3F4TA

Crystal structure of wolbachia pipientis alpha-dsba1 c97a/c146a
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
200
structure length
200
Chain Sequence
ITSNELLLPLPNDKLLGDPKAPILMIEYASLTCYHCSLFHRNVFPKIKEKYIDTGKMLYIFRHFPLDYRGLKAAMLSHAYEKQEDYFNFNKAVFNSIDSWNYYNLSDLTLLQRIAALSNLKQDAFNQAINDKKIMDKIVNDKSLAINKLGITATPIFFIKLNDDKSYIEHNKVKHGGYKELKYFTNVIDKLYGKAIVKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of the Oxidoreductase alpha-DsbA1 from Wolbachia pipientis
pubmed doi rcsb
source organism Wolbachia pipientis
molecule tags Oxidoreductase
molecule keywords Putative uncharacterized protein
total genus 75
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2008-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.80 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Ribonucleotide Reductase Protein R1; domain 1 3f4tA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3f4tA01
3UMAA 2GT6A 2ON5A 2GQKA 1PRXA 4PX1A 1TOFA 1MD3A 4LLRA 2RLIA 4EUYA 4XTSA 2PERA 3W6GA 3A2WA 1V98A 1QGVA 3CRTA 2AJQB 5HR0A 3R2QA 4XS4B 4MZCA 3F3QA 4ZBAA 1XFLA 1EEMA 3IRAA 4KH7A 1TJDA 1GUHA 2IMEA 5GAPD 3BD2A 3EU3A 5AN1A 3DRNA 5DDLA 3LG6A 3VPQA 2M46A 1YF0A 3IXRA 1GP1A 5DAKA 2X64A 3ZIVA 2FY6A 4TXOB 3A2XA 4K1FA 2DJ0A 4OMVA 4J2FA 3G7JA 2ALBA 5DBQA 5G5FA 2V6KA 1PGTA 1GTUA 4MH3A 4N30A 2IMIA 2DIZA 2C3QA 1AW9A 1GSYA 5HR3A 2LJAA 1XWBA 1VGLA 2VCTA 3WT1A 5G1KA 2RM5A 2LRNA 4TKYA 3G9BA 1TRSA 2G2QA 4I2UA 2CZ2A 3D4TA 2L5OA 3FZ5A 5GSSA 2GQMA 5GSTA 4N11A 1BX9A 2VL2C 3VPTA 4L5LA 2VM1A 3I6AA 5LD0A 5JCWA 1FVJA 1OKTA 3FHKA 1WWJA 2CVBA 3QDNA 3QMXA 1A8YA 1K3YA 1YJ6A 1T8EB 1WRYA 1SKRB 4IW9A 2R37A 1TRVA 4QQ7A 1OC3A 4DSSB 5IMZA 2GVPA 1XZOA 1VF4A 1QFNA 3ERFA 1BQ7A 1F3BA 1FB0A 2DJ3A 4HS1A 2F3MA 1F37A 2V32A 4ZL9A 2VCXA 1W89A 1LJRA 4OWYA 3ZMLA 1I9DA 4GSNA 4GCIA 3EC3A 3TB2A 1MDKA 3EMXA 1JHBA 5J4UA 5E59A 3IK7A 3EVIA 4PQHA 5FWGA 1ERTA 2AUVA 4MZWA 5JWQB 5GAND 1SK0A 1A2LA 1M2BA 3A5WA 5D9XA 5B8BA 1SL2B 3FR6A 3IOSA 3BBYA 3PGTA 4TXVA 4N0ZA 1SD8A 1GTBA 3CRUA 5CRDA 14GSA 1V40A 3LORA 4XHMA 3RHCA 4PXOA 2C80A 4KGIA 5ECOB 4AJ8A 1F2EA 4PQ1A 1DUGA 1TRUA 3DKSA 2H71A 3GA4A 2L4QA 3KP8A 3RHBA 2B6MA 1C72A 3NOFA 1Y6EA 2CV4A 3GYKA 2KHPA 3FR3A 1YKAA 4NHWA 1GTAA 2HYXA 4MP4A 3FR9A 5J9BA 2VCVA 1M7TA 3GNJA 3QAGA 2K8VA 4IJIA 4MMMA 3GTUA 4IELA 4RQRA 3H93A 5EY6A 3VK9A 2YV7A 3RDWA 2BTOT 3QPMA 2HNLA 1R5PA 1TK0B 3IC4A 1UC7A 5HR2A 2DJKA 4IP1A 1Y25A 2RIIA 1ZL9A 4I8BA 3F3RA 3HKRA 3J7Yb 1BJXA 1AQWA 3CSJA 1RW1A 4ULXA 5D93A 4F9ZA 2V41A 1W4VA 3V1WA 2RUEA 5ID2B 3VWUA 5ECRB 5IMCA 4MPGA 2VOCA 1JZDA 1M2DA 2H1GA 3P90A 4TN8A 2PVQA 4ML1A 2GDRA 2P5QA 3TKQA 1MD4A 3E9JB 4CHSA 1GSFA 2B7KA 4YAVA 3APQA 3EE2A 4HQZA 2P0GA 3C7MA 4WKWA 3DVXA 2FCHA 1XVQA 2A2RA 1X5DA 1GRXA 2PWJA 4K7OA 4EO3A 4IS0A 1SJ6A 4K0NA 1HNCA 3TJFA 4L0WA 5KEJA 1THOA 2DMLA 2FUG2 1XIYA 2IIYA 3D5JA 2VIMA 2VL3A 2NBSA 1PD21 4POMA 2YV9A 1A2JA 2EIOA 1O73A 3GKXA 5JWOB 4NV5A 5A4WA 1T7PB 2FA4A 4HQSA 4MDCA 5G2ZA 4NMUA 1H4OA 2LNTA 1DBYA 5IOWA 4NWYA 2AHEA 1PA3A 4NV2A 1SL0B 3FZ4A 3IA1A 1M99A 2H6XA 1SK1A 3FZ9A 1SYRA 2PUKC 3W8SA 1PMTA 3DGQA 3GN3A 4ZBDA 2C4JA 2CAQA 6GSXA 1IYHA 3GKMA 4OCEA 4LMVA 3TRXA 5D9WA 2ZNMA 4BWSA 3QAVA 3D22A 1S3CA 3ERWA 5DCGA 2LJRA 5GZZB 1G6YA 4HDEA 1Z7RA 2QGVA 5KN0A 3TRQA 4GWRA 3KTLA 4YQUA 1XWCA 4IVFA 1KTEA 1ERWA 3TOUA 4GQFA 2VUPA 4MJBA 2WB9A 4HZ4A 1Z5YE 1R26A 3QD9A 3O6TA 18GSA 4TR1A 5D96A 2IL3A 1VF3A 3MDKA 2K8SA 4KDUA 1KBNA 2LRTA 3ZYWA 5ECMB 1YF1A 4V2LA 5ECKB 2H6YA 3IAM2 3US3A 1CQGA 1TI3A 3C73A 2LJKA 2VD0A 2Z9SA 4DSRA 6GSTA 4BWQA 19GSA 1K3LA 2M80A 2DLXA 3L9SA 2YN1A 4G10A 4POKA 1F3AA 5JCUA 3TKSE 1JZWA 1XW9A 3DIEA 4OCFA 2EIQA 2C3NA 3FKFA 2YZUA 3L0HA 3C71A 2MMAA 4L8EA 3WYWA 2FWFA 2D2ZA 2WFCA 3UIWA 4RQXA 3TDGA 4D73A 3IHQA 3Q74A 5D9VA 2C0GA 3J7Yk 5C00A 5ELGA 2LS5A 1LU4A 5ENUA 4RUVA 3HVXA 2MBSA 1XWGA 3P8WA 3HHVA 1UN2A 4WR5A 4L0UA 1PX6A 1R7HA 2WRTA 2CZ3A 3LWAA 1TI1A 5CREA 4TR3A 3VWVA 3UBLA 1EGRA 2HSHA 2VL2A 4AF2A 3FK8A 2PN8A 2IFQB 5DJLA 3NIVA 2I1UA 2A4VA 1R5AA 2GS3A 4POBA 4K9ZA 1EP7A 3F6DA 2OE1A 3BOAA 2TRXA 4IQAA 5F8BA 2H74A 2H0HA 1XOBA 1YEPA 4I2TA 3FW2A 4DSQA 1K0NA 1TK5B 4EXJA 5ECLB 1OE8A 1PQNA 1SJIA 4WXTA 1USBA 4KB3A 1A23A 1O7UA 1SYXA 4TR1B 2ON7A 4G9HA 3WGEA 2R5GA 3FY7A 3ZREA 2XBQA 3F63A 2GTUA 4G19A 2RM6A 1I5GA 2IN3A 3GURA 4XRAA 4YAPA 3TJJA 2ES7A 4Q5NA 1JLVA 1NW2A 1SKSB 2H0IA 2GQLA 5C04A 2BMXA 2CQ9A 4AJ7A 4FO5A 11GSA 1VRSD 5ELAA 1FAAA 3VLNA 1A24A 2F8FA 4ZB8A 5IQYA 1T4ZA 1Z6NA 3E0UA 5DJMA 3VURA 3HD5A 2FGXA 3KM6A 2YP6A 2FNOA 2MMOA 2FHEA 1R4WA 4JEDA 1QUWA 1ZZYA 2GZYA 1DE2A 1BEDA 5G1LA 12GSA 1ACVA 2H66A 3ZZXA 1ON4A 3HJPA 4MPFA 3ZMKA 2C0DA 3D4MA 1V9WA 5F05A 2PBJA 1URMA 4H86A 2LQQA 2PGTA 5G30A 3H79A 2H70A 2HSYA 5B6NA 2LRCA 4EDYA 1WIKA 3M8NA 4ZIJA 2YWOA 3TKPA 2LNSA 1OVNA 4JRRA 3APSA 5IMFA 3HZ8A 5ECNB 3GUSA 4TXOA 5DQSA 1V2AA 4E8HA 4KX4A 2WULA 1PKZA 1GUKA 2LEGA 6GSYA 4KE3A 3KXOA 2YZHA 2XBIA 3HY2A 3C8EA 2L6CA 1XWKA 4WBJA 4ECIA 1HQOA 2PPTA 4ACSA 16GSA 5HFIA 4MF5A 2C0EA 2IWTA 5ECQB 1TU7A 1QMVA 4JZQA 3QOUA 3I43A 5H5QA 2WS2A 3F0IA 1K0OA 2CAIA 3U5RE 1Z7PA 4GXZA 4HU7A 1WOUA 1YQ1A 1EV4A 3TOTA 22GSA 2R6KA 1N2AA 4Q5RA 2DIYA 2O85A 6GSWA 1GH2A 1EOGA 2B3SA 3F9UA 3M3MA 1BG5A 2F8AA 1Q98A 5FHIA 1TRWA 3D0ZA 1KEBA 2JADA 3S9FA 4BVYA 3ZL5A 5D73A 4OFTA 2TIRA 4XIHA 4O32A 3OR5A 1PSQA 2JZTA 2H30A 4LA1A 2XC2A 2CT6A 2R2JA 4GRFA 4CW9A 3LYPA 1HD2A 4FYBA 1V58A 4K0GA 4IP6A 2GSRA 2DSAA 1O81A 2J23A 2EIRA 5EVOA 4WETA 1X9WB 1WP0A 1V57A 2HRNA 4HJMA 1FOVA 4GSSA 1ZMAA 1AIUA 3H8QA 4IHUA 4RI6A 4KNDA 4OFNA 4KSOA 1O8WA 1SU9A 1YZXA 1T4YA 2CX3A 4LMWA 5CO3A 1HNBA 5AIVA 3QAWA 2JSYA 5J9CA 1FB6A 5COHA 1ZOFA 4F82A 4IKHA 4WF5A 4MZBA 3KMOA 1JLWA 2REMA 3UBKA 3HVVA 1TW9A 2E0QA 4KDYA 5A5KA 3QCPA 4TOPA 1ZYQB 2ZCTA 3F4TA 1B48A 2B1KA 2CX4A 1M9AA 3ZVJD 3LQ7A 3WGXA 2FWHA 1N8JA 2DJ1A 5D9TA 2CVDA 1QK8A 4J57E 2GSTA 2LSTA 4DEJA 3LFLA 1NSWA 2GZPA 2GZZA 2LV3A 4ML6A 4X0XA 1Z9HA 1B9YC 3DD3A 3IR4A 2XPDA 1SKWB 1OAZA 4ECCA 5DQYA 5DVBA 1GLQA 4MF7A 4F03A 3HYPA 3D21A 2AYTA 1U87A 2OACA 1MDIA 2VM2A 2MYGA 5IMDA 3SWLA 4ZBBA 1WMJA 3LSZA 1MDJA 5G5EA 5IO0A 2GSQA 2JL4A 3KMNA 2I9HA 2E2MA 2QKEA 2V2GA 4BVXA 3CSIA 3L4NA 4QL7A 4K6XA 1HNAA 1EV9A 5CRHA 1EZKA 4O7HA 3F8UA 1H75A 1Z6MA 5G31A 2HZFA 4KA0A 1M9BA 3CBUA 2MBTA 2N5BA 1FVKA 3NZNA 2P5RA 3PH9A 4FH8A 4F0CA 3IV4A 4MF6A 1ABAA 1K0DA 4WEYA 4O5RA 1SL1B 2YJ7A 4OO5A 2O7KA 4LL1B 4P3YB 2ZUPA 2QSIA 4PUFC 5H5RA 2YWIA 3F4RA 3QFBC 3ERGA 4K8MA 2MZCA 2H1BA 3KH7A 3GFKA 3Q18A 3EURA 4FYCA 1EGOA 4NPBA 2KP1A 2LTKA 3GL3A 5B7CA 1ML6A 1UVZA 2G0FA 1MEKA 3CTFA 4WR4A 4O92A 3EINA 2IMKA 4GTUA 3LXTA 3TCOA 3WD6A 1JZOA 4EDZA 2R4VA 1GSQA 3N9JA 4N10A 4IN0A 2HZEA 2O87A 3GX8A 1G7OA 4ZL7A 4ILFA 5CNWA 5EPFA 5AIXA 3Q19A 4XRDA 3KZQA 4V1Ap 4BL7A 2JZSA 5HQPA 4X43A 4POLA 2A2SA 2H73A 4J56E 4EC0A 1A0RP 1TKDB 5ABRA 3IE3A 1GULA 5DCHA 4IBPA 1K0BA 2L57A 3DMLA 3UVHA 4K2DA 5IIZA 3EWLA 2K9FA 1WPIA 5A4VA 2C1YA 4E8EA 3RAZA 3LGCA 1BAYA 4JU5A 3APOA 3EU4A 1EP8A 1THXA 2H1DA 1U3IA 1TDIA 4NAXA 3L9UA 2VCQA 1B9XC 2VLUA 1HYUA 2CA8A 1BYEA 4MLYA 3WT2A 1PL1A 1A0FA 2OKAA 2OA7A 1OKDA 3JCML 4HUAA 4GLTA 1ST9A 4XS4A 1O6JA 4PQIA 3I9V2 3MNGA 2L4CA 3A2VA 3DWVA 1CQHA 1JFUA 2FD3A 5IOXA 1ZGNA 2DBCA 4KDXA 1IYIA 2GSSA 1S3DA 4KUNA 1TU8A 2B5EA 2YPMA 1AUCA 2X8CA 1LBKA 1GNWA 4IGJA 3GRXA 4OFMA 1GTIA 2HLSA 4MJEA 1FHEA 4FIWA 2E2GA 2KOKA 5AGYA 4V2MA 4EF0A 1TXXA 1J08A 4RI7A 2AV4A 5ECHB 3LYKA 2DJ2A 3W8JA 3CTGA 5B6MA 20GSA 2C0FA 3ZFLA 4MJCA 2AAWA 3DVWA 5IPHA 4WBRD 3GHAA 2B1LA 3G7IA 1TTZA 1EEJA 2MMZA 2JSZA 2M72A 3ISOA 5IPGA 1Z3EA 2NPBA 1U6TA 2FWEA 3TJBA 1GL8A 4LL4B 5EL8A 1K3OA 1OE7A 3UOMA 4BPYA 5J5NA 2YWNA 3LEFA 2L59A 3C1RA 3TRPA 1O8XA 1EWXA 4FYUA 3L78A 2FLSA 3LJRA 1RK4A 3BCKA 6GSSA 4MABA 3M0FA 1FW1A 1VF2A 2H8LA 2YCDA 3ZLPA 1GSSA 3GV1A 2CVKA 3UARA 3HJMA 2YNXA 5DAKB 2JU5A 3GH6A 5F0GA 3MSZA 1ERUA 3IAS2 5L71A 3O76A 4ZB9A 5JCGA 3FZAA 5A4UA 1MTCA 5ID2A 3ZFBA 4JR4A 3CMIA 3GIXA 5LCZA 5B8AA 1NHOA 2HFDA 2J9HA 2TRCP 3TKSC 1AQXA 1X5CA 5F07A 1F9MA 3ED3A 4V2NA 2JZRA 1T3BA 3MWHA 3UJ1A 3O3TA 4PUAA 4KCAA 5ECSA 1PL2A 1T1VA 1TK8B 1FO5A 1K0AA 3CXGA 5HFGA 3DYRA 4V1Ag 2VLTA 3P2AA 3GH9A 3KD0A 5H5SA 4CDOA 3ME7A 2R3XA 4K7NA 3CSHA 3AY8A 4HZ2A 5FT3A 2WDUA 2N5FA 1U88A 3GX0A 4JR6A 1J0FA 4YH2A 2WJUA 4TRXA 4HOJA 3FRCA 5IMAA 3ZTLA 2FA8A 4F2IA 3ZRDA 1AQVA 1AAZA 2K18A 4MJAA 2F51A 2N5AA 3VWXA 4GSTA 5J3RA 2B5XA 1XCCA 1X5EA 5D8IA 1YEXA 2VAFA 3PR8A 1XBSA 1YKCA 2IPAA 4PURA 1PX7A 4MCUA 3L9VA 5INYA 2HXKA 1K0CA 3IK9A 1NHYA 1GUMA 1GWCA 1OC8A 1S3AA 3CYNA 5KN2A 4XS1A 3GL5A 2HRFA 4I5QA 4TR4A 1ILOA 3BJ5A 5IO2A 2X8HA 3HZ4A 5AISA 4AJ6A 4I97A 5CYYA 2GLRA 5CRGA 3DXBA 2I81A 4ID0A 3TGZA 1B4QA 1XW6A 5J41A 4HEA2 1O85A 1ZCPA 3TKRA 3HCZA 5ECIB 4DSSA 1X9MB 3F4SA 3EMPA 2B5YA 2LKUA 5ECPB 2QC7A 