3F4TA

Crystal structure of wolbachia pipientis alpha-dsba1 c97a/c146a
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
200
structure length
200
Chain Sequence
ITSNELLLPLPNDKLLGDPKAPILMIEYASLTCYHCSLFHRNVFPKIKEKYIDTGKMLYIFRHFPLDYRGLKAAMLSHAYEKQEDYFNFNKAVFNSIDSWNYYNLSDLTLLQRIAALSNLKQDAFNQAINDKKIMDKIVNDKSLAINKLGITATPIFFIKLNDDKSYIEHNKVKHGGYKELKYFTNVIDKLYGKAIVKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of the Oxidoreductase alpha-DsbA1 from Wolbachia pipientis
pubmed doi rcsb
source organism Wolbachia pipientis
molecule tags Oxidoreductase
molecule keywords Putative uncharacterized protein
total genus 75
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2008-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.80 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Ribonucleotide Reductase Protein R1; domain 1 3f4tA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3f4tA01
2H76A 3HJMA 1S3DA 4BPYA 1JHBA 3CYNA 1A0RP 3VI5A 4MZWA 3Q18A 5AN1A 2DLXA 4MABA 1GUKA 3RDWA 4QL7A 3G9BA 4JEDA 1NM3A 5DVBA 1QUWA 3GNJA 1O81A 3KH9A 2GDRA 1NHYA 5J9BA 2PVOC 1EP8A 3U5RE 1K0MA 2ALBA 2GQKA 4X0XA 1TP9A 5JCUA 1WRYA 3TDGA 1ML6A 2HYXA 4FO5A 4I6XA 3CTFA 5ECRB 1PQNA 2JZTA 2X8HA 2VUPA 1QGVA 3KXOA 1U3AA 4TR3A 4F82A 5HR0A 2MZCA 2WZ9A 1SKSB 2QSIA 3CSIA 4MJBA 2FGXA 3GN3A 4L8EA 2YJ7A 3VI7A 4F9ZA 3IR4A 4LL1B 1TW9A 2AAWA 2LTKA 1F6MC 4LLRA 1XVQA 1J08A 1ILOA 2GS3A 2QC7A 1YEXA 4XS1A 3VWWA 3A5WA 3I6AA 1VRSD 3S9FA 2DMLA 2VL2C 3EURA 1K0BA 1ZYEA 5DAKA 4OFMA 1MTCA 2LQOA 1TI3A 4OO5A 1LBKA 1O7UA 4DEJA 5ECSA 1TTZA 2DJJA 2YV7A 1F2EA 5HQPA 5HR3A 4X43A 3CTGA 3WGXA 1AQXA 4L0UA 3TRXA 2RUFA 1ABAA 1M2DA 1GLPA 1TJDA 4ECBA 3TKSC 5ELAA 1GSQA 2K18A 1EGOA 3M3MA 3TKSA 1K3LA 3TRQA 3GH6A 4XRDA 4ZIJA 2HT9A 4TRXA 2WULA 1A2JA 1G7OA 2GGTA 3UBKA 2GZPA 4V1Ag 2LJAA 2XPEA 2JACA 5FWGA 3UJ1A 1K3OA 5CRDA 2C3NA 4HEA2 2V6OA 5HFGA 1JZRA 4NAXA 1PA3A 2GT6A 4KW6A 1S3AA 3VPTA 1DUGA 2DJKA 4CDOA 3TJKA 4TR4A 4DSSB 1JFUA 3F4SA 3M0FA 5IMCA 5B8BA 1X5EA 1GWCA 2H66A 2L57A 2RLIA 2WJUA 5ELGA 3GA4A 1PKZA 4NXIA 2F51A 4G2EA 4F03A 5A4WA 1M0UA 4ZL8A 5CAXA 4IQ1A 1X9SB 2X99A 4KX4A 1O73A 2YOIA 3EE2A 1SD9A 1XW5A 3HJOA 3EMXA 4XS6A 2WRTA 4HUAA 2VLTA 3WT2A 1V98A 1HNBA 2P31A 1O8WA 2CX4A 1B4PA 2YZUA 4JR4A 2M80A 1GUMA 1OC8A 1I9DA 3EYTA 3RHCA 3EMPA 19GSA 5EY6A 5H5RA 2O87A 5D9TA 3UEMA 1AIUA 2P5QA 2C0EA 1Z5YE 4ZL9A 4YQMA 2X64A 2R3XA 10GSA 1Z7RA 3TKRA 4KDYA 1XOAA 1QXHA 4D73A 2V2GA 2CAIA 4G10A 1Y6EA 4ECCA 5IMZA 4OFNA 4NPBA 3GHAA 4F2IA 4CHSA 2WB9A 1SJIA 4E8HA 3LQ7A 13GSA 1Q98A 4HOJA 1YQ1A 1GNWA 2KUCA 1WPIA 3TCOA 4ULXA 1A23A 4TN8A 1NSWA 4RQXA 3C1RA 1I5GA 1A8YA 2VM2A 4IS0A 3MSZA 2PPTA 2OA7A 3ZLPA 1ST9A 1EOHA 4Q5RA 4BVXA 1EEMA 5ECIB 1XW9A 2C0FA 5AIVA 3FR3A 3KJYA 4OFTA 1ZCPA 3ZVJA 2WCIA 4ILFA 2DBCA 4GF0A 1F9MA 3VFIA 2I4AA 3MNGA 18GSA 5IIZA 1V40A 1SU9A 2C1YA 3M1GA 2RIIA 4PQ1A 4AGSA 3RBTA 1SENA 5A5KA 3HDCA 1Z7PA 2ON5A 1ZGNA 2DIZA 4EE0A 3BCIA 4OMVA 4WETA 4EC0A 3UIWA 4YH2A 2H0HA 2OJLA 3AY8A 4ZILA 1TRSA 4EF0A 4HDEA 3SWLA 4GQCA 3EWLA 1ZOFA 2L5LA 2MMOA 1YY7A 2DJ2A 1T4ZA 4MP4A 3RPPA 4IBPA 4MLYA 2H6XA 1KEBA 5KEJA 1FVKA 2CT6A 2C8UA 3L9UA 3UOMA 1O6JA 2YPMA 1GSEA 4QQ7A 4ZB6A 1BEDA 2LJRA 5DALA 1AXDA 2KOKA 2C4JA 2YJHA 1Z3EA 1TDIA 2Z9SA 2YWNA 2AHEA 3KMNA 3KGKA 1GUHA 1JZWA 4IKHA 4RI7A 5CRHA 2XPDA 3GTUA 3M8NA 1M7TA 1E2YA 1OE7A 3ZIVA 1VF1A 3LYPA 4ZB8A 3ERGA 2GSTA 4ZBDA 3KIJA 3L0HA 2BTOT 5B8AA 3TKQA 3DVXA 1K0DA 3O3TA 3TOUA 2GSSA 4FH8A 2VLVA 1M2BA 1BAYA 1PD21 4HZ2A 1OAZA 1M99A 1SD8A 2VCXA 3CSJA 1EP7A 2YV9A 1XFLA 1H75A 4EUYA 4IP1A 1Y25A 2O89A 1TK8B 1EV4A 2D2ZA 4L5LA 1BYEA 4G19A 2FUG2 1MEKA 3QR6A 2KP1A 3ZZXA 2MMAA 3KP8A 5LCZA 2PU9C 2VL2A 3FR6A 1B4QA 3F6DA 3F8UA 2RUEA 5L71A 1M9AA 2HSHA 5ECNB 2AJQB 1USBA 5KN1A 3QFBC 5C00A 5DJLA 14GSA 3APSA 1DBYA 2H8LA 1ZL9A 4MCUA 3WYWA 3FEUA 5D96A 4TXOB 5CYYA 3Q74A 2HLSA 1M2AA 3M9JA 3IBHA 1XWAA 1FG4A 5JCWA 1LJRA 1KTEA 1GSYA 3VPQA 4MK3A 4V1Ap 1W89A 5KN2A 3C8EA 2H71A 1N2AA 1PRXA 5FHIA 2NPBA 2IFQB 5F8BA 3GKMA 3IK9A 1TRWA 1A2MA 4YQVA 1XW6A 3CRTA 1XWBA 3GX0A 2VOCA 4KDUA 1K0AA 3F0IA 3WGDA 4AJ6A 4WF5A 4NMUA 4X1UA 1OC9B 3IXRA 2XBQA 1A2LA 3P90A 2ZCTA 1WIKA 2OBKA 1HD2A 3H79A 2FCHA 1XBSA 1TKDB 5KN0A 2PVQA 11GSA 1OC3A 4NHWA 4XRAA 4ACSA 4WXTA 4DSSA 4CW9A 1VGLA 5EVOA 4O32A 3ZL5A 1NW2A 3LFLA 1GSUA 3L4NA 3WD6A 2HRNA 2LS5A 3WT1A 1TK5B 3APQA 1PGTA 1Z6MA 4XCSA 1Z6NA 2G0FA 4Z7XA 4I97A 5JCGA 1QMVA 2H70A 1TU7A 2HNLA 2P0GA 2VO4A 5D9VA 1OVNA 1BG5A 4EL1A 4XS4A 3ZRDA 2AB6A 4HU7A 4OD7A 1FHEA 2GT5A 4K2DA 2CAQA 4POMA 1ZZYA 1X9MB 6GSVA 1J0FA 3E0UA 3HD5A 3KZQA 3IAS2 3HY2A 1R4WA 8GSSA 4GCIA 4DSQA 1QQ2A 4PX1A 5G5EA 5HFKA 5E59A 1UA5A 2EIOA 2VM1A 2H01A 2AUVA 3RAZA 2B1LA 3WGEA 4ZBAA 4EDZA 2VCTA 1SJZA 2VD1A 3H1NA 2PUKC 2V41A 4IQAA 1K0CA 1LU4A 1TI1A 2HXKA 1WOUA 2OBIA 2IL3A 5D73A 1UVZA 4IGJA 3ME7A 2TRXA 2YWMA 5G30A 5A4VA 3P7XA 4HU9A 2R2JA 2RM6A 3UVTA 2MBTA 1A24A 2VCVA 5DBQA 1TRUA 4PUFC 1CQHA 4K0GA 2L6CA 3CRUA 4MA9A 2ZNMA 1F3AA 3I43A 1V9WA 5ECLB 4TVEA 2H1GA 3Q6OA 3W6GA 3NIVA 1EGRA 2HZEB 3TJJA 3DD3A 4K0NA 2V32A 3LG6A 4MPGA 3IE3A 4XIHA 1FB0A 2FA8A 4KGIA 2EC4A 3GFKA 3QCPA 1OC9A 3UMAA 4N11A 3GRXA 1ERWA 1S3CA 1ERUA 3DYRA 1T7PB 2R6KA 2B3SA 1T4YA 1B48A 1GRXA 2DC5A 5IQYA 2FLSA 2H19A 2YZHA 4RQRA 3HA9A 3ZYWA 1G6WA 3ZTLA 1ERTA 2JSYA 4K7OA 1H4OA 3HKRA 22GSA 2IFQA 4ISDA 4EKZA 2I9HA 3GL5A 2TRCP 1NHOA 2H1BA 4XTSA 3ZMLA 2J23A 4LMWA 4IN0A 1PMTA 4IJIA 2B1KA 4N0ZA 4K9ZA 1GP1A 4I2UA 4PGTA 6GSXA 3LXZA 1GNEA 1URMA 2YWIA 3MDKA 2E2GA 3IAM2 3KTLA 5D93A 1XXUA 2PGTA 1EV9A 4I5QA 1BQ7A 3GUSA 2FWGA 2H6YA 4L0WA 3ZREA 1YEPA 4HI7A 5JWRB 4HS1A 1A8LA 4WR4A 5IPGA 2KHPA 2MBSA 4AJ8A 1AQVA 4HQZA 4EO3A 4BVYA 4QL9A 2WFCA 1V2AA 2R4VA 4IP6A 2H6ZA 1T1VA 5IMDA 5JWOB 3EU3A 5FT3A 1AW9A 4PUAA 3A2WA 1CQGA 3BCKA 1KBNA 1HYUA 1G7EA 4ECJA 1SK1A 2L5OA 1U87A 3IPZA 4TR0A 5GSTA 1AQWA 4K6XA 5LD0A 3GTUB 1R5PA 2L6DA 4NV5A 2LKUA 1F37A 1O85A 3MAKA 3HVVA 5AIXA 4HQSA 5AISA 4FYUA 3FZ4A 2ES7A 1SKRB 3U6VA 4MH2A 2DJ3A 3IHQA 1SL0B 1SYRA 2XBIA 3FZ5A 5EL8A 2B6MA 2LUSA 3F4TA 2GSRA 3OR5A 2GTUA 3NZNA 3I9V2 4DVCA 3GIXA 2C0GA 2O85A 5H5SA 1DE1A 3QMXA 3FHKA 3VWXA 4MMMA 4J2FA 1B9YC 4IHUA 4BWSA 4ZBBA 1BJXA 4KDXA 3IV4A 2GZZA 4O5RA 5ECHB 1W4VA 2DJ1A 1F3BA 2CVDA 2M46A 2VAFA 2B7JA 4Q5QA 4WKWA 3LGCA 4AJ7A 4BWQA 3ZIJA 2BMXA 5DQYA 3DRNA 3ZITA 3DIEA 1GTIA 2LQQA 2XHFA 4TXVA 3UVHA 2FY6A 5GZZB 4JBBA 2ZUPA 3LJRA 5ID2A 2KP2A 4TOPA 4MF6A 1G0TA 3IC4A 3H4KA 1JLWA 1K3YA 1YKAA 2CVKA 5F07A 2A4VA 4JE1A 4K1FA 3QDNA 4PQHA 4JR6A 2B5YA 5AGYA 3LXTA 1EOGA 2ON7A 3LEFA 3HHVA 1J9BA 1X9WB 2EIRA 5HR2A 2IMKA 5ECOB 2GQLA 2IWTA 5B7CA 4V2LA 1Q4JA 3F3QA 1R26A 5J3RA 4PQIA 1YKCA 1ACVA 5INYA 3UL3A 1SL2B 2P5RA 2LSTA 3V1WA 3ZFLA 3DGQA 2CQ9A 3HCZA 4GRFA 4GSSA 4TXOA 2H0GA 1RK4A 1XWCA 3O76A 4GLTA 3FY7A 4RUVA 1MDIA 1DE2A 2CVBA 3J7Yb 2EIQA 2E2MA 3DWVA 4GTUA 1O8XA 2O8VB 3LORA 2H72A 3GKKA 4JZQA 3D22A 2FNOA 3BOAA 5LNKe 5IMAA 4Q5NA 2VLUA 5DQSA 4N0VA 3I69A 3KEBA 4OO4A 3RHBA 1T00A 3QPMA 2LJKA 1E6BA 5DJMA 1GSFA 2HRFA 1GSDA 3F4RA 3FK8A 2YCDA 1KNGA 2B5XA 5ECMB 1GLQA 2H73A 5ABRA 5A4UA 4HJ2A 2IPAA 5D8IA 4KCEA 3KMOA 2G2QA 2JZSA 3R2QA 5G2ZA 4P3YB 3HVSA 17GSA 2IN3A 5J9CA 5J4UA 1RQMA 2L4QA 3E9JB 1UC7A 6GSTA 3H8QA 1GULA 1ZYQB 2TIRA 5GAPD 5ECPB 1SYXA 3H93A 2VCQA 4KH7A 4TKYA 1XIYA 2C80A 2REMA 5HFIA 1SJ6A 5G31A 1T8EB 1VF3A 1XZOA 2HI7A 2M72A 1GSSA 3HZ8A 5G5FA 4WEYA 2N5FA 4IW9A 2X8GA 1WWJA 3TGZA 5COHA 1FB6A 4HJMA 4FIWA 2JADA 3IDVA 16GSA 3P8WA 2LRTA 2VIMA 5CRGA 4TR1A 2RM5A 1RW1A 3D4TA 3L9SA 3F3RA 1VF4A 4NHZA 1QFNA 5CP1A 1XOBA 2CV4A 4MZCA 4NV2A 3VURA 3KP9A 2N5AA 4MPFA 1FOVA 2NDOA 5IMFA 6GSYA 4WF4A 5GSSA 3HXSA 1JZDA 2C3TA 3ZFBA 2H0IA 4OWYA 4J56E 2GVPA 2GZYA 3N5OA 1B8XA 4KB3A 3TJGA 3GV1A 3TKPA 3A3TA 4KNDA 4MH3A 3VWUA 5JWQB 1U3IA 1PSQA 1IYIA 1AUCA 2XC2A 3L9VA 2C0DA 1SL1B 7GSSA 1WJKA 4ECIA 3W8SA 5DDLA 3CSHA 3KTBA 6GSUA 1GTUA 2DMMA 1MDKA 5E4WA 5CNWA 5H5QA 3TOTA 2QKEA 3TB2A 2FWHA 4K8MA 4POLA 3DVWA 3D4MA 4I8BA 5G1KA 3ZMKA 4KSMA 5B6MA 4KUNA 4GWRA 3GSTA 2OADA 2QGVA 3D0ZA 2LEGA 3BJ5A 2WS2A 5DALB 5F0GA 2YN1A 2NTOA 3GYKA 2J9HA 2IJYA 4POKA 4PXOA 4MJEA 5DAKB 1TK0B 1WP0A 4H86A 2OKAA 2F9SA 3GSSA 4ML6A 3QAWA 2OE3A 1JLVA 1MDJA 4LA1A 5ID2B 4NWYA 3UAPA 5J5NA 2E7PA 3EINA 1GTBA 5EPFA 1EZKA 3GL3A 3VLNA 3UBLA 5DCHA 1OKDA 3DMLA 3QOUA 1YDKA 4POBA 4O7HA 2NBSA 4D73B 4ZL7A 2IIYA 1GL8A 1PL2A 3ME8A 3GX8A 1K0NA 4FYBA 3PH9A 2VCZA 3UARA 5F05A 1GTAA 3P2AA 1FVJA 2DSAA 3LYKA 2AV4A 3HYPA 1QK8A 2JSZA 2BJXA 3ZVJD 3HJPA 2HZFA 5HR1A 3ED3A 4DSRA 3PGTA 3KH7A 3C7MA 4GQFA 2DJ0A 3QFAC 4OCFA 4L5OA 1PX6A 1VF2A 3QAGA 1PKWA 5IPHA 2HSYA 3L78A 2MMNA 4O92A 3F63A 4MDCA 3ISOA 1GH2A 3D21A 1PN9A 1PL1A 4MF7A 4K7IA 2HFDA 3GMFA 2F3MA 2LNTA 3ERFA 3E3EA 2VL3A 3J7Yk 5ECKB 3JCML 2FWEA 4MZBA 3DKSA 1HQOA 4WBRD 2FWFA 1SKWB 4V2NA 2DIYA 3BBYA 2MMZA 2F8FA 2H75A 1JZOA 1B9XC 4AF2A 1FO5A 1AAZA 2B5EA 2AYTA 1EWXA 3QAVA 4GSNA 1R5AA 2PBJA 1WMJA 1TU8A 2VL9A 2NVLA 2HE3A 1THXA 2R37A 1Z9HA 3EU4A 4MJAA 4YQUA 2CA8A 1X5CA 1SK2A 3CXGA 3US3A 1FAAA 3SBCA 3GKNA 4XS4B 1YF0A 3QD9A 2JU5A 2FD3A 2YP6A 3A2VA 1K0OA 2CZ2A 2IMEA 5ENUA 1V57A 3GH9A 3ERWA 5J41A 3CMIA 3FRCA 3VK9A 4I2TA 4JRRA 4BA7A 5IO0A 3FW2A 2H1DA 1EEJA 2F8AA 4E8EA 2I1UA 2L59A 3TJBA 4BL7A 2KLXA 3N9JA 3KCMA 2JL4A 1SK0A 4YAPA 1HNAA 4IELA 3D5JA 5D9WA 4EXJA 1ON4A 2VCWA 2H74A 2E0QA 3IOSA 5IOXA 4YAVA 2K8VA 4GSTA 3C71A 3G7YA 3IK7A 2WGRA 2H1AA 5D9XA 4F0CA 5KN3A 1XVWA 4PNGA 2B7KA 4TW5A 3FR9A 3FKFA 4EVMA 1TRVA 2X8CA 3APOA 1T3BA 3O6TA 5IO2A 1X0RA 2LRCA 1X5DA 3MWHA 2IMIA 4V2MA 2WDUA 3NOFA 2L4CA 1MD4A 2CZ3A 4IJ3A 1OYJA 4PNFA 1V58A 2K9FA 4WR5A 1ZMAA 1XWGA 3HZ4A 3M9KA 4ZXGA 3A2XA 4XHMA 2PN8A 3RPNA 2R5GA 2LNSA 4KSOA 12GSA 9GSSA 3TRPA 3G7JA 1THOA 3LSZA 1XCCA 1XWKA 2V1MA 2A2RA 4KAEA 1A0FA 2H30A 5C04A 4EDYA 1HNCA 4N10A 3FZ9A 1OKTA 3GURA 4LMVA 2K8SA 3C1SA 1R7HA 3Q19A 4K7NA 5IOWA 3FYGA 2I81A 2VD0A 3CBUA 1OE8A 5CREA 4TR1B 1C72A 5ECQB 4JU5A 3BD2A 4PURA 2CX3A 3TJFA 2LV3A 3EC3A 1PX7A 3EVIA 5GAND 5IM9A 3DXBA 1XPVA 3PINA 2I3YA 6GSSA 6GSWA 1DSBA 3K8NA 2C3QA 4MJCA 2FHEA 3D6IA 3G7IA 4N30A 2PWJA 2IMFA 5CRWA 3KD0A 3PR8A 3F6FA 4RI6A 1YJ6A 1YF1A 1YZXA 4ML1A 2YANA 2GQMA 3F9UA 4J57E 3DEXA 1G6YA 3TKSE 1ERVA 4GXZA 3TUEA 2HZEA 3W8JA 20GSA 2V6KA 4OCEA 2PMTA 4ID0A 3HVXA 2N5BA 2YWOA 2OE1A 1N8JA 3IA1A 2LRNA 1WE0A 2FA4A 1M9BA 4F0BA 4HZ4A 4ZB9A 5F06A 1FW1A 1AC1A 2O7KA 4KCAA 5G1LA 2OE0A 1BX9A 3VWVA 4WBJA 2IMDA 3GKXA 3IRAA 3KM6A 5IMVA 2PERA 4KA0A 2JZRA 4IVFA 3LWAA 1IYHA 2GLRA 2MYGA 1MD3A 3FZAA 4G9HA 1TOFA 4MF5A 2A2SA 5DCGA 3C73A 1TXXA 1UN2A 5CO3A 1U88A 2GSQA 1U6TA 2YNXA 5B6NA 4KE3A 4LL4B 4Q5FA 4FYCA 2OACA 2K6VA
