  3WD6 A;  1Q98 A;  1XOB A;  4P3Y B;  1OKD A;  4F2I A;  5IOX A;  4G19 A;  4GXZ A;  1VF3 A;  4F03 A;  2MMO A;  2F51 A;  2F8F A;  6GST A;  1PD2 1;  2R5G A;  4G2E A;  1NHY A;  3QAV A;  2H01 A;  3LEF A;  2AJQ B;  3ZRE A;  4JR6 A;  4HJM A;  4WF4 A;  5D96 A;  2LNS A;  2X64 A;  1YEP A;  2OKA A;  3AY8 A;  4I97 A;  5GZZ B;  2B7J A;  2YWI A;  4TOP A;  5IO0 A;  1TK5 B;  2VD1 A;  4ZBB A;  2PBJ A;  1SKS B;  4XRA A;  2F8A A;  5J41 A;  4GRF A;  5DDL A;  3PH9 A;  1IYH A;  2JSY A;  5D9X A;  4MLY A;  4ECJ A;  4BVY A;  4E8H A;  5F07 A;  4K6X A;  2DJ3 A;  3GTU B;  3IC4 A;  1A2L A;  2HYX A;  2FWE A;  2PN8 A;  2MBT A;  19GS A;  4K7N A;  1QQ2 A;  5DJL A;  2B5E A;  5JWR B;  2LEG A;  1EOH A;  4IKH A;  5FWG A;  2GVP A;  4NWY A;  1WE0 A;  1GP1 A;  2H1B A;  5H5S A;  3F4T A;  2H75 A;  1ML6 A;  1JZR A;  4HZ4 A;  4ECB A;  1OC9 B;  3ZIT A;  2KUC A;  4I2T A;  1F6M C;  5GAN D;  6GSW A;  3DYR A;  2GZY A;  3F9U A;  3CTF A;  2YZU A;  5DBQ A;  2CZ2 A;  3IHQ A;  4NHW A;  1PRX A;  3FKF A;  3UJ1 A;  5IO2 A;  2VD0 A;  3HKR A; 
#chains in the Genus database with same CATH topology
 4L5O A;  5B8B A;  5IOW A;  5J5N A;  1GUK A;  3DML A;  2H1D A;  1ILO A;  4QQ7 A;  3D21 A;  1T1V A;  2L5L A;  4L5L A;  3D22 A;  1JLV A;  1CQH A;  1HD2 A;  2P5R A;  2NPB A;  1GLQ A;  3F4S A;  4YH2 A;  3FY7 A;  1V9W A;  4OFT A;  1A8L A;  3NO9 A;  1SYX A;  1FG4 A;  1Z4I A;  4G9H A;  3U5R E;  3HJM A;  3TOT A;  4FO5 A;  4KW6 A;  2DBC A;  2REM A;  1XBS A;  2CAI A;  3O3T A;  1AQV A;  2X8C A;  2Z9S A;  6GSV A;  3KGK A;  3WT1 A;  1W89 A;  2JZS A;  3KH7 A;  1TJV A;  1ABA A;  3F8U A;  3VK9 A;  4MZW A;  2WFC A;  1YFE A;  2JZR A;  3NOF A;  3VWW A;  3ZMK A;  4HS1 A;  4XTS A;  4G0L A;  1BQ7 A;  1V40 A;  2XPE A;  2ZCT A;  1A8Y A;  5CO3 A;  1UN2 A;  1JZO A;  4GTU A;  1T7P B;  2H8L A;  2I1U A;  3UBK A;  1U16 A;  4ECI A;  2H1A A;  2PER A;  1Z4L A;  3G7I A;  3I9V 2;  3LJR A;  3MDK A;  4J56 E;  4L8E A;  5F06 A;  4ZXG A;  1OYJ A;  4MMM A;  4JED A;  5ABR A;  4PNG A;  2B1K A;  2G0F A;  1GSF A;  4QL7 A;  4N10 A;  5G5F A;  2H6Y A;  4GCI A;  1AW9 A;  4HDE A;  7GSS A;  3KH9 A;  2I9H A;  4GSN A;  4FIW A;  1YF0 A;  3HDC A;  4GST A;  3HA9 A;  2MMN A;  2YV9 A;  2KHP A;  1FO5 A;  3KMO A;  2JU5 A;  3M9J A;  5JWO B;  2DIY A;  3APO A;  4EE0 A;  4HSC X;  5DJM A;  3N9J A;  2IMK A;  5DAK B;  2QC7 A;  2AV4 A;  2H76 A;  2YZH A;  1QUW A;  3NZN A;  3C7M A;  2C1Y A;  1J08 A;  2HRA A;  3M1G A;  4MH2 A;  2PVO C;  2H19 A;  1XWB A;  3A2W A;  2L5O A;  4KX4 A;  20GS A;  5CP1 A;  4AJ7 A;  4TR0 A;  2YJH A;  3R3E A;  4L57 A;  3FR3 A;  3IV4 A;  1GTA A;  3QFA C;  1GUH A;  3GN3 A;  2OA7 A;  1F3A A;  1WRY A;  3VLN A;  3ZRD A;  2RUF A;  1H4O A;  5E4W A;  1AXD A;  5INY A;  1FUO A;  4HEA 2;  1XOA A;  2P5Q A;  4V2M A;  3P7X A;  5G30 A;  3ME7 A;  1K0O A;  2HT9 A;  2C0G A;  1V2A A;  5IIZ A;  2X75 A;  2M72 A;  1ON4 A;  3HYP A;  4K7O A;  3UVH A;  1T4Y A;  4TXO B;  1QXH A;  1ERT A;  2C3Q A;  2DMM A;  2YN1 A;  2L4Q A;  3V1W A;  1DUG A;  2CX3 A;  2LNT A;  2VCW A;  4BL7 B;  4TVE A;  4IJ3 A;  1BX9 A;  1SU9 A;  4POL A;  3IXR A;  3WGE A;  2LJK A;  4WBJ A;  4HQZ A;  4X43 A;  3JCM L;  3FEU A;  2JAC A;  4OD7 A;  4XS1 A;  4L6C A;  1MD4 A;  1QK8 A;  2GGT A;  1YJ6 A;  4OCE A;  2D28 C;  3Q74 A;  2GQL A;  4K5R A;  3UMA A;  3HVX A;  5F0G A;  1TK8 B;  4IBP A;  4MWO A;  1NSW A;  4YAP A;  2O87 A;  3LG6 A;  4USS A;  1M3I A;  2E2G A;  1YF1 A;  5F05 A;  1FUR A;  2C80 A;  1K0B A;  4MX2 A;  4ISD A;  1GTI A;  1GSE A;  1R5A A;  2JZT A;  4A5P A;  3IC8 A;  3BD2 A;  3IRA A;  3SBC A;  2P0G A;  3ZVJ A;  3C71 A;  1F2E A;  2XBQ A;  2ON5 A;  5G5E A;  3DKS A;  4BVX B;  3ZYW A;  2IME A;  1HNB A;  1TJW A;  3FK8 A;  2IWT A;  3S9F A;  3ZLP A;  4ICY A;  3GKM A;  3KTB A;  1W4V A;  1SKW B;  1O8X A;  3CRU A;  3GH9 A;  5AIS A;  1TI3 A;  2O7K A;  2H6X A;  1GRX A;  1M3J A;  2FWH A;  2YWO A;  1U15 A;  4IN0 A;  4CY6 A;  4MDC A;  3H8Q A;  4LMV A;  5EPF A;  3IOS A;  1M0U A;  2DJ0 A;  2VL9 A;  2FWF A;  5D93 A;  4NFL