2NTOA 1PKWA 3H4KA 2OE0A 1VF1A 2GGTA 2H72A 2VCWA 4QL9A 4IQ1A 1M2AA 3FYGA 1EOHA 1WJKA 1YDKA 3GMFA 1A8LA 3HDCA 4NHZA 2C3TA 4JE1A 1B4PA 4GQCA 3ZITA 4XCSA 3RPPA 3M9KA 4ZL8A 1GNEA 2P31A 2GT5A 2WCIA 3ZIJA 1NM3A 3ZVJA 2I3YA 1X0RA 4ZB6A 2H19A 2L6DA 5IM9A 2OADA 2H01A 1B8XA 2C8UA 3UEMA 3FEUA 1K0MA 1F6MC 4MA9A 3TJGA 1M0UA 2IJYA 2IMFA 5CP1A 3UAPA 5DALB 4ECBA 1XXUA 4KAEA 2BJXA 2OBKA 4EKZA 2H76A 5HR1A 2VCZA 3KGKA 3GSSA 4MH2A 3HJOA 2VO4A 4IJ3A 3C1SA 4OD7A 2AB6A 2KP2A 1U3AA 3KCMA 1XW5A 2RUFA 3GSTA 3M9JA 1JZRA 3HXSA 2HT9A 1G7EA 4YQMA 2OBIA 1A2MA 1GSDA 1E2YA 2LQOA 2DJJA 4ZXGA 4G2EA 1G6WA 1UA5A 2VLVA 1DSBA 4HU9A 4YQVA 2H6ZA 2H0GA 4D73B 4TW5A 1AC1A 1TP9A 3K8NA 1GSUA 4ZILA 5CRWA 2HE3A 2YWMA 5IMVA 2PU9C 3IDVA 2PVOC 5F06A 4GF0A 4TR0A 1J9BA 5E4WA 2MMNA 2XPEA 3WGDA 2JACA 3LXZA 3RPNA 3A3TA 4N0VA 3TUEA 2E7PA 3DEXA 1GLPA 2L5LA 4NXIA 3EYTA 3KIJA 1XPVA 3GTUB 5HFKA 4KCEA 2YOIA 4X1UA 4BA7A 3QFAC 2IMDA 3D6IA 4HJ2A 3TJKA 2F9SA 3PINA 3ME8A 4EVMA 4ECJA 17GSA 4Q5FA 2NVLA 1X9SB 2PMTA 4KSMA 3VFIA 3BCIA 1OYJA 1XOAA 2XHFA 2VL9A 3VWWA 3VI7A 2LUSA 5KN1A 2EC4A 3U6VA 4MK3A 6GSVA 5DALA 3Q6OA 1RQMA 3SBCA 4EL1A 1XWAA 2IFQA 1KNGA 3F6FA 1SJZA 3KEBA 2H1AA 2V1MA 2O89A 3UVTA 4PNFA 1OC9B 13GSA 2V6OA 3H1NA 4TVEA 4Q5QA 2X8GA 3GKNA 1ZYEA 1G0TA 9GSSA 1Q4JA 3G7YA 4PNGA 3KH9A 4OO4A 4EE0A 3RBTA 2NDOA 4F0BA 1OC9A 3QR6A 2DMMA 8GSSA 3HVSA 1QQ2A 2OJLA 2VD1A 7GSSA 2FWGA 3VI5A 5JWRB 4I6XA 3HA9A 1QXHA 1FG4A 1AXDA 2H75A 2K6VA 1GSEA 2WZ9A 3IBHA 1SK2A 4JBBA 3P7XA 10GSA 5CAXA 2KUCA 4HI7A 4XS6A 4ISDA 2YJHA 3TKSA 1WE0A 1ERVA 3M1GA 1PN9A 1SD9A 4KW6A 2HI7A 4K7IA 2WGRA 5LNKe 2HZEB 3KJYA 2X99A 2B7JA 2DC5A 2O8VB 1E6BA 3GKKA 3UL3A 4WF4A 4L5OA 6GSUA 1YY7A 2OE3A 3IPZA 4DVCA 2KLXA 4PGTA 5KN3A 3E3EA 2I4AA 3MAKA 3I69A 1DE1A 1SENA 3KP9A 4AGSA 1T00A 1XVWA 3N5OA 3KTBA 2YANA 4Z7XA
chains in the Genus database with same CATH superfamily
3UMAA 2GT6A 2ON5A 2GQKA 1PRXA 1S3RA 4PX1A 1TOFA 1MD3A 4LLRA 2RLIA 4EUYA 4XTSA 2PERA 3W6GA 3A2WA 1V98A 1QGVA 3CRTA 2AJQB 5HR0A 3R2QA 4XS4B 3MYDA 4MZCA 3F3QA 4ZBAA 1XFLA 1EEMA 3IRAA 4KH7A 1TJDA 1GUHA 2IMEA 5GAPD 3BD2A 3EU3A 1MH9A 5AN1A 3DRNA 5DDLA 3LG6A 3VPQA 2M46A 1YF0A 3IXRA 1GP1A 5DAKA 2X64A 3ZIVA 2FY6A 4TXOB 3A2XA 4K1FA 2DJ0A 1TJVA 4OMVA 4J2FA 3G7JA 2ALBA 5DBQA 5G5FA 2V6KA 4K5SA 1PGTA 1GTUA 3OCEA 4MH3A 2RCNA 4N30A 2IMIA 2DIZA 2C3QA 1I0AA 4PTSA 1AW9A 2R0GA 1Z4QA 1GSYA 2JARA 5HR3A 4MX2A 2A2PA 2LJAA 1XWBA 1VGLA 2VCTA 3WT1A 5G1KA 2RM5A 2LRNA 4TKYA 3G9BA 1TRSA 2G2QA 4I2UA 2CZ2A 4ICYA 3D4TA 1T9HA 2L5OA 3FZ5A 5GSSA 2GQMA 5GSTA 4N11A 1BX9A 2VL2C 3VPTA 1ZYPA 4L5LA 2VM1A 3I6AA 5LD0A 5JCWA 2X4AA 4EIPA 4Z2RA 1FVJA 1OKTA 3FHKA 1WWJA 2CVBA 3QDNA 3QMXA 1A8YA 1K3YA 1YJ6A 1T8EB 1WRYA 1SKRB 4IW9A 2R37A 1TRVA 4QQ7A 1OC3A 4DSSB 5IMZA 2GVPA 1XZOA 1VF4A 1QFNA 4KF9A 3ERFA 1BQ7A 1F3BA 1FB0A 1KQ7A 2DJ3A 4HS1A 2F3MA 1F37A 2V32A 4ZL9A 2VCXA 1W89A 4L57A 1LJRA 4OWYA 3ZMLA 1I9DA 4GSNA 4O5UA 4GCIA 3EC3A 3TB2A 1MDKA 3EMXA 1JHBA 5J4UA 5E59A 3IK7A 3EVIA 4PQHA 5FWGA 5HW2A 1ERTA 2AUVA 4MZWA 4FQUA 5JWQB 5GAND 1SK0A 1A2LA 1M2BA 4USSA 3E04A 3A5WA 5D9XA 5B8BA 1SL2B 3FR6A 3IOSA 3BBYA 3PGTA 4TXVA 4N0ZA 1SD8A 1GTBA 5D6BA 3CRUA 4EEIA 5CRDA 14GSA 1V40A 3LORA 4XHMA 3RHCA 4PXOA 2C80A 4KGIA 5ECOB 4AJ8A 1F2EA 4PQ1A 1Z4KA 1DUGA 1TRUA 3DKSA 2H71A 3GA4A 2L4QA 3KP8A 3RHBA 2B6MA 1C72A 2QGAB 1Q91A 3NOFA 1Y6EA 2CV4A 3GYKA 2KHPA 3FR3A 1Z4LA 1YKAA 2QA1A 4NHWA 1GTAA 2E9FA 2HYXA 4MP4A 3FR9A 3TV2A 5J9BA 2VCVA 3IC8A 1M7TA 3GNJA 3QAGA 2K8VA 4IJIA 4MMMA 3GTUA 4IELA 4RQRA 3H93A 5EY6A 3VK9A 2YV7A 3RDWA 2BTOT 3QPMA 2HNLA 1R5PA 1TK0B 3IC4A 1UC7A 5HR2A 2DJKA 4IP1A 1Y25A 2RIIA 1ZL9A 4I8BA 3F3RA 4BIKA 3HKRA 3J7Yb 1BJXA 1AQWA 1FOHA 3CSJA 1RW1A 4ULXA 5D93A 4F9ZA 2V41A 1W4VA 3V1WA 2RUEA 5ID2B 3VWUA 5ECRB 5IMCA 4MPGA 2VOCA 3IHGA 1JZDA 1M2DA 2H1GA 3P90A 4TN8A 2PVQA 4ML1A 2GDRA 2P5QA 3TKQA 1MD4A 3E9JB 4CHSA 1GSFA 2B7KA 1RE5A 4YAVA 3APQA 3EE2A 4HQZA 2P0GA 3C7MA 4WKWA 3DVXA 2FCHA 1XVQA 2A2RA 1X5DA 1GRXA 2PWJA 4K7OA 4EO3A 4IS0A 1SJ6A 4K0NA 1HNCA 4APAA 3TJFA 4L0WA 5KEJA 1THOA 2DMLA 2FUG2 1XIYA 2IIYA 3D5JA 2VIMA 1IW7D 2VL3A 2NBSA 1PD21 4POMA 2YV9A 1A2JA 2EIOA 1O73A 3GKXA 5JWOB 1M3JA 4NV5A 5A4WA 1T7PB 2FA4A 4HQSA 4MDCA 5G2ZA 4NMUA 1H4OA 2LNTA 1DBYA 5IOWA 4NWYA 2AHEA 1PA3A 4NV2A 1SL0B 3FZ4A 3IA1A 1M99A 2H6XA 1SK1A 3FZ9A 1SYRA 4HGVA 2PUKC 3W8SA 1PMTA 3DGQA 3GN3A 4ZBDA 2C4JA 2CAQA 6GSXA 1IYHA 3GKMA 4OCEA 4LMVA 3TRXA 1XG8A 5D9WA 2ZNMA 4BWSA 3QAVA 3D22A 1C3CA 1S3CA 3ERWA 5DCGA 2LJRA 5GZZB 1G6YA 4HDEA 1Z7RA 2QGVA 5KN0A 3TRQA 4GWRA 3KTLA 4YQUA 1XWCA 4IVFA 1KTEA 1ERWA 3TOUA 4GQFA 2VUPA 4MJBA 2WB9A 4E88A 4HZ4A 1Z5YE 1R26A 2PFMA 3QD9A 3O6TA 18GSA 4TR1A 5D96A 2IL3A 1VF3A 3MDKA 2K8SA 4KDUA 1KBNA 2LRTA 3ZYWA 3RD8A 4G0IA 5ECMB 1YF1A 4V2LA 5ECKB 2H6YA 3IAM2 3US3A 4CY8A 1CQGA 1TI3A 3C73A 2LJKA 2VD0A 2Z9SA 4DSRA 6GSTA 5KOWA 4BWQA 19GSA 1K3LA 2M80A 2DLXA 3L9SA 2YN1A 4G10A 4POKA 1F3AA 5JCUA 5F91A 4G0KA 3TKSE 1JZWA 1XW9A 3DIEA 4OCFA 2EIQA 2C3NA 3FKFA 2YZUA 3L0HA 3C71A 2MMAA 4L8EA 3WYWA 2FWFA 2D2ZA 2WFCA 3UIWA 4RQXA 3TDGA 4D73A 3IHQA 3Q74A 5D9VA 2C0GA 1TJ7A 3J7Yk 5C00A 5ELGA 2LS5A 1LU4A 5ENUA 4RUVA 3HVXA 2MBSA 1XWGA 3P8WA 3HHVA 1UN2A 4WR5A 1Z4PX 4L0UA 1PX6A 1R7HA 2WRTA 2CZ3A 4HSCX 3LWAA 1TI1A 5CREA 4TR3A 3VWVA 2D28C 3UBLA 1EGRA 2HSHA 2VL2A 4AF2A 3FK8A 2PN8A 2IFQB 5DJLA 3NIVA 2I1UA 2A4VA 5F92A 1R5AA 2GS3A 4POBA 4K9ZA 1EP7A 3F6DA 2OE1A 3BOAA 2TRXA 4IQAA 5F8BA 2H74A 2H0HA 3FMWA 1XOBA 1YEPA 4I2TA 3FW2A 4DSQA 1K0NA 1TK5B 2I7DA 4EXJA 5ECLB 1OE8A 1VDKA 1PQNA 1DOFA 1SJIA 4WXTA 1USBA 4KB3A 1A23A 1O7UA 1SYXA 4TR1B 2ON7A 4G9HA 3WGEA 2R5GA 3FY7A 3ZREA 2PTSA 2XBQA 3F63A 2GTUA 4G19A 2RM6A 1I5GA 2IN3A 3GURA 4XRAA 4YAPA 3TJJA 2ES7A 4Q5NA 1JLVA 1NW2A 1SKSB 2H0IA 2GQLA 4Z2UA 5C04A 2BMXA 2CQ9A 4AJ7A 4FO5A 11GSA 1VRSD 5ELAA 1FAAA 3VLNA 1A24A 2F8FA 4ZB8A 1Q92A 5IQYA 1T4ZA 1Z6NA 3E0UA 5DJMA 3VURA 3HD5A 2FGXA 3KM6A 1K62A 2YP6A 2FNOA 2MMOA 3LW9A 2FHEA 1R4WA 4JEDA 1QUWA 1ZZYA 2GZYA 1DE2A 1BEDA 5G1LA 12GSA 1ACVA 2H66A 3ZZXA 1ON4A 3HJPA 4MPFA 4X4JA 3ZMKA 2C0DA 3D4MA 1V9WA 5F05A 2PBJA 1URMA 4H86A 2JAWA 1HY0A 2LQQA 2PGTA 5G30A 2R0PA 3H79A 2H70A 2HSYA 5B6NA 2LRCA 1Z4MA 4EDYA 1WIKA 3M8NA 4NFLA 4ZIJA 2YWOA 3HVNA 3TKPA 2LNSA 1OVNA 4JRRA 3APSA 5IMFA 3HZ8A 5ECNB 3GUSA 2HVGA 4TXOA 5DQSA 1V2AA 4E8HA 4KX4A 2WULA 1PKZA 1GUKA 2LEGA 6GSYA 4KE3A 3KXOA 2YZHA 2XBIA 3HY2A 3C8EA 2L6CA 1XWKA 4WBJA 4ECIA 1HQOA 4K5RA 2PPTA 4ACSA 16GSA 5HFIA 4MF5A 2C0EA 2IWTA 4MNNA 1ZYNA 5ECQB 1TU7A 1QMVA 4JZQA 3QOUA 3I43A 5H5QA 2WS2A 3F0IA 1K0OA 2CAIA 3U5RE 1Z7PA 4GXZA 4HU7A 1WOUA 1YQ1A 1EV4A 3TOTA 1HY1A 22GSA 2R6KA 1N2AA 4Q5RA 2DIYA 2O85A 6GSWA 1GH2A 1EOGA 2B3SA 3F9UA 3M3MA 1BG5A 2F8AA 1Q98A 5FHIA 4YIHA 1TRWA 3D0ZA 1KEBA 2JADA 1J3UA 3S9FA 4BVYA 3ZL5A 5D73A 4OFTA 2TIRA 4XIHA 4O32A 3OR5A 1PSQA 2JZTA 2H30A 4LA1A 2XC2A 2CT6A 2R2JA 4GRFA 4CW9A 3LYPA 1HD2A 2JAUA 4FYBA 1V58A 4K0GA 4IP6A 2GSRA 2DSAA 1O81A 2J23A 3R3EA 1Z4JA 2EIRA 5EVOA 4WETA 1X9WB 1WP0A 1V57A 2HRNA 4HJMA 1FOVA 4GSSA 1K7WA 1ZMAA 1AIUA 3H8QA 4IHUA 4RI6A 4KNDA 4OFNA 4KSOA 1O8WA 1SU9A 1YZXA 1T4YA 2CX3A 4LMWA 5CO3A 1HNBA 5AIVA 3QAWA 2JSYA 5J9CA 1FB6A 5COHA 4K2XA 1ZOFA 2PTRA 4F82A 4IKHA 4WF5A 4MZBA 3KMOA 1JLWA 2REMA 3UBKA 3HVVA 1TW9A 2E0QA 4KDYA 5A5KA 3QCPA 4TOPA 1ZYQB 2ZCTA 3F4TA 1B48A 2B1KA 2CX4A 1FUOA 1M9AA 3ZVJD 3LQ7A 3WGXA 2FWHA 1N8JA 2DJ1A 5D9TA 2CVDA 1QK8A 4J57E 2GSTA 2LSTA 4DEJA 3LFLA 1NSWA 2GZPA 2GZZA 2LV3A 4ML6A 4X0XA 1Z9HA 1B9YC 3DD3A 3IR4A 2XPDA 1SKWB 1OAZA 4ECCA 5DQYA 5DVBA 1GLQA 4MF7A 4F03A 1Z4IA 3HYPA 3D21A 2AYTA 1U87A 2OACA 1MDIA 2VM2A 2MYGA 5IMDA 3SWLA 4ZBBA 1WMJA 3LSZA 1MDJA 5G5EA 5IO0A 2GSQA 2JL4A 3KMNA 2I9HA 2E2MA 2QKEA 2V2GA 4BVXA 3CSIA 3L4NA 4QL7A 4O5QA 4K6XA 1HNAA 1EV9A 5CRHA 1EZKA 4O7HA 3F8UA 1H75A 1Z6MA 5G31A 2HZFA 4KA0A 1M9BA 3CBUA 2MBTA 2N5BA 1FUPA 1FVKA 3A5IA 3NZNA 2P5RA 3PH9A 4FH8A 4F0CA 3IV4A 4MF6A 1ABAA 1K0DA 4Z2TA 4WEYA 4O5RA 4YIKA 1SL1B 2YJ7A 4OO5A 2O7KA 3OCFA 4LL1B 4P3YB 2JAOA 2ZUPA 2QSIA 4PUFC 5H5RA 2YWIA 3F4RA 3QFBC 3ERGA 4K8MA 2MZCA 2H1BA 3KH7A 2X49A 3GFKA 3Q18A 3EURA 4FYCA 1EGOA 4NPBA 2KP1A 2LTKA 3GL3A 5B7CA 3BWVA 1ML6A 1UVZA 2G0FA 3R6VA 1MEKA 3CTFA 4WR4A 4O92A 3EINA 2IMKA 4GTUA 3LXTA 3TCOA 3WD6A 1JZOA 4EDZA 2R4VA 1GSQA 3N9JA 4N10A 4NLEA 4IN0A 2HZEA 2O87A 3GX8A 1G7OA 4ZL7A 4ILFA 5CNWA 5EPFA 5AIXA 3Q19A 4XRDA 2X75A 3KZQA 4V1Ap 4BL7A 2JZSA 5HQPA 4X43A 4POLA 2A2SA 2H73A 3CQFA 4J56E 4EC0A 1U0LA 1A0RP 1TKDB 5ABRA 3IE3A 1GULA 5DCHA 4IBPA 1K0BA 2L57A 3QBPA 3DMLA 3UVHA 4K2DA 5IIZA 3EWLA 2K9FA 1WPIA 5A4VA 2C1YA 4E8EA 3RAZA 4NSLA 3LGCA 1BAYA 4JU5A 3APOA 3EU4A 1EP8A 1THXA 2H1DA 1U3IA 1TDIA 4NAXA 3L9UA 2VCQA 1B9XC 2VLUA 2HRKA 1HYUA 2CA8A 1BYEA 4MLYA 3WT2A 1PL1A 1A0FA 2OKAA 2OA7A 1OKDA 3JCML 4HUAA 4GLTA 1ST9A 4XS4A 