chains in the Genus database with same CATH superfamily
2H76A 3HJMA 1S3DA 4BPYA 3R3EA 1JHBA 2PTSA 3CYNA 4EFCA 1A0RP 3VI5A 4MZWA 3Q18A 5AN1A 2DLXA 4MABA 1GUKA 3RDWA 4QL7A 3G9BA 2A2PA 4JEDA 1NM3A 5DVBA 1IW7D 1QUWA 3GNJA 1O81A 3KH9A 2GDRA 1NHYA 5J9BA 3PPUA 2PVOC 1EP8A 2HRKA 3U5RE 1K0MA 2ALBA 2GQKA 4X0XA 1TP9A 5JCUA 1WRYA 3IC8A 3TDGA 1ML6A 2HYXA 4FO5A 4I6XA 3CTFA 5ECRB 1PQNA 2JZTA 2X8HA 3HVNA 4BVXB 2VUPA 1QGVA 3KXOA 1U3AA 4TR3A 4F82A 5HR0A 2MZCA 2WZ9A 1SKSB 2QSIA 4O5QA 3CSIA 4MJBA 2FGXA 3GN3A 4L8EA 2YJ7A 4L6CA 3VI7A 4F9ZA 3IR4A 4LL1B 1TW9A 2AAWA 2LTKA 1F6MC 4LLRA 1XVQA 1J08A 1ILOA 2GS3A 2QC7A 3NO9A 1YEXA 4XS1A 3VWWA 3A5WA 3I6AA 1VRSD 3S9FA 2DMLA 2VL2C 3EURA 1YFEA 1K0BA 1ZYEA 5DAKA 4OFMA 1MTCA 2LQOA 1TI3A 4OO5A 1T9HA 1LBKA 1O7UA 4DEJA 5ECSA 1TTZA 2DJJA 2YV7A 1F2EA 5HQPA 5HR3A 4X43A 3CI0K 3CTGA 3WGXA 1AQXA 4L0UA 3TRXA 2RUFA 1ABAA 1M2DA 1GLPA 1TJDA 4ECBA 3TKSC 5ELAA 4MX2A 1GSQA 2K18A 1EGOA 3M3MA 1K7WA 3TKSA 1K3LA 3TRQA 3GH6A 4XRDA 4ZIJA 2HT9A 4TRXA 2WULA 1A2JA 1G7OA 2GGTA 3UBKA 2GZPA 4V1Ag 2LJAA 2XPEA 2JACA 5FWGA 3UJ1A 1K3OA 5CRDA 2C3NA 4HEA2 2V6OA 5HFGA 1JZRA 4NAXA 1PA3A 2GT6A 4KW6A 1S3AA 3VPTA 3CQFA 1DUGA 2DJKA 4CDOA 3TJKA 4TR4A 4DSSB 1JFUA 3F4SA 3M0FA 5IMCA 5B8BA 1X5EA 1GWCA 2H66A 2L57A 2RLIA 2WJUA 5ELGA 3GA4A 1PKZA 2PFMA 4NXIA 2F51A 4G2EA 4F03A 5A4WA 1M0UA 4ZL8A 5CAXA 4IQ1A 1X9SB 2X99A 4EEIA 4KX4A 1O73A 2YOIA 3EE2A 1SD9A 1XW5A 3HJOA 3EMXA 4XS6A 2WRTA 4HUAA 2VLTA 3WT2A 1V98A 1HNBA 2P31A 1O8WA 2CX4A 1B4PA 2YZUA 4JR4A 1TJUA 2M80A 1TJVA 1GUMA 1OC8A 1I9DA 3EYTA 3RHCA 3EMPA 19GSA 5EY6A 5H5RA 2O87A 5D9TA 3UEMA 1AIUA 2P5QA 2C0EA 1Z5YE 4ZL9A 4K2XA 4YQMA 2X64A 2R3XA 10GSA 1Z7RA 3TKRA 4PTSA 4KDYA 5D6BA 1XOAA 1QXHA 4D73A 2V2GA 2CAIA 4G10A 1Y6EA 4ECCA 5IMZA 4OFNA 4NPBA 2X49A 3GHAA 4F2IA 4CHSA 2WB9A 1SJIA 4E8HA 3LQ7A 13GSA 1Q98A 4HOJA 1YQ1A 1GNWA 1VDKA 2KUCA 1WPIA 3TCOA 2QA1A 4ULXA 1A23A 4TN8A 1NSWA 4RQXA 3C1RA 1Q91A 1I5GA 1A8YA 2VM2A 4IS0A 3MSZA 2PPTA 2OA7A 1FOHA 3ZLPA 3FMWA 1ST9A 1EOHA 4X4JA 4Q5RA 4BVXA 3IHGA 1EEMA 2UZ8A 5ECIB 1XW9A 2C0FA 3OCEA 5AIVA 3FR3A 3KJYA 4OFTA 1ZCPA 3ZVJA 2WCIA 4ILFA 2DBCA 4GF0A 1F9MA 3VFIA 2I4AA 3MNGA 18GSA 5IIZA 1V40A 1SU9A 2C1YA 3M1GA 2RIIA 4PQ1A 4AGSA 3RBTA 1SENA 5A5KA 3HDCA 1Z7PA 2ON5A 1ZGNA 2DIZA 4EE0A 3BCIA 4OMVA 4WETA 4EC0A 3UIWA 4YH2A 2H0HA 2OJLA 3AY8A 4ZILA 1S3RA 1RE5A 1TRSA 4EF0A 4HDEA 3SWLA 4G0KA 4GQCA 3C8TA 3EWLA 1ZOFA 2L5LA 2MMOA 1YY7A 2DJ2A 2HRAA 1T4ZA 4K5RA 2R0GA 4MP4A 3RPPA 4IBPA 4MLYA 2H6XA 1KEBA 5KEJA 4O5UA 1FVKA 2JAUA 2CT6A 1DOFA 2C8UA 3L9UA 3UOMA 1O6JA 2YPMA 1GSEA 4Z2UA 4QQ7A 4ZB6A 1BEDA 2LJRA 5DALA 1AXDA 2KOKA 2C4JA 2YJHA 1Z3EA 1TDIA 2Z9SA 2YWNA 2AHEA 3KMNA 3KGKA 1GUHA 1JZWA 4IKHA 4RI7A 5CRHA 2JAOA 5F92A 2XPDA 3GTUA 2PTRA 3M8NA 1M7TA 1E2YA 1OE7A 3ZIVA 1VF1A 3LYPA 4ZB8A 3ERGA 2GSTA 4ZBDA 3KIJA 3L0HA 2BTOT 5B8AA 3TKQA 3DVXA 1K0DA 3O3TA 3TOUA 2GSSA 4FH8A 2VLVA 1M2BA 1BAYA 1PD21 4HZ2A 1OAZA 1M99A 1SD8A 2VCXA 3CSJA 1EP7A 4BL7B 2YV9A 1XFLA 1H75A 4EUYA 4IP1A 1Y25A 2O89A 1TK8B 1EV4A 2D2ZA 4L5LA 1BYEA 4G19A 2FUG2 1MEKA 3QR6A 2KP1A 3ZZXA 2MMAA 3KP8A 5LCZA 5HW2A 2PU9C 4MUMA 2VL2A 3FR6A 1B4QA 3F6DA 3F8UA 2RUEA 5L71A 1M9AA 2HSHA 5ECNB 4CY8A 2AJQB 1USBA 5KN1A 3QFBC 5DJLA 5C00A 14GSA 3APSA 1DBYA 2H8LA 1ZL9A 4MCUA 4EIPA 3WYWA 1U16A 3FEUA 5D96A 4TXOB 5CYYA 3Q74A 2HLSA 1M2AA 3M9JA 3IBHA 1XWAA 1FG4A 5JCWA 1LJRA 1KTEA 1GSYA 4MK3A 3VPQA 4V1Ap 1W89A 5KN2A 1I0AA 3C8EA 2H71A 1N2AA 1PRXA 4APBA 5FHIA 2NPBA 2IFQB 5F8BA 3GKMA 3IK9A 4YIKA 1TRWA 1A2MA 4YQVA 1XW6A 3CRTA 1XWBA 3GX0A 2VOCA 4KDUA 1K0AA 3F0IA 3WGDA 4AJ6A 4WF5A 4NMUA 4X1UA 1OC9B 3IXRA 2XBQA 1A2LA 3P90A 2ZCTA 1WIKA 2OBKA 1HD2A 3H79A 2FCHA 1XBSA 1TKDB 5KN0A 2PVQA 11GSA 1OC3A 4NHWA 4XRAA 4ACSA 4WXTA 4DSSA 1MH9A 4CW9A 1VGLA 5EVOA 4O32A 3ZL5A 1NW2A 3LFLA 1Z4MA 1GSUA 1FUQA 3L4NA 3GTDA 3WD6A 2HRNA 2LS5A 3WT1A 1TK5B 3APQA 2HVGA 1PGTA 1Z6MA 4XCSA 1Z6NA 2G0FA 4Z7XA 4I97A 1QMVA 2H70A 5JCGA 1TU7A 5BMUA 2HNLA 2P0GA 2VO4A 5D9VA 4Z2RA 1OVNA 1BG5A 4EL1A 4XS4A 1KQ7A 3ZRDA 4CY6A 2AB6A 4HU7A 4OD7A 1FHEA 2GT5A 4K2DA 2CAQA 4YKFA 4POMA 1ZZYA 1X9MB 6GSVA 1J0FA 1JSWA 3E0UA 4NLEA 3HD5A 3KZQA 3IAS2 3BHGA 3HY2A 1R4WA 8GSSA 4GCIA 4DSQA 1QQ2A 4PX1A 5G5EA 1Z4IA 5HFKA 5E59A 1UA5A 2EIOA 2VM1A 2H01A 2AUVA 3RAZA 2B1LA 3WGEA 4ZBAA 4EDZA 2VCTA 1SJZA 2VD1A 3H1NA 2PUKC 2V41A 4IQAA 1K0CA 1LU4A 1TI1A 2HXKA 1WOUA 2OBIA 2IL3A 5D73A 1UVZA 4IGJA 3ME7A 1FUOA 2TRXA 2YWMA 5G30A 5A4VA 3P7XA 4HU9A 2R2JA 2RM6A 3UVTA 2MBTA 1A24A 2VCVA 5DBQA 1TRUA 4K5SA 4PUFC 1CQHA 4K0GA 2L6CA 1DCNA 3CRUA 4MA9A 2ZNMA 1Z4QA 1F3AA 3I43A 5ECLB 1V9WA 1K62A 4TVEA 2H1GA 3Q6OA 4ICYA 1ZYNA 3W6GA 4KF9A 3NIVA 1EGRA 2HZEB 3TJJA 3DD3A 4K0NA 2V32A 3LG6A 4MPGA 3IE3A 4XIHA 1FB0A 2FA8A 4KGIA 1HY1A 2EC4A 3GFKA 3QCPA 1OC9A 3UMAA 4N11A 3GRXA 1ERWA 1S3CA 1ERUA 3DYRA 1T7PB 3OCFA 2R6KA 2B3SA 1T4YA 1B48A 1GRXA 2DC5A 5IQYA 2FLSA 2H19A 2YZHA 4RQRA 1PN0A 3HA9A 3ZYWA 1G6WA 1PFOA 3ZTLA 1ERTA 2JSYA 4K7OA 1H4OA 3HKRA 22GSA 2IFQA 4ISDA 4EKZA 2I9HA 3GL5A 2TRCP 1NHOA 2H1BA 4XTSA 3ZMLA 2J23A 4LMWA 2DKHA 4IN0A 1PMTA 4IJIA 2B1KA 4N0ZA 1FUPA 4K9ZA 1GP1A 4I2UA 4PGTA 6GSXA 3LXZA 1GNEA 1URMA 2YWIA 3MDKA 2E2GA 3IAM2 3KTLA 5D93A 1XXUA 2PGTA 1EV9A 4I5QA 1BQ7A 2A4HA 2DKIA 3GUSA 4USSA 2FWGA 2H6YA 4L0WA 3ZREA 1YEPA 1Z4LA 4HI7A 5JWRB 4HS1A 1A8LA 4WR4A 5IPGA 2KHPA 2MBSA 4AJ8A 1AQVA 4HQZA 4EO3A 4BVYA 4QL9A 2WFCA 1V2AA 2R4VA 4IP6A 2H6ZA 1T1VA 5IMDA 5JWOB 3EU3A 5FT3A 1AW9A 4PUAA 3A2WA 1CQGA 3BCKA 1KBNA 1HYUA 1G7EA 4ECJA 1SK1A 2L5OA 1U87A 3IPZA 4TR0A 5GSTA 1AQWA 4K6XA 5LD0A 3GTUB 1R5PA 2L6DA 4NV5A 2D28C 2LKUA 1F37A 1O85A 3MAKA 3HVVA 5AIXA 4HQSA 5AISA 4FYUA 3FZ4A 2ES7A 1SKRB 3U6VA 4MH2A 2DJ3A 3IHQA 3R6QA 1SL0B 1SYRA 2XBIA 3FZ5A 5EL8A 2B6MA 2LUSA 3F4TA 2GSRA 3OR5A 2GTUA 4ADLA 3NZNA 4FQUA 3A5IA 3I9V2 4BIKA 4DVCA 3GIXA 2C0GA 2O85A 5H5SA 1DE1A 3QMXA 3FHKA 3VWXA 4MMMA 4J2FA 1B9YC 2E9FA 5KOXA 1TJ7A 4IHUA 4BWSA 4ZBBA 1BJXA 4KDXA 3IV4A 2GZZA 4O5RA 5ECHB 1W4VA 2DJ1A 1F3BA 2CVDA 2M46A 2VAFA 2B7JA 4Q5QA 2R0PA 3LGCA 4WKWA 4AJ7A 4BWQA 3ZIJA 2BMXA 5DQYA 3DRNA 3ZITA 3DIEA 1GTIA 2LQQA 2XHFA 4TXVA 3UVHA 2FY6A 5GZZB 4JBBA 2ZUPA 3LJRA 5ID2A 2KP2A 4TOPA 4MF6A 1G0TA 3E04A 3IC4A 3H4KA 1JLWA 1K3YA 1YKAA 2CVKA 5F07A 2A4VA 4K1FA 4JE1A 3QDNA 4PQHA 4JR6A 2B5YA 5AGYA 3EPTA 3LXTA 1EOGA 2ON7A 3LEFA 3HHVA 1J9BA 1X9WB 2EIRA 4IQJM 2YV5A 5HR2A 2IMKA 5ECOB 2GQLA 2IWTA 5B7CA 4V2LA 1Q4JA 3F3QA 1R26A 5J3RA 4PQIA 1YKCA 1ACVA 2R0CA 5INYA 1U15A 3UL3A 1SL2B 2P5RA 2LSTA 1YFMA 2X75A 3V1WA 3ZFLA 3DGQA 2CQ9A 3HCZA 4GRFA 4GSSA 4TXOA 2H0GA 1RK4A 1XWCA 3O76A 4GLTA 3FY7A 4RUVA 1MDIA 1DE2A 2CVBA 3J7Yb 2EIQA 2E2MA 3DWVA 4GTUA 1O8XA 2O8VB 3LORA 4L6AA 2H72A 3GKKA 4JZQA 3D22A 1M3JA 2FNOA 3BOAA 5LNKe 4G0LA 5IMAA 4Q5NA 2VLUA 5DQSA 4N0VA 3I69A 4YIHA 3KEBA 4OO4A 1Q5NA 3RHBA 1T00A 3QPMA 2LJKA 1E6BA 5DJMA 1GSFA 2HRFA 1GSDA 3F4RA 3FK8A 2D27A 2YCDA 1KNGA 2B5XA 5ECMB 5KOWA 1J3UA 1GLQA 2H73A 5ABRA 5A4UA 4HJ2A 2IPAA 1HY0A 5D8IA 4KCEA 3KMOA 2G2QA 2JZSA 3R2QA 5G2ZA 4P3YB 3HVSA 17GSA 2IN3A 5J9CA 4NFLA 5J4UA 1RQMA 2L4QA 3E9JB 1UC7A 6GSTA 3H8QA 1GULA 1ZYQB 2TIRA 5GAPD 5ECPB 3GZHA 1SYXA 4ADMA 5BRTA 3H93A 2VCQA 4KH7A 4TKYA 1XIYA 2C80A 2REMA 5HFIA 1SJ6A 5G31A 1T8EB 1VF3A 1XZOA 2HI7A 2M72A 1GSSA 3HZ8A 5G5FA 4WEYA 2N5FA 4IW9A 2X8GA 1WWJA 3TGZA 5COHA 1FB6A 4HJMA 4FIWA 2JADA 3IDVA 16GSA 3P8WA 2LRTA 2VIMA 5CRGA 4TR1A 2RM5A 1RW1A 3D4TA 3L9SA 3F3RA 1VF4A 4NHZA 1QFNA 5CP1A 1XOBA 2CV4A 3LW9A 1XWOA 4MZCA 4NV2A 3VURA 3KP9A 2N5AA 4MPFA 1FOVA 2NDOA 5IMFA 6GSYA 4MWOA 4WF4A 5GSSA 3HXSA 1JZDA 2C3TA 3ZFBA 2H0IA 4OWYA 4J56E 2GVPA 2GZYA 3N5OA 1B8XA 2JARA 4KB3A 3TJGA 3GV1A 2JAWA 3TKPA 3A3TA 4KNDA 4MH3A 3VWUA 5JWQB 1U3IA 1PSQA 1IYIA 1AUCA 2XC2A 3L9VA 2C0DA 1SL1B 7GSSA 1WJKA 4ECIA 4YKGA 3W8SA 5DDLA 3CSHA 3KTBA 6GSUA 1GTUA 2DMMA 1MDKA 5E4WA 5CNWA 5H5QA 3TOTA 2QKEA 3TB2A 2FWHA 4K8MA 4POLA 3DVWA 3D4MA 1M3IA 4I8BA 5G1KA 3ZMKA 4KSMA 5B6MA 4KUNA 4GWRA 3GSTA 2OADA 2QGVA 1AUWA 3D0ZA 2LEGA 3BJ5A 2WS2A 5DALB 5F0GA 2YN1A 2NTOA 3GYKA 2J9HA 2QGAB 2IJYA 4POKA 4PXOA 4MJEA 5DAKB 1TK0B 1WP0A 4H86A 2OKAA 2F9SA 3GSSA 4ML6A 3QAWA 2OE3A 1JLVA 1MDJA 4LA1A 5ID2B 4NWYA 3UAPA 5J5NA 2E7PA 3EINA 1GTBA 5EPFA 1EZKA 3GL3A 3VLNA 3UBLA 5DCHA 1OKDA 3DMLA 3QOUA 1YDKA 4POBA 4O7HA 2NBSA 4D73B 4ZL7A 2IIYA 1GL8A 1PL2A 3ME8A 3GX8A 1K0NA 4FYBA 3PH9A 2VCZA 3UARA 5F05A 1GTAA 3P2AA 4L57A 1FVJA 2DSAA 3LYKA 2AV4A 3MIXA 3HYPA 1QK8A 2JSZA 2BJXA 3ZVJD 3HJPA 2HZFA 5HR1A 3ED3A 4DSRA 1C3UA 3PGTA 3KH7A 3C7MA 4GQFA 2DJ0A 3QFAC 4OCFA 1FURA 4L5OA 4A5PA 1PX6A 1VF2A 3QAGA 1PKWA 5IPHA 2HSYA 3L78A 2MMNA 4O92A 3F63A 4MDCA 3ISOA 1GH2A 3D21A 1TJWA 1PN9A 1PL1A 4MF7A 4K7IA 2HFDA 3GMFA 2F3MA 2LNTA 3ERFA 2PTQA 3E3EA 2VL3A 3J7Yk 5ECKB 3JCML 2FWEA 1XG8A 3DKSA 1HQOA 4MZBA 