A;  2DIZ A;  5CRG A;  3M8N A;  2PU9 C;  1Z7P A;  2I4A A;  2TRX A;  3LQ7 A;  4ZIJ A;  4IGJ A;  3MWH A;  1HQO A;  3EPT A;  1O7U A;  1T00 A;  4JR4 A;  2PPT A;  3ED3 A;  2VL2 A;  2GQM A;  3E3E A;  3RRP A;  2VIM A;  4EF0 A;  4XHM A;  4WKW A;  4GSS A;  2AYT A;  5KOW A;  2QGV A;  3GL3 A;  4ECC A;  4LLR A;  2RCN A;  5KN2 A;  3LFL A;  2TRC P;  2RUE A;  4TR4 A;  1LJR A;  3J7Y k;  1PX7 A;  1Y6E A;  1MH9 A;  5AGY A;  3RHB A;  2VO4 A;  2P31 A;  2CA8 A;  2AHE A;  2YOI A;  4POM A;  4Z2U A;  4KUN A;  1KNG A;  2K8V A;  3ZL5 A;  2IMD A;  1M7T A;  3F63 A;  3C8T A;  3FYG A;  4FQU A;  2RLI A;  2VL3 A;  2YAN A;  2NVL A;  1HNA A;  4L0W A;  4PQI A;  3QBP A;  5D9V A;  1AUC A;  3HXS A;  2XHF A;  1RW1 A;  1VGL A;  2HI7 A;  2VM1 A;  4MJB A;  3CYN A;  2DML A;  3QFB C;  1ZMA A;  4F9Z A;  2HE3 A;  1MDI A;  2V6K A;  3PR8 A;  4DEJ A;  1IW7 D;  1QMV A;  1A23 A;  2FGX A;  3CSI A;  14GS A;  4AJ8 A;  1OKT A;  2CT6 A;  5G31 A;  1FW1 A;  6GSY A;  1K62 A;  13GS A;  2V32 A;  3EE2 A;  5ENU A;  2H71 A;  3FRC A;  2L59 A;  1OE7 A;  2B6M A;  2XBI A;  3BCI A;  3UEM A;  4LA1 A;  5BMU A;  3GFK A;  1RE5 A;  4KE3 A;  3UAP A;  4ILF A;  5ECS A;  1PQN A;  4EL1 A;  4LL4 B;  4MJC A;  4Z2T A;  3LSZ A;  2A4V A;  1R4W A;  2IFQ B;  1JZD A;  1G6W A;  3E04 A;  2LV3 A;  1J3U A;  2HZF A;  2MZC A;  5ID2 A;  4FYC A;  2DKH A;  3GA4 A;  4IW9 A;  4DVC A;  4V1A g;  4O7H A;  1YEX A;  4LL1 B;  4K9Z A;  1S3A A;  3ME8 A;  4V2N A;  3O76 A;  4OMV A;  4DSS A;  1FHE A;  3L4N A;  2PTR A;  5DCH A;  3ZIJ A;  4ADM A;  3D4M A;  5DAK A;  2KP2 A;  4TKY A;  2HZE B;  2VL2 C;  3F6D A;  1K0D A;  3RD8 A;  3A2V A;  2IPA A;  3U19 A;  2OBI A;  1MD3 A;  3LGC A;  5DCG A;  2OE3 A;  2O89 A;  2H0H A;  4ULX A;  1GNE A;  3N5O A;  4Q5F A;  4OFN A;  4YQV A;  1XPV A;  2JSZ A;  1G0T A;  4F0B A;  3EVI A;  1E2Y A;  1U3A A;  1EOG A;  1V57 A;  3HZ8 A;  2H72 A;  2B1L A;  16GS A;  2PGT A;  4KA0 A;  1Q4J A;  1GSD A;  5LD0 A;  4YIK A;  3H79 A;  1F37 A;  4XS4 B;  2A2R A;  5C04 A;  3WGD A;  2EIQ A;  3M9K A;  3C8E A;  2C0D A;  1NHO A;  1M9A A;  2QKE A;  3TDG A;  2LQO A;  2VUP A;  1TDI A;  4MH3 A;  1Z4J A;  2V41 A;  4KDX A;  3BJ5 A;  4JE1 A;  4N30 A;  5J3R A;  1GUL A;  4K0G A;  3L0H A;  4D73 A;  4FYU A;  1K3O A;  1FOH A;  3E0U A;  2CVK A;  4RQX A;  3D4T A;  2IMF A;  3ZIV A;  5CRD A;  4MNN A;  2E9F A;  1GH2 A;  1T8E B;  2C4J A;  3GL5 A;  3FZA A;  1TTZ A;  3DWV A;  1HY1 A;  4TRX A;  1J0F A;  2CX4 A;  3GZH A;  1YQ1 A;  3ZFL A;  5D6B A;  3KTL A;  2OAC A;  4OFM A;  4PUA A;  4PQ1 A;  1Z4M A;  2LKU A;  4TR1 B;  4PTS A;  1EP8 A;  3LWA A;  1GSU A;  5H5Q A;  5ELG A;  2I81 A;  5J9C A;  2IN3 A;  5G1K A;  2GQK A;  5AIX A;  1JHB A;  4XCS A;  4LMW A;  4MF7 A;  2X4A A;  2X8H A;  1XWG A;  1OC8 A;  4IQJ M;  5D73 A;  1I5G A;  1X5D A;  5HFG A;  1K0A A;  3TJB A;  2EC4 A;  1BAY A;  1M2D A;  2LUS A;  2B5X A;  4JZQ A;  1G7E A;  3VWU A;  5D9T A;  1KEB A;  5D9W A;  4KCE A;  4G0K A;  1SEN A;  1XW5 A;  2XC2 A;  1YFM A;  2AAW A;  2V1M A;  4KND A;  2LQQ A;  4ZB6 A;  2A2P A;  3APS A;  2ON7 A;  4HI7 A;  5HQP A;  1B4P A;  1PL1 A;  1Z5Y E;  3IA1 A;  4RI6 A;  1HY0 A;  3IK9 A;  1SJZ A;  4V1A p;  3BBY A;  2H0I A;  3HY2 A;  4Z7X A;  3UL3 A;  4NPB A;  4HQS A;  4KAE A;  1I9D A;  3CQF A;  1AUW A;  4KCA A;  3APQ A;  5CAX A;  5L71 A;  3KEB A;  5DQS A;  4MJA A;  1ST9 A;  3UBL A;  4IHU A;  2QGA B;  2OAD A;  5GST A;  4FH8 A;  5HR3 A;  4O5R A;  1EZK A;  2PTQ A;  5ECL B;  2V2G A;  3GHA A;  1GSS A;  5IMD A;  3GTD A;  2E0Q A;  4EDY A;  4NXI A;  1PGT A;  4MK3 A;  1HNC A;  2VLV A;  4E88 A;  5ECK B;  3K8N A;  2ALB A;  3IBH A;  3G7J A;  1TU8 A;  1MEK A;  2R37 A;  4WR5 A;  1XCC A;  1B9Y C;  1GL8 A;  4L6A A;  4GQC A;  4JU5 A;  2YCD A;  1M2A A;  1PN0 A;  2NTO A;  3ZVJ D;  1GTU A;  3TKS E;  5AIV A;  3PIN A;  3NIV A;  2FD3 A;  4BPY A;  1KQ7 A;  3FHK A;  4ACS A;  5ECI B;  1K3Y A;  1SJI A;  1JLW A;  3HZ4 A;  5AN1 A;  1DCN A;  1XFL A;  3EYT A;  1S3C A;  1AC1 A;  3GNJ A;  1ERW A;  3VWV A;  2UZ8 A;  3VPQ A;  