1O6JA 4PQIA 3I9V2 3MNGA 2L4CA 3A2VA 3DWVA 1CQHA 1JFUA 4BL7B 2FD3A 1XWOA 5IOXA 1ZGNA 3C8TA 2DBCA 3MIXA 4ADMA 4KDXA 1IYIA 2GSSA 1S3DA 4KUNA 1TU8A 2B5EA 2YPMA 1AUCA 2X8CA 1LBKA 1GNWA 1AUWA 4IGJA 3GRXA 4OFMA 1GTIA 2HLSA 4MJEA 1FHEA 4FIWA 2E2GA 2KOKA 5AGYA 4V2MA 4EF0A 1TXXA 1J08A 4RI7A 2AV4A 5ECHB 3LYKA 2DJ2A 3W8JA 3CTGA 2R0CA 5B6MA 20GSA 2C0FA 3ZFLA 4MJCA 2AAWA 3DVWA 5IPHA 4WBRD 3GHAA 2B1LA 3G7IA 1TTZA 1EEJA 2MMZA 2JSZA 2M72A 3ISOA 5IPGA 1Z3EA 2NPBA 1U6TA 2FWEA 3TJBA 1GL8A 4LL4B 5EL8A 1K3OA 1OE7A 3UOMA 4BPYA 5J5NA 2YWNA 3LEFA 2L59A 2HSMA 3C1RA 4YKFA 1O8XA 3TRPA 1EWXA 4FYUA 3L78A 2FLSA 3LJRA 1RK4A 3BCKA 6GSSA 4MABA 3M0FA 2PTQA 1FW1A 1VF2A 2H8LA 2YCDA 3ZLPA 1GSSA 3GV1A 2CVKA 3UARA 3HJMA 2YNXA 5KOXA 5DAKB 4L6AA 2JU5A 3GH6A 5F0GA 3MSZA 1ERUA 3IAS2 5L71A 3O76A 4ZB9A 5JCGA 3FZAA 5A4UA 1MTCA 5ID2A 3ZFBA 4JR4A 3CMIA 3GIXA 5LCZA 5B8AA 1NHOA 2HFDA 2J9HA 2TRCP 3TKSC 1AQXA 1X5CA 5F07A 2UZ8A 1F9MA 3ED3A 3U13A 4V2NA 2JZRA 1T3BA 3GZHA 3MWHA 3UJ1A 3O3TA 4PUAA 4KCAA 5ECSA 1PL2A 1T1VA 1TK8B 1FO5A 1K0AA 3CXGA 5HFGA 1DCNA 3DYRA 4V1Ag 2VLTA 3P2AA 3GH9A 3KD0A 5H5SA 4CDOA 5BRTA 3ME7A 2R3XA 4K7NA 3CSHA 3AY8A 4HZ2A 5FT3A 4YKGA 2WDUA 2N5FA 1U88A 3GX0A 4JR6A 4EFCA 1J0FA 4YH2A 2WJUA 3CI0K 4TRXA 4HOJA 3FRCA 5IMAA 3ZTLA 2HRAA 2FA8A 4F2IA 3ZRDA 1AQVA 1AAZA 2K18A 4MJAA 2F51A 2N5AA 3VWXA 4GSTA 5J3RA 2B5XA 1XCCA 1X5EA 5D8IA 1YEXA 2VAFA 3PR8A 1XBSA 1YKCA 2IPAA 4PURA 1PX7A 4MCUA 3L9VA 5INYA 2HXKA 3EPTA 1K0CA 3IK9A 1NHYA 1GUMA 1S3AA 1GWCA 1OC8A 3CYNA 5KN2A 4XS1A 3GL5A 2HRFA 4I5QA 4TR4A 1ILOA 3BJ5A 5IO2A 2X8HA 3HZ4A 5AISA 4AJ6A 4I97A 5CYYA 2GLRA 5CRGA 3DXBA 2I81A 4ID0A 3TGZA 1B4QA 1XW6A 3R6QA 5J41A 4HEA2 1O85A 1ZCPA 3TKRA 4MUMA 3HCZA 5ECIB 4DSSA 1X9MB 3F4SA 3EMPA 2B5YA 2LKUA 5ECPB 2QC7A 2NTOA 1PKWA 3H4KA 2OE0A 1VF1A 2GGTA 2H72A 2VCWA 4QL9A 4IQ1A 2DKHA 1M2AA 3FYGA 1EOHA 1WJKA 1YDKA 3GMFA 1A8LA 3HDCA 4NHZA 2C3TA 4JE1A 1B4PA 4GQCA 3ZITA 4XCSA 4EIQA 3RPPA 3M9KA 4ZL8A 1GNEA 2P31A 2GT5A 2WCIA 3ZIJA 1NM3A 3ZVJA 2I3YA 1X0RA 4ZB6A 2H19A 2L6DA 5IM9A 2OADA 2H01A 1B8XA 2C8UA 3UEMA 3FEUA 1K0MA 1F6MC 4MA9A 3TJGA 1M0UA 2IJYA 2IMFA 3PPUA 5CP1A 3UAPA 5DALB 4ECBA 4A5PA 1XXUA 4KAEA 2BJXA 2OBKA 4EKZA 2H76A 5HR1A 2VCZA 3KGKA 3GSSA 4MH2A 3HJOA 2VO4A 4IJ3A 3RRPA 3C1SA 4OD7A 2AB6A 2KP2A 1U3AA 3KCMA 1XW5A 2RUFA 3GSTA 3M9JA 1JZRA 3HXSA 1FURA 2HT9A 1G7EA 4YQMA 2OBIA 1A2MA 1GSDA 1E2YA 2LQOA 2DJJA 1YFMA 2A4HA 4ZXGA 1PN0A 4G2EA 1G6WA 1UA5A 2VLVA 1DSBA 4HU9A 4YQVA 2H6ZA 2H0GA 4D73B 4TW5A 4G0LA 1AC1A 1TP9A 3K8NA 1GSUA 4ZILA 5CRWA 2HE3A 2YWMA 5IMVA 1M3IA 4IQJM 2PU9C 3IDVA 2PVOC 5F06A 4GF0A 4TR0A 1J9BA 5E4WA 4BVYB 2MMNA 2XPEA 3WGDA 2JACA 3LXZA 3RPNA 3A3TA 4N0VA 3TUEA 2E7PA 3DEXA 1GLPA 2L5LA 4NXIA 3EYTA 3KIJA 1XPVA 3GTUB 5HFKA 4KCEA 2YOIA 4X1UA 1TJUA 3QFAC 2IMDA 4BA7A 1PFOA 3D6IA 4L6CA 4HJ2A 3TJKA 2F9SA 3PINA 3ME8A 4EVMA 4ADLA 4ECJA 17GSA 3GTDA 4Q5FA 2NVLA 1X9SB 4BVXB 1C3UA 2PMTA 4KSMA 3VFIA 2DKIA 3BCIA 1OYJA 1XOAA 2XHFA 2VL9A 3VWWA 3VI7A 2LUSA 5KN1A 2FUSA 2EC4A 3U6VA 4MK3A 6GSVA 5DALA 3Q6OA 1RQMA 3SBCA 4EL1A 1XWAA 2IFQA 1KNGA 3F6FA 1SJZA 3KEBA 2H1AA 1JSWA 2V1MA 2O89A 3UVTA 1FUQA 4PNFA 1OC9B 13GSA 2V6OA 3H1NA 4TVEA 4Q5QA 2X8GA 3GKNA 1ZYEA 1G0TA 9GSSA 1Q4JA 3G7YA 4PNGA 3KH9A 4OO4A 4EE0A 3RBTA 2NDOA 4APBA 4F0BA 1OC9A 3QR6A 2DMMA 8GSSA 3HVSA 1QQ2A 2OJLA 2VD1A 7GSSA 1Q5NA 4MWOA 2FWGA 3VI5A 3U19A 5JWRB 4I6XA 3HA9A 1QXHA 1U15A 1FG4A 1AXDA 2H75A 2K6VA 1YFEA 1GSEA 5BMUA 2WZ9A 3IBHA 1SK2A 1TJWA 4JBBA 3P7XA 10GSA 5CAXA 2KUCA 4HI7A 4XS6A 4ISDA 2YJHA 3TKSA 1WE0A 1ERVA 3M1GA 1PN9A 1SD9A 4KW6A 2HI7A 4K7IA 2WGRA 5LNKe 2HZEB 3KJYA 2X99A 2B7JA 2DC5A 2QA2A 2O8VB 1E6BA 3GKKA 4CY6A 1U16A 3UL3A 2YV5A 4WF4A 4L5OA 6GSUA 1YY7A 2OE3A 3IPZA 4DVCA 2KLXA 4PGTA 5KN3A 3E3EA 3BHGA 2I4AA 3MAKA 3I69A 1DE1A 1SENA 3NO9A 3KP9A 1T00A 1XVWA 3N5OA 4AGSA 3KTBA 2YANA 2D27A 4Z7XA
chains in the Genus database with same CATH topology
3UMAA 2GT6A 2ON5A 2GQKA 1PRXA 4PX1A 1TOFA 1MD3A 4LLRA 2RLIA 4EUYA 4XTSA 2PERA 3W6GA 3A2WA 1V98A 1QGVA 3CRTA 2AJQB 5HR0A 3R2QA 4XS4B 3MYDA 4MZCA 3F3QA 4ZBAA 1XFLA 1EEMA 3IRAA 4KH7A 1TJDA 1GUHA 2IMEA 5GAPD 3BD2A 3EU3A 5AN1A 3DRNA 5DDLA 3LG6A 3VPQA 2M46A 1YF0A 3IXRA 1GP1A 5DAKA 2X64A 3ZIVA 2FY6A 4TXOB 3A2XA 4K1FA 2DJ0A 4OMVA 4J2FA 3G7JA 2ALBA 5DBQA 5G5FA 2V6KA 4K5SA 1PGTA 1GTUA 4MH3A 4N30A 2IMIA 2DIZA 2C3QA 4PTSA 1AW9A 2R0GA 1GSYA 5HR3A 2A2PA 2LJAA 1XWBA 1VGLA 2VCTA 3WT1A 5G1KA 2RM5A 2LRNA 4TKYA 3G9BA 1TRSA 2G2QA 4I2UA 2CZ2A 4ICYA 3D4TA 2L5OA 3FZ5A 5GSSA 2GQMA 5GSTA 4N11A 1BX9A 2VL2C 3VPTA 1ZYPA 4L5LA 2VM1A 3I6AA 5LD0A 5JCWA 2X4AA 4EIPA 4Z2RA 1FVJA 1OKTA 3FHKA 1WWJA 2CVBA 3QDNA 3QMXA 1A8YA 1K3YA 1YJ6A 1T8EB 1WRYA 1SKRB 4IW9A 2R37A 1TRVA 4QQ7A 1OC3A 4DSSB 5IMZA 2GVPA 1XZOA 1VF4A 1QFNA 4KF9A 3ERFA 1BQ7A 1F3BA 1FB0A 2DJ3A 4HS1A 2F3MA 1F37A 2V32A 4ZL9A 2VCXA 1W89A 1LJRA 4OWYA 3ZMLA 1I9DA 4GSNA 4O5UA 3TB2A 4GCIA 3EC3A 1MDKA 3EMXA 1JHBA 5J4UA 5E59A 3IK7A 3EVIA 4PQHA 5FWGA 1ERTA 2AUVA 4MZWA 4FQUA 5JWQB 5GAND 1SK0A 1A2LA 1M2BA 4USSA 3A5WA 5D9XA 5B8BA 1SL2B 3FR6A 3IOSA 3BBYA 3PGTA 4TXVA 4N0ZA 1SD8A 1GTBA 3CRUA 5CRDA 14GSA 1V40A 3LORA 4XHMA 3RHCA 4PXOA 2C80A 4KGIA 5ECOB 4AJ8A 1F2EA 4PQ1A 1DUGA 1TRUA 3DKSA 2H71A 3GA4A 2L4QA 3KP8A 3RHBA 2B6MA 1C72A 3NOFA 1Y6EA 2CV4A 3GYKA 2KHPA 3FR3A 1YKAA 2QA1A 4NHWA 1GTAA 2HYXA 4MP4A 3FR9A 5J9BA 2VCVA 3IC8A 1M7TA 3GNJA 3QAGA 2K8VA 4IJIA 4MMMA 3GTUA 4IELA 4RQRA 3H93A 5EY6A 3VK9A 2YV7A 3RDWA 2BTOT 3QPMA 2HNLA 1R5PA 1TK0B 3IC4A 1UC7A 5HR2A 2DJKA 4IP1A 1Y25A 2RIIA 1ZL9A 4I8BA 3F3RA 3HKRA 3J7Yb 1BJXA 1AQWA 1FOHA 3CSJA 1RW1A 4ULXA 5D93A 4F9ZA 2V41A 1W4VA 3V1WA 2RUEA 5ID2B 3VWUA 5ECRB 5IMCA 4MPGA 2VOCA 3IHGA 1JZDA 1M2DA 2H1GA 3P90A 4TN8A 2PVQA 4ML1A 2GDRA 2P5QA 3TKQA 1MD4A 3E9JB 4CHSA 1GSFA 2B7KA 4YAVA 3APQA 3EE2A 4HQZA 2P0GA 3C7MA 4WKWA 3DVXA 2FCHA 1XVQA 2A2RA 1X5DA 1GRXA 2PWJA 4K7OA 4EO3A 4IS0A 1SJ6A 4K0NA 1HNCA 3TJFA 4L0WA 5KEJA 1THOA 2DMLA 2FUG2 1XIYA 2IIYA 3D5JA 2VIMA 1IW7D 2VL3A 2NBSA 1PD21 4POMA 2YV9A 1A2JA 2EIOA 1O73A 3GKXA 5JWOB 4NV5A 5A4WA 1T7PB 2FA4A 4HQSA 4MDCA 5G2ZA 4NMUA 1H4OA 2LNTA 1DBYA 5IOWA 4NWYA 2AHEA 1PA3A 4NV2A 1SL0B 3FZ4A 3IA1A 1M99A 2H6XA 1SK1A 3FZ9A 1SYRA 2PUKC 3W8SA 1PMTA 3DGQA 3GN3A 4ZBDA 2C4JA 2CAQA 6GSXA 1IYHA 3GKMA 4OCEA 4LMVA 3TRXA 5D9WA 2ZNMA 4BWSA 3QAVA 3D22A 1S3CA 3ERWA 5DCGA 2LJRA 5GZZB 1G6YA 4HDEA 1Z7RA 2QGVA 5KN0A 3TRQA 4GWRA 3KTLA 4YQUA 1XWCA 4IVFA 1KTEA 1ERWA 3TOUA 4GQFA 2VUPA 4MJBA 2WB9A 4HZ4A 1Z5YE 1R26A 3QD9A 3O6TA 18GSA 4TR1A 5D96A 2IL3A 1VF3A 3MDKA 2K8SA 4KDUA 1KBNA 2LRTA 3ZYWA 4G0IA 5ECMB 1YF1A 4V2LA 5ECKB 2H6YA 3IAM2 3US3A 4CY8A 1CQGA 1TI3A 3C73A 2LJKA 2VD0A 2Z9SA 4DSRA 6GSTA 5KOWA 4BWQA 19GSA 1K3LA 2M80A 2DLXA 3L9SA 2YN1A 4G10A 4POKA 1F3AA 5JCUA 4G0KA 3TKSE 1JZWA 1XW9A 3DIEA 4OCFA 2EIQA 2C3NA 3FKFA 2YZUA 3L0HA 3C71A 2MMAA 4L8EA 3WYWA 2FWFA 2D2ZA 2WFCA 3UIWA 4RQXA 3TDGA 4D73A 3IHQA 3Q74A 5D9VA 2C0GA 3J7Yk 5C00A 5ELGA 2LS5A 1LU4A 5ENUA 4RUVA 3HVXA 2MBSA 1XWGA 3P8WA 3HHVA 1UN2A 4WR5A 4L0UA 1PX6A 1R7HA 2WRTA 2CZ3A 3LWAA 1TI1A 5CREA 4TR3A 3VWVA 2D28C 3UBLA 1EGRA 2HSHA 2VL2A 4AF2A 3FK8A 2PN8A 2IFQB 5DJLA 3NIVA 2I1UA 2A4VA 1R5AA 2GS3A 4POBA 4K9ZA 1EP7A 3F6DA 2OE1A 3BOAA 2TRXA 4IQAA 5F8BA 2H74A 2H0HA 3FMWA 1XOBA 1YEPA 4I2TA 3FW2A 4DSQA 1K0NA 1TK5B 4EXJA 5ECLB 1OE8A 1PQNA 1SJIA 4WXTA 1USBA 4KB3A 1A23A 1O7UA 1SYXA 4TR1B 2ON7A 4G9HA 3WGEA 2R5GA 3FY7A 3ZREA 2XBQA 3F63A 2GTUA 4G19A 2RM6A 1I5GA 2IN3A 3GURA 4XRAA 4YAPA 3TJJA 2ES7A 4Q5NA 1JLVA 1NW2A 1SKSB 2H0IA 2GQLA 4Z2UA 5C04A 2BMXA 2CQ9A 4AJ7A 4FO5A 11GSA 1VRSD 5ELAA 1FAAA 3VLNA 1A24A 2F8FA 4ZB8A 5IQYA 1T4ZA 1Z6NA 3E0UA 5DJMA 3VURA 3HD5A 2FGXA 3KM6A 2YP6A 2FNOA 2MMOA 3LW9A 2FHEA 1R4WA 4JEDA 1QUWA 1ZZYA 2GZYA 1DE2A 1BEDA 5G1LA 12GSA 1ACVA 2H66A 3ZZXA 1ON4A 3HJPA 4MPFA 4X4JA 3ZMKA 2C0DA 3D4MA 1V9WA 5F05A 2PBJA 1URMA 4H86A 2LQQA 2PGTA 5G30A 2R0PA 3H79A 2H70A 2HSYA 5B6NA 2LRCA 4EDYA 1WIKA 3M8NA 4ZIJA 2YWOA 3TKPA 2LNSA 1OVNA 4JRRA 3APSA 5IMFA 3HZ8A 5ECNB 3GUSA 4TXOA 5DQSA 1V2AA 4E8HA 4KX4A 2WULA 1PKZA 1GUKA 2LEGA 6GSYA 4KE3A 3KXOA 2YZHA 2XBIA 3HY2A 3C8EA 2L6CA 1XWKA 4WBJA 4ECIA 1HQOA 4K5RA 2PPTA 4ACSA 16GSA 5HFIA 4MF5A 2C0EA 2IWTA 4MNNA 1ZYNA 5ECQB 1TU7A 1QMVA 4JZQA 3QOUA 3I43A 5H5QA 2WS2A 3F0IA 1K0OA 2CAIA 3U5RE 1Z7PA 4GXZA 4HU7A 1WOUA 1YQ1A 1EV4A 3TOTA 22GSA 2R6KA 1N2AA 4Q5RA 2DIYA 2O85A 6GSWA 1GH2A 1EOGA 2B3SA 3F9UA 3M3MA 1BG5A 2F8AA 1Q98A 5FHIA 1TRWA 3D0ZA 1KEBA 2JADA 3S9FA 4BVYA 3ZL5A 5D73A 4OFTA 2TIRA 4XIHA 4O32A 3OR5A 1PSQA 2JZTA 2H30A 4LA1A 2XC2A 2CT6A 2R2JA 4GRFA 4CW9A 3LYPA 1HD2A 4FYBA 1V58A 4K0GA 4IP6A 2GSRA 2DSAA 1O81A 2J23A 3R3EA 2EIRA 5EVOA 4WETA 1X9WB 1WP0A 1V57A 2HRNA 4HJMA 1FOVA 4GSSA 1ZMAA 1AIUA 3H8QA 4IHUA 4RI6A 4KNDA 4OFNA 4KSOA 1O8WA 1SU9A 1YZXA 