4WBRD 2FWFA 1SKWB 4V2NA 1Z4PX 2DIYA 1ZYPA 3BBYA 2MMZA 2F8FA 2H75A 1JZOA 1B9XC 4AF2A 1FO5A 1AAZA 2B5EA 2AYTA 1EWXA 3QAVA 4GSNA 1R5AA 2PBJA 1WMJA 1TU8A 2VL9A 2NVLA 2HE3A 1THXA 2R37A 1Z9HA 3EU4A 4MJAA 4YQUA 2CA8A 1X5CA 1SK2A 3CXGA 3US3A 1FAAA 3SBCA 3GKNA 4G0IA 4XS4B 1YF0A 3QD9A 2JU5A 2FD3A 2YP6A 3A2VA 1K0OA 2CZ2A 2IMEA 5ENUA 1V57A 3GH9A 3ERWA 2RCNA 5J41A 3CMIA 3FRCA 3VK9A 4I2TA 4JRRA 4BA7A 5IO0A 3FW2A 2H1DA 1EEJA 2F8AA 4E8EA 2I1UA 2L59A 3TJBA 4BL7A 2KLXA 3N9JA 3KCMA 2JL4A 1SK0A 4YAPA 1HNAA 4IELA 3D5JA 5D9WA 4EXJA 1ON4A 2VCWA 2I7DA 2H74A 2E0QA 3IOSA 5IOXA 3RRPA 4YAVA 2K8VA 4GSTA 3C71A 3G7YA 2HSMA 3IK7A 2WGRA 4MNNA 2H1AA 5D9XA 4F0CA 5KN3A 1XVWA 4PNGA 2B7KA 4TW5A 3FR9A 3FKFA 4EVMA 1TRVA 2X8CA 3APOA 1T3BA 3U19A 3O6TA 5IO2A 1X0RA 2LRCA 1X5DA 3MWHA 2IMIA 4V2MA 2WDUA 3NOFA 2L4CA 1MD4A 2CZ3A 4IJ3A 1OYJA 4PNFA 1V58A 2K9FA 4WR5A 3MYDA 1ZMAA 1XWGA 3HZ4A 3M9KA 3BWVA 4ZXGA 3A2XA 4XHMA 2PN8A 3RPNA 2QA2A 2R5GA 4HSCX 2LNSA 4KSOA 12GSA 9GSSA 4APAA 3TRPA 3G7JA 1THOA 3LSZA 1XCCA 1XWKA 2V1MA 2A2RA 4Z2TA 4KAEA 1A0FA 2H30A 5C04A 4EDYA 1HNCA 4N10A 3FZ9A 1OKTA 3GURA 4LMVA 2K8SA 3C1SA 1R7HA 3Q19A 4K7NA 5IOWA 1U0LA 3FYGA 2I81A 2VD0A 3CBUA 1OE8A 5CREA 4TR1B 1C72A 5ECQB 4JU5A 3BD2A 4PURA 2CX3A 3TJFA 2LV3A 3EC3A 1PX7A 3EVIA 2FUSA 4EIQA 5GAND 4E88A 5IM9A 3DXBA 1XPVA 3PINA 2I3YA 6GSSA 4HGVA 6GSWA 1DSBA 3K8NA 3TV2A 2C3QA 4MJCA 2FHEA 3D6IA 3G7IA 4N30A 2PWJA 2IMFA 5CRWA 3KD0A 3PR8A 3F6FA 4RI6A 1YJ6A 1YF1A 1YZXA 4ML1A 2YANA 2GQMA 4BVYB 3F9UA 1Q92A 4J57E 3DEXA 1G6YA 3TKSE 1ERVA 4GXZA 3TUEA 2HZEA 3W8JA 20GSA 2V6KA 4OCEA 2PMTA 4ID0A 3HVXA 2N5BA 2YWOA 2OE1A 1N8JA 3IA1A 2LRNA 1WE0A 2FA4A 1M9BA 4F0BA 4HZ4A 4ZB9A 5F06A 1Z4JA 1FW1A 1AC1A 2O7KA 4KCAA 5G1LA 2OE0A 1BX9A 3VWVA 4WBJA 2IMDA 3GKXA 3IRAA 4NSLA 3KM6A 5IMVA 2PERA 4KA0A 2JZRA 4IVFA 3LWAA 2X4AA 1C3CA 1IYHA 2GLRA 2MYGA 1MD3A 3FZAA 4G9HA 1TOFA 4MF5A 2A2SA 3R6VA 5DCGA 3C73A 1TXXA 1UN2A 3RD8A 5CO3A 1U88A 2GSQA 1U6TA 2YNXA 5B6NA 4KE3A 1Z4KA 4LL4B 4Q5FA 4FYCA 5F91A 2OACA 3QBPA 2K6VA 3U13A
chains in the Genus database with same CATH topology
2H76A 3HJMA 1S3DA 4BPYA 3R3EA 1JHBA 3CYNA 1A0RP 3VI5A 4MZWA 3Q18A 5AN1A 2DLXA 4MABA 1GUKA 3RDWA 4QL7A 3G9BA 2A2PA 4JEDA 1NM3A 5DVBA 1IW7D 1QUWA 3GNJA 1O81A 3KH9A 2GDRA 1NHYA 5J9BA 3PPUA 2PVOC 1EP8A 2HRKA 3U5RE 1K0MA 2ALBA 2GQKA 4X0XA 1TP9A 5JCUA 1WRYA 3IC8A 3TDGA 1ML6A 2HYXA 4FO5A 4I6XA 3CTFA 5ECRB 1PQNA 2JZTA 2X8HA 4BVXB 2VUPA 1QGVA 3KXOA 1U3AA 4TR3A 4F82A 5HR0A 2MZCA 2WZ9A 1SKSB 2QSIA 4O5QA 3CSIA 4MJBA 2FGXA 3GN3A 4L8EA 2YJ7A 3VI7A 4F9ZA 3IR4A 4LL1B 1TW9A 2AAWA 2LTKA 1F6MC 4LLRA 1XVQA 1J08A 1ILOA 2GS3A 2QC7A 1YEXA 4XS1A 3VWWA 3A5WA 3I6AA 1VRSD 3S9FA 2DMLA 2VL2C 3EURA 1K0BA 1ZYEA 5DAKA 4OFMA 1MTCA 2LQOA 1TI3A 4OO5A 1LBKA 1O7UA 4DEJA 5ECSA 1TTZA 2DJJA 2YV7A 1F2EA 5HQPA 5HR3A 4X43A 3CTGA 3WGXA 1AQXA 4L0UA 3TRXA 2RUFA 1ABAA 1M2DA 1GLPA 1TJDA 4ECBA 3TKSC 5ELAA 1GSQA 2K18A 1EGOA 3M3MA 3TKSA 1K3LA 3TRQA 3GH6A 4XRDA 4ZIJA 2HT9A 4TRXA 2WULA 1A2JA 1G7OA 2GGTA 3UBKA 2GZPA 4V1Ag 2LJAA 2XPEA 2JACA 5FWGA 3UJ1A 1K3OA 5CRDA 2C3NA 4HEA2 2V6OA 5HFGA 1JZRA 4NAXA 1PA3A 2GT6A 4KW6A 1S3AA 3VPTA 1DUGA 2DJKA 4CDOA 3TJKA 4TR4A 4DSSB 1JFUA 5IMCA 3F4SA 3M0FA 5B8BA 1X5EA 1GWCA 2H66A 2L57A 2RLIA 2WJUA 5ELGA 3GA4A 1PKZA 4NXIA 2F51A 4G2EA 4F03A 5A4WA 1M0UA 4ZL8A 5CAXA 4IQ1A 1X9SB 2X99A 4KX4A 1O73A 2YOIA 3EE2A 1SD9A 1XW5A 3HJOA 3EMXA 4XS6A 2WRTA 4HUAA 2VLTA 3WT2A 1V98A 1HNBA 2P31A 1O8WA 2CX4A 1B4PA 2YZUA 4JR4A 2M80A 1GUMA 1OC8A 1I9DA 3EYTA 3RHCA 3EMPA 19GSA 5EY6A 5H5RA 2O87A 5D9TA 3UEMA 1AIUA 2P5QA 2C0EA 1Z5YE 4ZL9A 4K2XA 4YQMA 2X64A 2R3XA 10GSA 1Z7RA 3TKRA 4PTSA 4KDYA 1XOAA 1QXHA 4D73A 2V2GA 2CAIA 4G10A 1Y6EA 4ECCA 5IMZA 4OFNA 4NPBA 2X49A 3GHAA 4F2IA 4CHSA 2WB9A 1SJIA 4E8HA 3LQ7A 13GSA 1Q98A 4HOJA 1YQ1A 1GNWA 2KUCA 1WPIA 3TCOA 2QA1A 4ULXA 1A23A 4TN8A 1NSWA 4RQXA 3C1RA 1I5GA 1A8YA 2VM2A 4IS0A 3MSZA 2PPTA 2OA7A 1FOHA 3ZLPA 3FMWA 1ST9A 1EOHA 4X4JA 4Q5RA 4BVXA 3IHGA 1EEMA 2UZ8A 5ECIB 1XW9A 2C0FA 5AIVA 3FR3A 3KJYA 4OFTA 1ZCPA 3ZVJA 2WCIA 4ILFA 2DBCA 4GF0A 1F9MA 3VFIA 2I4AA 3MNGA 18GSA 5IIZA 1V40A 1SU9A 2C1YA 3M1GA 2RIIA 4PQ1A 4AGSA 3RBTA 1SENA 5A5KA 3HDCA 1Z7PA 2ON5A 1ZGNA 2DIZA 4EE0A 3BCIA 4OMVA 4WETA 4EC0A 3UIWA 4YH2A 2H0HA 2OJLA 3AY8A 4ZILA 1TRSA 4EF0A 4HDEA 3SWLA 4G0KA 4GQCA 3EWLA 1ZOFA 2L5LA 2MMOA 1YY7A 2DJ2A 2HRAA 1T4ZA 4K5RA 2R0GA 4MP4A 3RPPA 4IBPA 4MLYA 2H6XA 1KEBA 5KEJA 4O5UA 1FVKA 2CT6A 2C8UA 3L9UA 3UOMA 1O6JA 2YPMA 1GSEA 4Z2UA 4QQ7A 4ZB6A 1BEDA 2LJRA 5DALA 1AXDA 2KOKA 2C4JA 2YJHA 1Z3EA 1TDIA 2Z9SA 2YWNA 2AHEA 3KMNA 3KGKA 1GUHA 1JZWA 4IKHA 4RI7A 5CRHA 2XPDA 3GTUA 3M8NA 1M7TA 1E2YA 1OE7A 3ZIVA 1VF1A 3LYPA 4ZB8A 3ERGA 2GSTA 4ZBDA 3KIJA 3L0HA 2BTOT 5B8AA 3TKQA 3DVXA 1K0DA 3O3TA 3TOUA 2GSSA 4FH8A 2VLVA 1M2BA 1BAYA 1PD21 4HZ2A 1OAZA 1M99A 1SD8A 2VCXA 3CSJA 1EP7A 4BL7B 2YV9A 1XFLA 1H75A 4EUYA 4IP1A 1Y25A 2O89A 1TK8B 1EV4A 2D2ZA 4L5LA 1BYEA 4G19A 2FUG2 1MEKA 3QR6A 2KP1A 3ZZXA 2MMAA 3KP8A 5LCZA 2PU9C 2VL2A 3FR6A 1B4QA 3F6DA 3F8UA 2RUEA 5L71A 1M9AA 2HSHA 5ECNB 4CY8A 2AJQB 1USBA 5KN1A 3QFBC 5C00A 5DJLA 14GSA 3APSA 1DBYA 2H8LA 1ZL9A 4MCUA 4EIPA 3WYWA 3FEUA 5D96A 4TXOB 5CYYA 3Q74A 2HLSA 1M2AA 3M9JA 3IBHA 1XWAA 1FG4A 5JCWA 1LJRA 1KTEA 1GSYA 4MK3A 3VPQA 4V1Ap 1W89A 5KN2A 3C8EA 2H71A 1N2AA 1PRXA 5FHIA 2NPBA 2IFQB 5F8BA 3GKMA 3IK9A 1TRWA 1A2MA 4YQVA 1XW6A 3CRTA 1XWBA 3GX0A 2VOCA 4KDUA 1K0AA 3F0IA 3WGDA 4AJ6A 4WF5A 4NMUA 4X1UA 1OC9B 3IXRA 2XBQA 1A2LA 3P90A 2ZCTA 1WIKA 2OBKA 1HD2A 3H79A 2FCHA 1XBSA 1TKDB 5KN0A 2PVQA 11GSA 1OC3A 4NHWA 4XRAA 4ACSA 4WXTA 4DSSA 4CW9A 1VGLA 5EVOA 4O32A 3ZL5A 1NW2A 3LFLA 1GSUA 3L4NA 3WD6A 2HRNA 2LS5A 3WT1A 1TK5B 3APQA 1PGTA 1Z6MA 4XCSA 1Z6NA 2G0FA 4Z7XA 4I97A 5JCGA 1QMVA 2H70A 1TU7A 5BMUA 2HNLA 2P0GA 2VO4A 5D9VA 4Z2RA 1OVNA 1BG5A 4EL1A 4XS4A 3ZRDA 4CY6A 2AB6A 4HU7A 4OD7A 1FHEA 2GT5A 4K2DA 2CAQA 4YKFA 4POMA 1ZZYA 1X9MB 6GSVA 1J0FA 3E0UA 3HD5A 3KZQA 3IAS2 3HY2A 1R4WA 8GSSA 4GCIA 4DSQA 1QQ2A 4PX1A 5G5EA 5HFKA 5E59A 1UA5A 2EIOA 2VM1A 2H01A 2AUVA 3RAZA 2B1LA 3WGEA 4ZBAA 4EDZA 2VCTA 1SJZA 2VD1A 3H1NA 2PUKC 2V41A 4IQAA 1K0CA 1LU4A 1TI1A 2HXKA 1WOUA 2OBIA 2IL3A 5D73A 1UVZA 4IGJA 3ME7A 2TRXA 2YWMA 5G30A 5A4VA 3P7XA 4HU9A 2R2JA 2RM6A 3UVTA 2MBTA 1A24A 2VCVA 5DBQA 1TRUA 4K5SA 4PUFC 1CQHA 4K0GA 2L6CA 3CRUA 4MA9A 2ZNMA 1F3AA 3I43A 1V9WA 5ECLB 4TVEA 2H1GA 3Q6OA 4ICYA 1ZYNA 3W6GA 4KF9A 3NIVA 1EGRA 2HZEB 3TJJA 3DD3A 4K0NA 2V32A 3LG6A 4MPGA 3IE3A 4XIHA 1FB0A 2FA8A 4KGIA 2EC4A 3GFKA 3QCPA 1OC9A 3UMAA 4N11A 3GRXA 1ERWA 1S3CA 1ERUA 3DYRA 1T7PB 2R6KA 2B3SA 1T4YA 1B48A 1GRXA 2DC5A 5IQYA 2FLSA 2H19A 2YZHA 4RQRA 1PN0A 3HA9A 3ZYWA 1G6WA 3ZTLA 1ERTA 2JSYA 4K7OA 1H4OA 3HKRA 22GSA 2IFQA 4ISDA 4EKZA 2I9HA 3GL5A 2TRCP 1NHOA 2H1BA 4XTSA 3ZMLA 2J23A 4LMWA 2DKHA 4IN0A 1PMTA 4IJIA 2B1KA 4N0ZA 4K9ZA 1GP1A 4I2UA 4PGTA 6GSXA 3LXZA 1GNEA 1URMA 2YWIA 3MDKA 2E2GA 3IAM2 3KTLA 5D93A 1XXUA 2PGTA 1EV9A 4I5QA 1BQ7A 2A4HA 2DKIA 3GUSA 4USSA 2FWGA 2H6YA 4L0WA 3ZREA 1YEPA 4HI7A 5JWRB 4HS1A 1A8LA 4WR4A 5IPGA 2KHPA 2MBSA 4AJ8A 1AQVA 4HQZA 4EO3A 4BVYA 4QL9A 2WFCA 1V2AA 2R4VA 4IP6A 2H6ZA 1T1VA 5IMDA 5JWOB 3EU3A 5FT3A 1AW9A 4PUAA 3A2WA 1CQGA 3BCKA 1KBNA 1HYUA 1G7EA 4ECJA 1SK1A 2L5OA 1U87A 3IPZA 4TR0A 5GSTA 1AQWA 4K6XA 5LD0A 3GTUB 1R5PA 2L6DA 4NV5A 2D28C 2LKUA 1F37A 1O85A 3MAKA 3HVVA 5AIXA 4HQSA 5AISA 4FYUA 3FZ4A 2ES7A 1SKRB 3U6VA 4MH2A 2DJ3A 3IHQA 1SL0B 1SYRA 2XBIA 3FZ5A 5EL8A 2B6MA 2LUSA 3F4TA 2GSRA 3OR5A 2GTUA 3NZNA 4FQUA 3A5IA 3I9V2 4DVCA 3GIXA 2C0GA 2O85A 5H5SA 1DE1A 3QMXA 3FHKA 3VWXA 4MMMA 4J2FA 1B9YC 5KOXA 4IHUA 4BWSA 4ZBBA 1BJXA 4KDXA 3IV4A 2GZZA 4O5RA 5ECHB 1W4VA 2DJ1A 1F3BA 2CVDA 2M46A 2VAFA 2B7JA 4Q5QA 2R0PA 3LGCA 4WKWA 4AJ7A 4BWQA 3ZIJA 2BMXA 5DQYA 3DRNA 3ZITA 3DIEA 1GTIA 2LQQA 2XHFA 4TXVA 3UVHA 2FY6A 5GZZB 4JBBA 2ZUPA 3LJRA 5ID2A 2KP2A 4TOPA 4MF6A 1G0TA 3IC4A 3H4KA 1JLWA 1K3YA 1YKAA 2CVKA 5F07A 2A4VA 4JE1A 4K1FA 3QDNA 4PQHA 4JR6A 2B5YA 5AGYA 3EPTA 3LXTA 1EOGA 2ON7A 3LEFA 3HHVA 1J9BA 1X9WB 2EIRA 4IQJM 5HR2A 2IMKA 5ECOB 2GQLA 2IWTA 5B7CA 4V2LA 1Q4JA 3F3QA 1R26A 5J3RA 4PQIA 1YKCA 1ACVA 2R0CA 5INYA 3UL3A 1SL2B 2P5RA 2LSTA 3V1WA 3ZFLA 3DGQA 2CQ9A 3HCZA 4GRFA 4GSSA 4TXOA 2H0GA 1RK4A 1XWCA 3O76A 4GLTA 3FY7A 4RUVA 1MDIA 1DE2A 2CVBA 3J7Yb 2EIQA 2E2MA 3DWVA 4GTUA 1O8XA 2O8VB 3LORA 2H72A 3GKKA 4JZQA 3D22A 2FNOA 3BOAA 5LNKe 4G0LA 5IMAA 4Q5NA 2VLUA 5DQSA 4N0VA 3I69A 3KEBA 4OO4A 3RHBA 1T00A 3QPMA 2LJKA 1E6BA 5DJMA 1GSFA 2HRFA 1GSDA 3F4RA 3FK8A 2D27A 2YCDA 1KNGA 2B5XA 5ECMB 5KOWA 1GLQA 2H73A 5ABRA 5A4UA 4HJ2A 2IPAA 5D8IA 4KCEA 3KMOA 2G2QA 2JZSA 3R2QA 5G2ZA 4P3YB 3HVSA 17GSA 2IN3A 5J9CA 5J4UA 1RQMA 2L4QA 3E9JB 1UC7A 6GSTA 3H8QA 1GULA 1ZYQB 2TIRA 5GAPD 5ECPB 1SYXA 5BRTA 3H93A 2VCQA 4KH7A 4TKYA 1XIYA 2C80A 2REMA 5HFIA 1SJ6A 5G31A 1T8EB 1VF3A 1XZOA 2HI7A 2M72A 1GSSA 3HZ8A 5G5FA 4WEYA 2N5FA 4IW9A 2X8GA 1WWJA 3TGZA 5COHA 1FB6A 4HJMA 4FIWA 2JADA 3IDVA 16GSA 3P8WA 2LRTA 2VIMA 5CRGA 4TR1A 2RM5A 1RW1A 3D4TA 3L9SA 3F3RA 1VF4A 4NHZA 1QFNA 5CP1A 1XOBA 2CV4A 3LW9A 4MZCA 4NV2A 3VURA 3KP9A 2N5AA 4MPFA 1FOVA 2NDOA 5IMFA 6GSYA 4WF4A 5GSSA 3HXSA 1JZDA 2C3TA 3ZFBA 2H0IA 4OWYA 4J56E 2GVPA 2GZYA 3N5OA 1B8XA 4KB3A 3TJGA 3GV1A 3TKPA 3A3TA 4KNDA 4MH3A 3VWUA 5JWQB 1U3IA 1PSQA 1IYIA 1AUCA 2XC2A 3L9VA 2C0DA 1SL1B 7GSSA 1WJKA 4ECIA 4YKGA 3W8SA 5DDLA 3CSHA 3KTBA 6GSUA 1GTUA 2DMMA 1MDKA 5E4WA 5CNWA 5H5QA 3TOTA 2QKEA 3TB2A 2FWHA 4K8MA 4POLA 3DVWA 3D4MA 4I8BA 5G1KA 3ZMKA 4KSMA 5B6MA 4KUNA 4GWRA 3GSTA 2OADA 2QGVA 3D0ZA 2LEGA 3BJ5A 2WS2A 5DALB 5F0GA 2YN1A 2NTOA 3GYKA 2J9HA 2IJYA 4POKA 4PXOA 4MJEA 5DAKB 1TK0B 1WP0A 4H86A 2OKAA 2F9SA 3GSSA 4ML6A 3QAWA 2OE3A 1JLVA 1MDJA 