4TXV A;  1C3U A;  3TRX A;  2GS3 A;  3R2Q A;  1F9M A;  1X0R A;  2IIY A;  4KSM A;  2FCH A;  4AJ6 A;  3TJF A;  1OE8 A;  4CHS A;  1S3D A;  1ZL9 A;  12GS A;  2I7D A;  1SJ6 A;  3MAK A;  4KDY A;  3F4R A;  1IYI A;  1EV9 A;  1EV4 A;  5DAL A;  2VCQ A;  1U3I A;  2RM5 A;  5F91 A;  4XS6 A;  4JBB A;  1AQX A;  1ZZY A;  3EUR A;  9GSS A;  1AAZ A;  2K6V A;  2FLS A;  6GSU A;  2YV7 A;  3VPT A;  2J23 A;  22GS A;  3R6V A;  4GQF A;  1K0M A;  1TXX A;  3ERW A;  1EWX A;  3GX8 A;  4NAX A;  3PPU A;  2DJJ A;  5IPH A;  1TI1 A;  1U87 A;  1YY7 A;  4I2U A;  1LBK A;  2HNL A;  1R7H A;  3TKR A;  2FNO A;  1WOU A;  2DJK A;  4IVF A;  4X1U A;  1THO A;  2DSA A;  1TJD A;  1WJK A;  1Q5N A;  4MA9 A;  5GAP D;  3KJY A;  4J57 E;  5ECR B;  2CAQ A;  2HZE A;  3RHC A;  4TW5 A;  2WDU A;  2WJU A;  2LRN A;  5JCG A;  2LST A;  2NBS A;  2VCZ A;  4G10 A;  1C72 A;  2CQ9 A;  3TKQ A;  3A3T A;  2R0C A;  1O73 A;  4DSR A;  2JAW A;  3CBU A;  1Z6N A;  5G1L A;  2PTS A;  1V58 A;  3EC3 A;  2HRN A;  3IAS 2;  1WMJ A;  3GTU A;  2LJR A;  2D2Z A;  5IMA A;  1CQG A;  5JCW A;  3Q18 A;  3H1N A;  2GSQ A;  3LOR A;  2GDR A;  4NHZ A;  2C3N A;  1K3L A;  3BOA A;  3EMP A;  3RPP A;  2D27 A;  1AIU A;  2JL4 A;  1J9B A;  1K0N A;  4XIH A;  4EDZ A;  4XS4 A;  4MZC A;  2BMX A;  1HYU A;  1GUM A;  4K7I A;  5DQY A;  2EIO A;  4KDU A;  3M0F A;  2X99 A;  4N0V A;  4WR4 A;  1OC9 A;  4G0I A;  5G2Z A;  2YP6 A;  6GSX A;  2LRT A;  2C0E A;  2R4V A;  4NV2 A;  5ECH B;  4MUM A;  2H73 A;  2AB6 A;  1XWK A;  2ZUP A;  2N5B A;  3KXO A;  5FT3 A;  2ES7 A;  2WRT A;  4KF9 A;  3F3R A;  1PSQ A;  4MCU A;  4EIP A;  2H0G A;  4EC0 A;  4OO5 A;  3GH6 A;  1K7W A;  1M9B A;  1FVK A;  2WZ9 A;  17GS A;  2OBK A;  1PX6 A;  2YPM A;  2TIR A;  3C1S A;  4Q5N A;  3CSH A;  3GUS A;  3TB2 A;  3US3 A;  5BRT A;  4IP1 A;  1WWJ A;  4K5S A;  4JRR A;  4DSQ A;  5KN1 A;  3GYK A;  3P2A A;  5KN0 A;  3GV1 A;  1ZCP A;  3QPM A;  3L9S A;  3IPZ A;  2C0F A;  2VCV A;  2YV5 A;  2MYG A;  2BTO T;  2L6D A;  2OE1 A;  3TKS A;  1K0C A;  4HU7 A;  1Z9H A;  4MJE A;  2DJ2 A;  5ELA A;  3KMN A;  3D6I A;  1ERU A;  4IQA A;  1PL2 A;  5IMC A;  3VI5 A;  3GSS A;  4IS0 A;  1DE1 A;  3R6Q A;  1XW6 A;  2LS5 A;  1U6T A;  4EXJ A;  4TR3 A;  2GTU A;  4MAB A;  2JAD A;  3LYP A;  5ECQ B;  1THX A;  1OVN A;  1N8J A;  3F3Q A;  1TW9 A;  4O32 A;  4K8M A;  1OC3 A;  1DBY A;  1E6B A;  3WT2 A;  1GLP A;  2QA2 A;  2FHE A;  5IQY A;  2YJ7 A;  4K0N A;  4HUA A;  3BCK A;  4NMU A;  4POB A;  2DLX A;  5ECN B;  1YKA A;  3VUR A;  1O85 A;  5IMZ A;  1FB6 A;  2MMZ A;  4O5U A;  1Q91 A;  1R5P A;  3P8W A;  4CW9 A;  4ML1 A;  1GWC A;  4ML6 A;  4RQR A;  1MDK A;  3SWL A;  3I69 A;  3FR6 A;  3IAM 2;  1B4Q A;  3GKX A;  2A4H A;  2HVG A;  2WGR A;  5B6N A;  1EEJ A;  4H86 A;  5LNK e;  1B48 A;  1XZO A;  4X4J A;  1BED A;  1T4Z A;  4GF0 A;  3GKN A;  3C73 A;  1BJX A;  5HR0 A;  3HVV A;  3KP9 A;  2M80 A;  5J9B A;  3MNG A;  4ADL A;  1X5E A;  1YZX A;  5DVB A;  4RUV A;  5CYY A;  3IK7 A;  1SYR A;  4PUF C;  3W8S A;  3IE3 A;  2F3M A;  4IQ1 A;  3KCM A;  3KP8 A;  2E7P A;  4WET A;  1RK4 A;  5KN3 A;  2B5Y A;  1KTE A;  5HFK A;  3F0I A;  2B3S A;  1WP0 A;  1U88 A;  1Z6M A;  3BWV A;  4TXO A;  3ZML A;  4YQU A;  2FA4 A;  2FY6 A;  3GIX A;  3E9J B;  2FUG 2;  1O6J A;  5HR2 A;  4BL7 A;  2H30 A;  2MBS A;  1XWO A;  5KEJ A;  2R0G A;  5F8B A;  3QMX A;  4N0Z A;  1B8X A;  3HVS A;  2GZZ A;  3TKS C;  3MIX A;  2FA8 A;  1SKR B;  3C1R A;  4Q5R A;  5IMV A;  3HCZ A;  1ZYP A;  4J2F A;  4ZL7 A;  1A24 A;  4HU9 A;  3LW9 A;  3IR4 A;  1PFO A;  5CRE A;  1TKD B;  4ZB8 A;  4QL9 A;  1X9W B;  3FZ9 A;  1PMT A;  3G9B A;  4MP4 A;  3RDW A;  4ZL9 A;  3LXZ A;  1VRS D;  4I5Q A;  4MZB A;  1V98 A;  1Z4P X;  4HGV A;  4F82 A;  2H70 A;  4ZB9 A;  3HVN A;  6GSS A;  3ISO A;  4YQM A;  2R6K A;  3DRN A;  1FAA A;  1XVW A;  4HJ2 A;  3LYK A;  1ZYN A;  3DVW A;  4EO3 A;  4KGI A;  2M46 A;  3VFI A;  1SL0 B;  2VOC A;  2VAF A;  2RM6 A;  5HFI A;  1Z4Q A;  2KLX A;  1EGR A;  1ZYQ B;  4YIH A;  4KH7 A;  2L57 A;  4ID0 A;  4ZL8 A;  3Q6O A;  