1T4YA 2CX3A 4LMWA 5CO3A 1HNBA 5AIVA 3QAWA 2JSYA 5J9CA 1FB6A 5COHA 4K2XA 1ZOFA 4F82A 4IKHA 4WF5A 4MZBA 3KMOA 1JLWA 2REMA 3UBKA 3HVVA 1TW9A 2E0QA 4KDYA 5A5KA 3QCPA 4TOPA 1ZYQB 2ZCTA 3F4TA 1B48A 2B1KA 2CX4A 1M9AA 3ZVJD 3LQ7A 3WGXA 2FWHA 1N8JA 2DJ1A 5D9TA 2CVDA 1QK8A 4J57E 2GSTA 2LSTA 4DEJA 3LFLA 1NSWA 2GZPA 2GZZA 2LV3A 4ML6A 4X0XA 1Z9HA 1B9YC 3DD3A 3IR4A 2XPDA 1SKWB 1OAZA 4ECCA 5DQYA 5DVBA 1GLQA 4MF7A 4F03A 3HYPA 3D21A 2AYTA 1U87A 2OACA 1MDIA 2VM2A 2MYGA 5IMDA 3SWLA 4ZBBA 1WMJA 3LSZA 1MDJA 5G5EA 5IO0A 2GSQA 2JL4A 3KMNA 2I9HA 2E2MA 2QKEA 2V2GA 4BVXA 3CSIA 3L4NA 4QL7A 4O5QA 4K6XA 1HNAA 1EV9A 5CRHA 1EZKA 4O7HA 3F8UA 1H75A 1Z6MA 5G31A 2HZFA 4KA0A 1M9BA 3CBUA 2MBTA 2N5BA 1FVKA 3A5IA 3NZNA 2P5RA 3PH9A 4FH8A 4F0CA 3IV4A 4MF6A 1ABAA 1K0DA 4Z2TA 4WEYA 4O5RA 1SL1B 2YJ7A 4OO5A 2O7KA 4LL1B 4P3YB 2ZUPA 2QSIA 4PUFC 5H5RA 2YWIA 3F4RA 3QFBC 3ERGA 4K8MA 2MZCA 2H1BA 3KH7A 2X49A 3GFKA 3Q18A 3EURA 4FYCA 1EGOA 4NPBA 2KP1A 2LTKA 3GL3A 5B7CA 1ML6A 1UVZA 2G0FA 1MEKA 3CTFA 4WR4A 4O92A 3EINA 2IMKA 4GTUA 3LXTA 3TCOA 3WD6A 1JZOA 4EDZA 2R4VA 1GSQA 3N9JA 4N10A 4IN0A 2HZEA 2O87A 3GX8A 1G7OA 4ZL7A 4ILFA 5CNWA 5EPFA 5AIXA 3Q19A 4XRDA 3KZQA 4V1Ap 4BL7A 2JZSA 5HQPA 4X43A 4POLA 2A2SA 2H73A 4J56E 4EC0A 1A0RP 1TKDB 5ABRA 3IE3A 1GULA 5DCHA 4IBPA 1K0BA 2L57A 3DMLA 3UVHA 4K2DA 5IIZA 3EWLA 2K9FA 1WPIA 5A4VA 2C1YA 4E8EA 3RAZA 3LGCA 1BAYA 4JU5A 3APOA 3EU4A 1EP8A 1THXA 2H1DA 1U3IA 1TDIA 4NAXA 3L9UA 2VCQA 1B9XC 2VLUA 2HRKA 1HYUA 2CA8A 1BYEA 4MLYA 3WT2A 1PL1A 1A0FA 2OKAA 2OA7A 1OKDA 3JCML 4HUAA 4GLTA 1ST9A 4XS4A 1O6JA 4PQIA 3I9V2 3MNGA 2L4CA 3A2VA 3DWVA 1CQHA 1JFUA 4BL7B 2FD3A 5IOXA 1ZGNA 2DBCA 3MIXA 4KDXA 1IYIA 2GSSA 1S3DA 4KUNA 1TU8A 2B5EA 2YPMA 1AUCA 2X8CA 1LBKA 1GNWA 4IGJA 3GRXA 4OFMA 1GTIA 2HLSA 4MJEA 1FHEA 4FIWA 2E2GA 2KOKA 5AGYA 4V2MA 4EF0A 1TXXA 1J08A 4RI7A 2AV4A 5ECHB 3LYKA 2DJ2A 3W8JA 3CTGA 2R0CA 5B6MA 20GSA 2C0FA 3ZFLA 4MJCA 2AAWA 3DVWA 5IPHA 4WBRD 3GHAA 2B1LA 3G7IA 1TTZA 1EEJA 2MMZA 2JSZA 2M72A 3ISOA 5IPGA 1Z3EA 2NPBA 1U6TA 2FWEA 3TJBA 1GL8A 4LL4B 5EL8A 1K3OA 1OE7A 3UOMA 4BPYA 5J5NA 2YWNA 3LEFA 2L59A 2HSMA 3C1RA 4YKFA 1O8XA 3TRPA 1EWXA 4FYUA 3L78A 2FLSA 3LJRA 1RK4A 3BCKA 6GSSA 4MABA 3M0FA 1FW1A 1VF2A 2H8LA 2YCDA 3ZLPA 1GSSA 3GV1A 2CVKA 3UARA 3HJMA 2YNXA 5KOXA 5DAKB 2JU5A 3GH6A 5F0GA 3MSZA 1ERUA 3IAS2 5L71A 3O76A 4ZB9A 5JCGA 3FZAA 5A4UA 1MTCA 5ID2A 3ZFBA 4JR4A 3CMIA 3GIXA 5LCZA 5B8AA 1NHOA 2HFDA 2J9HA 2TRCP 3TKSC 1AQXA 1X5CA 5F07A 2UZ8A 1F9MA 3ED3A 4V2NA 2JZRA 1T3BA 3MWHA 3UJ1A 3O3TA 4PUAA 4KCAA 5ECSA 1PL2A 1T1VA 1TK8B 1FO5A 1K0AA 3CXGA 5HFGA 3DYRA 4V1Ag 2VLTA 3P2AA 3GH9A 3KD0A 5H5SA 4CDOA 5BRTA 3ME7A 2R3XA 4K7NA 3CSHA 3AY8A 4HZ2A 5FT3A 4YKGA 2WDUA 2N5FA 1U88A 3GX0A 4JR6A 1J0FA 4YH2A 2WJUA 4TRXA 4HOJA 3FRCA 5IMAA 3ZTLA 2HRAA 2FA8A 4F2IA 3ZRDA 1AQVA 1AAZA 2K18A 4MJAA 2F51A 2N5AA 3VWXA 4GSTA 5J3RA 2B5XA 1XCCA 1X5EA 5D8IA 1YEXA 2VAFA 3PR8A 1XBSA 1YKCA 2IPAA 4PURA 1PX7A 4MCUA 3L9VA 5INYA 2HXKA 3EPTA 1K0CA 3IK9A 1NHYA 1GUMA 1GWCA 1OC8A 1S3AA 3CYNA 5KN2A 4XS1A 3GL5A 2HRFA 4I5QA 4TR4A 1ILOA 3BJ5A 5IO2A 2X8HA 3HZ4A 5AISA 4AJ6A 4I97A 5CYYA 2GLRA 5CRGA 3DXBA 2I81A 4ID0A 3TGZA 1B4QA 1XW6A 5J41A 4HEA2 1O85A 1ZCPA 3TKRA 3HCZA 5ECIB 4DSSA 1X9MB 3F4SA 3EMPA 2B5YA 2LKUA 5ECPB 2QC7A 2NTOA 1PKWA 3H4KA 2OE0A 1VF1A 2GGTA 2H72A 2VCWA 4QL9A 4IQ1A 2DKHA 1M2AA 3FYGA 1EOHA 1WJKA 1YDKA 3GMFA 1A8LA 3HDCA 4NHZA 2C3TA 4JE1A 1B4PA 4GQCA 3ZITA 4XCSA 4EIQA 3RPPA 3M9KA 4ZL8A 1GNEA 2P31A 2GT5A 2WCIA 3ZIJA 1NM3A 3ZVJA 2I3YA 1X0RA 4ZB6A 2H19A 2L6DA 5IM9A 2OADA 2H01A 1B8XA 2C8UA 3UEMA 3FEUA 1K0MA 1F6MC 4MA9A 3TJGA 1M0UA 2IJYA 2IMFA 3PPUA 5CP1A 3UAPA 5DALB 4ECBA 4A5PA 1XXUA 4KAEA 2BJXA 2OBKA 4EKZA 2H76A 5HR1A 2VCZA 3KGKA 3GSSA 4MH2A 3HJOA 2VO4A 4IJ3A 3C1SA 4OD7A 2AB6A 2KP2A 1U3AA 3KCMA 1XW5A 2RUFA 3GSTA 3M9JA 1JZRA 3HXSA 2HT9A 1G7EA 4YQMA 2OBIA 1A2MA 1GSDA 1E2YA 2LQOA 2DJJA 2A4HA 4ZXGA 1PN0A 4G2EA 1G6WA 1UA5A 2VLVA 1DSBA 4HU9A 4YQVA 2H6ZA 2H0GA 4D73B 4TW5A 4G0LA 1AC1A 1TP9A 3K8NA 1GSUA 4ZILA 5CRWA 2HE3A 2YWMA 5IMVA 4IQJM 2PU9C 3IDVA 2PVOC 5F06A 4GF0A 4TR0A 1J9BA 5E4WA 4BVYB 2MMNA 2XPEA 3WGDA 2JACA 3LXZA 3RPNA 3A3TA 4N0VA 3TUEA 2E7PA 3DEXA 1GLPA 2L5LA 4NXIA 3EYTA 3KIJA 1XPVA 3GTUB 5HFKA 4KCEA 2YOIA 4X1UA 4BA7A 3QFAC 2IMDA 3D6IA 4HJ2A 3TJKA 2F9SA 3PINA 3ME8A 4EVMA 4ECJA 17GSA 4Q5FA 2NVLA 1X9SB 4BVXB 2PMTA 4KSMA 3VFIA 2DKIA 3BCIA 1OYJA 1XOAA 2XHFA 2VL9A 3VWWA 3VI7A 2LUSA 5KN1A 2EC4A 3U6VA 4MK3A 6GSVA 5DALA 3Q6OA 1RQMA 3SBCA 4EL1A 1XWAA 2IFQA 1KNGA 3F6FA 1SJZA 3KEBA 2H1AA 2V1MA 2O89A 3UVTA 4PNFA 1OC9B 13GSA 2V6OA 3H1NA 4TVEA 4Q5QA 2X8GA 3GKNA 1ZYEA 1G0TA 9GSSA 1Q4JA 3G7YA 4PNGA 3KH9A 4OO4A 4EE0A 3RBTA 2NDOA 4F0BA 1OC9A 3QR6A 2DMMA 8GSSA 3HVSA 1QQ2A 2OJLA 2VD1A 7GSSA 2FWGA 3VI5A 5JWRB 4I6XA 3HA9A 1QXHA 1FG4A 1AXDA 2H75A 2K6VA 1GSEA 5BMUA 2WZ9A 3IBHA 1SK2A 4JBBA 3P7XA 10GSA 5CAXA 2KUCA 4HI7A 4XS6A 4ISDA 2YJHA 3TKSA 1WE0A 1ERVA 3M1GA 1PN9A 1SD9A 4KW6A 2HI7A 4K7IA 2WGRA 5LNKe 2HZEB 3KJYA 2X99A 2B7JA 2DC5A 2QA2A 2O8VB 1E6BA 3GKKA 4CY6A 3UL3A 4WF4A 4L5OA 6GSUA 1YY7A 2OE3A 3IPZA 4DVCA 2KLXA 4PGTA 5KN3A 3E3EA 2I4AA 3MAKA 3I69A 1DE1A 1SENA 3KP9A 4AGSA 1T00A 1XVWA 3N5OA 3KTBA 2YANA 2D27A 4Z7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UMA A;  2GT6 A;  2ON5 A;  2GQK A;  1PRX A;  4PX1 A;  1TOF A;  1MD3 A;  4LLR A;  2RLI A;  4EUY A;  4XTS A;  2PER A;  3W6G A;  3A2W A;  1V98 A;  1QGV A;  3CRT A;  2AJQ B;  5HR0 A;  3R2Q A;  4XS4 B;  4MZC A;  3F3Q A;  4ZBA A;  1XFL A;  1EEM A;  3IRA A;  4KH7 A;  1TJD A;  1GUH A;  2IME A;  5GAP D;  3BD2 A;  3EU3 A;  5AN1 A;  3DRN A;  5DDL A;  3LG6 A;  3VPQ A;  2M46 A;  1YF0 A;  3IXR A;  1GP1 A;  5DAK A;  2X64 A;  3ZIV A;  2FY6 A;  4TXO B;  3A2X A;  4K1F A;  2DJ0 A;  4OMV A;  4J2F A;  3G7J A;  2ALB A;  5DBQ A;  5G5F A;  2V6K A;  1PGT A;  1GTU A;  4MH3 A;  4N30 A;  2IMI A;  2DIZ A;  2C3Q A;  1AW9 A;  1GSY A;  5HR3 A;  2LJA A;  1XWB A;  1VGL A;  2VCT A;  3WT1 A;  5G1K A;  2RM5 A;  2LRN A;  4TKY A;  3G9B A;  1TRS A;  2G2Q A;  4I2U A;  2CZ2 A;  3D4T A;  2L5O A;  3FZ5 A;  5GSS A;  2GQM A;  5GST A;  4N11 A;  1BX9 A;  2VL2 C;  3VPT A;  4L5L A;  2VM1 A;  3I6A A;  5LD0 A;  5JCW A;  1FVJ A;  1OKT A;  3FHK A;  1WWJ A;  2CVB A;  3QDN A;  3QMX A;  1A8Y A;  1K3Y A;  1YJ6 A;  1T8E B;  1WRY A;  1SKR B;  4IW9 A;  2R37 A;  1TRV A;  4QQ7 A;  1OC3 A;  4DSS B;  5IMZ A;  2GVP A;  1XZO A;  1VF4 A;  1QFN A;  3ERF A;  1BQ7 A;  1F3B A;  1FB0 A;  2DJ3 A;  4HS1 A;  2F3M A;  1F37 A;  2V32 A;  4ZL9 A;  2VCX A;  1W89 A;  1LJR A;  4OWY A;  3ZML A;  1I9D A;  4GSN A;  4GCI A;  3EC3 A;  3TB2 A;  1MDK A;  3EMX A;  1JHB A;  5J4U A;  5E59 A;  3IK7 A;  3EVI A;  4PQH A;  5FWG A;  1ERT A;  2AUV A;  4MZW A;  5JWQ B;  5GAN D;  1SK0 A;  1A2L A;  1M2B A;  3A5W A;  5D9X A;  5B8B A;  1SL2 B;  3FR6 A;  3IOS A;  3BBY A;  3PGT A;  4TXV A;  4N0Z A;  1SD8 A;  1GTB A;  3CRU A;  5CRD A;  14GS A;  1V40 A;  3LOR A;  4XHM A;  3RHC A;  4PXO A;  2C80 A;  4KGI A;  5ECO B;  4AJ8 A;  1F2E A;  4PQ1 A;  1DUG A;  1TRU A;  3DKS A;  2H71 A;  3GA4 A;  2L4Q A;  3KP8 A;  3RHB A;  2B6M A;  1C72 A;  3NOF A;  1Y6E A;  2CV4 A;  3GYK A;  2KHP A;  3FR3 A;  1YKA A;  4NHW A;  1GTA A;  2HYX A;  4MP4 A;  3FR9 A;  5J9B A;  2VCV A;  1M7T A;  3GNJ A;  3QAG A;  2K8V A;  4IJI A;  4MMM A;  3GTU A;  4IEL A;  4RQR A;  3H93 A;  5EY6 A;  3VK9 A;  2YV7 A;  3RDW A;  2BTO T;  3QPM A;  2HNL A;  1R5P A;  1TK0 B;  3IC4 A;  1UC7 A;  5HR2 A;  2DJK A;  4IP1 A;  1Y25 A;  2RII A;  1ZL9 A;  4I8B A;  3F3R A;  3HKR A;  3J7Y b;  1BJX A;  1AQW A;  3CSJ A;  1RW1 A;  4ULX A;  5D93 A;  4F9Z A;  2V41 A;  1W4V A;  3V1W A;  2RUE A;  5ID2 B;  3VWU A;  5ECR B;  5IMC A;  4MPG A;  2VOC A;  1JZD A;  1M2D A;  2H1G A;  3P90 A;  4TN8 A;  2PVQ A;  4ML1 A;  2GDR A;  2P5Q A;  3TKQ A;  1MD4 A;  3E9J B;  4CHS A;  1GSF A;  2B7K A;  4YAV A;  3APQ A;  3EE2 A;  4HQZ A;  2P0G A;  3C7M A;  4WKW A;  3DVX A;  2FCH A;  1XVQ A;  2A2R A;  1X5D A;  1GRX A;  2PWJ A;  4K7O A;  4EO3 A;  4IS0 A;  1SJ6 A;  4K0N A;  1HNC A;  3TJF A;  4L0W A;  5KEJ A;  1THO A;  2DML A;  2FUG 2;  1XIY A;  2IIY A;  3D5J A;  2VIM A;  2VL3 A;  2NBS A;  1PD2 1;  4POM A;  2YV9 A;  1A2J A;  2EIO A;  1O73 A;  3GKX A;  5JWO B;  4NV5 A;  5A4W A;  1T7P B;  2FA4 A;  4HQS A;  4MDC A;  5G2Z A;  4NMU A;  1H4O A;  2LNT A;  1DBY A;  5IOW A;  4NWY A;  2AHE A;  1PA3 A;  4NV2 A;  1SL0 B;  3FZ4 A;  3IA1 A;  1M99 A;  2H6X A;  1SK1 A;  3FZ9 A;  1SYR A;  2PUK C;  3W8S A;  1PMT A;  3DGQ A;  3GN3 A;  4ZBD A;  2C4J A;  2CAQ A;  6GSX A;  1IYH A;  3GKM A;  4OCE A;  4LMV A;  3TRX A;  5D9W A;  2ZNM A;  4BWS A;  3QAV A;  3D22 A;  1S3C A;  3ERW A;  5DCG A;  2LJR A;  5GZZ B;  1G6Y A;  4HDE A;  1Z7R A;  2QGV A;  5KN0 A;  