4LA1A 5ID2B 4NWYA 3UAPA 5J5NA 2E7PA 3EINA 1GTBA 5EPFA 1EZKA 3GL3A 3VLNA 3UBLA 5DCHA 1OKDA 3DMLA 3QOUA 1YDKA 4POBA 4O7HA 2NBSA 4D73B 4ZL7A 2IIYA 1GL8A 1PL2A 3ME8A 3GX8A 1K0NA 4FYBA 3PH9A 2VCZA 3UARA 5F05A 1GTAA 3P2AA 1FVJA 2DSAA 3LYKA 2AV4A 3MIXA 3HYPA 1QK8A 2JSZA 2BJXA 3ZVJD 3HJPA 2HZFA 5HR1A 3ED3A 4DSRA 3PGTA 3KH7A 3C7MA 4GQFA 2DJ0A 3QFAC 4OCFA 4L5OA 4A5PA 1PX6A 1VF2A 3QAGA 1PKWA 5IPHA 2HSYA 3L78A 2MMNA 4O92A 3F63A 4MDCA 3ISOA 1GH2A 3D21A 1PN9A 1PL1A 4MF7A 4K7IA 2HFDA 3GMFA 2F3MA 2LNTA 3ERFA 3E3EA 2VL3A 3J7Yk 5ECKB 3JCML 2FWEA 4MZBA 3DKSA 1HQOA 4WBRD 2FWFA 1SKWB 4V2NA 2DIYA 1ZYPA 3BBYA 2MMZA 2F8FA 2H75A 1JZOA 1B9XC 4AF2A 1FO5A 1AAZA 2B5EA 2AYTA 1EWXA 3QAVA 4GSNA 1R5AA 2PBJA 1WMJA 1TU8A 2VL9A 2NVLA 2HE3A 1THXA 2R37A 1Z9HA 3EU4A 4MJAA 4YQUA 2CA8A 1X5CA 1SK2A 3CXGA 3US3A 1FAAA 3SBCA 3GKNA 4G0IA 4XS4B 1YF0A 3QD9A 2JU5A 2FD3A 2YP6A 3A2VA 1K0OA 2CZ2A 2IMEA 5ENUA 1V57A 3GH9A 3ERWA 5J41A 3CMIA 3FRCA 3VK9A 4I2TA 4JRRA 4BA7A 5IO0A 3FW2A 2H1DA 1EEJA 2F8AA 4E8EA 2I1UA 2L59A 3TJBA 4BL7A 2KLXA 3N9JA 3KCMA 2JL4A 1SK0A 4YAPA 1HNAA 4IELA 3D5JA 5D9WA 4EXJA 1ON4A 2VCWA 2H74A 2E0QA 3IOSA 5IOXA 4YAVA 2K8VA 4GSTA 3C71A 3G7YA 2HSMA 3IK7A 2WGRA 4MNNA 2H1AA 5D9XA 4F0CA 5KN3A 1XVWA 4PNGA 2B7KA 4TW5A 3FR9A 3FKFA 4EVMA 1TRVA 2X8CA 3APOA 1T3BA 3O6TA 5IO2A 1X0RA 2LRCA 1X5DA 3MWHA 2IMIA 4V2MA 2WDUA 3NOFA 2L4CA 1MD4A 2CZ3A 4IJ3A 1OYJA 4PNFA 1V58A 2K9FA 4WR5A 3MYDA 1ZMAA 1XWGA 3HZ4A 3M9KA 4ZXGA 3A2XA 4XHMA 2PN8A 3RPNA 2QA2A 2R5GA 2LNSA 4KSOA 12GSA 9GSSA 3TRPA 3G7JA 1THOA 3LSZA 1XCCA 1XWKA 2V1MA 2A2RA 4Z2TA 4KAEA 1A0FA 2H30A 5C04A 4EDYA 1HNCA 4N10A 3FZ9A 1OKTA 3GURA 4LMVA 2K8SA 3C1SA 1R7HA 3Q19A 4K7NA 5IOWA 3FYGA 2I81A 2VD0A 3CBUA 1OE8A 5CREA 4TR1B 1C72A 5ECQB 4JU5A 3BD2A 4PURA 2CX3A 3TJFA 2LV3A 3EC3A 1PX7A 3EVIA 4EIQA 5GAND 5IM9A 3DXBA 1XPVA 3PINA 2I3YA 6GSSA 6GSWA 1DSBA 3K8NA 2C3QA 4MJCA 2FHEA 3D6IA 3G7IA 4N30A 2PWJA 2IMFA 5CRWA 3KD0A 3PR8A 3F6FA 4RI6A 1YJ6A 1YF1A 1YZXA 4ML1A 2YANA 2GQMA 4BVYB 3F9UA 4J57E 3DEXA 1G6YA 3TKSE 1ERVA 4GXZA 3TUEA 2HZEA 3W8JA 20GSA 2V6KA 4OCEA 2PMTA 4ID0A 3HVXA 2N5BA 2YWOA 2OE1A 1N8JA 3IA1A 2LRNA 1WE0A 2FA4A 1M9BA 4F0BA 4HZ4A 4ZB9A 5F06A 1FW1A 1AC1A 2O7KA 4KCAA 5G1LA 2OE0A 1BX9A 3VWVA 4WBJA 2IMDA 3GKXA 3IRAA 3KM6A 5IMVA 2PERA 4KA0A 2JZRA 4IVFA 3LWAA 2X4AA 1IYHA 2GLRA 2MYGA 1MD3A 3FZAA 4G9HA 1TOFA 4MF5A 2A2SA 5DCGA 3C73A 1TXXA 1UN2A 5CO3A 1U88A 2GSQA 1U6TA 2YNXA 5B6NA 4KE3A 4LL4B 4Q5FA 4FYCA 2OACA 2K6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H76 A;  3HJM A;  1S3D A;  4BPY A;  1JHB A;  3CYN A;  1A0R P;  3VI5 A;  4MZW A;  3Q18 A;  5AN1 A;  2DLX A;  4MAB A;  1GUK A;  3RDW A;  4QL7 A;  3G9B A;  4JED A;  1NM3 A;  5DVB A;  1QUW A;  3GNJ A;  1O81 A;  3KH9 A;  2GDR A;  1NHY A;  5J9B A;  2PVO C;  1EP8 A;  3U5R E;  1K0M A;  2ALB A;  2GQK A;  4X0X A;  1TP9 A;  5JCU A;  1WRY A;  3TDG A;  1ML6 A;  2HYX A;  4FO5 A;  4I6X A;  3CTF A;  5ECR B;  1PQN A;  2JZT A;  2X8H A;  2VUP A;  1QGV A;  3KXO A;  1U3A A;  4TR3 A;  4F82 A;  5HR0 A;  2MZC A;  2WZ9 A;  1SKS B;  2QSI A;  3CSI A;  4MJB A;  2FGX A;  3GN3 A;  4L8E A;  2YJ7 A;  3VI7 A;  4F9Z A;  3IR4 A;  4LL1 B;  1TW9 A;  2AAW A;  2LTK A;  1F6M C;  4LLR A;  1XVQ A;  1J08 A;  1ILO A;  2GS3 A;  2QC7 A;  1YEX A;  4XS1 A;  3VWW A;  3A5W A;  3I6A A;  1VRS D;  3S9F A;  2DML A;  2VL2 C;  3EUR A;  1K0B A;  1ZYE A;  5DAK A;  4OFM A;  1MTC A;  2LQO A;  1TI3 A;  4OO5 A;  1LBK A;  1O7U A;  4DEJ A;  5ECS A;  1TTZ A;  2DJJ A;  2YV7 A;  1F2E A;  5HQP A;  5HR3 A;  4X43 A;  3CTG A;  3WGX A;  1AQX A;  4L0U A;  3TRX A;  2RUF A;  1ABA A;  1M2D A;  1GLP A;  1TJD A;  4ECB A;  3TKS C;  5ELA A;  1GSQ A;  2K18 A;  1EGO A;  3M3M A;  3TKS A;  1K3L A;  3TRQ A;  3GH6 A;  4XRD A;  4ZIJ A;  2HT9 A;  4TRX A;  2WUL A;  1A2J A;  1G7O A;  2GGT A;  3UBK A;  2GZP A;  4V1A g;  2LJA A;  2XPE A;  2JAC A;  5FWG A;  3UJ1 A;  1K3O A;  5CRD A;  2C3N A;  4HEA 2;  2V6O A;  5HFG A;  1JZR A;  4NAX A;  1PA3 A;  2GT6 A;  4KW6 A;  1S3A A;  3VPT A;  1DUG A;  2DJK A;  4CDO A;  3TJK A;  4TR4 A;  4DSS B;  1JFU A;  3F4S A;  3M0F A;  5IMC A;  5B8B A;  1X5E A;  1GWC A;  2H66 A;  2L57 A;  2RLI A;  2WJU A;  5ELG A;  3GA4 A;  1PKZ A;  4NXI A;  2F51 A;  4G2E A;  4F03 A;  5A4W A;  1M0U A;  4ZL8 A;  5CAX A;  4IQ1 A;  1X9S B;  2X99 A;  4KX4 A;  1O73 A;  2YOI A;  3EE2 A;  1SD9 A;  1XW5 A;  3HJO A;  3EMX A;  4XS6 A;  2WRT A;  4HUA A;  2VLT A;  3WT2 A;  1V98 A;  1HNB A;  2P31 A;  1O8W A;  2CX4 A;  1B4P A;  2YZU A;  4JR4 A;  2M80 A;  1GUM A;  1OC8 A;  1I9D A;  3EYT A;  3RHC A;  3EMP A;  19GS A;  5EY6 A;  5H5R A;  2O87 A;  5D9T A;  3UEM A;  1AIU A;  2P5Q A;  2C0E A;  1Z5Y E;  4ZL9 A;  4YQM A;  2X64 A;  2R3X A;  10GS A;  1Z7R A;  3TKR A;  4KDY A;  1XOA A;  1QXH A;  4D73 A;  2V2G A;  2CAI A;  4G10 A;  1Y6E A;  4ECC A;  5IMZ A;  4OFN A;  4NPB A;  3GHA A;  4F2I A;  4CHS A;  2WB9 A;  1SJI A;  4E8H A;  3LQ7 A;  13GS A;  1Q98 A;  4HOJ A;  1YQ1 A;  1GNW A;  2KUC A;  1WPI A;  3TCO A;  4ULX A;  1A23 A;  4TN8 A;  1NSW A;  4RQX A;  3C1R A;  1I5G A;  1A8Y A;  2VM2 A;  4IS0 A;  3MSZ A;  2PPT A;  2OA7 A;  3ZLP A;  1ST9 A;  1EOH A;  4Q5R A;  4BVX A;  1EEM A;  5ECI B;  1XW9 A;  2C0F A;  5AIV A;  3FR3 A;  3KJY A;  4OFT A;  1ZCP A;  3ZVJ A;  2WCI A;  4ILF A;  2DBC A;  4GF0 A;  1F9M A;  3VFI A;  2I4A A;  3MNG A;  18GS A;  5IIZ A;  1V40 A;  1SU9 A;  2C1Y A;  3M1G A;  2RII A;  4PQ1 A;  4AGS A;  3RBT A;  1SEN A;  5A5K A;  3HDC A;  1Z7P A;  2ON5 A;  1ZGN A;  2DIZ A;  4EE0 A;  3BCI A;  4OMV A;  4WET A;  4EC0 A;  3UIW A;  4YH2 A;  2H0H A;  2OJL A;  3AY8 A;  4ZIL A;  1TRS A;  4EF0 A;  4HDE A;  3SWL A;  4GQC A;  3EWL A;  1ZOF A;  2L5L A;  2MMO A;  1YY7 A;  2DJ2 A;  1T4Z A;  4MP4 A;  3RPP A;  4IBP A;  4MLY A;  2H6X A;  1KEB A;  5KEJ A;  1FVK A;  2CT6 A;  2C8U A;  3L9U A;  3UOM A;  1O6J A;  2YPM A;  1GSE A;  4QQ7 A;  4ZB6 A;  1BED A;  2LJR A;  5DAL A;  1AXD A;  2KOK A;  2C4J A;  2YJH A;  1Z3E A;  1TDI A;  2Z9S A;  2YWN A;  2AHE A;  3KMN A;  3KGK A;  1GUH A;  1JZW A;  4IKH A;  4RI7 A;  5CRH A;  2XPD A;  3GTU A;  3M8N A;  1M7T A;  1E2Y A;  1OE7 A;  3ZIV A;  1VF1 A;  3LYP A;  4ZB8 A;  3ERG A;  2GST A;  4ZBD A;  3KIJ A;  3L0H A;  2BTO T;  5B8A A;  3TKQ A;  3DVX A;  1K0D A;  3O3T A;  3TOU A;  2GSS A;  4FH8 A;  2VLV A;  1M2B A;  1BAY A;  1PD2 1;  4HZ2 A;  1OAZ A;  1M99 A;  1SD8 A;  2VCX A;  3CSJ A;  1EP7 A;  2YV9 A;  1XFL A;  1H75 A;  4EUY A;  4IP1 A;  1Y25 A;  2O89 A;  1TK8 B;  1EV4 A;  2D2Z A;  4L5L A;  1BYE A;  4G19 A;  2FUG 2;  1MEK A;  3QR6 A;  2KP1 A;  3ZZX A;  2MMA A;  3KP8 A;  5LCZ A;  2PU9 C;  2VL2 A;  3FR6 A;  1B4Q A;  3F6D A;  3F8U A;  2RUE A;  5L71 A;  1M9A A;  2HSH A;  5ECN B;  2AJQ B;  1USB A;  5KN1 A;  3QFB C;  5C00 A;  5DJL A;  14GS A;  3APS A;  1DBY A;  2H8L A;  1ZL9 A;  4MCU A;  3WYW A;  3FEU A;  5D96 A;  4TXO B;  5CYY A;  3Q74 A;  2HLS A;  1M2A A;  3M9J A;  3IBH A;  1XWA A;  1FG4 A;  5JCW A;  1LJR A;  1KTE A;  1GSY A;  3VPQ A;  4MK3 A;  4V1A p;  1W89 A;  5KN2 A;  3C8E A;  2H71 A;  1N2A A;  1PRX A;  5FHI A;  2NPB A;  2IFQ B;  5F8B A;  3GKM A;  3IK9 A;  1TRW A;  1A2M A;  4YQV A;  1XW6 A;  3CRT A;  1XWB A;  3GX0 A;  2VOC A;  4KDU A;  1K0A A;  3F0I A;  3WGD A;  4AJ6 A;  4WF5 A;  4NMU A;  4X1U A;  1OC9 B;  3IXR A;  2XBQ A;  1A2L A;  3P90 A;  2ZCT A;  1WIK A;  2OBK A;  1HD2 A;  3H79 A;  2FCH A;  1XBS A;  1TKD B;  5KN0 A;  2PVQ A;  11GS A;  1OC3 A;  4NHW A;  4XRA A;  4ACS A;  4WXT A;  4DSS A;  4CW9 A;  1VGL A;  5EVO A;  4O32 A;  3ZL5 A;  1NW2 A;  3LFL A;  1GSU A;  3L4N A;  3WD6 A;  2HRN A;  2LS5 A;  3WT1 A;  1TK5 B;  3APQ A;  1PGT A;  1Z6M A;  4XCS A;  1Z6N A;  2G0F A;  4Z7X A;  4I97 A;  5JCG A;  1QMV A;  2H70 A;  1TU7 A;  2HNL A;  2P0G A;  2VO4 A;  5D9V A;  1OVN A;  1BG5 A;  4EL1 A;  4XS4 A;  3ZRD A;  2AB6 A;  4HU7 A;  4OD7 A;  1FHE A;  2GT5 A;  4K2D A;  2CAQ A;  4POM A;  1ZZY A;  1X9M B;  6GSV A;  1J0F A;  3E0U A;  3HD5 A;  3KZQ A;  3IAS 2;  3HY2 A;  1R4W A;  8GSS A;  4GCI A;  4DSQ A;  1QQ2 A;  4PX1 A;  5G5E A;  5HFK A;  5E59 A;  1UA5 A;  2EIO A;  2VM1 A;  2H01 A;  2AUV A;  3RAZ A;  2B1L A;  3WGE A;  4ZBA A;  4EDZ A;  2VCT A;  1SJZ A;  2VD1 A;  3H1N A;  2PUK C;  2V41 A;  4IQA A;  1K0C A;  1LU4 A;  1TI1 A;  2HXK A;  1WOU A;  2OBI A;  2IL3 A;  5D73 A;  1UVZ A;  4IGJ A;  3ME7 A;  2TRX A;  2YWM A;  5G30 A;  5A4V A;  3P7X A;  4HU9 A;  2R2J A;  2RM6 A;  3UVT A;  2MBT A;  1A24 A;  2VCV A;  5DBQ A;  1TRU A;  4PUF C;  1CQH A;  4K0G A;  2L6C A;  3CRU A;  4MA9 A;  2ZNM A;  1F3A A;  3I43 A;  1V9W A;  5ECL B;  4TVE A;  2H1G A;  3Q6O A;  3W6G A;  3NIV A;  1EGR A;  2HZE B;  3TJJ A;  3DD3 A;  4K0N A;  2V32 A;  3LG6 A;  4MPG A;  3IE3 A;  4XIH A;  1FB0 A;  2FA8 A;  4KGI A;  2EC4 A;  3GFK A;  3QCP A;  1OC9 A;  3UMA A;  4N11 A;  3GRX A;  1ERW A;  1S3C A;  1ERU A;  3DYR A;  1T7P B;  2R6K A;  2B3S A;  1T4Y A;  1B48 A;  1GRX A;  2DC5 A;  5IQY A;  2FLS A;  2H19 A;  2YZH A;  4RQR A;  3HA9 A;  3ZYW A;  1G6W A;  3ZTL A;  1ERT A;  2JSY A;  4K7O A;  1H4O A;  3HKR A;  22GS A;  2IFQ A;  4ISD A;  4EKZ A;  2I9H A;  3GL5 A;  2TRC P;  1NHO A;  2H1B A;  4XTS A;  3ZML A;  2J23 A;  4LMW A;  4IN0 A;  1PMT A;  4IJI A;  2B1K A;  4N0Z A;  4K9Z A;  1GP1 A;  4I2U A;  4PGT A;  6GSX A;  3LXZ A;  1GNE A;  1URM A;  2YWI A;  3MDK A;  2E2G A;  3IAM 2;  3KTL A;  5D93 A;  1XXU A;  2PGT A;  1EV9 A;  4I5Q A;  1BQ7 A;  3GUS A;  2FWG A;  2H6Y A;  4L0W A;  3ZRE A;  1YEP A;  4HI7 A;  5JWR B;  4HS1 A;  1A8L A;  4WR4 A;  5IPG A;  2KHP A;  2MBS A;  4AJ8 A;  1AQV A;  4HQZ A;  4EO3 A;  4BVY A;  4QL9 A;  2WFC A;  1V2A A;  2R4V