5ECO B;  3W6G A;  5B8A A;  4N11 A;  2JAU A;  4BVX A;  4PQH A;  3IDV A;  3KIJ A;  2L4C A;  4KB3 A;  1JZW A;  3ZFB A;  4I8B A;  2HRK A;  2K8S A;  2YWN A;  5COH A;  2KOK A;  4TN8 A;  1EGO A;  2GZP A;  5F92 A;  2PUK C;  1ERV A;  2R3X A;  4HZ2 A;  1ZGN A;  3EMX A;  2WS2 A;  1UC7 A;  1FB0 A;  2DKI A;  3BHG A;  1SK0 A;  2GSR A;  1BYE A;  2VLU A;  3OR5 A;  3A2X A;  5JCU A;  2EIR A;  3H4K A;  5IPG A;  1VF4 A;  1O81 A;  3MSZ A;  1PN9 A;  3QR6 A;  2I3Y A;  1VDK A;  5IMF A;  3DVX A;  2K18 A;  4X0X A;  2X8G A;  2R0P A;  5JWQ B;  1FVJ A;  2WB9 A;  5CNW A;  2CZ3 A;  5CRH A;  2HSM A;  4NSL A;  3D5J A;  4F0C A;  4GWR A;  3CTG A;  5KOX A;  5ID2 B;  3HJO A;  4NV5 A;  3QAG A;  2LJA A;  3TRQ A;  2IJY A;  4DSS B;  2PVQ A;  3F6F A;  3P90 A;  1WIK A;  3D0Z A;  4KSO A;  3TCO A;  5IM9 A;  4EEI A;  1DE2 A;  1TRU A;  3UIW A;  4APB A;  4PNF A;  3TUE A;  3L78 A;  1T3B A;  5B7C A;  2GT5 A;  4PX1 A;  3U6V A;  2J9H A;  3GRX A;  5A5K A;  1AQW A;  4EUY A;  3HHV A;  3FMW A;  2H6Z A;  2OE0 A;  2N5F A;  2YWM A;  1A2M A;  4BVY B;  1TU7 A;  1GNW A;  2LTK A;  1Q92 A;  1OAZ A;  4O5Q A;  3DGQ A;  4I6X A;  1TJ7 A;  1SK1 A;  3GST A;  3FZ4 A;  1USB A;  3TKP A;  1DSB A;  4IP6 A;  1RQM A;  1SL1 B;  1F3B A;  3CMI A;  1DOF A;  18GS A;  2VCX A;  4PXO A;  1EEM A;  5HR1 A;  1X9S B;  4RI7 A;  1FUP A;  4HOJ A;  3WYW A;  1VF1 A;  1PKW A;  2R2J A;  2KP1 A;  5CRW A;  3IHG A;  2HLS A;  5C00 A;  3QDN A;  3KZQ A;  3TV2 A;  2LRC A;  3CSJ A;  1C3C A;  4NLE A;  2HSY A;  2VCT A;  1TRV A;  4D73 B;  2L6C A;  3ZTL A;  3GX0 A;  5E59 A;  2OJL A;  3CXG A;  1A0R P;  3DD3 A;  1Z4K A;  3TGZ A;  1NM3 A;  1X5C A;  3ERG A;  1EP7 A;  1O8W A;  2H74 A;  4OCF A;  4APA A;  1N2A A;  2IFQ A;  3KM6 A;  4WF5 A;  5EVO A;  1TOF A;  4O92 A;  5FHI A;  2IMI A;  4CY8 A;  1XIY A;  2BJX A;  5A4U A;  2GST A;  2HRF A;  2XPD A;  4ZIL A;  4Q5Q A;  2NDO A;  4FYB A;  1ZOF A;  1ACV A;  4MPG A;  2G2Q A;  3EU3 A;  3TJK A;  2WUL A;  1NW2 A;  1M2B A;  4ZBD A;  2JAR A;  1VF2 A;  3GUR A;  1XWC A;  4OWY A;  1TJU A;  4MF6 A;  3TJJ A;  1YDK A;  5EY6 A;  3FZ5 A;  5A4W A;  3QOU A;  3RAZ A;  1FUQ A;  2N5A A;  3TRP A;  4L0U A;  1MDJ A;  3EIN A;  3OCF A;  4PGT A;  4AF2 A;  5GSS A;  1PKZ A;  1PA3 A;  2PMT A;  2CV4 A;  3KD0 A;  2C3T A;  3EWL A;  1X9M B;  3O6T A;  1GSQ A;  3TOU A;  4CDO A;  1R26 A;  1LU4 A;  2VM2 A;  4E8E A;  2H1G A;  3Q19 A;  2B7K A;  3HD5 A;  3DIE A;  3I6A A;  3ZZX A;  2O85 A;  2CVD A;  2IL3 A;  3H93 A;  2QSI A;  4AGS A;  4K2D A;  3QCP A;  4BIK A;  1GTB A;  4WEY A;  4ZBA A;  1XW9 A;  4XRD A;  3RBT A;  2A2S A;  2RII A;  4BWQ A;  4MF5 A;  3RPN A;  2QA1 A;  3QAW A;  4YAV A;  1UVZ A;  5LCZ A;  1S3R A;  3LXT A;  1XXU A;  1G7O A;  1A0F A;  2DC5 A;  4EFC A;  3DXB A;  4IEL A;  3GMF A;  1KBN A;  2F9S A;  1FOV A;  2AUV A;  2MMA A;  1JSW A;  3FW2 A;  4IJI A;  1M99 A;  3EU4 A;  4EVM A;  4K1F A;  1WPI A;  3UVT A;  1Y25 A;  5HW2 A;  2HXK A;  3WGX A;  2DJ1 A;  2YNX A;  3QD9 A;  3M3M A;  3L9U A;  3DEX A;  3VWX A;  3UAR A;  1URM A;  5J4U A;  1H75 A;  3CRT A;  5H5R A;  4TR1 A;  2GLR A;  1ZYE A;  1B9X C;  3VI7 A;  2V6O A;  3A5W A;  2E2M A;  1SD9 A;  1A2J A;  2ZNM A;  2VLT A;  1UA5 A;  4V2L A;  4WBR D;  1QFN A;  3W8J A;  5ECM B;  3OCE A;  4BWS A;  3GKK A;  2WCI A;  1Z3E A;  1XVQ A;  1XWA A;  4BA7 A;  1TK0 B;  2GT6 A;  1TRW A;  4GLT A;  3TJG A;  8GSS A;  4WXT A;  2C8U A;  3L9V A;  4YKF A;  3FR9 A;  3J7Y b;  1SL2 B;  3I43 A;  1YKC A;  4PUR A;  1G6Y A;  4MPF A;  11GS A;  3HJP A;  5D8I A;  2CVB A;  1TP9 A;  3ERF A;  1GSY A;  1SK2 A;  5B6M A;  2HSH A;  1SD8 A;  1JFU A;  5EL8 A;  2H66 A;  5DAL B;  3UOM A;  1BG5 A;  1MTC A;  2HFD A;  5A4V A;  3CI0 K;  2GSS A;  2O8V B;  4OO4 A;  10GS A;  3G7Y A;  3PGT A;  5ECP B;  1TRS A;  2K9F A;  1QGV A;  2FWG A;  2X49 A;  4POK A;  1Z7R A;  4EKZ A;  2PWJ A;  3WD6 A;  4EIQ A;  1Q98 A;  1XOB A;  4P3Y B;  1OKD A;  4F2I A;  1I0A A;  5IOX A;  2JAO A;  4G19 A;  4GXZ A;  1VF3 A;  4F03 A;  2MMO A;  2F51 A;  2F8F A;  6GST A;  1T9H