3TRQ A;  4GWR A;  3KTL A;  4YQU A;  1XWC A;  4IVF A;  1KTE A;  1ERW A;  3TOU A;  4GQF A;  2VUP A;  4MJB A;  2WB9 A;  4HZ4 A;  1Z5Y E;  1R26 A;  3QD9 A;  3O6T A;  18GS A;  4TR1 A;  5D96 A;  2IL3 A;  1VF3 A;  3MDK A;  2K8S A;  4KDU A;  1KBN A;  2LRT A;  3ZYW A;  5ECM B;  1YF1 A;  4V2L A;  5ECK B;  2H6Y A;  3IAM 2;  3US3 A;  1CQG A;  1TI3 A;  3C73 A;  2LJK A;  2VD0 A;  2Z9S A;  4DSR A;  6GST A;  4BWQ A;  19GS A;  1K3L A;  2M80 A;  2DLX A;  3L9S A;  2YN1 A;  4G10 A;  4POK A;  1F3A A;  5JCU A;  3TKS E;  1JZW A;  1XW9 A;  3DIE A;  4OCF A;  2EIQ A;  2C3N A;  3FKF A;  2YZU A;  3L0H A;  3C71 A;  2MMA A;  4L8E A;  3WYW A;  2FWF A;  2D2Z A;  2WFC A;  3UIW A;  4RQX A;  3TDG A;  4D73 A;  3IHQ A;  3Q74 A;  5D9V A;  2C0G A;  3J7Y k;  5C00 A;  5ELG A;  2LS5 A;  1LU4 A;  5ENU A;  4RUV A;  3HVX A;  2MBS A;  1XWG A;  3P8W A;  3HHV A;  1UN2 A;  4WR5 A;  4L0U A;  1PX6 A;  1R7H A;  2WRT A;  2CZ3 A;  3LWA A;  1TI1 A;  5CRE A;  4TR3 A;  3VWV A;  3UBL A;  1EGR A;  2HSH A;  2VL2 A;  4AF2 A;  3FK8 A;  2PN8 A;  2IFQ B;  5DJL A;  3NIV A;  2I1U A;  2A4V A;  1R5A A;  2GS3 A;  4POB A;  4K9Z A;  1EP7 A;  3F6D A;  2OE1 A;  3BOA A;  2TRX A;  4IQA A;  5F8B A;  2H74 A;  2H0H A;  1XOB A;  1YEP A;  4I2T A;  3FW2 A;  4DSQ A;  1K0N A;  1TK5 B;  4EXJ A;  5ECL B;  1OE8 A;  1PQN A;  1SJI A;  4WXT A;  1USB A;  4KB3 A;  1A23 A;  1O7U A;  1SYX A;  4TR1 B;  2ON7 A;  4G9H A;  3WGE A;  2R5G A;  3FY7 A;  3ZRE A;  2XBQ A;  3F63 A;  2GTU A;  4G19 A;  2RM6 A;  1I5G A;  2IN3 A;  3GUR A;  4XRA A;  4YAP A;  3TJJ A;  2ES7 A;  4Q5N A;  1JLV A;  1NW2 A;  1SKS B;  2H0I A;  2GQL A;  5C04 A;  2BMX A;  2CQ9 A;  4AJ7 A;  4FO5 A;  11GS A;  1VRS D;  5ELA A;  1FAA A;  3VLN A;  1A24 A;  2F8F A;  4ZB8 A;  5IQY A;  1T4Z A;  1Z6N A;  3E0U A;  5DJM A;  3VUR A;  3HD5 A;  2FGX A;  3KM6 A;  2YP6 A;  2FNO A;  2MMO A;  2FHE A;  1R4W A;  4JED A;  1QUW A;  1ZZY A;  2GZY A;  1DE2 A;  1BED A;  5G1L A;  12GS A;  1ACV A;  2H66 A;  3ZZX A;  1ON4 A;  3HJP A;  4MPF A;  3ZMK A;  2C0D A;  3D4M A;  1V9W A;  5F05 A;  2PBJ A;  1URM A;  4H86 A;  2LQQ A;  2PGT A;  5G30 A;  3H79 A;  2H70 A;  2HSY A;  5B6N A;  2LRC A;  4EDY A;  1WIK A;  3M8N A;  4ZIJ A;  2YWO A;  3TKP A;  2LNS A;  1OVN A;  4JRR A;  3APS A;  5IMF A;  3HZ8 A;  5ECN B;  3GUS A;  4TXO A;  5DQS A;  1V2A A;  4E8H A;  4KX4 A;  2WUL A;  1PKZ A;  1GUK A;  2LEG A;  6GSY A;  4KE3 A;  3KXO A;  2YZH A;  2XBI A;  3HY2 A;  3C8E A;  2L6C A;  1XWK A;  4WBJ A;  4ECI A;  1HQO A;  2PPT A;  4ACS A;  16GS A;  5HFI A;  4MF5 A;  2C0E A;  2IWT A;  5ECQ B;  1TU7 A;  1QMV A;  4JZQ A;  3QOU A;  3I43 A;  5H5Q A;  2WS2 A;  3F0I A;  1K0O A;  2CAI A;  3U5R E;  1Z7P A;  4GXZ A;  4HU7 A;  1WOU A;  1YQ1 A;  1EV4 A;  3TOT A;  22GS A;  2R6K A;  1N2A A;  4Q5R A;  2DIY A;  2O85 A;  6GSW A;  1GH2 A;  1EOG A;  2B3S A;  3F9U A;  3M3M A;  1BG5 A;  2F8A A;  1Q98 A;  5FHI A;  1TRW A;  3D0Z A;  1KEB A;  2JAD A;  3S9F A;  4BVY A;  3ZL5 A;  5D73 A;  4OFT A;  2TIR A;  4XIH A;  4O32 A;  3OR5 A;  1PSQ A;  2JZT A;  2H30 A;  4LA1 A;  2XC2 A;  2CT6 A;  2R2J A;  4GRF A;  4CW9 A;  3LYP A;  1HD2 A;  4FYB A;  1V58 A;  4K0G A;  4IP6 A;  2GSR A;  2DSA A;  1O81 A;  2J23 A;  2EIR A;  5EVO A;  4WET A;  1X9W B;  1WP0 A;  1V57 A;  2HRN A;  4HJM A;  1FOV A;  4GSS A;  1ZMA A;  1AIU A;  3H8Q A;  4IHU A;  4RI6 A;  4KND A;  4OFN A;  4KSO A;  1O8W A;  1SU9 A;  1YZX A;  1T4Y A;  2CX3 A;  4LMW A;  5CO3 A;  1HNB A;  5AIV A;  3QAW A;  2JSY A;  5J9C A;  1FB6 A;  5COH A;  1ZOF A;  4F82 A;  4IKH A;  4WF5 A;  4MZB A;  3KMO A;  1JLW A;  2REM A;  3UBK A;  3HVV A;  1TW9 A;  2E0Q A;  4KDY A;  5A5K A;  3QCP A;  4TOP A;  1ZYQ B;  2ZCT A;  3F4T A;  1B48 A;  2B1K A;  2CX4 A;  1M9A A;  3ZVJ D;  3LQ7 A;  3WGX A;  2FWH A;  1N8J A;  2DJ1 A;  5D9T A;  2CVD A;  1QK8 A;  4J57 E;  2GST A;  2LST A;  4DEJ A;  3LFL A;  1NSW A;  2GZP A;  2GZZ A;  2LV3 A;  4ML6 A;  4X0X A;  1Z9H A;  1B9Y C;  3DD3 A;  3IR4 A;  2XPD A;  1SKW B;  1OAZ A;  4ECC A;  5DQY A;  5DVB A;  1GLQ A;  4MF7 A;  4F03 A;  3HYP A;  3D21 A;  2AYT A;  1U87 A;  2OAC A;  1MDI A;  2VM2 A;  2MYG A;  5IMD A;  3SWL A;  4ZBB A;  1WMJ A;  3LSZ A;  1MDJ A;  5G5E A;  5IO0 A;  2GSQ A;  2JL4 A;  3KMN A;  2I9H A;  2E2M A;  2QKE A;  2V2G A;  4BVX A;  3CSI A;  3L4N A;  4QL7 A;  4K6X A;  1HNA A;  1EV9 A;  5CRH A;  1EZK A;  4O7H A;  3F8U A;  1H75 A;  1Z6M A;  5G31 A;  2HZF A;  4KA0 A;  1M9B A;  3CBU A;  2MBT A;  2N5B A;  1FVK A;  3NZN A;  2P5R A;  3PH9 A;  4FH8 A;  4F0C A;  3IV4 A;  4MF6 A;  1ABA A;  1K0D A;  4WEY A;  4O5R A;  1SL1 B;  2YJ7 A;  4OO5 A;  2O7K A;  4LL1 B;  4P3Y B;  2ZUP A;  2QSI A;  4PUF C;  5H5R A;  2YWI A;  3F4R A;  3QFB C;  3ERG A;  4K8M A;  2MZC A;  2H1B A;  3KH7 A;  3GFK A;  3Q18 A;  3EUR A;  4FYC A;  1EGO A;  4NPB A;  2KP1 A;  2LTK A;  3GL3 A;  5B7C A;  1ML6 A;  1UVZ A;  2G0F A;  1MEK A;  3CTF A;  4WR4 A;  4O92 A;  3EIN A;  2IMK A;  4GTU A;  3LXT A;  3TCO A;  3WD6 A;  1JZO A;  4EDZ A;  2R4V A;  1GSQ A;  3N9J A;  4N10 A;  4IN0 A;  2HZE A;  2O87 A;  3GX8 A;  1G7O A;  4ZL7 A;  4ILF A;  5CNW A;  5EPF A;  5AIX A;  3Q19 A;  4XRD A;  3KZQ A;  4V1A p;  4BL7 A;  2JZS A;  5HQP A;  4X43 A;  4POL A;  2A2S A;  2H73 A;  4J56 E;  4EC0 A;  1A0R P;  1TKD B;  5ABR A;  3IE3 A;  1GUL A;  5DCH A;  4IBP A;  1K0B A;  2L57 A;  3DML A;  3UVH A;  4K2D A;  5IIZ A;  3EWL A;  2K9F A;  1WPI A;  5A4V A;  2C1Y A;  4E8E A;  3RAZ A;  3LGC A;  1BAY A;  4JU5 A;  3APO A;  3EU4 A;  1EP8 A;  1THX A;  2H1D A;  1U3I A;  1TDI A;  4NAX A;  3L9U A;  2VCQ A;  1B9X C;  2VLU A;  1HYU A;  2CA8 A;  1BYE A;  4MLY A;  3WT2 A;  1PL1 A;  1A0F A;  2OKA A;  2OA7 A;  1OKD A;  3JCM L;  4HUA A;  4GLT A;  1ST9 A;  4XS4 A;  1O6J A;  4PQI A;  3I9V 2;  3MNG A;  2L4C A;  3A2V A;  3DWV A;  1CQH A;  1JFU A;  2FD3 A;  5IOX A;  1ZGN A;  2DBC A;  4KDX A;  1IYI A;  2GSS A;  1S3D A;  4KUN A;  1TU8 A;  2B5E A;  2YPM A;  1AUC A;  2X8C A;  1LBK A;  1GNW A;  4IGJ A;  3GRX A;  4OFM A;  1GTI A;  2HLS A;  4MJE A;  1FHE A;  4FIW A;  2E2G A;  2KOK A;  5AGY A;  4V2M A;  4EF0 A;  1TXX A;  1J08 A;  4RI7 A;  2AV4 A;  5ECH B;  3LYK A;  2DJ2 A;  3W8J A;  3CTG A;  5B6M A;  20GS A;  2C0F A;  3ZFL A;  4MJC A;  2AAW A;  3DVW A;  5IPH A;  4WBR D;  3GHA A;  2B1L A;  3G7I A;  1TTZ A;  1EEJ A;  2MMZ A;  2JSZ A;  2M72 A;  3ISO A;  5IPG A;  1Z3E A;  2NPB A;  1U6T A;  2FWE A;  3TJB A;  1GL8 A;  4LL4 B;  5EL8 A;  1K3O A;  1OE7 A;  3UOM A;  4BPY A;  5J5N A;  2YWN A;  3LEF A;  2L59 A;  3C1R A;  3TRP A;  1O8X A;  1EWX A;  4FYU A;  3L78 A;  2FLS A;  3LJR A;  1RK4 A;  3BCK A;  6GSS A;  4MAB A;  3M0F A;  1FW1 A;  1VF2 A;  2H8L A;  2YCD A;  3ZLP A;  1GSS A;  3GV1 A;  2CVK A;  3UAR A;  3HJM A;  2YNX A;  5DAK B;  2JU5 A;  3GH6 A;  5F0G A;  3MSZ A;  1ERU A;  3IAS 2;  5L71 A;  3O76 A;  4ZB9 A;  5JCG A;  3FZA A;  5A4U A;  1MTC A;  5ID2 A;  3ZFB A;  4JR4 A;  3CMI A;  3GIX A;  5LCZ A;  5B8A A;  1NHO A;  2HFD A;  2J9H A;  2TRC P;  3TKS C;  1AQX A;  1X5C A;  5F07 A;  1F9M A;  3ED3 A;  4V2N A;  2JZR A;  1T3B A;  3MWH A;  3UJ1 A;  3O3T A;  4PUA A;  4KCA A;  5ECS A;  1PL2 A;  1T1V A;  1TK8 B;  1FO5 A;  1K0A A;  3CXG A;  5HFG A;  3DYR A;  4V1A g;  2VLT A;  3P2A A;  3GH9 A;  3KD0 A;  5H5S A;  4CDO A;  3ME7 A;  2R3X A;  4K7N A;  3CSH A;  3AY8 A;  4HZ2 A;  5FT3 A;  2WDU A;  2N5F A;  1U88 A;  3GX0 A;  4JR6 A;  1J0F A;  4YH2 A;  2WJU A;  4TRX A;  4HOJ A;  3FRC A;  5IMA A;  3ZTL A;  2FA8 A;  4F2I A;  3ZRD A;  1AQV A;  1AAZ A;  2K18 A;  4MJA A;  2F51 A;  2N5A A;  3VWX A;  4GST A;  5J3R A;  2B5X A;  1XCC A;  1X5E A;  5D8I A;  1YEX A;  2VAF A;  3PR8 A;  1XBS A;  1YKC A;  2IPA A;  4PUR A;  1PX7 A;  4MCU A;  3L9V A;  5INY A;  2HXK A;  1K0C A;  3IK9 A;  1NHY A;  1GUM A;  1GWC A;  1OC8 A;  1S3A A;  3CYN A;  5KN2 A;  4XS1 A;  3GL5 A;  2HRF A;  4I5Q A;  4TR4 A;  1ILO A;  3BJ5 A;  5IO2 A;  2X8H A;  3HZ4 A;  5AIS A;  4AJ6 A;  4I97 A;  5CYY A;  2GLR A;  5CRG A;  3DXB A;  2I81 A;  4ID0 A;  3TGZ A;  1B4Q A;  1XW6 A;  5J41 A;  4HEA 2;  1O85 A;  1ZCP A;  3TKR A;  3HCZ A;  5ECI B;  4DSS A;  1X9M B;  3F4S A;  3EMP A;  2B5Y A;  2LKU A;  5ECP B;  2QC7 A;  2NTO A;  1PKW A;  3H4K A;  2OE0 A;  1VF1 A;  2GGT A;  2H72 A;  2VCW A;  4QL9 A;  4IQ1 A;  1M2A A;  3FYG A;  1EOH A;  1WJK A;  1YDK A;  3GMF A;  1A8L A;  3HDC A;  4NHZ A;  2C3T A;  4JE1 A;  1B4P A;  4GQC A;  3ZIT A;  4XCS A;  3RPP A;  3M9K A;  4ZL8 A;  1GNE A;  2P31 A;  2GT5 A;  2WCI A;  3ZIJ A;  1NM3 A;  3ZVJ A;  2I3Y A;  1X0R A;  4ZB6 A;  2H19 A;  2L6D A;  5IM9 A;  2OAD A;  2H01 A;  1B8X A;  2C8U A;  3UEM A;  3FEU A;  1K0M A;  1F6M C;  4MA9 A;  3TJG A;  1M0U A;  2IJY A;  2IMF A;  5CP1 A;  3UAP A;  5DAL B;  4ECB A;  1XXU