A;  4IP6 A;  2H6Z A;  1T1V A;  5IMD A;  5JWO B;  3EU3 A;  5FT3 A;  1AW9 A;  4PUA A;  3A2W A;  1CQG A;  3BCK A;  1KBN A;  1HYU A;  1G7E A;  4ECJ A;  1SK1 A;  2L5O A;  1U87 A;  3IPZ A;  4TR0 A;  5GST A;  1AQW A;  4K6X A;  5LD0 A;  3GTU B;  1R5P A;  2L6D A;  4NV5 A;  2LKU A;  1F37 A;  1O85 A;  3MAK A;  3HVV A;  5AIX A;  4HQS A;  5AIS A;  4FYU A;  3FZ4 A;  2ES7 A;  1SKR B;  3U6V A;  4MH2 A;  2DJ3 A;  3IHQ A;  1SL0 B;  1SYR A;  2XBI A;  3FZ5 A;  5EL8 A;  2B6M A;  2LUS A;  3F4T A;  2GSR A;  3OR5 A;  2GTU A;  3NZN A;  3I9V 2;  4DVC A;  3GIX A;  2C0G A;  2O85 A;  5H5S A;  1DE1 A;  3QMX A;  3FHK A;  3VWX A;  4MMM A;  4J2F A;  1B9Y C;  4IHU A;  4BWS A;  4ZBB A;  1BJX A;  4KDX A;  3IV4 A;  2GZZ A;  4O5R A;  5ECH B;  1W4V A;  2DJ1 A;  1F3B A;  2CVD A;  2M46 A;  2VAF A;  2B7J A;  4Q5Q A;  4WKW A;  3LGC A;  4AJ7 A;  4BWQ A;  3ZIJ A;  2BMX A;  5DQY A;  3DRN A;  3ZIT A;  3DIE A;  1GTI A;  2LQQ A;  2XHF A;  4TXV A;  3UVH A;  2FY6 A;  5GZZ B;  4JBB A;  2ZUP A;  3LJR A;  5ID2 A;  2KP2 A;  4TOP A;  4MF6 A;  1G0T A;  3IC4 A;  3H4K A;  1JLW A;  1K3Y A;  1YKA A;  2CVK A;  5F07 A;  2A4V A;  4JE1 A;  4K1F A;  3QDN A;  4PQH A;  4JR6 A;  2B5Y A;  5AGY A;  3LXT A;  1EOG A;  2ON7 A;  3LEF A;  3HHV A;  1J9B A;  1X9W B;  2EIR A;  5HR2 A;  2IMK A;  5ECO B;  2GQL A;  2IWT A;  5B7C A;  4V2L A;  1Q4J A;  3F3Q A;  1R26 A;  5J3R A;  4PQI A;  1YKC A;  1ACV A;  5INY A;  3UL3 A;  1SL2 B;  2P5R A;  2LST A;  3V1W A;  3ZFL A;  3DGQ A;  2CQ9 A;  3HCZ A;  4GRF A;  4GSS A;  4TXO A;  2H0G A;  1RK4 A;  1XWC A;  3O76 A;  4GLT A;  3FY7 A;  4RUV A;  1MDI A;  1DE2 A;  2CVB A;  3J7Y b;  2EIQ A;  2E2M A;  3DWV A;  4GTU A;  1O8X A;  2O8V B;  3LOR A;  2H72 A;  3GKK A;  4JZQ A;  3D22 A;  2FNO A;  3BOA A;  5LNK e;  5IMA A;  4Q5N A;  2VLU A;  5DQS A;  4N0V A;  3I69 A;  3KEB A;  4OO4 A;  3RHB A;  1T00 A;  3QPM A;  2LJK A;  1E6B A;  5DJM A;  1GSF A;  2HRF A;  1GSD A;  3F4R A;  3FK8 A;  2YCD A;  1KNG A;  2B5X A;  5ECM B;  1GLQ A;  2H73 A;  5ABR A;  5A4U A;  4HJ2 A;  2IPA A;  5D8I A;  4KCE A;  3KMO A;  2G2Q A;  2JZS A;  3R2Q A;  5G2Z A;  4P3Y B;  3HVS A;  17GS A;  2IN3 A;  5J9C A;  5J4U A;  1RQM A;  2L4Q A;  3E9J B;  1UC7 A;  6GST A;  3H8Q A;  1GUL A;  1ZYQ B;  2TIR A;  5GAP D;  5ECP B;  1SYX A;  3H93 A;  2VCQ A;  4KH7 A;  4TKY A;  1XIY A;  2C80 A;  2REM A;  5HFI A;  1SJ6 A;  5G31 A;  1T8E B;  1VF3 A;  1XZO A;  2HI7 A;  2M72 A;  1GSS A;  3HZ8 A;  5G5F A;  4WEY A;  2N5F A;  4IW9 A;  2X8G A;  1WWJ A;  3TGZ A;  5COH A;  1FB6 A;  4HJM A;  4FIW A;  2JAD A;  3IDV A;  16GS A;  3P8W A;  2LRT A;  2VIM A;  5CRG A;  4TR1 A;  2RM5 A;  1RW1 A;  3D4T A;  3L9S A;  3F3R A;  1VF4 A;  4NHZ A;  1QFN A;  5CP1 A;  1XOB A;  2CV4 A;  4MZC A;  4NV2 A;  3VUR A;  3KP9 A;  2N5A A;  4MPF A;  1FOV A;  2NDO A;  5IMF A;  6GSY A;  4WF4 A;  5GSS A;  3HXS A;  1JZD A;  2C3T A;  3ZFB A;  2H0I A;  4OWY A;  4J56 E;  2GVP A;  2GZY A;  3N5O A;  1B8X A;  4KB3 A;  3TJG A;  3GV1 A;  3TKP A;  3A3T A;  4KND A;  4MH3 A;  3VWU A;  5JWQ B;  1U3I A;  1PSQ A;  1IYI A;  1AUC A;  2XC2 A;  3L9V A;  2C0D A;  1SL1 B;  7GSS A;  1WJK A;  4ECI A;  3W8S A;  5DDL A;  3CSH A;  3KTB A;  6GSU A;  1GTU A;  2DMM A;  1MDK A;  5E4W A;  5CNW A;  5H5Q A;  3TOT A;  2QKE A;  3TB2 A;  2FWH A;  4K8M A;  4POL A;  3DVW A;  3D4M A;  4I8B A;  5G1K A;  3ZMK A;  4KSM A;  5B6M A;  4KUN A;  4GWR A;  3GST A;  2OAD A;  2QGV A;  3D0Z A;  2LEG A;  3BJ5 A;  2WS2 A;  5DAL B;  5F0G A;  2YN1 A;  2NTO A;  3GYK A;  2J9H A;  2IJY A;  4POK A;  4PXO A;  4MJE A;  5DAK B;  1TK0 B;  1WP0 A;  4H86 A;  2OKA A;  2F9S A;  3GSS A;  4ML6 A;  3QAW A;  2OE3 A;  1JLV A;  1MDJ A;  4LA1 A;  5ID2 B;  4NWY A;  3UAP A;  5J5N A;  2E7P A;  3EIN A;  1GTB A;  5EPF A;  1EZK A;  3GL3 A;  3VLN A;  3UBL A;  5DCH A;  1OKD A;  3DML A;  3QOU A;  1YDK A;  4POB A;  4O7H A;  2NBS A;  4D73 B;  4ZL7 A;  2IIY A;  1GL8 A;  1PL2 A;  3ME8 A;  3GX8 A;  1K0N A;  4FYB A;  3PH9 A;  2VCZ A;  3UAR A;  5F05 A;  1GTA A;  3P2A A;  1FVJ A;  2DSA A;  3LYK A;  2AV4 A;  3HYP A;  1QK8 A;  2JSZ A;  2BJX A;  3ZVJ D;  3HJP A;  2HZF A;  5HR1 A;  3ED3 A;  4DSR A;  3PGT A;  3KH7 A;  3C7M A;  4GQF A;  2DJ0 A;  3QFA C;  4OCF A;  4L5O A;  1PX6 A;  1VF2 A;  3QAG A;  1PKW A;  5IPH A;  2HSY A;  3L78 A;  2MMN A;  4O92 A;  3F63 A;  4MDC A;  3ISO A;  1GH2 A;  3D21 A;  1PN9 A;  1PL1 A;  4MF7 A;  4K7I A;  2HFD A;  3GMF A;  2F3M A;  2LNT A;  3ERF A;  3E3E A;  2VL3 A;  3J7Y k;  5ECK B;  3JCM L;  2FWE A;  4MZB A;  3DKS A;  1HQO A;  4WBR D;  2FWF A;  1SKW B;  4V2N A;  2DIY A;  3BBY A;  2MMZ A;  2F8F A;  2H75 A;  1JZO A;  1B9X C;  4AF2 A;  1FO5 A;  1AAZ A;  2B5E A;  2AYT A;  1EWX A;  3QAV A;  4GSN A;  1R5A A;  2PBJ A;  1WMJ A;  1TU8 A;  2VL9 A;  2NVL A;  2HE3 A;  1THX A;  2R37 A;  1Z9H A;  3EU4 A;  4MJA A;  4YQU A;  2CA8 A;  1X5C A;  1SK2 A;  3CXG A;  3US3 A;  1FAA A;  3SBC A;  3GKN A;  4XS4 B;  1YF0 A;  3QD9 A;  2JU5 A;  2FD3 A;  2YP6 A;  3A2V A;  1K0O A;  2CZ2 A;  2IME A;  5ENU A;  1V57 A;  3GH9 A;  3ERW A;  5J41 A;  3CMI A;  3FRC A;  3VK9 A;  4I2T A;  4JRR A;  4BA7 A;  5IO0 A;  3FW2 A;  2H1D A;  1EEJ A;  2F8A A;  4E8E A;  2I1U A;  2L59 A;  3TJB A;  4BL7 A;  2KLX A;  3N9J A;  3KCM A;  2JL4 A;  1SK0 A;  4YAP A;  1HNA A;  4IEL A;  3D5J A;  5D9W A;  4EXJ A;  1ON4 A;  2VCW A;  2H74 A;  2E0Q A;  3IOS A;  5IOX A;  4YAV A;  2K8V A;  4GST A;  3C71 A;  3G7Y A;  3IK7 A;  2WGR A;  2H1A A;  5D9X A;  4F0C A;  5KN3 A;  1XVW A;  4PNG A;  2B7K A;  4TW5 A;  3FR9 A;  3FKF A;  4EVM A;  1TRV A;  2X8C A;  3APO A;  1T3B A;  3O6T A;  5IO2 A;  1X0R A;  2LRC A;  1X5D A;  3MWH A;  2IMI A;  4V2M A;  2WDU A;  3NOF A;  2L4C A;  1MD4 A;  2CZ3 A;  4IJ3 A;  1OYJ A;  4PNF A;  1V58 A;  2K9F A;  4WR5 A;  1ZMA A;  1XWG A;  3HZ4 A;  3M9K A;  4ZXG A;  3A2X A;  4XHM A;  2PN8 A;  3RPN A;  2R5G A;  2LNS A;  4KSO A;  12GS A;  9GSS A;  3TRP A;  3G7J A;  1THO A;  3LSZ A;  1XCC A;  1XWK A;  2V1M A;  2A2R A;  4KAE A;  1A0F A;  2H30 A;  5C04 A;  4EDY A;  1HNC A;  4N10 A;  3FZ9 A;  1OKT A;  3GUR A;  4LMV A;  2K8S A;  3C1S A;  1R7H A;  3Q19 A;  4K7N A;  5IOW A;  3FYG A;  2I81 A;  2VD0 A;  3CBU A;  1OE8 A;  5CRE A;  4TR1 B;  1C72 A;  5ECQ B;  4JU5 A;  3BD2 A;  4PUR A;  2CX3 A;  3TJF A;  2LV3 A;  3EC3 A;  1PX7 A;  3EVI A;  5GAN D;  5IM9 A;  3DXB A;  1XPV A;  3PIN A;  2I3Y A;  6GSS A;  6GSW A;  1DSB A;  3K8N A;  2C3Q A;  4MJC A;  2FHE A;  3D6I A;  3G7I A;  4N30 A;  2PWJ A;  2IMF A;  5CRW A;  3KD0 A;  3PR8 A;  3F6F A;  4RI6 A;  1YJ6 A;  1YF1 A;  1YZX A;  4ML1 A;  2YAN A;  2GQM A;  3F9U A;  4J57 E;  3DEX A;  1G6Y A;  3TKS E;  1ERV A;  4GXZ A;  3TUE A;  2HZE A;  3W8J A;  20GS A;  2V6K A;  4OCE A;  2PMT A;  4ID0 A;  3HVX A;  2N5B A;  2YWO A;  2OE1 A;  1N8J A;  3IA1 A;  2LRN A;  1WE0 A;  2FA4 A;  1M9B A;  4F0B A;  4HZ4 A;  4ZB9 A;  5F06 A;  1FW1 A;  1AC1 A;  2O7K A;  4KCA A;  5G1L A;  2OE0 A;  1BX9 A;  3VWV A;  4WBJ A;  2IMD A;  3GKX A;  3IRA A;  3KM6 A;  5IMV A;  2PER A;  4KA0 A;  2JZR A;  4IVF A;  3LWA A;  1IYH A;  2GLR A;  2MYG A;  1MD3 A;  3FZA A;  4G9H A;  1TOF A;  4MF5 A;  2A2S A;  5DCG A;  3C73 A;  1TXX A;  1UN2 A;  5CO3 A;  1U88 A;  2GSQ A;  1U6T A;  2YNX A;  5B6N A;  4KE3 A;  4LL4 B;  4Q5F A;  4FYC A;  2OAC A;  2K6V A; 
#chains in the Genus database with same CATH topology
 2H76 A;  3HJM A;  1S3D A;  4BPY A;  3R3E A;  1JHB A;  2PTS A;  3CYN A;  4EFC A;  1A0R P;  3VI5 A;  4MZW A;  3Q18 A;  5AN1 A;  2DLX A;  4MAB A;  1GUK A;  3RDW A;  4QL7 A;  3G9B A;  2A2P A;  4JED A;  1NM3 A;  5DVB A;  1IW7 D;  1QUW A;  3GNJ A;  1O81 A;  3KH9 A;  2GDR A;  1NHY A;  5J9B A;  3PPU A;  2PVO C;  1EP8 A;  2HRK A;  3U5R E;  1K0M A;  2ALB A;  2GQK A;  4X0X A;  1TP9 A;  5JCU A;  1WRY A;  3IC8 A;  3TDG A;  1ML6 A;  2HYX A;  4FO5 A;  4I6X A;  3CTF A;  5ECR B;  1PQN A;  2JZT A;  2X8H A;  3HVN A;  4BVX B;  2VUP A;  1QGV A;  3KXO A;  1U3A A;  4TR3 A;  4F82 A;  5HR0 A;  2MZC A;  2WZ9 A;  1SKS B;  2QSI A;  4O5Q A;  3CSI A;  4MJB A;  2FGX A;  3GN3 A;  4L8E A;  2YJ7 A;  4L6C A;  3VI7 A;  4F9Z A;  3IR4 A;  4LL1 B;  1TW9 A;  2AAW A;  2LTK A;  1F6M C;  4LLR A;  1XVQ A;  1J08 A;  1ILO A;  2GS3 A;  2QC7 A;  3NO9 A;  1YEX A;  4XS1 A;  3VWW A;  3A5W A;  3I6A A;  1VRS D;  3S9F A;  2DML A;  2VL2 C;  3EUR A;  1YFE A;  1K0B A;  1ZYE A;  5DAK A;  4OFM A;  1MTC A;  2LQO A;  1TI3 A;  4OO5 A;  1T9H A;  1LBK A;  1O7U A;  4DEJ A;  5ECS A;  1TTZ A;  2DJJ A;  2YV7 A;  1F2E A;  5HQP A;  5HR3 A;  4X43 A;  3CI0 K;  3CTG A;  3WGX A;  1AQX A;  4L0U A;  3TRX A;  2RUF A;  1ABA A;  1M2D A;  1GLP A;  1TJD A;  4ECB A;  3TKS C;  5ELA A;  4MX2 A;  1GSQ A;  2K18 A;  1EGO A;  3M3M A;  1K7W A;  3TKS A;  1K3L A;  3TRQ A;  3GH6 A;  4XRD A;  4ZIJ A;  2HT9 A;  4TRX A;  2WUL A;  1A2J A;  1G7O A;  2GGT A;  3UBK A;  2GZP A;  4V1A g;  2LJA A;  2XPE A;  2JAC A;  5FWG A;  3UJ1 A;  1K3O A;  5CRD A;  2C3N A;  4HEA 2;  2V6O A;  5HFG A;  1JZR A;  4NAX A;  1PA3 A;  2GT6 A;  4KW6 A;  1S3A A;  3VPT A;  3CQF A;  1DUG A;  2DJK A;  4CDO A;  3TJK A;  4TR4 A;  4DSS B;  1JFU A;  3F4S A;  3M0F A;  5IMC A;  5B8B A;  1X5E A;  1GWC A;  2H66 A;  2L57 A;  2RLI A;  2WJU A;  5ELG A;  3GA4 A;  1PKZ A;  2PFM A;  4NXI A;  2F51 A;  4G2E A;  4F03 A;  5A4W A;  1M0U A;  4ZL8 A;  5CAX A;  4IQ1 A;  1X9S B;  2X99 A;  4EEI A;  4KX4 A;  1O73 A;  2YOI A;  3EE2 A;  1SD9 A;  1XW5 A;  3HJO A;  3EMX A;  4XS6 A;  2WRT A;  4HUA A;  2VLT A;  3WT2 A;  1V98 A;  1HNB A;  2P31 A;  1O8W A;  2CX4 A;  1B4P A;  2YZU A;  4JR4 A;  1TJU A;  2M80 A;  1TJV A;  1GUM A;  1OC8 A;  1I9D A;  3EYT A;  3RHC A;  