A;  3MYD A;  1PD2 1;  2R5G A;  4G2E A;  1NHY A;  3QAV A;  2H01 A;  3LEF A;  2AJQ B;  3ZRE A;  4JR6 A;  4HJM A;  4Z2R A;  4WF4 A;  5D96 A;  2X64 A;  2LNS A;  1YEP A;  2OKA A;  3AY8 A;  4I97 A;  5GZZ B;  2B7J A;  2YWI A;  4TOP A;  5IO0 A;  4K2X A;  1TK5 B;  2VD1 A;  4ZBB A;  2PBJ A;  1SKS B;  4XRA A;  2F8A A;  5J41 A;  4GRF A;  5DDL A;  3PH9 A;  1IYH A;  2JSY A;  5D9X A;  4MLY A;  4ECJ A;  1XG8 A;  4BVY A;  4YKG A;  4E8H A;  5F07 A;  4K6X A;  2DJ3 A;  3GTU B;  3U13 A;  3IC4 A;  1U0L A;  1A2L A;  2HYX A;  2FWE A;  2PN8 A;  2MBT A;  2PFM A;  19GS A;  4K7N A;  1QQ2 A;  5DJL A;  2B5E A;  5JWR B;  2LEG A;  1EOH A;  4IKH A;  5FWG A;  2GVP A;  4NWY A;  1WE0 A;  1GP1 A;  2H1B A;  5H5S A;  3F4T A;  2H75 A;  1ML6 A;  1JZR A;  4HZ4 A;  4ECB A;  1OC9 B;  3ZIT A;  2KUC A;  3A5I A;  4I2T A;  1F6M C;  2FUS A;  5GAN D;  6GSW A;  3DYR A;  2GZY A;  3F9U A;  3CTF A;  2YZU A;  5DBQ A;  2CZ2 A;  3IHQ A;  4NHW A;  1PRX A;  3FKF A;  3UJ1 A;  5IO2 A;  2VD0 A;  3HKR A; 
#chains in the Genus database with same CATH homology
 4L5O A;  5B8B A;  5IOW A;  5J5N A;  1GUK A;  3DML A;  2H1D A;  1ILO A;  4QQ7 A;  3D21 A;  1T1V A;  2L5L A;  4L5L A;  3D22 A;  1JLV A;  1CQH A;  1HD2 A;  2P5R A;  2NPB A;  1GLQ A;  3F4S A;  4YH2 A;  3FY7 A;  1V9W A;  4OFT A;  1A8L A;  1SYX A;  1FG4 A;  4G9H A;  3U5R E;  3HJM A;  3TOT A;  4FO5 A;  4KW6 A;  2DBC A;  2REM A;  1XBS A;  2CAI A;  3O3T A;  1AQV A;  2X8C A;  2Z9S A;  6GSV A;  3KGK A;  3WT1 A;  1W89 A;  2JZS A;  3KH7 A;  1ABA A;  3F8U A;  3VK9 A;  4MZW A;  2WFC A;  2JZR A;  3NOF A;  3VWW A;  3ZMK A;  4HS1 A;  4XTS A;  4G0L A;  1BQ7 A;  1V40 A;  2XPE A;  2ZCT A;  1A8Y A;  5CO3 A;  1UN2 A;  1JZO A;  4GTU A;  1T7P B;  2H8L A;  2I1U A;  3UBK A;  4ECI A;  2H1A A;  2PER A;  3G7I A;  3I9V 2;  3LJR A;  3MDK A;  4J56 E;  4L8E A;  5F06 A;  4ZXG A;  1OYJ A;  4MMM A;  4JED A;  5ABR A;  4PNG A;  2B1K A;  2G0F A;  1GSF A;  4QL7 A;  4N10 A;  5G5F A;  2H6Y A;  4GCI A;  1AW9 A;  4HDE A;  7GSS A;  3KH9 A;  2I9H A;  4GSN A;  4FIW A;  1YF0 A;  3HDC A;  4GST A;  3HA9 A;  2MMN A;  2YV9 A;  2KHP A;  1FO5 A;  3KMO A;  2JU5 A;  3M9J A;  5JWO B;  2DIY A;  3APO A;  4EE0 A;  5DJM A;  3N9J A;  2IMK A;  5DAK B;  2QC7 A;  2AV4 A;  2H76 A;  2YZH A;  1QUW A;  3NZN A;  3C7M A;  2C1Y A;  1J08 A;  2HRA A;  3M1G A;  4MH2 A;  2PVO C;  2H19 A;  1XWB A;  3A2W A;  2L5O A;  4KX4 A;  20GS A;  5CP1 A;  4AJ7 A;  4TR0 A;  2YJH A;  3R3E A;  3FR3 A;  3IV4 A;  1GTA A;  3QFA C;  1GUH A;  3GN3 A;  2OA7 A;  1F3A A;  1WRY A;  3VLN A;  3ZRD A;  2RUF A;  1H4O A;  5E4W A;  1AXD A;  5INY A;  4HEA 2;  1XOA A;  2P5Q A;  4V2M A;  3P7X A;  5G30 A;  3ME7 A;  1K0O A;  2HT9 A;  2C0G A;  1V2A A;  5IIZ A;  2M72 A;  1ON4 A;  3HYP A;  4K7O A;  3UVH A;  1T4Y A;  4TXO B;  1QXH A;  1ERT A;  2C3Q A;  2DMM A;  2YN1 A;  2L4Q A;  3V1W A;  1DUG A;  2CX3 A;  2LNT A;  2VCW A;  4BL7 B;  4TVE A;  4IJ3 A;  1BX9 A;  1SU9 A;  4POL A;  3IXR A;  3WGE A;  2LJK A;  4WBJ A;  4HQZ A;  4X43 A;  3JCM L;  3FEU A;  2JAC A;  4OD7 A;  4XS1 A;  1MD4 A;  1QK8 A;  2GGT A;  1YJ6 A;  4OCE A;  2D28 C;  3Q74 A;  2GQL A;  4K5R A;  3UMA A;  3HVX A;  5F0G A;  1TK8 B;  4IBP A;  1NSW A;  4YAP A;  2O87 A;  3LG6 A;  4USS A;  2E2G A;  1YF1 A;  5F05 A;  2C80 A;  1K0B A;  4ISD A;  1GTI A;  1GSE A;  1R5A A;  2JZT A;  4A5P A;  3IC8 A;  3BD2 A;  3IRA A;  3SBC A;  2P0G A;  3ZVJ A;  3C71 A;  1F2E A;  2XBQ A;  2ON5 A;  5G5E A;  3DKS A;  4BVX B;  3ZYW A;  2IME A;  1HNB A;  3FK8 A;  2IWT A;  3S9F A;  3ZLP A;  4ICY A;  3GKM A;  3KTB A;  1W4V A;  1SKW B;  1O8X A;  3CRU A;  3GH9 A;  5AIS A;  1TI3 A;  2O7K A;  2H6X A;  1GRX A;  2FWH A;  2YWO A;  4IN0 A;  4CY6 A;  4MDC A;  3H8Q A;  4LMV A;  5EPF A;  3IOS A;  1M0U A;  2DJ0 A;  2VL9 A;  2FWF A;  5D93 A;  2DIZ A;  5CRG A;  3M8N A;  2PU9 C;  1Z7P A;  2I4A A;  2TRX A;  3LQ7 A;  4ZIJ A;  4IGJ A;  3MWH A;  1HQO A;  3EPT A;  1O7U A;  1T00 A;  4JR4 A;  2PPT A;  3ED3 A;  2VL2 A;  2GQM A;  3E3E A;  2VIM A;  4EF0 A;  4XHM