A;  4KAE A;  2BJX A;  2OBK A;  4EKZ A;  2H76 A;  5HR1 A;  2VCZ A;  3KGK A;  3GSS A;  4MH2 A;  3HJO A;  2VO4 A;  4IJ3 A;  3C1S A;  4OD7 A;  2AB6 A;  2KP2 A;  1U3A A;  3KCM A;  1XW5 A;  2RUF A;  3GST A;  3M9J A;  1JZR A;  3HXS A;  2HT9 A;  1G7E A;  4YQM A;  2OBI A;  1A2M A;  1GSD A;  1E2Y A;  2LQO A;  2DJJ A;  4ZXG A;  4G2E A;  1G6W A;  1UA5 A;  2VLV A;  1DSB A;  4HU9 A;  4YQV A;  2H6Z A;  2H0G A;  4D73 B;  4TW5 A;  1AC1 A;  1TP9 A;  3K8N A;  1GSU A;  4ZIL A;  5CRW A;  2HE3 A;  2YWM A;  5IMV A;  2PU9 C;  3IDV A;  2PVO C;  5F06 A;  4GF0 A;  4TR0 A;  1J9B A;  5E4W A;  2MMN A;  2XPE A;  3WGD A;  2JAC A;  3LXZ A;  3RPN A;  3A3T A;  4N0V A;  3TUE A;  2E7P A;  3DEX A;  1GLP A;  2L5L A;  4NXI A;  3EYT A;  3KIJ A;  1XPV A;  3GTU B;  5HFK A;  4KCE A;  2YOI A;  4X1U A;  4BA7 A;  3QFA C;  2IMD A;  3D6I A;  4HJ2 A;  3TJK A;  2F9S A;  3PIN A;  3ME8 A;  4EVM A;  4ECJ A;  17GS A;  4Q5F A;  2NVL A;  1X9S B;  2PMT A;  4KSM A;  3VFI A;  3BCI A;  1OYJ A;  1XOA A;  2XHF A;  2VL9 A;  3VWW A;  3VI7 A;  2LUS A;  5KN1 A;  2EC4 A;  3U6V A;  4MK3 A;  6GSV A;  5DAL A;  3Q6O A;  1RQM A;  3SBC A;  4EL1 A;  1XWA A;  2IFQ A;  1KNG A;  3F6F A;  1SJZ A;  3KEB A;  2H1A A;  2V1M A;  2O89 A;  3UVT A;  4PNF A;  1OC9 B;  13GS A;  2V6O A;  3H1N A;  4TVE A;  4Q5Q A;  2X8G A;  3GKN A;  1ZYE A;  1G0T A;  9GSS A;  1Q4J A;  3G7Y A;  4PNG A;  3KH9 A;  4OO4 A;  4EE0 A;  3RBT A;  2NDO A;  4F0B A;  1OC9 A;  3QR6 A;  2DMM A;  8GSS A;  3HVS A;  1QQ2 A;  2OJL A;  2VD1 A;  7GSS A;  2FWG A;  3VI5 A;  5JWR B;  4I6X A;  3HA9 A;  1QXH A;  1FG4 A;  1AXD A;  2H75 A;  2K6V A;  1GSE A;  2WZ9 A;  3IBH A;  1SK2 A;  4JBB A;  3P7X A;  10GS A;  5CAX A;  2KUC A;  4HI7 A;  4XS6 A;  4ISD A;  2YJH A;  3TKS A;  1WE0 A;  1ERV A;  3M1G A;  1PN9 A;  1SD9 A;  4KW6 A;  2HI7 A;  4K7I A;  2WGR A;  5LNK e;  2HZE B;  3KJY A;  2X99 A;  2B7J A;  2DC5 A;  2O8V B;  1E6B A;  3GKK A;  3UL3 A;  4WF4 A;  4L5O A;  6GSU A;  1YY7 A;  2OE3 A;  3IPZ A;  4DVC A;  2KLX A;  4PGT A;  5KN3 A;  3E3E A;  2I4A A;  3MAK A;  3I69 A;  1DE1 A;  1SEN A;  3KP9 A;  4AGS A;  1T00 A;  1XVW A;  3N5O A;  3KTB A;  2YAN A;  4Z7X A; 
#chains in the Genus database with same CATH topology
 3UMA A;  2GT6 A;  2ON5 A;  2GQK A;  1PRX A;  1S3R A;  4PX1 A;  1TOF A;  1MD3 A;  4LLR A;  2RLI A;  4EUY A;  4XTS A;  2PER A;  3W6G A;  3A2W A;  1V98 A;  1QGV A;  3CRT A;  2AJQ B;  5HR0 A;  3R2Q A;  4XS4 B;  3MYD A;  4MZC A;  3F3Q A;  4ZBA A;  1XFL A;  1EEM A;  3IRA A;  4KH7 A;  1TJD A;  1GUH A;  2IME A;  5GAP D;  3BD2 A;  3EU3 A;  1MH9 A;  5AN1 A;  3DRN A;  5DDL A;  3LG6 A;  3VPQ A;  2M46 A;  1YF0 A;  3IXR A;  1GP1 A;  5DAK A;  2X64 A;  3ZIV A;  2FY6 A;  4TXO B;  3A2X A;  4K1F A;  2DJ0 A;  1TJV A;  4OMV A;  4J2F A;  3G7J A;  2ALB A;  5DBQ A;  5G5F A;  2V6K A;  4K5S A;  1PGT A;  1GTU A;  3OCE A;  4MH3 A;  2RCN A;  4N30 A;  2IMI A;  2DIZ A;  2C3Q A;  1I0A A;  4PTS A;  1AW9 A;  2R0G A;  1Z4Q A;  1GSY A;  2JAR A;  5HR3 A;  4MX2 A;  2A2P A;  2LJA A;  1XWB A;  1VGL A;  2VCT A;  3WT1 A;  5G1K A;  2RM5 A;  2LRN A;  4TKY A;  3G9B A;  1TRS A;  2G2Q A;  4I2U A;  2CZ2 A;  4ICY A;  3D4T A;  1T9H A;  2L5O A;  3FZ5 A;  5GSS A;  2GQM A;  5GST A;  4N11 A;  1BX9 A;  2VL2 C;  3VPT A;  1ZYP A;  4L5L A;  2VM1 A;  3I6A A;  5LD0 A;  5JCW A;  2X4A A;  4EIP A;  4Z2R A;  1FVJ A;  1OKT A;  3FHK A;  1WWJ A;  2CVB A;  3QDN A;  3QMX A;  1A8Y A;  1K3Y A;  1YJ6 A;  1T8E B;  1WRY A;  1SKR B;  4IW9 A;  2R37 A;  1TRV A;  4QQ7 A;  1OC3 A;  4DSS B;  5IMZ A;  2GVP A;  1XZO A;  1VF4 A;  1QFN A;  4KF9 A;  3ERF A;  1BQ7 A;  1F3B A;  1FB0 A;  1KQ7 A;  2DJ3 A;  4HS1 A;  2F3M A;  1F37 A;  2V32 A;  4ZL9 A;  2VCX A;  1W89 A;  4L57 A;  1LJR A;  4OWY A;  3ZML A;  1I9D A;  4GSN A;  4O5U A;  4GCI A;  3EC3 A;  3TB2 A;  1MDK A;  3EMX A;  1JHB A;  5J4U A;  5E59 A;  3IK7 A;  3EVI A;  4PQH A;  5FWG A;  5HW2 A;  1ERT A;  2AUV A;  4MZW A;  4FQU A;  5JWQ B;  5GAN D;  1SK0 A;  1A2L A;  1M2B A;  4USS A;  3E04 A;  3A5W A;  5D9X A;  5B8B A;  1SL2 B;  3FR6 A;  3IOS A;  3BBY A;  3PGT A;  4TXV A;  4N0Z A;  1SD8 A;  1GTB A;  5D6B A;  3CRU A;  4EEI A;  5CRD A;  14GS A;  1V40 A;  3LOR A;  4XHM A;  3RHC A;  4PXO A;  2C80 A;  4KGI A;  5ECO B;  4AJ8 A;  1F2E A;  4PQ1 A;  1Z4K A;  1DUG A;  1TRU A;  3DKS A;  2H71 A;  3GA4 A;  2L4Q A;  3KP8 A;  3RHB A;  2B6M A;  1C72 A;  2QGA B;  1Q91 A;  3NOF A;  1Y6E A;  2CV4 A;  3GYK A;  2KHP A;  3FR3 A;  1Z4L A;  1YKA A;  2QA1 A;  4NHW A;  1GTA A;  2E9F A;  2HYX A;  4MP4 A;  3FR9 A;  3TV2 A;  5J9B A;  2VCV A;  3IC8 A;  1M7T A;  3GNJ A;  3QAG A;  2K8V A;  4IJI A;  4MMM A;  3GTU A;  4IEL A;  4RQR A;  3H93 A;  5EY6 A;  3VK9 A;  2YV7 A;  3RDW A;  2BTO T;  3QPM A;  2HNL A;  1R5P A;  1TK0 B;  3IC4 A;  1UC7 A;  5HR2 A;  2DJK A;  4IP1 A;  1Y25 A;  2RII A;  1ZL9 A;  4I8B A;  3F3R A;  4BIK A;  3HKR A;  3J7Y b;  1BJX A;  1AQW A;  1FOH A;  3CSJ A;  1RW1 A;  4ULX A;  5D93 A;  4F9Z A;  2V41 A;  1W4V A;  3V1W A;  2RUE A;  5ID2 B;  3VWU A;  5ECR B;  5IMC A;  4MPG A;  2VOC A;  3IHG A;  1JZD A;  1M2D A;  2H1G A;  3P90 A;  4TN8 A;  2PVQ A;  4ML1 A;  2GDR A;  2P5Q A;  3TKQ A;  1MD4 A;  3E9J B;  4CHS A;  1GSF A;  2B7K A;  1RE5 A;  4YAV A;  3APQ A;  3EE2 A;  4HQZ A;  2P0G A;  3C7M A;  4WKW A;  3DVX A;  2FCH A;  1XVQ A;  2A2R A;  1X5D A;  1GRX A;  2PWJ A;  4K7O A;  4EO3 A;  4IS0 A;  1SJ6 A;  4K0N A;  1HNC A;  4APA A;  3TJF A;  4L0W A;  5KEJ A;  1THO A;  2DML A;  2FUG 2;  1XIY A;  2IIY A;  3D5J A;  2VIM A;  1IW7 D;  2VL3 A;  2NBS A;  1PD2 1;  4POM A;  2YV9 A;  1A2J A;  2EIO A;  1O73 A;  3GKX A;  5JWO B;  1M3J A;  4NV5 A;  5A4W A;  1T7P B;  2FA4 A;  4HQS A;  4MDC A;  5G2Z A;  4NMU A;  1H4O A;  2LNT A;  1DBY A;  5IOW A;  4NWY A;  2AHE A;  1PA3 A;  4NV2 A;  1SL0 B;  3FZ4 A;  3IA1 A;  1M99 A;  2H6X A;  1SK1 A;  3FZ9 A;  1SYR A;  4HGV A;  2PUK C;  3W8S A;  1PMT A;  3DGQ A;  3GN3 A;  4ZBD A;  2C4J A;  2CAQ A;  6GSX A;  1IYH A;  3GKM A;  4OCE A;  4LMV A;  3TRX A;  1XG8 A;  5D9W A;  2ZNM A;  4BWS A;  3QAV A;  3D22 A;  1C3C A;  1S3C A;  3ERW A;  5DCG A;  2LJR A;  5GZZ B;  1G6Y A;  4HDE A;  1Z7R A;  2QGV A;  5KN0 A;  3TRQ A;  4GWR A;  3KTL A;  4YQU A;  1XWC A;  4IVF A;  1KTE A;  1ERW A;  3TOU A;  4GQF A;  2VUP A;  4MJB A;  2WB9 A;  4E88 A;  4HZ4 A;  1Z5Y E;  1R26 A;  2PFM A;  3QD9 A;  3O6T A;  18GS A;  4TR1 A;  5D96 A;  2IL3 A;  1VF3 A;  3MDK A;  2K8S A;  4KDU A;  1KBN A;  2LRT A;  3ZYW A;  3RD8 A;  4G0I A;  5ECM B;  1YF1 A;  4V2L A;  5ECK B;  2H6Y A;  3IAM 2;  3US3 A;  4CY8 A;  1CQG A;  1TI3 A;  3C73 A;  2LJK A;  2VD0 A;  2Z9S A;  4DSR A;  6GST A;  5KOW A;  4BWQ A;  19GS A;  1K3L A;  2M80 A;  2DLX A;  3L9S A;  2YN1 A;  4G10 A;  4POK A;  1F3A A;  5JCU A;  5F91 A;  4G0K A;  3TKS E;  1JZW A;  1XW9 A;  3DIE A;  4OCF A;  2EIQ A;  2C3N A;  3FKF A;  2YZU A;  3L0H A;  3C71 A;  2MMA A;  4L8E A;  3WYW A;  2FWF A;  2D2Z A;  2WFC A;  3UIW A;  4RQX A;  3TDG A;  4D73 A;  3IHQ A;  3Q74 A;  5D9V A;  2C0G A;  1TJ7 A;  3J7Y k;  5C00 A;  5ELG A;  2LS5 A;  1LU4 A;  5ENU A;  4RUV A;  3HVX A;  2MBS A;  1XWG A;  3P8W A;  3HHV A;  1UN2 A;  4WR5 A;  1Z4P X;  4L0U A;  1PX6 A;  1R7H A;  2WRT A;  2CZ3 A;  4HSC X;  3LWA A;  1TI1 A;  5CRE A;  4TR3 A;  3VWV A;  2D28 C;  3UBL A;  1EGR A;  2HSH A;  2VL2 A;  4AF2 A;  3FK8 A;  2PN8 A;  2IFQ B;  5DJL A;  3NIV A;  2I1U A;  2A4V A;  5F92 A;  1R5A A;  2GS3 A;  4POB A;  4K9Z A;  1EP7 A;  3F6D A;  2OE1 A;  3BOA A;  2TRX A;  4IQA A;  5F8B A;  2H74 A;  2H0H A;  3FMW A;  1XOB A;  1YEP A;  4I2T A;  3FW2 A;  4DSQ A;  1K0N A;  1TK5 B;  2I7D A;  4EXJ A;  5ECL B;  1OE8 A;  1VDK A;  1PQN A;  1DOF A;  1SJI A;  4WXT A;  1USB A;  4KB3 A;  1A23 A;  1O7U A;  1SYX A;  4TR1 B;  2ON7 A;  4G9H A;  3WGE A;  2R5G A;  3FY7 A;  3ZRE A;  2PTS A;  2XBQ A;  3F63 A;  2GTU A;  4G19 A;  2RM6 A;  1I5G A;  2IN3 A;  3GUR A;  4XRA A;  4YAP A;  3TJJ A;  2ES7 A;  4Q5N A;  1JLV A;  1NW2 A;  1SKS B;  2H0I A;  2GQL A;  4Z2U A;  5C04 A;  2BMX A;  2CQ9 A;  4AJ7 A;  4FO5 A;  11GS A;  1VRS D;  5ELA A;  1FAA A;  3VLN A;  1A24 A;  2F8F A;  4ZB8 A;  1Q92 A;  5IQY A;  1T4Z A;  1Z6N A;  3E0U A;  5DJM A;  3VUR A;  3HD5 A;  2FGX A;  3KM6 A;  1K62 A;  2YP6 A;  2FNO A;  2MMO A;  3LW9 A;  2FHE A;  1R4W A;  4JED A;  1QUW A;  1ZZY A;  2GZY A;  1DE2 A;  1BED A;  5G1L A;  12GS A;  1ACV A;  2H66 A;  3ZZX A;  1ON4 A;  3HJP A;  4MPF A;  4X4J A;  3ZMK A;  2C0D A;  3D4M A;  1V9W A;  5F05 A;  2PBJ A;  1URM A;  4H86 A;  2JAW A;  1HY0 A;  2LQQ A;  2PGT A;  5G30 A;  2R0P A;  3H79 A;  2H70 A;  2HSY A;  5B6N A;  2LRC A;  1Z4M A;  4EDY A;  1WIK A;  3M8N A;  4NFL A;  4ZIJ A;  2YWO A;  3HVN A;  3TKP A;  2LNS A;  1OVN A;  4JRR