3EMP A;  19GS A;  5EY6 A;  5H5R A;  2O87 A;  5D9T A;  3UEM A;  1AIU A;  2P5Q A;  2C0E A;  1Z5Y E;  4ZL9 A;  4K2X A;  4YQM A;  2X64 A;  2R3X A;  10GS A;  1Z7R A;  3TKR A;  4PTS A;  4KDY A;  5D6B A;  1XOA A;  1QXH A;  4D73 A;  2V2G A;  2CAI A;  4G10 A;  1Y6E A;  4ECC A;  5IMZ A;  4OFN A;  4NPB A;  2X49 A;  3GHA A;  4F2I A;  4CHS A;  2WB9 A;  1SJI A;  4E8H A;  3LQ7 A;  13GS A;  1Q98 A;  4HOJ A;  1YQ1 A;  1GNW A;  1VDK A;  2KUC A;  1WPI A;  3TCO A;  2QA1 A;  4ULX A;  1A23 A;  4TN8 A;  1NSW A;  4RQX A;  3C1R A;  1Q91 A;  1I5G A;  1A8Y A;  2VM2 A;  4IS0 A;  3MSZ A;  2PPT A;  2OA7 A;  1FOH A;  3ZLP A;  3FMW A;  1ST9 A;  1EOH A;  4X4J A;  4Q5R A;  4BVX A;  3IHG A;  1EEM A;  2UZ8 A;  5ECI B;  1XW9 A;  2C0F A;  3OCE A;  5AIV A;  3FR3 A;  3KJY A;  4OFT A;  1ZCP A;  3ZVJ A;  2WCI A;  4ILF A;  2DBC A;  4GF0 A;  1F9M A;  3VFI A;  2I4A A;  3MNG A;  18GS A;  5IIZ A;  1V40 A;  1SU9 A;  2C1Y A;  3M1G A;  2RII A;  4PQ1 A;  4AGS A;  3RBT A;  1SEN A;  5A5K A;  3HDC A;  1Z7P A;  2ON5 A;  1ZGN A;  2DIZ A;  4EE0 A;  3BCI A;  4OMV A;  4WET A;  4EC0 A;  3UIW A;  4YH2 A;  2H0H A;  2OJL A;  3AY8 A;  4ZIL A;  1S3R A;  1RE5 A;  1TRS A;  4EF0 A;  4HDE A;  3SWL A;  4G0K A;  4GQC A;  3C8T A;  3EWL A;  1ZOF A;  2L5L A;  2MMO A;  1YY7 A;  2DJ2 A;  2HRA A;  1T4Z A;  4K5R A;  2R0G A;  4MP4 A;  3RPP A;  4IBP A;  4MLY A;  2H6X A;  1KEB A;  5KEJ A;  4O5U A;  1FVK A;  2JAU A;  2CT6 A;  1DOF A;  2C8U A;  3L9U A;  3UOM A;  1O6J A;  2YPM A;  1GSE A;  4Z2U A;  4QQ7 A;  4ZB6 A;  1BED A;  2LJR A;  5DAL A;  1AXD A;  2KOK A;  2C4J A;  2YJH A;  1Z3E A;  1TDI A;  2Z9S A;  2YWN A;  2AHE A;  3KMN A;  3KGK A;  1GUH A;  1JZW A;  4IKH A;  4RI7 A;  5CRH A;  2JAO A;  5F92 A;  2XPD A;  3GTU A;  2PTR A;  3M8N A;  1M7T A;  1E2Y A;  1OE7 A;  3ZIV A;  1VF1 A;  3LYP A;  4ZB8 A;  3ERG A;  2GST A;  4ZBD A;  3KIJ A;  3L0H A;  2BTO T;  5B8A A;  3TKQ A;  3DVX A;  1K0D A;  3O3T A;  3TOU A;  2GSS A;  4FH8 A;  2VLV A;  1M2B A;  1BAY A;  1PD2 1;  4HZ2 A;  1OAZ A;  1M99 A;  1SD8 A;  2VCX A;  3CSJ A;  1EP7 A;  4BL7 B;  2YV9 A;  1XFL A;  1H75 A;  4EUY A;  4IP1 A;  1Y25 A;  2O89 A;  1TK8 B;  1EV4 A;  2D2Z A;  4L5L A;  1BYE A;  4G19 A;  2FUG 2;  1MEK A;  3QR6 A;  2KP1 A;  3ZZX A;  2MMA A;  3KP8 A;  5LCZ A;  5HW2 A;  2PU9 C;  4MUM A;  2VL2 A;  3FR6 A;  1B4Q A;  3F6D A;  3F8U A;  2RUE A;  5L71 A;  1M9A A;  2HSH A;  5ECN B;  4CY8 A;  2AJQ B;  1USB A;  5KN1 A;  3QFB C;  5DJL A;  5C00 A;  14GS A;  3APS A;  1DBY A;  2H8L A;  1ZL9 A;  4MCU A;  4EIP A;  3WYW A;  1U16 A;  3FEU A;  5D96 A;  4TXO B;  5CYY A;  3Q74 A;  2HLS A;  1M2A A;  3M9J A;  3IBH A;  1XWA A;  1FG4 A;  5JCW A;  1LJR A;  1KTE A;  1GSY A;  4MK3 A;  3VPQ A;  4V1A p;  1W89 A;  5KN2 A;  1I0A A;  3C8E A;  2H71 A;  1N2A A;  1PRX A;  4APB A;  5FHI A;  2NPB A;  2IFQ B;  5F8B A;  3GKM A;  3IK9 A;  4YIK A;  1TRW A;  1A2M A;  4YQV A;  1XW6 A;  3CRT A;  1XWB A;  3GX0 A;  2VOC A;  4KDU A;  1K0A A;  3F0I A;  3WGD A;  4AJ6 A;  4WF5 A;  4NMU A;  4X1U A;  1OC9 B;  3IXR A;  2XBQ A;  1A2L A;  3P90 A;  2ZCT A;  1WIK A;  2OBK A;  1HD2 A;  3H79 A;  2FCH A;  1XBS A;  1TKD B;  5KN0 A;  2PVQ A;  11GS A;  1OC3 A;  4NHW A;  4XRA A;  4ACS A;  4WXT A;  4DSS A;  1MH9 A;  4CW9 A;  1VGL A;  5EVO A;  4O32 A;  3ZL5 A;  1NW2 A;  3LFL A;  1Z4M A;  1GSU A;  1FUQ A;  3L4N A;  3GTD A;  3WD6 A;  2HRN A;  2LS5 A;  3WT1 A;  1TK5 B;  3APQ A;  2HVG A;  1PGT A;  1Z6M A;  4XCS A;  1Z6N A;  2G0F A;  4Z7X A;  4I97 A;  1QMV A;  2H70 A;  5JCG A;  1TU7 A;  5BMU A;  2HNL A;  2P0G A;  2VO4 A;  5D9V A;  4Z2R A;  1OVN A;  1BG5 A;  4EL1 A;  4XS4 A;  1KQ7 A;  3ZRD A;  4CY6 A;  2AB6 A;  4HU7 A;  4OD7 A;  1FHE A;  2GT5 A;  4K2D A;  2CAQ A;  4YKF A;  4POM A;  1ZZY A;  1X9M B;  6GSV A;  1J0F A;  1JSW A;  3E0U A;  4NLE A;  3HD5 A;  3KZQ A;  3IAS 2;  3BHG A;  3HY2 A;  1R4W A;  8GSS A;  4GCI A;  4DSQ A;  1QQ2 A;  4PX1 A;  5G5E A;  1Z4I A;  5HFK A;  5E59 A;  1UA5 A;  2EIO A;  2VM1 A;  2H01 A;  2AUV A;  3RAZ A;  2B1L A;  3WGE A;  4ZBA A;  4EDZ A;  2VCT A;  1SJZ A;  2VD1 A;  3H1N A;  2PUK C;  2V41 A;  4IQA A;  1K0C A;  1LU4 A;  1TI1 A;  2HXK A;  1WOU A;  2OBI A;  2IL3 A;  5D73 A;  1UVZ A;  4IGJ A;  3ME7 A;  1FUO A;  2TRX A;  2YWM A;  5G30 A;  5A4V A;  3P7X A;  4HU9 A;  2R2J A;  2RM6 A;  3UVT A;  2MBT A;  1A24 A;  2VCV A;  5DBQ A;  1TRU A;  4K5S A;  4PUF C;  1CQH A;  4K0G A;  2L6C A;  1DCN A;  3CRU A;  4MA9 A;  2ZNM A;  1Z4Q A;  1F3A A;  3I43 A;  5ECL B;  1V9W A;  1K62 A;  4TVE A;  2H1G A;  3Q6O A;  4ICY A;  1ZYN A;  3W6G A;  4KF9 A;  3NIV A;  1EGR A;  2HZE B;  3TJJ A;  3DD3 A;  4K0N A;  2V32 A;  3LG6 A;  4MPG A;  3IE3 A;  4XIH A;  1FB0 A;  2FA8 A;  4KGI A;  1HY1 A;  2EC4 A;  3GFK A;  3QCP A;  1OC9 A;  3UMA A;  4N11 A;  3GRX A;  1ERW A;  1S3C A;  1ERU A;  3DYR A;  1T7P B;  3OCF A;  2R6K A;  2B3S A;  1T4Y A;  1B48 A;  1GRX A;  2DC5 A;  5IQY A;  2FLS A;  2H19 A;  2YZH A;  4RQR A;  1PN0 A;  3HA9 A;  3ZYW A;  1G6W A;  1PFO A;  3ZTL A;  1ERT A;  2JSY A;  4K7O A;  1H4O A;  3HKR A;  22GS A;  2IFQ A;  4ISD A;  4EKZ A;  2I9H A;  3GL5 A;  2TRC P;  1NHO A;  2H1B A;  4XTS A;  3ZML A;  2J23 A;  4LMW A;  2DKH A;  4IN0 A;  1PMT A;  4IJI A;  2B1K A;  4N0Z A;  1FUP A;  4K9Z A;  1GP1 A;  4I2U A;  4PGT A;  6GSX A;  3LXZ A;  1GNE A;  1URM A;  2YWI A;  3MDK A;  2E2G A;  3IAM 2;  3KTL A;  5D93 A;  1XXU A;  2PGT A;  1EV9 A;  4I5Q A;  1BQ7 A;  2A4H A;  2DKI A;  3GUS A;  4USS A;  2FWG A;  2H6Y A;  4L0W A;  3ZRE A;  1YEP A;  1Z4L A;  4HI7 A;  5JWR B;  4HS1 A;  1A8L A;  4WR4 A;  5IPG A;  2KHP A;  2MBS A;  4AJ8 A;  1AQV A;  4HQZ A;  4EO3 A;  4BVY A;  4QL9 A;  2WFC A;  1V2A A;  2R4V A;  4IP6 A;  2H6Z A;  1T1V A;  5IMD A;  5JWO B;  3EU3 A;  5FT3 A;  1AW9 A;  4PUA A;  3A2W A;  1CQG A;  3BCK A;  1KBN A;  1HYU A;  1G7E A;  4ECJ A;  1SK1 A;  2L5O A;  1U87 A;  3IPZ A;  4TR0 A;  5GST A;  1AQW A;  4K6X A;  5LD0 A;  3GTU B;  1R5P A;  2L6D A;  4NV5 A;  2D28 C;  2LKU A;  1F37 A;  1O85 A;  3MAK A;  3HVV A;  5AIX A;  4HQS A;  5AIS A;  4FYU A;  3FZ4 A;  2ES7 A;  1SKR B;  3U6V A;  4MH2 A;  2DJ3 A;  3IHQ A;  3R6Q A;  1SL0 B;  1SYR A;  2XBI A;  3FZ5 A;  5EL8 A;  2B6M A;  2LUS A;  3F4T A;  2GSR A;  3OR5 A;  2GTU A;  4ADL A;  3NZN A;  4FQU A;  3A5I A;  3I9V 2;  4BIK A;  4DVC A;  3GIX A;  2C0G A;  2O85 A;  5H5S A;  1DE1 A;  3QMX A;  3FHK A;  3VWX A;  4MMM A;  4J2F A;  1B9Y C;  2E9F A;  5KOX A;  1TJ7 A;  4IHU A;  4BWS A;  4ZBB A;  1BJX A;  4KDX A;  3IV4 A;  2GZZ A;  4O5R A;  5ECH B;  1W4V A;  2DJ1 A;  1F3B A;  2CVD A;  2M46 A;  2VAF A;  2B7J A;  4Q5Q A;  2R0P A;  3LGC A;  4WKW A;  4AJ7 A;  4BWQ A;  3ZIJ A;  2BMX A;  5DQY A;  3DRN A;  3ZIT A;  3DIE A;  1GTI A;  2LQQ A;  2XHF A;  4TXV A;  3UVH A;  2FY6 A;  5GZZ B;  4JBB A;  2ZUP A;  3LJR A;  5ID2 A;  2KP2 A;  4TOP A;  4MF6 A;  1G0T A;  3E04 A;  3IC4 A;  3H4K A;  1JLW A;  1K3Y A;  1YKA A;  2CVK A;  5F07 A;  2A4V A;  4K1F A;  4JE1 A;  3QDN A;  4PQH A;  4JR6 A;  2B5Y A;  5AGY A;  3EPT A;  3LXT A;  1EOG A;  2ON7 A;  3LEF A;  3HHV A;  1J9B A;  1X9W B;  2EIR A;  4IQJ M;  2YV5 A;  5HR2 A;  2IMK A;  5ECO B;  2GQL A;  2IWT A;  5B7C A;  4V2L A;  1Q4J A;  3F3Q A;  1R26 A;  5J3R A;  4PQI A;  1YKC A;  1ACV A;  2R0C A;  5INY A;  1U15 A;  3UL3 A;  1SL2 B;  2P5R A;  2LST A;  1YFM A;  2X75 A;  3V1W A;  3ZFL A;  3DGQ A;  2CQ9 A;  3HCZ A;  4GRF A;  4GSS A;  4TXO A;  2H0G A;  1RK4 A;  1XWC A;  3O76 A;  4GLT A;  3FY7 A;  4RUV A;  1MDI A;  1DE2 A;  2CVB A;  3J7Y b;  2EIQ A;  2E2M A;  3DWV A;  4GTU A;  1O8X A;  2O8V B;  3LOR A;  4L6A A;  2H72 A;  3GKK A;  4JZQ A;  3D22 A;  1M3J A;  2FNO A;  3BOA A;  5LNK e;  4G0L A;  5IMA A;  4Q5N A;  2VLU A;  5DQS A;  4N0V A;  3I69 A;  4YIH A;  3KEB A;  4OO4 A;  1Q5N A;  3RHB A;  1T00 A;  3QPM A;  2LJK A;  1E6B A;  5DJM A;  1GSF A;  2HRF A;  1GSD A;  3F4R A;  3FK8 A;  2D27 A;  2YCD A;  1KNG A;  2B5X A;  5ECM B;  5KOW A;  1J3U A;  1GLQ A;  2H73 A;  5ABR A;  5A4U A;  4HJ2 A;  2IPA A;  1HY0 A;  5D8I A;  4KCE A;  3KMO A;  2G2Q A;  2JZS A;  3R2Q A;  5G2Z A;  4P3Y B;  3HVS A;  17GS A;  2IN3 A;  5J9C A;  4NFL A;  5J4U A;  1RQM A;  2L4Q A;  3E9J B;  1UC7 A;  6GST A;  3H8Q A;  1GUL A;  1ZYQ B;  2TIR A;  5GAP D;  5ECP B;  3GZH A;  1SYX A;  4ADM A;  5BRT A;  3H93 A;  2VCQ A;  4KH7 A;  4TKY A;  1XIY A;  2C80 A;  2REM A;  5HFI A;  1SJ6 A;  5G31 A;  1T8E B;  1VF3 A;  1XZO A;  2HI7 A;  2M72 A;  1GSS A;  3HZ8 A;  5G5F A;  4WEY A;  2N5F A;  4IW9 A;  2X8G A;  1WWJ A;  3TGZ A;  5COH A;  1FB6 A;  4HJM A;  4FIW A;  2JAD A;  3IDV A;  16GS A;  3P8W A;  2LRT A;  2VIM A;  5CRG A;  4TR1 A;  2RM5 A;  1RW1 A;  3D4T A;  3L9S A;  3F3R A;  1VF4 A;  4NHZ A;  1QFN A;  5CP1 A;  1XOB A;  2CV4 A;  3LW9 A;  1XWO A;  4MZC A;  4NV2 A;  3VUR A;  3KP9 A;  2N5A A;  4MPF A;  1FOV A;  2NDO A;  5IMF A;  6GSY A;  4MWO A;  4WF4 A;  5GSS A;  3HXS A;  1JZD A;  2C3T A;  3ZFB A;  2H0I A;  4OWY A;  4J56 E;  2GVP A;  2GZY A;  3N5O A;  1B8X A;  2JAR A;  4KB3 A;  3TJG A;  3GV1 A;  2JAW A;  3TKP A;  3A3T A;  4KND A;  4MH3 A;  3VWU A;  5JWQ B;  1U3I A;  1PSQ A;  1IYI A;  1AUC A;  2XC2 A;  3L9V A;  2C0D A;  1SL1 B;  7GSS A;  1WJK A;  4ECI A;  4YKG A;  3W8S A;  5DDL A;  3CSH A;  3KTB A;  6GSU A;  1GTU A;  2DMM A;  1MDK A;  5E4W A;  5CNW A;  5H5Q A;  3TOT A;  2QKE A;  3TB2 A;  2FWH A;  4K8M A;  4POL A;  3DVW A;  3D4M A;  1M3I A;  4I8B A;  5G1K A;  3ZMK A;  4KSM A;  5B6M A;  4KUN A;  4GWR A;  3GST A;  2OAD A;  2QGV A;  1AUW A;  3D0Z A;  2LEG A;  3BJ5 A;  2WS2 A;  5DAL B;  5F0G A;  2YN1 A;  2NTO A;  3GYK A;  2J9H A;  2QGA B;  2IJY A;  4POK A;  