A;  4WKW A;  4GSS A;  2AYT A;  5KOW A;  2QGV A;  3GL3 A;  4ECC A;  4LLR A;  5KN2 A;  3LFL A;  2TRC P;  2RUE A;  4TR4 A;  1LJR A;  3J7Y k;  1PX7 A;  1Y6E A;  5AGY A;  3RHB A;  2VO4 A;  2P31 A;  2CA8 A;  2AHE A;  2YOI A;  4POM A;  4Z2U A;  4KUN A;  1KNG A;  2K8V A;  3ZL5 A;  2IMD A;  1M7T A;  3F63 A;  3FYG A;  4FQU A;  2RLI A;  2VL3 A;  2YAN A;  2NVL A;  1HNA A;  4L0W A;  4PQI A;  5D9V A;  1AUC A;  3HXS A;  2XHF A;  1RW1 A;  1VGL A;  2HI7 A;  2VM1 A;  4MJB A;  3CYN A;  2DML A;  3QFB C;  1ZMA A;  4F9Z A;  2HE3 A;  1MDI A;  2V6K A;  3PR8 A;  4DEJ A;  1IW7 D;  1QMV A;  1A23 A;  2FGX A;  3CSI A;  14GS A;  4AJ8 A;  1OKT A;  2CT6 A;  5G31 A;  1FW1 A;  6GSY A;  13GS A;  2V32 A;  3EE2 A;  5ENU A;  2H71 A;  3FRC A;  2L59 A;  1OE7 A;  2B6M A;  2XBI A;  3BCI A;  3UEM A;  4LA1 A;  5BMU A;  3GFK A;  4KE3 A;  3UAP A;  4ILF A;  5ECS A;  1PQN A;  4EL1 A;  4LL4 B;  4MJC A;  4Z2T A;  3LSZ A;  2A4V A;  1R4W A;  2IFQ B;  1JZD A;  1G6W A;  2LV3 A;  2HZF A;  2MZC A;  5ID2 A;  4FYC A;  2DKH A;  3GA4 A;  4IW9 A;  4DVC A;  4V1A g;  4O7H A;  1YEX A;  4LL1 B;  4K9Z A;  1S3A A;  3ME8 A;  4V2N A;  3O76 A;  4OMV A;  4DSS A;  1FHE A;  3L4N A;  5DCH A;  3ZIJ A;  3D4M A;  5DAK A;  2KP2 A;  4TKY A;  2HZE B;  2VL2 C;  3F6D A;  1K0D A;  3A2V A;  2IPA A;  2OBI A;  1MD3 A;  3LGC A;  5DCG A;  2OE3 A;  2O89 A;  2H0H A;  4ULX A;  1GNE A;  3N5O A;  4Q5F A;  4OFN A;  4YQV A;  1XPV A;  2JSZ A;  1G0T A;  4F0B A;  3EVI A;  1E2Y A;  1U3A A;  1EOG A;  1V57 A;  3HZ8 A;  2H72 A;  2B1L A;  16GS A;  2PGT A;  4KA0 A;  1Q4J A;  1GSD A;  5LD0 A;  3H79 A;  1F37 A;  4XS4 B;  2A2R A;  5C04 A;  3WGD A;  2EIQ A;  3M9K A;  3C8E A;  2C0D A;  1NHO A;  1M9A A;  2QKE A;  3TDG A;  2LQO A;  2VUP A;  1TDI A;  4MH3 A;  2V41 A;  4KDX A;  3BJ5 A;  4JE1 A;  4N30 A;  5J3R A;  1GUL A;  4K0G A;  3L0H A;  4D73 A;  4FYU A;  1K3O A;  1FOH A;  3E0U A;  2CVK A;  4RQX A;  3D4T A;  2IMF A;  3ZIV A;  5CRD A;  4MNN A;  1GH2 A;  1T8E B;  2C4J A;  3GL5 A;  3FZA A;  1TTZ A;  3DWV A;  1J0F A;  4TRX A;  2CX4 A;  1YQ1 A;  3ZFL A;  3KTL A;  2OAC A;  4OFM A;  4PUA A;  4PQ1 A;  2LKU A;  4TR1 B;  4PTS A;  1EP8 A;  3LWA A;  1GSU A;  5H5Q A;  5ELG A;  2I81 A;  5J9C A;  2IN3 A;  5G1K A;  2GQK A;  5AIX A;  1JHB A;  4XCS A;  4LMW A;  4MF7 A;  2X4A A;  2X8H A;  1XWG A;  1OC8 A;  4IQJ M;  5D73 A;  1I5G A;  1X5D A;  5HFG A;  1K0A A;  3TJB A;  2EC4 A;  1BAY A;  1M2D A;  2LUS A;  2B5X A;  4JZQ A;  1G7E A;  3VWU A;  5D9T A;  1KEB A;  5D9W A;  4KCE A;  4G0K A;  1SEN A;  1XW5 A;  2XC2 A;  2AAW A;  2V1M A;  4KND A;  2LQQ A;  4ZB6 A;  2A2P A;  3APS A;  2ON7 A;  4HI7 A;  5HQP A;  1B4P A;  1PL1 A;  1Z5Y E;  3IA1 A;  4RI6 A;  3IK9 A;  1SJZ A;  4V1A p;  3BBY A;  2H0I A;  3HY2 A;  4Z7X A;  3UL3 A;  4NPB A;  4HQS A;  4KAE A;  1I9D A;  4KCA A;  3APQ A;  5CAX A;  5L71 A;  3KEB A;  5DQS A;  4MJA A;  1ST9 A;  3UBL A;  4IHU A;  2OAD A;  5GST A;  4FH8 A;  5HR3 A;  4O5R A;  1EZK A;  5ECL B;  2V2G A;  3GHA A;  1GSS A;  5IMD A;  2E0Q A;  4EDY A;  4NXI A;  1PGT A;  4MK3 A;  1HNC A;  2VLV A;  5ECK B;  3K8N A;  2ALB A;  3IBH A;  3G7J A;  1TU8 A;  1MEK A;  2R37 A;  4WR5 A;  1XCC A;  1B9Y C;  1GL8 A;  4GQC A;  4JU5 A;  2YCD A;  1M2A A;  1PN0 A;  2NTO A;  3ZVJ D;  1GTU A;  3TKS E;  5AIV A;  3PIN A;  3NIV A;  2FD3 A;  4BPY A;  3FHK A;  4ACS A;  5ECI B;  1K3Y A;  1SJI A;  1JLW A;  3HZ4 A;  5AN1 A;  1XFL A;  3EYT A;  1S3C A;  1AC1 A;  3GNJ A;  1ERW A;  3VWV A;  2UZ8 A;  3VPQ A;  4TXV A;  3TRX A;  2GS3 A;  3R2Q A;  1F9M A;  1X0R A;  2IIY A;  4KSM A;  2FCH A;  4AJ6 A;  3TJF A;  1OE8 A;  4CHS A;  1S3D A;  1ZL9 A;  12GS A;  1SJ6 A;  3MAK A;  4KDY A;  3F4R A;  1IYI A;  1EV9 A;  1EV4 A;  5DAL A;  2VCQ A;  1U3I A;  2RM5 A;  4XS6 A;  4JBB A;  1AQX A;  1ZZY A;  3EUR A;  9GSS A;  1AAZ A;  2K6V A;  2FLS A;  6GSU A;  2YV7 A;  3VPT A;  2J23 A;  22GS A;  4GQF A;  1K0M A;  1TXX A;  3ERW A;  1EWX A;  3GX8 A;  4NAX A;  3PPU A;  2DJJ A;  5IPH A;  1TI1 A;  1U87 A;  1YY7 A;  4I2U A;  