A;  3APS A;  5IMF A;  3HZ8 A;  5ECN B;  3GUS A;  2HVG A;  4TXO A;  5DQS A;  1V2A A;  4E8H A;  4KX4 A;  2WUL A;  1PKZ A;  1GUK A;  2LEG A;  6GSY A;  4KE3 A;  3KXO A;  2YZH A;  2XBI A;  3HY2 A;  3C8E A;  2L6C A;  1XWK A;  4WBJ A;  4ECI A;  1HQO A;  4K5R A;  2PPT A;  4ACS A;  16GS A;  5HFI A;  4MF5 A;  2C0E A;  2IWT A;  4MNN A;  1ZYN A;  5ECQ B;  1TU7 A;  1QMV A;  4JZQ A;  3QOU A;  3I43 A;  5H5Q A;  2WS2 A;  3F0I A;  1K0O A;  2CAI A;  3U5R E;  1Z7P A;  4GXZ A;  4HU7 A;  1WOU A;  1YQ1 A;  1EV4 A;  3TOT A;  1HY1 A;  22GS A;  2R6K A;  1N2A A;  4Q5R A;  2DIY A;  2O85 A;  6GSW A;  1GH2 A;  1EOG A;  2B3S A;  3F9U A;  3M3M A;  1BG5 A;  2F8A A;  1Q98 A;  5FHI A;  4YIH A;  1TRW A;  3D0Z A;  1KEB A;  2JAD A;  1J3U A;  3S9F A;  4BVY A;  3ZL5 A;  5D73 A;  4OFT A;  2TIR A;  4XIH A;  4O32 A;  3OR5 A;  1PSQ A;  2JZT A;  2H30 A;  4LA1 A;  2XC2 A;  2CT6 A;  2R2J A;  4GRF A;  4CW9 A;  3LYP A;  1HD2 A;  2JAU A;  4FYB A;  1V58 A;  4K0G A;  4IP6 A;  2GSR A;  2DSA A;  1O81 A;  2J23 A;  3R3E A;  1Z4J A;  2EIR A;  5EVO A;  4WET A;  1X9W B;  1WP0 A;  1V57 A;  2HRN A;  4HJM A;  1FOV A;  4GSS A;  1K7W A;  1ZMA A;  1AIU A;  3H8Q A;  4IHU A;  4RI6 A;  4KND A;  4OFN A;  4KSO A;  1O8W A;  1SU9 A;  1YZX A;  1T4Y A;  2CX3 A;  4LMW A;  5CO3 A;  1HNB A;  5AIV A;  3QAW A;  2JSY A;  5J9C A;  1FB6 A;  5COH A;  4K2X A;  1ZOF A;  2PTR A;  4F82 A;  4IKH A;  4WF5 A;  4MZB A;  3KMO A;  1JLW A;  2REM A;  3UBK A;  3HVV A;  1TW9 A;  2E0Q A;  4KDY A;  5A5K A;  3QCP A;  4TOP A;  1ZYQ B;  2ZCT A;  3F4T A;  1B48 A;  2B1K A;  2CX4 A;  1FUO A;  1M9A A;  3ZVJ D;  3LQ7 A;  3WGX A;  2FWH A;  1N8J A;  2DJ1 A;  5D9T A;  2CVD A;  1QK8 A;  4J57 E;  2GST A;  2LST A;  4DEJ A;  3LFL A;  1NSW A;  2GZP A;  2GZZ A;  2LV3 A;  4ML6 A;  4X0X A;  1Z9H A;  1B9Y C;  3DD3 A;  3IR4 A;  2XPD A;  1SKW B;  1OAZ A;  4ECC A;  5DQY A;  5DVB A;  1GLQ A;  4MF7 A;  4F03 A;  1Z4I A;  3HYP A;  3D21 A;  2AYT A;  1U87 A;  2OAC A;  1MDI A;  2VM2 A;  2MYG A;  5IMD A;  3SWL A;  4ZBB A;  1WMJ A;  3LSZ A;  1MDJ A;  5G5E A;  5IO0 A;  2GSQ A;  2JL4 A;  3KMN A;  2I9H A;  2E2M A;  2QKE A;  2V2G A;  4BVX A;  3CSI A;  3L4N A;  4QL7 A;  4O5Q A;  4K6X A;  1HNA A;  1EV9 A;  5CRH A;  1EZK A;  4O7H A;  3F8U A;  1H75 A;  1Z6M A;  5G31 A;  2HZF A;  4KA0 A;  1M9B A;  3CBU A;  2MBT A;  2N5B A;  1FUP A;  1FVK A;  3A5I A;  3NZN A;  2P5R A;  3PH9 A;  4FH8 A;  4F0C A;  3IV4 A;  4MF6 A;  1ABA A;  1K0D A;  4Z2T A;  4WEY A;  4O5R A;  4YIK A;  1SL1 B;  2YJ7 A;  4OO5 A;  2O7K A;  3OCF A;  4LL1 B;  4P3Y B;  2JAO A;  2ZUP A;  2QSI A;  4PUF C;  5H5R A;  2YWI A;  3F4R A;  3QFB C;  3ERG A;  4K8M A;  2MZC A;  2H1B A;  3KH7 A;  2X49 A;  3GFK A;  3Q18 A;  3EUR A;  4FYC A;  1EGO A;  4NPB A;  2KP1 A;  2LTK A;  3GL3 A;  5B7C A;  3BWV A;  1ML6 A;  1UVZ A;  2G0F A;  3R6V A;  1MEK A;  3CTF A;  4WR4 A;  4O92 A;  3EIN A;  2IMK A;  4GTU A;  3LXT A;  3TCO A;  3WD6 A;  1JZO A;  4EDZ A;  2R4V A;  1GSQ A;  3N9J A;  4N10 A;  4NLE A;  4IN0 A;  2HZE A;  2O87 A;  3GX8 A;  1G7O A;  4ZL7 A;  4ILF A;  5CNW A;  5EPF A;  5AIX A;  3Q19 A;  4XRD A;  2X75 A;  3KZQ A;  4V1A p;  4BL7 A;  2JZS A;  5HQP A;  4X43 A;  4POL A;  2A2S A;  2H73 A;  3CQF A;  4J56 E;  4EC0 A;  1U0L A;  1A0R P;  1TKD B;  5ABR A;  3IE3 A;  1GUL A;  5DCH A;  4IBP A;  1K0B A;  2L57 A;  3QBP A;  3DML A;  3UVH A;  4K2D A;  5IIZ A;  3EWL A;  2K9F A;  1WPI A;  5A4V A;  2C1Y A;  4E8E A;  3RAZ A;  4NSL A;  3LGC A;  1BAY A;  4JU5 A;  3APO A;  3EU4 A;  1EP8 A;  1THX A;  2H1D A;  1U3I A;  1TDI A;  4NAX A;  3L9U A;  2VCQ A;  1B9X C;  2VLU A;  2HRK A;  1HYU A;  2CA8 A;  1BYE A;  4MLY A;  3WT2 A;  1PL1 A;  1A0F A;  2OKA A;  2OA7 A;  1OKD A;  3JCM L;  4HUA A;  4GLT A;  1ST9 A;  4XS4 A;  1O6J A;  4PQI A;  3I9V 2;  3MNG A;  2L4C A;  3A2V A;  3DWV A;  1CQH A;  1JFU A;  4BL7 B;  2FD3 A;  1XWO A;  5IOX A;  1ZGN A;  3C8T A;  2DBC A;  3MIX A;  4ADM A;  4KDX A;  1IYI A;  2GSS A;  1S3D A;  4KUN A;  1TU8 A;  2B5E A;  2YPM A;  1AUC A;  2X8C A;  1LBK A;  1GNW A;  1AUW A;  4IGJ A;  3GRX A;  4OFM A;  1GTI A;  2HLS A;  4MJE A;  1FHE A;  4FIW A;  2E2G A;  2KOK A;  5AGY A;  4V2M A;  4EF0 A;  1TXX A;  1J08 A;  4RI7 A;  2AV4 A;  5ECH B;  3LYK A;  2DJ2 A;  3W8J A;  3CTG A;  2R0C A;  5B6M A;  20GS A;  2C0F A;  3ZFL A;  4MJC A;  2AAW A;  3DVW A;  5IPH A;  4WBR D;  3GHA A;  2B1L A;  3G7I A;  1TTZ A;  1EEJ A;  2MMZ A;  2JSZ A;  2M72 A;  3ISO A;  5IPG A;  1Z3E A;  2NPB A;  1U6T A;  2FWE A;  3TJB A;  1GL8 A;  4LL4 B;  5EL8 A;  1K3O A;  1OE7 A;  3UOM A;  4BPY A;  5J5N A;  2YWN A;  3LEF A;  2L59 A;  2HSM A;  3C1R A;  4YKF A;  1O8X A;  3TRP A;  1EWX A;  4FYU A;  3L78 A;  2FLS A;  3LJR A;  1RK4 A;  3BCK A;  6GSS A;  4MAB A;  3M0F A;  2PTQ A;  1FW1 A;  1VF2 A;  2H8L A;  2YCD A;  3ZLP A;  1GSS A;  3GV1 A;  2CVK A;  3UAR A;  3HJM A;  2YNX A;  5KOX A;  5DAK B;  4L6A A;  2JU5 A;  3GH6 A;  5F0G A;  3MSZ A;  1ERU A;  3IAS 2;  5L71 A;  3O76 A;  4ZB9 A;  5JCG A;  3FZA A;  5A4U A;  1MTC A;  5ID2 A;  3ZFB A;  4JR4 A;  3CMI A;  3GIX A;  5LCZ A;  5B8A A;  1NHO A;  2HFD A;  2J9H A;  2TRC P;  3TKS C;  1AQX A;  1X5C A;  5F07 A;  2UZ8 A;  1F9M A;  3ED3 A;  3U13 A;  4V2N A;  2JZR A;  1T3B A;  3GZH A;  3MWH A;  3UJ1 A;  3O3T A;  4PUA A;  4KCA A;  5ECS A;  1PL2 A;  1T1V A;  1TK8 B;  1FO5 A;  1K0A A;  3CXG A;  5HFG A;  1DCN A;  3DYR A;  4V1A g;  2VLT A;  3P2A A;  3GH9 A;  3KD0 A;  5H5S A;  4CDO A;  5BRT A;  3ME7 A;  2R3X A;  4K7N A;  3CSH A;  3AY8 A;  4HZ2 A;  5FT3 A;  4YKG A;  2WDU A;  2N5F A;  1U88 A;  3GX0 A;  4JR6 A;  4EFC A;  1J0F A;  4YH2 A;  2WJU A;  3CI0 K;  4TRX A;  4HOJ A;  3FRC A;  5IMA A;  3ZTL A;  2HRA A;  2FA8 A;  4F2I A;  3ZRD A;  1AQV A;  1AAZ A;  2K18 A;  4MJA A;  2F51 A;  2N5A A;  3VWX A;  4GST A;  5J3R A;  2B5X A;  1XCC A;  1X5E A;  5D8I A;  1YEX A;  2VAF A;  3PR8 A;  1XBS A;  1YKC A;  2IPA A;  4PUR A;  1PX7 A;  4MCU A;  3L9V A;  5INY A;  2HXK A;  3EPT A;  1K0C A;  3IK9 A;  1NHY A;  1GUM A;  1S3A A;  1GWC A;  1OC8 A;  3CYN A;  5KN2 A;  4XS1 A;  3GL5 A;  2HRF A;  4I5Q A;  4TR4 A;  1ILO A;  3BJ5 A;  5IO2 A;  2X8H A;  3HZ4 A;  5AIS A;  4AJ6 A;  4I97 A;  5CYY A;  2GLR A;  5CRG A;  3DXB A;  2I81 A;  4ID0 A;  3TGZ A;  1B4Q A;  1XW6 A;  3R6Q A;  5J41 A;  4HEA 2;  1O85 A;  1ZCP A;  3TKR A;  4MUM A;  3HCZ A;  5ECI B;  4DSS A;  1X9M B;  3F4S A;  3EMP A;  2B5Y A;  2LKU A;  5ECP B;  2QC7 A;  2NTO A;  1PKW A;  3H4K A;  2OE0 A;  1VF1 A;  2GGT A;  2H72 A;  2VCW A;  4QL9 A;  4IQ1 A;  2DKH A;  1M2A A;  3FYG A;  1EOH A;  1WJK A;  1YDK A;  3GMF A;  1A8L A;  3HDC A;  4NHZ A;  2C3T A;  4JE1 A;  1B4P A;  4GQC A;  3ZIT A;  4XCS A;  4EIQ A;  3RPP A;  3M9K A;  4ZL8 A;  1GNE A;  2P31 A;  2GT5 A;  2WCI A;  3ZIJ A;  1NM3 A;  3ZVJ A;  2I3Y A;  1X0R A;  4ZB6 A;  2H19 A;  2L6D A;  5IM9 A;  2OAD A;  2H01 A;  1B8X A;  2C8U A;  3UEM A;  3FEU A;  1K0M A;  1F6M C;  4MA9 A;  3TJG A;  1M0U A;  2IJY A;  2IMF A;  3PPU A;  5CP1 A;  3UAP A;  5DAL B;  4ECB A;  4A5P A;  1XXU A;  4KAE A;  2BJX A;  2OBK A;  4EKZ A;  2H76 A;  5HR1 A;  2VCZ A;  3KGK A;  3GSS A;  4MH2 A;  3HJO A;  2VO4 A;  4IJ3 A;  3RRP A;  3C1S A;  4OD7 A;  2AB6 A;  2KP2 A;  1U3A A;  3KCM A;  1XW5 A;  2RUF A;  3GST A;  3M9J A;  1JZR A;  3HXS A;  1FUR A;  2HT9 A;  1G7E A;  4YQM A;  2OBI A;  1A2M A;  1GSD A;  1E2Y A;  2LQO A;  2DJJ A;  1YFM A;  2A4H A;  4ZXG A;  1PN0 A;  4G2E A;  1G6W A;  1UA5 A;  2VLV A;  1DSB A;  4HU9 A;  4YQV A;  2H6Z A;  2H0G A;  4D73 B;  4TW5 A;  4G0L A;  1AC1 A;  1TP9 A;  3K8N A;  1GSU A;  4ZIL A;  5CRW A;  2HE3 A;  2YWM A;  5IMV A;  1M3I A;  4IQJ M;  2PU9 C;  3IDV A;  2PVO C;  5F06 A;  4GF0 A;  4TR0 A;  1J9B A;  5E4W A;  4BVY B;  2MMN A;  2XPE A;  3WGD A;  2JAC A;  3LXZ A;  3RPN A;  3A3T A;  4N0V A;  3TUE A;  2E7P A;  3DEX A;  1GLP A;  2L5L A;  4NXI A;  3EYT A;  3KIJ A;  1XPV A;  3GTU B;  5HFK A;  4KCE A;  2YOI A;  4X1U A;  1TJU A;  3QFA C;  2IMD A;  4BA7 A;  1PFO A;  3D6I A;  4L6C A;  4HJ2 A;  3TJK A;  2F9S A;  3PIN A;  3ME8 A;  4EVM A;  4ADL A;  4ECJ A;  17GS A;  3GTD A;  4Q5F A;  2NVL A;  1X9S B;  4BVX B;  1C3U A;  2PMT A;  4KSM A;  3VFI A;  2DKI A;  3BCI A;  1OYJ A;  1XOA A;  2XHF A;  2VL9 A;  3VWW A;  3VI7 A;  2LUS A;  5KN1 A;  2FUS A;  2EC4 A;  3U6V A;  4MK3 A;  6GSV A;  5DAL A;  3Q6O A;  1RQM A;  3SBC A;  4EL1 A;  1XWA A;  2IFQ A;  1KNG A;  3F6F A;  1SJZ A;  3KEB A;  2H1A A;  1JSW A;  2V1M A;  2O89 A;  3UVT A;  1FUQ A;  4PNF A;  1OC9 B;  13GS A;  2V6O A;  3H1N A;  4TVE A;  4Q5Q A;  2X8G A;  3GKN A;  1ZYE A;  1G0T A;  9GSS A;  1Q4J A;  3G7Y A;  4PNG A;  3KH9 A;  4OO4 A;  4EE0 A;  3RBT A;  2NDO A;  4APB A;  4F0B A;  1OC9 A;  3QR6 A;  2DMM A;  8GSS A;  3HVS A;  1QQ2 A;  2OJL A;  2VD1 A;  7GSS A;  1Q5N A;  4MWO A;  2FWG A;  3VI5 A;  3U19 A;  5JWR B;  4I6X A;  3HA9 A;  1QXH A;  1U15 A;  1FG4 A;  1AXD A;  2H75 A;  2K6V A;  1YFE A;  1GSE A;  5BMU A;  2WZ9 A;  3IBH A;  1SK2 A;  1TJW A;  4JBB A;  3P7X A;  10GS A;  5CAX A;  2KUC A;  4HI7 A;  4XS6 A;  4ISD A;  2YJH A;  3TKS A;  1WE0 A;  1ERV A;  3M1G A;  1PN9 A;  1SD9 A;  4KW6 A;  2HI7 A;  4K7I A;  2WGR A;  5LNK e;  2HZE B;  3KJY A;  2X99 A;  2B7J A;  2DC5 A;  2QA2 A;  2O8V B;  1E6B A;  3GKK A;  4CY6 A;  1U16 A;  3UL3 A;  2YV5 A;  4WF4 A;  4L5O A;  6GSU A;  1YY7 A;  2OE3 A;  3IPZ A;  4DVC A;  2KLX A;  4PGT A;  5KN3 A;  3E3E A;  3BHG A;  2I4A A;  3MAK A;  3I69 A;  1DE1 A;  1SEN A;  3NO9 A;  3KP9 A;  1T00 A;  1XVW A;  3N5O A;  4AGS A;  3KTB A;  2YAN A;  2D27 A;  4Z7X A; 