4PXO A;  4MJE A;  5DAK B;  1TK0 B;  1WP0 A;  4H86 A;  2OKA A;  2F9S A;  3GSS A;  4ML6 A;  3QAW A;  2OE3 A;  1JLV A;  1MDJ A;  4LA1 A;  5ID2 B;  4NWY A;  3UAP A;  5J5N A;  2E7P A;  3EIN A;  1GTB A;  5EPF A;  1EZK A;  3GL3 A;  3VLN A;  3UBL A;  5DCH A;  1OKD A;  3DML A;  3QOU A;  1YDK A;  4POB A;  4O7H A;  2NBS A;  4D73 B;  4ZL7 A;  2IIY A;  1GL8 A;  1PL2 A;  3ME8 A;  3GX8 A;  1K0N A;  4FYB A;  3PH9 A;  2VCZ A;  3UAR A;  5F05 A;  1GTA A;  3P2A A;  4L57 A;  1FVJ A;  2DSA A;  3LYK A;  2AV4 A;  3MIX A;  3HYP A;  1QK8 A;  2JSZ A;  2BJX A;  3ZVJ D;  3HJP A;  2HZF A;  5HR1 A;  3ED3 A;  4DSR A;  1C3U A;  3PGT A;  3KH7 A;  3C7M A;  4GQF A;  2DJ0 A;  3QFA C;  4OCF A;  1FUR A;  4L5O A;  4A5P A;  1PX6 A;  1VF2 A;  3QAG A;  1PKW A;  5IPH A;  2HSY A;  3L78 A;  2MMN A;  4O92 A;  3F63 A;  4MDC A;  3ISO A;  1GH2 A;  3D21 A;  1TJW A;  1PN9 A;  1PL1 A;  4MF7 A;  4K7I A;  2HFD A;  3GMF A;  2F3M A;  2LNT A;  3ERF A;  2PTQ A;  3E3E A;  2VL3 A;  3J7Y k;  5ECK B;  3JCM L;  2FWE A;  1XG8 A;  3DKS A;  1HQO A;  4MZB A;  4WBR D;  2FWF A;  1SKW B;  4V2N A;  1Z4P X;  2DIY A;  1ZYP A;  3BBY A;  2MMZ A;  2F8F A;  2H75 A;  1JZO A;  1B9X C;  4AF2 A;  1FO5 A;  1AAZ A;  2B5E A;  2AYT A;  1EWX A;  3QAV A;  4GSN A;  1R5A A;  2PBJ A;  1WMJ A;  1TU8 A;  2VL9 A;  2NVL A;  2HE3 A;  1THX A;  2R37 A;  1Z9H A;  3EU4 A;  4MJA A;  4YQU A;  2CA8 A;  1X5C A;  1SK2 A;  3CXG A;  3US3 A;  1FAA A;  3SBC A;  3GKN A;  4G0I A;  4XS4 B;  1YF0 A;  3QD9 A;  2JU5 A;  2FD3 A;  2YP6 A;  3A2V A;  1K0O A;  2CZ2 A;  2IME A;  5ENU A;  1V57 A;  3GH9 A;  3ERW A;  2RCN A;  5J41 A;  3CMI A;  3FRC A;  3VK9 A;  4I2T A;  4JRR A;  4BA7 A;  5IO0 A;  3FW2 A;  2H1D A;  1EEJ A;  2F8A A;  4E8E A;  2I1U A;  2L59 A;  3TJB A;  4BL7 A;  2KLX A;  3N9J A;  3KCM A;  2JL4 A;  1SK0 A;  4YAP A;  1HNA A;  4IEL A;  3D5J A;  5D9W A;  4EXJ A;  1ON4 A;  2VCW A;  2I7D A;  2H74 A;  2E0Q A;  3IOS A;  5IOX A;  3RRP A;  4YAV A;  2K8V A;  4GST A;  3C71 A;  3G7Y A;  2HSM A;  3IK7 A;  2WGR A;  4MNN A;  2H1A A;  5D9X A;  4F0C A;  5KN3 A;  1XVW A;  4PNG A;  2B7K A;  4TW5 A;  3FR9 A;  3FKF A;  4EVM A;  1TRV A;  2X8C A;  3APO A;  1T3B A;  3U19 A;  3O6T A;  5IO2 A;  1X0R A;  2LRC A;  1X5D A;  3MWH A;  2IMI A;  4V2M A;  2WDU A;  3NOF A;  2L4C A;  1MD4 A;  2CZ3 A;  4IJ3 A;  1OYJ A;  4PNF A;  1V58 A;  2K9F A;  4WR5 A;  3MYD A;  1ZMA A;  1XWG A;  3HZ4 A;  3M9K A;  3BWV A;  4ZXG A;  3A2X A;  4XHM A;  2PN8 A;  3RPN A;  2QA2 A;  2R5G A;  4HSC X;  2LNS A;  4KSO A;  12GS A;  9GSS A;  4APA A;  3TRP A;  3G7J A;  1THO A;  3LSZ A;  1XCC A;  1XWK A;  2V1M A;  2A2R A;  4Z2T A;  4KAE A;  1A0F A;  2H30 A;  5C04 A;  4EDY A;  1HNC A;  4N10 A;  3FZ9 A;  1OKT A;  3GUR A;  4LMV A;  2K8S A;  3C1S A;  1R7H A;  3Q19 A;  4K7N A;  5IOW A;  1U0L A;  3FYG A;  2I81 A;  2VD0 A;  3CBU A;  1OE8 A;  5CRE A;  4TR1 B;  1C72 A;  5ECQ B;  4JU5 A;  3BD2 A;  4PUR A;  2CX3 A;  3TJF A;  2LV3 A;  3EC3 A;  1PX7 A;  3EVI A;  2FUS A;  4EIQ A;  5GAN D;  4E88 A;  5IM9 A;  3DXB A;  1XPV A;  3PIN A;  2I3Y A;  6GSS A;  4HGV A;  6GSW A;  1DSB A;  3K8N A;  3TV2 A;  2C3Q A;  4MJC A;  2FHE A;  3D6I A;  3G7I A;  4N30 A;  2PWJ A;  2IMF A;  5CRW A;  3KD0 A;  3PR8 A;  3F6F A;  4RI6 A;  1YJ6 A;  1YF1 A;  1YZX A;  4ML1 A;  2YAN A;  2GQM A;  4BVY B;  3F9U A;  1Q92 A;  4J57 E;  3DEX A;  1G6Y A;  3TKS E;  1ERV A;  4GXZ A;  3TUE A;  2HZE A;  3W8J A;  20GS A;  2V6K A;  4OCE A;  2PMT A;  4ID0 A;  3HVX A;  2N5B A;  2YWO A;  2OE1 A;  1N8J A;  3IA1 A;  2LRN A;  1WE0 A;  2FA4 A;  1M9B A;  4F0B A;  4HZ4 A;  4ZB9 A;  5F06 A;  1Z4J A;  1FW1 A;  1AC1 A;  2O7K A;  4KCA A;  5G1L A;  2OE0 A;  1BX9 A;  3VWV A;  4WBJ A;  2IMD A;  3GKX A;  3IRA A;  4NSL A;  3KM6 A;  5IMV A;  2PER A;  4KA0 A;  2JZR A;  4IVF A;  3LWA A;  2X4A A;  1C3C A;  1IYH A;  2GLR A;  2MYG A;  1MD3 A;  3FZA A;  4G9H A;  1TOF A;  4MF5 A;  2A2S A;  3R6V A;  5DCG A;  3C73 A;  1TXX A;  1UN2 A;  3RD8 A;  5CO3 A;  1U88 A;  2GSQ A;  1U6T A;  2YNX A;  5B6N A;  4KE3 A;  1Z4K A;  4LL4 B;  4Q5F A;  4FYC A;  5F91 A;  2OAC A;  3QBP A;  2K6V A;  3U13 A; 
#chains in the Genus database with same CATH homology
 2H76 A;  3HJM A;  1S3D A;  4BPY A;  3R3E A;  1JHB A;  3CYN A;  1A0R P;  3VI5 A;  4MZW A;  3Q18 A;  5AN1 A;  2DLX A;  4MAB A;  1GUK A;  3RDW A;  4QL7 A;  3G9B A;  2A2P A;  4JED A;  1NM3 A;  5DVB A;  1IW7 D;  1QUW A;  3GNJ A;  1O81 A;  3KH9 A;  2GDR A;  1NHY A;  5J9B A;  3PPU A;  2PVO C;  1EP8 A;  2HRK A;  3U5R E;  1K0M A;  2ALB A;  2GQK A;  4X0X A;  1TP9 A;  5JCU A;  1WRY A;  3IC8 A;  3TDG A;  1ML6 A;  2HYX A;  4FO5 A;  4I6X A;  3CTF A;  5ECR B;  1PQN A;  2JZT A;  2X8H A;  4BVX B;  2VUP A;  1QGV A;  3KXO A;  1U3A A;  4TR3 A;  4F82 A;  5HR0 A;  2MZC A;  2WZ9 A;  1SKS B;  2QSI A;  4O5Q A;  3CSI A;  4MJB A;  2FGX A;  3GN3 A;  4L8E A;  2YJ7 A;  3VI7 A;  4F9Z A;  3IR4 A;  4LL1 B;  1TW9 A;  2AAW A;  2LTK A;  1F6M C;  4LLR A;  1XVQ A;  1J08 A;  1ILO A;  2GS3 A;  2QC7 A;  1YEX A;  4XS1 A;  3VWW A;  3A5W A;  3I6A A;  1VRS D;  3S9F A;  2DML A;  2VL2 C;  3EUR A;  1K0B A;  1ZYE A;  5DAK A;  4OFM A;  1MTC A;  2LQO A;  1TI3 A;  4OO5 A;  1LBK A;  1O7U A;  4DEJ A;  5ECS A;  1TTZ A;  2DJJ A;  2YV7 A;  1F2E A;  5HQP A;  5HR3 A;  4X43 A;  3CTG A;  3WGX A;  1AQX A;  4L0U A;  3TRX A;  2RUF A;  1ABA A;  1M2D A;  1GLP A;  1TJD A;  4ECB A;  3TKS C;  5ELA A;  1GSQ A;  2K18 A;  1EGO A;  3M3M A;  3TKS A;  1K3L A;  3TRQ A;  3GH6 A;  4XRD A;  4ZIJ A;  2HT9 A;  4TRX A;  2WUL A;  1A2J A;  1G7O A;  2GGT A;  3UBK A;  2GZP A;  4V1A g;  2LJA A;  2XPE A;  2JAC A;  5FWG A;  3UJ1 A;  1K3O A;  5CRD A;  2C3N A;  4HEA 2;  2V6O A;  5HFG A;  1JZR A;  4NAX A;  1PA3 A;  2GT6 A;  4KW6 A;  1S3A A;  3VPT A;  1DUG A;  2DJK A;  4CDO A;  3TJK A;  4TR4 A;  4DSS B;  1JFU A;  5IMC A;  3F4S A;  3M0F A;  5B8B A;  1X5E A;  1GWC A;  2H66 A;  2L57 A;  2RLI A;  2WJU A;  5ELG A;  3GA4 A;  1PKZ A;  4NXI A;  2F51 A;  4G2E A;  4F03 A;  5A4W A;  1M0U A;  4ZL8 A;  5CAX A;  4IQ1 A;  1X9S B;  2X99 A;  4KX4 A;  1O73 A;  2YOI A;  3EE2 A;  1SD9 A;  1XW5 A;  3HJO A;  3EMX A;  4XS6 A;  2WRT A;  4HUA A;  2VLT A;  3WT2 A;  1V98 A;  1HNB A;  2P31 A;  1O8W A;  2CX4 A;  1B4P A;  2YZU A;  4JR4 A;  2M80 A;  1GUM A;  1OC8 A;  1I9D A;  3EYT A;  3RHC A;  3EMP A;  19GS A;  5EY6 A;  5H5R A;  2O87 A;  5D9T A;  3UEM A;  1AIU A;  2P5Q A;  2C0E A;  1Z5Y E;  4ZL9 A;  4K2X A;  4YQM A;  2X64 A;  2R3X A;  10GS A;  1Z7R A;  3TKR A;  4PTS A;  4KDY A;  1XOA A;  1QXH A;  4D73 A;  2V2G A;  2CAI A;  4G10 A;  1Y6E A;  4ECC A;  5IMZ A;  4OFN A;  4NPB A;  2X49 A;  3GHA A;  4F2I A;  4CHS A;  2WB9 A;  1SJI A;  4E8H A;  3LQ7 A;  13GS A;  1Q98 A;  4HOJ A;  1YQ1 A;  1GNW A;  2KUC A;  1WPI A;  3TCO A;  2QA1 A;  4ULX A;  1A23 A;  4TN8 A;  1NSW A;  4RQX A;  3C1R A;  1I5G A;  1A8Y A;  2VM2 A;  4IS0 A;  3MSZ A;  2PPT A;  2OA7 A;  1FOH A;  3ZLP A;  3FMW A;  1ST9 A;  1EOH A;  4X4J A;  4Q5R A;  4BVX A;  3IHG A;  1EEM A;  2UZ8 A;  5ECI B;  1XW9 A;  2C0F A;  5AIV A;  3FR3 A;  3KJY A;  4OFT A;  1ZCP A;  3ZVJ A;  2WCI A;  4ILF A;  2DBC A;  4GF0 A;  1F9M A;  3VFI A;  2I4A A;  3MNG A;  18GS A;  5IIZ A;  1V40 A;  1SU9 A;  2C1Y A;  3M1G A;  2RII A;  4PQ1 A;  4AGS A;  3RBT A;  1SEN A;  5A5K A;  3HDC A;  1Z7P A;  2ON5 A;  1ZGN A;  2DIZ A;  4EE0 A;  3BCI A;  4OMV A;  4WET A;  4EC0 A;  3UIW A;  4YH2 A;  2H0H A;  2OJL A;  3AY8 A;  4ZIL A;  1TRS A;  4EF0 A;  4HDE A;  3SWL A;  4G0K A;  4GQC A;  3EWL A;  1ZOF A;  2L5L A;  2MMO A;  1YY7 A;  2DJ2 A;  2HRA A;  1T4Z A;  4K5R A;  2R0G A;  4MP4 A;  3RPP A;  4IBP A;  4MLY A;  2H6X A;  1KEB A;  5KEJ A;  4O5U A;  1FVK A;  2CT6 A;  2C8U A;  3L9U A;  3UOM A;  1O6J A;  2YPM A;  1GSE A;  4Z2U A;  4QQ7 A;  4ZB6 A;  1BED A;  2LJR A;  5DAL A;  1AXD A;  2KOK A;  2C4J A;  2YJH A;  1Z3E A;  1TDI A;  2Z9S A;  2YWN A;  2AHE A;  3KMN A;  3KGK A;  1GUH A;  1JZW A;  4IKH A;  4RI7 A;  5CRH A;  2XPD A;  3GTU A;  3M8N A;  1M7T A;  1E2Y A;  1OE7 A;  3ZIV A;  1VF1 A;  3LYP A;  4ZB8 A;  3ERG A;  2GST A;  4ZBD A;  3KIJ A;  3L0H A;  2BTO T;  5B8A A;  3TKQ A;  3DVX A;  1K0D A;  3O3T A;  3TOU A;  2GSS A;  4FH8 A;  2VLV A;  1M2B A;  1BAY A;  1PD2 1;  4HZ2 A;  1OAZ A;  1M99 A;  1SD8 A;  2VCX A;  3CSJ A;  1EP7 A;  4BL7 B;  2YV9 A;  1XFL A;  1H75 A;  4EUY A;  4IP1 A;  1Y25 A;  2O89 A;  1TK8 B;  1EV4 A;  2D2Z A;  4L5L A;  1BYE A;  4G19 A;  2FUG 2;  1MEK A;  3QR6 A;  2KP1 A;  3ZZX A;  2MMA A;  3KP8 A;  5LCZ A;  2PU9 C;  2VL2 A;  3FR6 A;  1B4Q A;  3F6D A;  3F8U A;  2RUE A;  5L71 A;  1M9A A;  2HSH A;  5ECN B;  4CY8 A;  2AJQ B;  1USB A;  5KN1 A;  3QFB C;  5C00 A;  5DJL A;  14GS A;  3APS A;  1DBY A;  2H8L A;  1ZL9 A;  4MCU A;  4EIP A;  3WYW A;  3FEU A;  5D96 A;  4TXO B;  5CYY A;  3Q74 A;  2HLS A;  1M2A A;  3M9J A;  3IBH A;  1XWA A;  1FG4 A;  5JCW A;  1LJR A;  1KTE A;  1GSY A;  4MK3 A;  3VPQ A;  4V1A p;  1W89 A;  5KN2 A;  3C8E A;  2H71 A;  1N2A A;  1PRX A;  5FHI A;  2NPB A;  2IFQ B;  5F8B A;  3GKM A;  3IK9 A;  1TRW A;  1A2M A;  4YQV A;  1XW6 A;  3CRT A;  1XWB A;  3GX0 A;  2VOC A;  4KDU A;  1K0A A;  3F0I A;  3WGD A;  4AJ6 A;  4WF5 A;  4NMU A;  4X1U A;  1OC9 B;  3IXR A;  2XBQ A;  1A2L A;  3P90 A;  2ZCT A;  1WIK A;  2OBK A;  1HD2 A;  3H79 A;  2FCH A;  1XBS A;  1TKD B;  5KN0 A;  2PVQ A;  11GS A;  1OC3 A;  4NHW A;  4XRA A;  4ACS A;  4WXT A;  4DSS A;  4CW9 A;  1VGL A;  5EVO A;  4O32 A;  3ZL5 A;  1NW2 A;  3LFL A;  1GSU A;  3L4N A;  3WD6 A;  2HRN A;  2LS5 A;  3WT1 A;  1TK5 B;  3APQ A;  1PGT A;  1Z6M A;  4XCS A;  1Z6N A;  2G0F A;  4Z7X A;  4I97 A;  5JCG A;  1QMV