1LBK A;  2HNL A;  1R7H A;  3TKR A;  2FNO A;  1WOU A;  2DJK A;  4IVF A;  4X1U A;  1THO A;  2DSA A;  1TJD A;  1WJK A;  4MA9 A;  5GAP D;  3KJY A;  4J57 E;  5ECR B;  2CAQ A;  2HZE A;  3RHC A;  4TW5 A;  2WDU A;  2WJU A;  2LRN A;  5JCG A;  2LST A;  2NBS A;  2VCZ A;  4G10 A;  1C72 A;  2CQ9 A;  3TKQ A;  3A3T A;  2R0C A;  1O73 A;  4DSR A;  3CBU A;  1Z6N A;  5G1L A;  1V58 A;  3EC3 A;  2HRN A;  3IAS 2;  1WMJ A;  3GTU A;  2LJR A;  2D2Z A;  5IMA A;  1CQG A;  5JCW A;  3Q18 A;  3H1N A;  2GSQ A;  3LOR A;  2GDR A;  4NHZ A;  2C3N A;  1K3L A;  3BOA A;  3EMP A;  3RPP A;  2D27 A;  1AIU A;  2JL4 A;  1J9B A;  1K0N A;  4XIH A;  4EDZ A;  4XS4 A;  4MZC A;  2BMX A;  1HYU A;  1GUM A;  4K7I A;  5DQY A;  2EIO A;  4KDU A;  3M0F A;  2X99 A;  4N0V A;  4WR4 A;  1OC9 A;  4G0I A;  5G2Z A;  2YP6 A;  6GSX A;  2LRT A;  2C0E A;  2R4V A;  4NV2 A;  5ECH B;  2H73 A;  2AB6 A;  1XWK A;  2ZUP A;  2N5B A;  3KXO A;  5FT3 A;  2ES7 A;  2WRT A;  4KF9 A;  3F3R A;  1PSQ A;  4MCU A;  4EIP A;  2H0G A;  4EC0 A;  4OO5 A;  3GH6 A;  1M9B A;  2WZ9 A;  1FVK A;  17GS A;  2OBK A;  1PX6 A;  2YPM A;  2TIR A;  3C1S A;  4Q5N A;  3CSH A;  3GUS A;  3TB2 A;  3US3 A;  5BRT A;  4IP1 A;  1WWJ A;  4K5S A;  4JRR A;  4DSQ A;  5KN1 A;  3GYK A;  3P2A A;  5KN0 A;  3GV1 A;  1ZCP A;  3QPM A;  3L9S A;  3IPZ A;  2C0F A;  2VCV A;  2MYG A;  2BTO T;  2L6D A;  2OE1 A;  3TKS A;  1K0C A;  4HU7 A;  1Z9H A;  4MJE A;  2DJ2 A;  5ELA A;  3KMN A;  3D6I A;  1ERU A;  4IQA A;  1PL2 A;  5IMC A;  3VI5 A;  3GSS A;  4IS0 A;  1DE1 A;  1XW6 A;  2LS5 A;  1U6T A;  4EXJ A;  4TR3 A;  2GTU A;  4MAB A;  2JAD A;  3LYP A;  5ECQ B;  1THX A;  1OVN A;  1N8J A;  3F3Q A;  1TW9 A;  4O32 A;  4K8M A;  1OC3 A;  1DBY A;  1E6B A;  3WT2 A;  1GLP A;  2QA2 A;  2FHE A;  5IQY A;  2YJ7 A;  4K0N A;  4HUA A;  3BCK A;  4NMU A;  4POB A;  2DLX A;  5ECN B;  1YKA A;  3VUR A;  1O85 A;  5IMZ A;  1FB6 A;  2MMZ A;  4O5U A;  1R5P A;  3P8W A;  4CW9 A;  4ML1 A;  1GWC A;  4ML6 A;  4RQR A;  1MDK A;  3SWL A;  3I69 A;  3FR6 A;  3IAM 2;  1B4Q A;  3GKX A;  2A4H A;  2WGR A;  5B6N A;  1EEJ A;  4H86 A;  5LNK e;  1B48 A;  1XZO A;  4X4J A;  1BED A;  1T4Z A;  4GF0 A;  3GKN A;  3C73 A;  1BJX A;  5HR0 A;  3HVV A;  3KP9 A;  2M80 A;  5J9B A;  3MNG A;  1X5E A;  1YZX A;  5DVB A;  4RUV A;  5CYY A;  3IK7 A;  1SYR A;  4PUF C;  3W8S A;  3IE3 A;  2F3M A;  4IQ1 A;  3KCM A;  3KP8 A;  2E7P A;  4WET A;  1RK4 A;  5KN3 A;  2B5Y A;  1KTE A;  5HFK A;  3F0I A;  2B3S A;  1WP0 A;  1U88 A;  1Z6M A;  4TXO A;  3ZML A;  4YQU A;  2FA4 A;  2FY6 A;  3GIX A;  3E9J B;  2FUG 2;  1O6J A;  5HR2 A;  4BL7 A;  2H30 A;  2MBS A;  5KEJ A;  2R0G A;  5F8B A;  3QMX A;  4N0Z A;  1B8X A;  3HVS A;  2GZZ A;  3TKS C;  3MIX A;  2FA8 A;  1SKR B;  3C1R A;  4Q5R A;  5IMV A;  3HCZ A;  1ZYP A;  4J2F A;  4ZL7 A;  1A24 A;  4HU9 A;  3LW9 A;  3IR4 A;  5CRE A;  1TKD B;  4ZB8 A;  4QL9 A;  1X9W B;  3FZ9 A;  1PMT A;  3G9B A;  4MP4 A;  3RDW A;  4ZL9 A;  3LXZ A;  1VRS D;  4I5Q A;  4MZB A;  1V98 A;  4F82 A;  2H70 A;  4ZB9 A;  6GSS A;  3ISO A;  4YQM A;  2R6K A;  3DRN A;  1FAA A;  1XVW A;  4HJ2 A;  3LYK A;  1ZYN A;  3DVW A;  4EO3 A;  4KGI A;  2M46 A;  3VFI A;  1SL0 B;  2VOC A;  2VAF A;  2RM6 A;  5HFI A;  2KLX A;  1EGR A;  1ZYQ B;  4KH7 A;  2L57 A;  4ID0 A;  4ZL8 A;  3Q6O A;  5ECO B;  3W6G A;  5B8A A;  4N11 A;  4BVX A;  4PQH A;  3IDV A;  3KIJ A;  2L4C A;  4KB3 A;  1JZW A;  3ZFB A;  4I8B A;  2HRK A;  2K8S A;  2YWN A;  5COH A;  2KOK A;  4TN8 A;  1EGO A;  2GZP A;  2PUK C;  1ERV A;  2R3X A;  4HZ2 A;  1ZGN A;  3EMX A;  2WS2 A;  1UC7 A;  1FB0 A;  2DKI A;  1SK0 A;  2GSR A;  1BYE A;  2VLU A;  3OR5 A;  3A2X A;  5JCU A;  2EIR A;  3H4K A;  5IPG A;  1VF4 A;  1O81 A;  3MSZ A;  1PN9 A;  3QR6 A;  2I3Y A;  5IMF A;  3DVX A;  2K18 A;  4X0X A;  2X8G A;  2R0P A;  5JWQ B;  1FVJ A;  2WB9 A;  5CNW A;  2CZ3 A;  5CRH A;  2HSM A;  3D5J A;  4F0C A;  4GWR A;  3CTG A;  5KOX A;  5ID2 B;  3HJO A;  4NV5 A;  3QAG A;  2LJA A;  3TRQ A;  2IJY A;  4DSS B;  2PVQ A;  3F6F A;  3P90 A;  1WIK A;  3D0Z A;  4KSO A;  3TCO A;  5IM9 A;  1DE2 A;  1TRU A;  3UIW A;  4PNF A;  3TUE A;  3L78 A;  1T3B A;  5B7C A;  2GT5 A;  4PX1 A;  3U6V A;  2J9H A;  3GRX A;  5A5K A;  1AQW A;  4EUY A;  3HHV A;  3FMW A;  2H6Z A;  2OE0 A;  2N5F A;  2YWM A;  1A2M A;  4BVY B;  1TU7 A;  1GNW A;  2LTK A;  1OAZ A;  4O5Q A;  3DGQ A;  4I6X A;  1SK1 A;  3GST A;  3FZ4 A;  1USB A;  3TKP A;  1DSB A;  4IP6 A;  1RQM A;  1SL1 B;  1F3B A;  3CMI A;  18GS A;  2VCX A;  4PXO A;  1EEM A;  5HR1 A;  1X9S B;  4RI7 A;  4HOJ A;  3WYW A;  1VF1 A;  1PKW A;  2R2J A;  2KP1 A;  5CRW A;  3IHG A;  2HLS A;  5C00 A;  3QDN A;  3KZQ A;  3CSJ A;  2LRC A;  2HSY A;  2VCT A;  1TRV A;  4D73 B;  2L6C A;  3ZTL A;  3GX0 A;  5E59 A;  2OJL A;  3CXG A;  1A0R P;  3DD3 A;  3TGZ A;  1NM3 A;  1X5C A;  3ERG A;  1EP7 A;  1O8W A;  2H74 A;  4OCF A;  1N2A A;  2IFQ A;  3KM6 A;  4WF5 A;  5EVO A;  1TOF A;  4O92 A;  5FHI A;  2IMI A;  4CY8 A;  1XIY A;  2BJX A;  5A4U A;  2GST A;  2HRF A;  2XPD A;  4ZIL A;  4Q5Q A;  2NDO A;  4FYB A;  1ZOF A;  1ACV A;  4MPG A;  2G2Q A;  3EU3 A;  3TJK A;  2WUL A;  1NW2 A;  1M2B A;  4ZBD A;  1VF2 A;  3GUR A;  1XWC A;  4OWY A;  4MF6 A;  3TJJ A;  1YDK A;  5EY6 A;  3FZ5 A;  5A4W A;  3QOU A;  3RAZ A;  2N5A A;  3TRP A;  4L0U A;  1MDJ A;  3EIN A;  4PGT A;  4AF2 A;  5GSS A;  1PKZ A;  1PA3 A;  2PMT A;  2CV4 A;  3KD0 A;  2C3T A;  3EWL A;  1X9M B;  3O6T A;  1GSQ A;  3TOU A;  4CDO A;  1R26 A;  1LU4 A;  2VM2 A;  4E8E A;  2H1G A;  3Q19 A;  2B7K A;  3HD5 A;  3DIE A;  3I6A A;  3ZZX A;  2O85 A;  2CVD A;  2IL3 A;  3H93 A;  2QSI A;  4AGS A;  4K2D A;  3QCP A;  1GTB A;  4WEY A;  4ZBA A;  1XW9 A;  4XRD A;  3RBT A;  2A2S A;  2RII A;  4BWQ A;  4MF5 A;  3RPN A;  2QA1 A;  3QAW A;  4YAV A;  1UVZ A;  5LCZ A;  3LXT A;  1XXU A;  1G7O A;  1A0F A;  2DC5 A;  3DXB A;  4IEL A;  3GMF A;  1KBN A;  2F9S A;  1FOV A;  2AUV A;  2MMA A;  3FW2 A;  4IJI A;  1M99 A;  3EU4 A;  4EVM A;  4K1F A;  1WPI A;  3UVT A;  1Y25 A;  2HXK A;  3WGX A;  2DJ1 A;  2YNX A;  3QD9 A;  3M3M A;  3L9U A;  3DEX A;  3VWX A;  3UAR A;  1URM A;  5J4U A;  1H75 A;  3CRT A;  5H5R A;  4TR1 A;  2GLR A;  1ZYE A;  1B9X C;  3VI7 A;  2V6O A;  3A5W A;  2E2M A;  1SD9 A;  1A2J A;  2ZNM A;  2VLT A;  1UA5 A;  4V2L A;  4WBR D;  1QFN A;  3W8J A;  5ECM B;  4BWS A;  3GKK A;  2WCI A;  1Z3E A;  1XVQ A;  1XWA A;  4BA7 A;  1TK0 B;  2GT6 A;  1TRW A;  4GLT A;  3TJG A;  8GSS A;  4WXT A;  2C8U A;  3L9V A;  4YKF A;  3FR9 A;  3J7Y b;  1SL2 B;  3I43 A;  1YKC A;  4PUR A;  1G6Y A;  4MPF A;  11GS A;  3HJP A;  5D8I A;  2CVB A;  1TP9 A;  3ERF A;  1GSY A;  1SK2 A;  5B6M A;  2HSH A;  1SD8 A;  1JFU A;  5EL8 A;  2H66 A;  5DAL B;  3UOM A;  1BG5 A;  1MTC A;  2HFD A;  5A4V A;  2GSS A;  2O8V B;  4OO4 A;  10GS A;  3G7Y A;  3PGT A;  5ECP B;  1TRS A;  2K9F A;  1QGV A;  2FWG A;  2X49 A;  4POK A;  1Z7R A;  4EKZ A;  2PWJ A;  3WD6 A;  4EIQ A;  1Q98 A;  1XOB A;  4P3Y B;  1OKD A;  4F2I A;  5IOX A;  4G19 A;  4GXZ A;  1VF3 A;  4F03 A;  2MMO A;  2F51 A;  2F8F A;  6GST A;  3MYD A;  1PD2 1;  2R5G A;  4G2E A;  1NHY A;  3QAV A;  2H01 A;  3LEF A;  2AJQ B;  3ZRE A;  4JR6 A;  4HJM A;  4Z2R A;  4WF4 A;  5D96 A;  2LNS A;  2X64 A;  1YEP A;  2OKA A;  3AY8 A;  4I97 A;  5GZZ B;  2B7J A;  2YWI A;  4TOP A;  5IO0 A;  4K2X A;  1TK5 B;  2VD1 A;  4ZBB A;  2PBJ A;  1SKS B;  4XRA A;  2F8A A;  5J41 A;  4GRF A;  5DDL A;  3PH9 A;  1IYH A;  2JSY A;  5D9X A;  4MLY A;  4ECJ A;  4BVY A;  4YKG A;  4E8H A;  5F07 A;  4K6X A;  2DJ3 A;  3GTU B;  3IC4 A;  1A2L A;  2HYX A;  2FWE A;  2PN8 A;  2MBT A;  19GS A;  4K7N A;  1QQ2 A;  5DJL A;  2B5E A;  5JWR B;  2LEG A;  1EOH A;  4IKH A;  5FWG A;  2GVP A;  4NWY A;  1WE0 A;  1GP1 A;  2H1B A;  5H5S A;  3F4T A;  2H75 A;  1ML6 A;  1JZR A;  4HZ4 A;  4ECB A;  1OC9 B;  3ZIT A;  2KUC A;  3A5I A;  4I2T A;  1F6M C;  5GAN D;  6GSW A;  3DYR A;  2GZY A;  3F9U A;  3CTF A;  2YZU A;  5DBQ A;  2CZ2 A;  3IHQ A;  4NHW A;  1PRX A;  3FKF A;  3UJ1 A;  5IO2 A;  2VD0 A;  3HKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...