A;  2H70 A;  1TU7 A;  5BMU A;  2HNL A;  2P0G A;  2VO4 A;  5D9V A;  4Z2R A;  1OVN A;  1BG5 A;  4EL1 A;  4XS4 A;  3ZRD A;  4CY6 A;  2AB6 A;  4HU7 A;  4OD7 A;  1FHE A;  2GT5 A;  4K2D A;  2CAQ A;  4YKF A;  4POM A;  1ZZY A;  1X9M B;  6GSV A;  1J0F A;  3E0U A;  3HD5 A;  3KZQ A;  3IAS 2;  3HY2 A;  1R4W A;  8GSS A;  4GCI A;  4DSQ A;  1QQ2 A;  4PX1 A;  5G5E A;  5HFK A;  5E59 A;  1UA5 A;  2EIO A;  2VM1 A;  2H01 A;  2AUV A;  3RAZ A;  2B1L A;  3WGE A;  4ZBA A;  4EDZ A;  2VCT A;  1SJZ A;  2VD1 A;  3H1N A;  2PUK C;  2V41 A;  4IQA A;  1K0C A;  1LU4 A;  1TI1 A;  2HXK A;  1WOU A;  2OBI A;  2IL3 A;  5D73 A;  1UVZ A;  4IGJ A;  3ME7 A;  2TRX A;  2YWM A;  5G30 A;  5A4V A;  3P7X A;  4HU9 A;  2R2J A;  2RM6 A;  3UVT A;  2MBT A;  1A24 A;  2VCV A;  5DBQ A;  1TRU A;  4K5S A;  4PUF C;  1CQH A;  4K0G A;  2L6C A;  3CRU A;  4MA9 A;  2ZNM A;  1F3A A;  3I43 A;  1V9W A;  5ECL B;  4TVE A;  2H1G A;  3Q6O A;  4ICY A;  1ZYN A;  3W6G A;  4KF9 A;  3NIV A;  1EGR A;  2HZE B;  3TJJ A;  3DD3 A;  4K0N A;  2V32 A;  3LG6 A;  4MPG A;  3IE3 A;  4XIH A;  1FB0 A;  2FA8 A;  4KGI A;  2EC4 A;  3GFK A;  3QCP A;  1OC9 A;  3UMA A;  4N11 A;  3GRX A;  1ERW A;  1S3C A;  1ERU A;  3DYR A;  1T7P B;  2R6K A;  2B3S A;  1T4Y A;  1B48 A;  1GRX A;  2DC5 A;  5IQY A;  2FLS A;  2H19 A;  2YZH A;  4RQR A;  1PN0 A;  3HA9 A;  3ZYW A;  1G6W A;  3ZTL A;  1ERT A;  2JSY A;  4K7O A;  1H4O A;  3HKR A;  22GS A;  2IFQ A;  4ISD A;  4EKZ A;  2I9H A;  3GL5 A;  2TRC P;  1NHO A;  2H1B A;  4XTS A;  3ZML A;  2J23 A;  4LMW A;  2DKH A;  4IN0 A;  1PMT A;  4IJI A;  2B1K A;  4N0Z A;  4K9Z A;  1GP1 A;  4I2U A;  4PGT A;  6GSX A;  3LXZ A;  1GNE A;  1URM A;  2YWI A;  3MDK A;  2E2G A;  3IAM 2;  3KTL A;  5D93 A;  1XXU A;  2PGT A;  1EV9 A;  4I5Q A;  1BQ7 A;  2A4H A;  2DKI A;  3GUS A;  4USS A;  2FWG A;  2H6Y A;  4L0W A;  3ZRE A;  1YEP A;  4HI7 A;  5JWR B;  4HS1 A;  1A8L A;  4WR4 A;  5IPG A;  2KHP A;  2MBS A;  4AJ8 A;  1AQV A;  4HQZ A;  4EO3 A;  4BVY A;  4QL9 A;  2WFC A;  1V2A A;  2R4V A;  4IP6 A;  2H6Z A;  1T1V A;  5IMD A;  5JWO B;  3EU3 A;  5FT3 A;  1AW9 A;  4PUA A;  3A2W A;  1CQG A;  3BCK A;  1KBN A;  1HYU A;  1G7E A;  4ECJ A;  1SK1 A;  2L5O A;  1U87 A;  3IPZ A;  4TR0 A;  5GST A;  1AQW A;  4K6X A;  5LD0 A;  3GTU B;  1R5P A;  2L6D A;  4NV5 A;  2D28 C;  2LKU A;  1F37 A;  1O85 A;  3MAK A;  3HVV A;  5AIX A;  4HQS A;  5AIS A;  4FYU A;  3FZ4 A;  2ES7 A;  1SKR B;  3U6V A;  4MH2 A;  2DJ3 A;  3IHQ A;  1SL0 B;  1SYR A;  2XBI A;  3FZ5 A;  5EL8 A;  2B6M A;  2LUS A;  3F4T A;  2GSR A;  3OR5 A;  2GTU A;  3NZN A;  4FQU A;  3A5I A;  3I9V 2;  4DVC A;  3GIX A;  2C0G A;  2O85 A;  5H5S A;  1DE1 A;  3QMX A;  3FHK A;  3VWX A;  4MMM A;  4J2F A;  1B9Y C;  5KOX A;  4IHU A;  4BWS A;  4ZBB A;  1BJX A;  4KDX A;  3IV4 A;  2GZZ A;  4O5R A;  5ECH B;  1W4V A;  2DJ1 A;  1F3B A;  2CVD A;  2M46 A;  2VAF A;  2B7J A;  4Q5Q A;  2R0P A;  3LGC A;  4WKW A;  4AJ7 A;  4BWQ A;  3ZIJ A;  2BMX A;  5DQY A;  3DRN A;  3ZIT A;  3DIE A;  1GTI A;  2LQQ A;  2XHF A;  4TXV A;  3UVH A;  2FY6 A;  5GZZ B;  4JBB A;  2ZUP A;  3LJR A;  5ID2 A;  2KP2 A;  4TOP A;  4MF6 A;  1G0T A;  3IC4 A;  3H4K A;  1JLW A;  1K3Y A;  1YKA A;  2CVK A;  5F07 A;  2A4V A;  4JE1 A;  4K1F A;  3QDN A;  4PQH A;  4JR6 A;  2B5Y A;  5AGY A;  3EPT A;  3LXT A;  1EOG A;  2ON7 A;  3LEF A;  3HHV A;  1J9B A;  1X9W B;  2EIR A;  4IQJ M;  5HR2 A;  2IMK A;  5ECO B;  2GQL A;  2IWT A;  5B7C A;  4V2L A;  1Q4J A;  3F3Q A;  1R26 A;  5J3R A;  4PQI A;  1YKC A;  1ACV A;  2R0C A;  5INY A;  3UL3 A;  1SL2 B;  2P5R A;  2LST A;  3V1W A;  3ZFL A;  3DGQ A;  2CQ9 A;  3HCZ A;  4GRF A;  4GSS A;  4TXO A;  2H0G A;  1RK4 A;  1XWC A;  3O76 A;  4GLT A;  3FY7 A;  4RUV A;  1MDI A;  1DE2 A;  2CVB A;  3J7Y b;  2EIQ A;  2E2M A;  3DWV A;  4GTU A;  1O8X A;  2O8V B;  3LOR A;  2H72 A;  3GKK A;  4JZQ A;  3D22 A;  2FNO A;  3BOA A;  5LNK e;  4G0L A;  5IMA A;  4Q5N A;  2VLU A;  5DQS A;  4N0V A;  3I69 A;  3KEB A;  4OO4 A;  3RHB A;  1T00 A;  3QPM A;  2LJK A;  1E6B A;  5DJM A;  1GSF A;  2HRF A;  1GSD A;  3F4R A;  3FK8 A;  2D27 A;  2YCD A;  1KNG A;  2B5X A;  5ECM B;  5KOW A;  1GLQ A;  2H73 A;  5ABR A;  5A4U A;  4HJ2 A;  2IPA A;  5D8I A;  4KCE A;  3KMO A;  2G2Q A;  2JZS A;  3R2Q A;  5G2Z A;  4P3Y B;  3HVS A;  17GS A;  2IN3 A;  5J9C A;  5J4U A;  1RQM A;  2L4Q A;  3E9J B;  1UC7 A;  6GST A;  3H8Q A;  1GUL A;  1ZYQ B;  2TIR A;  5GAP D;  5ECP B;  1SYX A;  5BRT A;  3H93 A;  2VCQ A;  4KH7 A;  4TKY A;  1XIY A;  2C80 A;  2REM A;  5HFI A;  1SJ6 A;  5G31 A;  1T8E B;  1VF3 A;  1XZO A;  2HI7 A;  2M72 A;  1GSS A;  3HZ8 A;  5G5F A;  4WEY A;  2N5F A;  4IW9 A;  2X8G A;  1WWJ A;  3TGZ A;  5COH A;  1FB6 A;  4HJM A;  4FIW A;  2JAD A;  3IDV A;  16GS A;  3P8W A;  2LRT A;  2VIM A;  5CRG A;  4TR1 A;  2RM5 A;  1RW1 A;  3D4T A;  3L9S A;  3F3R A;  1VF4 A;  4NHZ A;  1QFN A;  5CP1 A;  1XOB A;  2CV4 A;  3LW9 A;  4MZC A;  4NV2 A;  3VUR A;  3KP9 A;  2N5A A;  4MPF A;  1FOV A;  2NDO A;  5IMF A;  6GSY A;  4WF4 A;  5GSS A;  3HXS A;  1JZD A;  2C3T A;  3ZFB A;  2H0I A;  4OWY A;  4J56 E;  2GVP A;  2GZY A;  3N5O A;  1B8X A;  4KB3 A;  3TJG A;  3GV1 A;  3TKP A;  3A3T A;  4KND A;  4MH3 A;  3VWU A;  5JWQ B;  1U3I A;  1PSQ A;  1IYI A;  1AUC A;  2XC2 A;  3L9V A;  2C0D A;  1SL1 B;  7GSS A;  1WJK A;  4ECI A;  4YKG A;  3W8S A;  5DDL A;  3CSH A;  3KTB A;  6GSU A;  1GTU A;  2DMM A;  1MDK A;  5E4W A;  5CNW A;  5H5Q A;  3TOT A;  2QKE A;  3TB2 A;  2FWH A;  4K8M A;  4POL A;  3DVW A;  3D4M A;  4I8B A;  5G1K A;  3ZMK A;  4KSM A;  5B6M A;  4KUN A;  4GWR A;  3GST A;  2OAD A;  2QGV A;  3D0Z A;  2LEG A;  3BJ5 A;  2WS2 A;  5DAL B;  5F0G A;  2YN1 A;  2NTO A;  3GYK A;  2J9H A;  2IJY A;  4POK A;  4PXO A;  4MJE A;  5DAK B;  1TK0 B;  1WP0 A;  4H86 A;  2OKA A;  2F9S A;  3GSS A;  4ML6 A;  3QAW A;  2OE3 A;  1JLV A;  1MDJ A;  4LA1 A;  5ID2 B;  4NWY A;  3UAP A;  5J5N A;  2E7P A;  3EIN A;  1GTB A;  5EPF A;  1EZK A;  3GL3 A;  3VLN A;  3UBL A;  5DCH A;  1OKD A;  3DML A;  3QOU A;  1YDK A;  4POB A;  4O7H A;  2NBS A;  4D73 B;  4ZL7 A;  2IIY A;  1GL8 A;  1PL2 A;  3ME8 A;  3GX8 A;  1K0N A;  4FYB A;  3PH9 A;  2VCZ A;  3UAR A;  5F05 A;  1GTA A;  3P2A A;  1FVJ A;  2DSA A;  3LYK A;  2AV4 A;  3MIX A;  3HYP A;  1QK8 A;  2JSZ A;  2BJX A;  3ZVJ D;  3HJP A;  2HZF A;  5HR1 A;  3ED3 A;  4DSR A;  3PGT A;  3KH7 A;  3C7M A;  4GQF A;  2DJ0 A;  3QFA C;  4OCF A;  4L5O A;  4A5P A;  1PX6 A;  1VF2 A;  3QAG A;  1PKW A;  5IPH A;  2HSY A;  3L78 A;  2MMN A;  4O92 A;  3F63 A;  4MDC A;  3ISO A;  1GH2 A;  3D21 A;  1PN9 A;  1PL1 A;  4MF7 A;  4K7I A;  2HFD A;  3GMF A;  2F3M A;  2LNT A;  3ERF A;  3E3E A;  2VL3 A;  3J7Y k;  5ECK B;  3JCM L;  2FWE A;  4MZB A;  3DKS A;  1HQO A;  4WBR D;  2FWF A;  1SKW B;  4V2N A;  2DIY A;  1ZYP A;  3BBY A;  2MMZ A;  2F8F A;  2H75 A;  1JZO A;  1B9X C;  4AF2 A;  1FO5 A;  1AAZ A;  2B5E A;  2AYT A;  1EWX A;  3QAV A;  4GSN A;  1R5A A;  2PBJ A;  1WMJ A;  1TU8 A;  2VL9 A;  2NVL A;  2HE3 A;  1THX A;  2R37 A;  1Z9H A;  3EU4 A;  4MJA A;  4YQU A;  2CA8 A;  1X5C A;  1SK2 A;  3CXG A;  3US3 A;  1FAA A;  3SBC A;  3GKN A;  4G0I A;  4XS4 B;  1YF0 A;  3QD9 A;  2JU5 A;  2FD3 A;  2YP6 A;  3A2V A;  1K0O A;  2CZ2 A;  2IME A;  5ENU A;  1V57 A;  3GH9 A;  3ERW A;  5J41 A;  3CMI A;  3FRC A;  3VK9 A;  4I2T A;  4JRR A;  4BA7 A;  5IO0 A;  3FW2 A;  2H1D A;  1EEJ A;  2F8A A;  4E8E A;  2I1U A;  2L59 A;  3TJB A;  4BL7 A;  2KLX A;  3N9J A;  3KCM A;  2JL4 A;  1SK0 A;  4YAP A;  1HNA A;  4IEL A;  3D5J A;  5D9W A;  4EXJ A;  1ON4 A;  2VCW A;  2H74 A;  2E0Q A;  3IOS A;  5IOX A;  4YAV A;  2K8V A;  4GST A;  3C71 A;  3G7Y A;  2HSM A;  3IK7 A;  2WGR A;  4MNN A;  2H1A A;  5D9X A;  4F0C A;  5KN3 A;  1XVW A;  4PNG A;  2B7K A;  4TW5 A;  3FR9 A;  3FKF A;  4EVM A;  1TRV A;  2X8C A;  3APO A;  1T3B A;  3O6T A;  5IO2 A;  1X0R A;  2LRC A;  1X5D A;  3MWH A;  2IMI A;  4V2M A;  2WDU A;  3NOF A;  2L4C A;  1MD4 A;  2CZ3 A;  4IJ3 A;  1OYJ A;  4PNF A;  1V58 A;  2K9F A;  4WR5 A;  3MYD A;  1ZMA A;  1XWG A;  3HZ4 A;  3M9K A;  4ZXG A;  3A2X A;  4XHM A;  2PN8 A;  3RPN A;  2QA2 A;  2R5G A;  2LNS A;  4KSO A;  12GS A;  9GSS A;  3TRP A;  3G7J A;  1THO A;  3LSZ A;  1XCC A;  1XWK A;  2V1M A;  2A2R A;  4Z2T A;  4KAE A;  1A0F A;  2H30 A;  5C04 A;  4EDY A;  1HNC A;  4N10 A;  3FZ9 A;  1OKT A;  3GUR A;  4LMV A;  2K8S A;  3C1S A;  1R7H A;  3Q19 A;  4K7N A;  5IOW A;  3FYG A;  2I81 A;  2VD0 A;  3CBU A;  1OE8 A;  5CRE A;  4TR1 B;  1C72 A;  5ECQ B;  4JU5 A;  3BD2 A;  4PUR A;  2CX3 A;  3TJF A;  2LV3 A;  3EC3 A;  1PX7 A;  3EVI A;  4EIQ A;  5GAN D;  5IM9 A;  3DXB A;  1XPV A;  3PIN A;  2I3Y A;  6GSS A;  6GSW A;  1DSB A;  3K8N A;  2C3Q A;  4MJC A;  2FHE A;  3D6I A;  3G7I A;  4N30 A;  2PWJ A;  2IMF A;  5CRW A;  3KD0 A;  3PR8 A;  3F6F A;  4RI6 A;  1YJ6 A;  1YF1 A;  1YZX A;  4ML1 A;  2YAN A;  2GQM A;  4BVY B;  3F9U A;  4J57 E;  3DEX A;  1G6Y A;  3TKS E;  1ERV A;  4GXZ A;  3TUE A;  2HZE A;  3W8J A;  20GS A;  2V6K A;  4OCE A;  2PMT A;  4ID0 A;  3HVX A;  2N5B A;  2YWO A;  2OE1 A;  1N8J A;  3IA1 A;  2LRN A;  1WE0 A;  2FA4 A;  1M9B A;  4F0B A;  4HZ4 A;  4ZB9 A;  5F06 A;  1FW1 A;  1AC1 A;  2O7K A;  4KCA A;  5G1L A;  2OE0 A;  1BX9 A;  3VWV A;  4WBJ A;  2IMD A;  3GKX A;  3IRA A;  3KM6 A;  5IMV A;  2PER A;  4KA0 A;  2JZR A;  4IVF A;  3LWA A;  2X4A A;  1IYH A;  2GLR A;  2MYG A;  1MD3 A;  3FZA A;  4G9H A;  1TOF A;  4MF5 A;  2A2S A;  5DCG A;  3C73 A;  1TXX A;  1UN2 A;  5CO3 A;  1U88 A;  2GSQ A;  1U6T A;  2YNX A;  5B6N A;  4KE3 A;  4LL4 B;  4Q5F A;  4FYC A;  2OAC A;  2K6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...