#chains in the Genus database with same CATH homology
 3UMA A;  2GT6 A;  2ON5 A;  2GQK A;  1PRX A;  4PX1 A;  1TOF A;  1MD3 A;  4LLR A;  2RLI A;  4EUY A;  4XTS A;  2PER A;  3W6G A;  3A2W A;  1V98 A;  1QGV A;  3CRT A;  2AJQ B;  5HR0 A;  3R2Q A;  4XS4 B;  3MYD A;  4MZC A;  3F3Q A;  4ZBA A;  1XFL A;  1EEM A;  3IRA A;  4KH7 A;  1TJD A;  1GUH A;  2IME A;  5GAP D;  3BD2 A;  3EU3 A;  5AN1 A;  3DRN A;  5DDL A;  3LG6 A;  3VPQ A;  2M46 A;  1YF0 A;  3IXR A;  1GP1 A;  5DAK A;  2X64 A;  3ZIV A;  2FY6 A;  4TXO B;  3A2X A;  4K1F A;  2DJ0 A;  4OMV A;  4J2F A;  3G7J A;  2ALB A;  5DBQ A;  5G5F A;  2V6K A;  4K5S A;  1PGT A;  1GTU A;  4MH3 A;  4N30 A;  2IMI A;  2DIZ A;  2C3Q A;  4PTS A;  1AW9 A;  2R0G A;  1GSY A;  5HR3 A;  2A2P A;  2LJA A;  1XWB A;  1VGL A;  2VCT A;  3WT1 A;  5G1K A;  2RM5 A;  2LRN A;  4TKY A;  3G9B A;  1TRS A;  2G2Q A;  4I2U A;  2CZ2 A;  4ICY A;  3D4T A;  2L5O A;  3FZ5 A;  5GSS A;  2GQM A;  5GST A;  4N11 A;  1BX9 A;  2VL2 C;  3VPT A;  1ZYP A;  4L5L A;  2VM1 A;  3I6A A;  5LD0 A;  5JCW A;  2X4A A;  4EIP A;  4Z2R A;  1FVJ A;  1OKT A;  3FHK A;  1WWJ A;  2CVB A;  3QDN A;  3QMX A;  1A8Y A;  1K3Y A;  1YJ6 A;  1T8E B;  1WRY A;  1SKR B;  4IW9 A;  2R37 A;  1TRV A;  4QQ7 A;  1OC3 A;  4DSS B;  5IMZ A;  2GVP A;  1XZO A;  1VF4 A;  1QFN A;  4KF9 A;  3ERF A;  1BQ7 A;  1F3B A;  1FB0 A;  2DJ3 A;  4HS1 A;  2F3M A;  1F37 A;  2V32 A;  4ZL9 A;  2VCX A;  1W89 A;  1LJR A;  4OWY A;  3ZML A;  1I9D A;  4GSN A;  4O5U A;  3TB2 A;  4GCI A;  3EC3 A;  1MDK A;  3EMX A;  1JHB A;  5J4U A;  5E59 A;  3IK7 A;  3EVI A;  4PQH A;  5FWG A;  1ERT A;  2AUV A;  4MZW A;  4FQU A;  5JWQ B;  5GAN D;  1SK0 A;  1A2L A;  1M2B A;  4USS A;  3A5W A;  5D9X A;  5B8B A;  1SL2 B;  3FR6 A;  3IOS A;  3BBY A;  3PGT A;  4TXV A;  4N0Z A;  1SD8 A;  1GTB A;  3CRU A;  5CRD A;  14GS A;  1V40 A;  3LOR A;  4XHM A;  3RHC A;  4PXO A;  2C80 A;  4KGI A;  5ECO B;  4AJ8 A;  1F2E A;  4PQ1 A;  1DUG A;  1TRU A;  3DKS A;  2H71 A;  3GA4 A;  2L4Q A;  3KP8 A;  3RHB A;  2B6M A;  1C72 A;  3NOF A;  1Y6E A;  2CV4 A;  3GYK A;  2KHP A;  3FR3 A;  1YKA A;  2QA1 A;  4NHW A;  1GTA A;  2HYX A;  4MP4 A;  3FR9 A;  5J9B A;  2VCV A;  3IC8 A;  1M7T A;  3GNJ A;  3QAG A;  2K8V A;  4IJI A;  4MMM A;  3GTU A;  4IEL A;  4RQR A;  3H93 A;  5EY6 A;  3VK9 A;  2YV7 A;  3RDW A;  2BTO T;  3QPM A;  2HNL A;  1R5P A;  1TK0 B;  3IC4 A;  1UC7 A;  5HR2 A;  2DJK A;  4IP1 A;  1Y25 A;  2RII A;  1ZL9 A;  4I8B A;  3F3R A;  3HKR A;  3J7Y b;  1BJX A;  1AQW A;  1FOH A;  3CSJ A;  1RW1 A;  4ULX A;  5D93 A;  4F9Z A;  2V41 A;  1W4V A;  3V1W A;  2RUE A;  5ID2 B;  3VWU A;  5ECR B;  5IMC A;  4MPG A;  2VOC A;  3IHG A;  1JZD A;  1M2D A;  2H1G A;  3P90 A;  4TN8 A;  2PVQ A;  4ML1 A;  2GDR A;  2P5Q A;  3TKQ A;  1MD4 A;  3E9J B;  4CHS A;  1GSF A;  2B7K A;  4YAV A;  3APQ A;  3EE2 A;  4HQZ A;  2P0G A;  3C7M A;  4WKW A;  3DVX A;  2FCH A;  1XVQ A;  2A2R A;  1X5D A;  1GRX A;  2PWJ A;  4K7O A;  4EO3 A;  4IS0 A;  1SJ6 A;  4K0N A;  1HNC A;  3TJF A;  4L0W A;  5KEJ A;  1THO A;  2DML A;  2FUG 2;  1XIY A;  2IIY A;  3D5J A;  2VIM A;  1IW7 D;  2VL3 A;  2NBS A;  1PD2 1;  4POM A;  2YV9 A;  1A2J A;  2EIO A;  1O73 A;  3GKX A;  5JWO B;  4NV5 A;  5A4W A;  1T7P B;  2FA4 A;  4HQS A;  4MDC A;  5G2Z A;  4NMU A;  1H4O A;  2LNT A;  1DBY A;  5IOW A;  4NWY A;  2AHE A;  1PA3 A;  4NV2 A;  1SL0 B;  3FZ4 A;  3IA1 A;  1M99 A;  2H6X A;  1SK1 A;  3FZ9 A;  1SYR A;  2PUK C;  3W8S A;  1PMT A;  3DGQ A;  3GN3 A;  4ZBD A;  2C4J A;  2CAQ A;  6GSX A;  1IYH A;  3GKM A;  4OCE A;  4LMV A;  3TRX A;  5D9W A;  2ZNM A;  4BWS A;  3QAV A;  3D22 A;  1S3C A;  3ERW A;  5DCG A;  2LJR A;  5GZZ B;  1G6Y A;  4HDE A;  1Z7R A;  2QGV A;  5KN0 A;  3TRQ A;  4GWR A;  3KTL A;  4YQU A;  1XWC A;  4IVF A;  1KTE A;  1ERW A;  3TOU A;  4GQF A;  2VUP A;  4MJB A;  2WB9 A;  4HZ4 A;  1Z5Y E;  1R26 A;  3QD9 A;  3O6T A;  18GS A;  4TR1 A;  5D96 A;  2IL3 A;  1VF3 A;  3MDK A;  2K8S A;  4KDU A;  1KBN A;  2LRT A;  3ZYW A;  4G0I A;  5ECM B;  1YF1 A;  4V2L A;  5ECK B;  2H6Y A;  3IAM 2;  3US3 A;  4CY8 A;  1CQG A;  1TI3 A;  3C73 A;  2LJK A;  2VD0 A;  2Z9S A;  4DSR A;  6GST A;  5KOW A;  4BWQ A;  19GS A;  1K3L A;  2M80 A;  2DLX A;  3L9S A;  2YN1 A;  4G10 A;  4POK A;  1F3A A;  5JCU A;  4G0K A;  3TKS E;  1JZW A;  1XW9 A;  3DIE A;  4OCF A;  2EIQ A;  2C3N A;  3FKF A;  2YZU A;  3L0H A;  3C71 A;  2MMA A;  4L8E A;  3WYW A;  2FWF A;  2D2Z A;  2WFC A;  3UIW A;  4RQX A;  3TDG A;  4D73 A;  3IHQ A;  3Q74 A;  5D9V A;  2C0G A;  3J7Y k;  5C00 A;  5ELG A;  2LS5 A;  1LU4 A;  5ENU A;  4RUV A;  3HVX A;  2MBS A;  1XWG A;  3P8W A;  3HHV A;  1UN2 A;  4WR5 A;  4L0U A;  1PX6 A;  1R7H A;  2WRT A;  2CZ3 A;  3LWA A;  1TI1 A;  5CRE A;  4TR3 A;  3VWV A;  2D28 C;  3UBL A;  1EGR A;  2HSH A;  2VL2 A;  4AF2 A;  3FK8 A;  2PN8 A;  2IFQ B;  5DJL A;  3NIV A;  2I1U A;  2A4V A;  1R5A A;  2GS3 A;  4POB A;  4K9Z A;  1EP7 A;  3F6D A;  2OE1 A;  3BOA A;  2TRX A;  4IQA A;  5F8B A;  2H74 A;  2H0H A;  3FMW A;  1XOB A;  1YEP A;  4I2T A;  3FW2 A;  4DSQ A;  1K0N A;  1TK5 B;  4EXJ A;  5ECL B;  1OE8 A;  1PQN A;  1SJI A;  4WXT A;  1USB A;  4KB3 A;  1A23 A;  1O7U A;  1SYX A;  4TR1 B;  2ON7 A;  4G9H A;  3WGE A;  2R5G A;  3FY7 A;  3ZRE A;  2XBQ A;  3F63 A;  2GTU A;  4G19 A;  2RM6 A;  1I5G A;  2IN3 A;  3GUR A;  4XRA A;  4YAP A;  3TJJ A;  2ES7 A;  4Q5N A;  1JLV A;  1NW2 A;  1SKS B;  2H0I A;  2GQL A;  4Z2U A;  5C04 A;  2BMX A;  2CQ9 A;  4AJ7 A;  4FO5 A;  11GS A;  1VRS D;  5ELA A;  1FAA A;  3VLN A;  1A24 A;  2F8F A;  4ZB8 A;  5IQY A;  1T4Z A;  1Z6N A;  3E0U A;  5DJM A;  3VUR A;  3HD5 A;  2FGX A;  3KM6 A;  2YP6 A;  2FNO A;  2MMO A;  3LW9 A;  2FHE A;  1R4W A;  4JED A;  1QUW A;  1ZZY A;  2GZY A;  1DE2 A;  1BED A;  5G1L A;  12GS A;  1ACV A;  2H66 A;  3ZZX A;  1ON4 A;  3HJP A;  4MPF A;  4X4J A;  3ZMK A;  2C0D A;  3D4M A;  1V9W A;  5F05 A;  2PBJ A;  1URM A;  4H86 A;  2LQQ A;  2PGT A;  5G30 A;  2R0P A;  3H79 A;  2H70 A;  2HSY A;  5B6N A;  2LRC A;  4EDY A;  1WIK A;  3M8N A;  4ZIJ A;  2YWO A;  3TKP A;  2LNS A;  1OVN A;  4JRR A;  3APS A;  5IMF A;  3HZ8 A;  5ECN B;  3GUS A;  4TXO A;  5DQS A;  1V2A A;  4E8H A;  4KX4 A;  2WUL A;  1PKZ A;  1GUK A;  2LEG A;  6GSY A;  4KE3 A;  3KXO A;  2YZH A;  2XBI A;  3HY2 A;  3C8E A;  2L6C A;  1XWK A;  4WBJ A;  4ECI A;  1HQO A;  4K5R A;  2PPT A;  4ACS A;  16GS A;  5HFI A;  4MF5 A;  2C0E A;  2IWT A;  4MNN A;  1ZYN A;  5ECQ B;  1TU7 A;  1QMV A;  4JZQ A;  3QOU A;  3I43 A;  5H5Q A;  2WS2 A;  3F0I A;  1K0O A;  2CAI A;  3U5R E;  1Z7P A;  4GXZ A;  4HU7 A;  1WOU A;  1YQ1 A;  1EV4 A;  3TOT A;  22GS A;  2R6K A;  1N2A A;  4Q5R A;  2DIY A;  2O85 A;  6GSW A;  1GH2 A;  1EOG A;  2B3S A;  3F9U A;  3M3M A;  1BG5 A;  2F8A A;  1Q98 A;  5FHI A;  1TRW A;  3D0Z A;  1KEB A;  2JAD A;  3S9F A;  4BVY A;  3ZL5 A;  5D73 A;  4OFT A;  2TIR A;  4XIH A;  4O32 A;  3OR5 A;  1PSQ A;  2JZT A;  2H30 A;  4LA1 A;  2XC2 A;  2CT6 A;  2R2J A;  4GRF A;  4CW9 A;  3LYP A;  1HD2 A;  4FYB A;  1V58 A;  4K0G A;  4IP6 A;  2GSR A;  2DSA A;  1O81 A;  2J23 A;  3R3E A;  2EIR A;  5EVO A;  4WET A;  1X9W B;  1WP0 A;  1V57 A;  2HRN A;  4HJM A;  1FOV A;  4GSS A;  1ZMA A;  1AIU A;  3H8Q A;  4IHU A;  4RI6 A;  4KND A;  4OFN A;  4KSO A;  1O8W A;  1SU9 A;  1YZX A;  1T4Y A;  2CX3 A;  4LMW A;  5CO3 A;  1HNB A;  5AIV A;  3QAW A;  2JSY A;  5J9C A;  1FB6 A;  5COH A;  4K2X A;  1ZOF A;  4F82 A;  4IKH A;  4WF5 A;  4MZB A;  3KMO A;  1JLW A;  2REM A;  3UBK A;  3HVV A;  1TW9 A;  2E0Q A;  4KDY A;  5A5K A;  3QCP A;  4TOP A;  1ZYQ B;  2ZCT A;  3F4T A;  1B48 A;  2B1K A;  2CX4 A;  1M9A A;  3ZVJ D;  3LQ7 A;  3WGX A;  2FWH A;  1N8J A;  2DJ1 A;  5D9T A;  2CVD A;  1QK8 A;  4J57 E;  2GST A;  2LST A;  4DEJ A;  3LFL A;  1NSW A;  2GZP A;  2GZZ A;  2LV3 A;  4ML6 A;  4X0X A;  1Z9H A;  1B9Y C;  3DD3 A;  3IR4 A;  2XPD A;  1SKW B;  1OAZ A;  4ECC A;  5DQY A;  5DVB A;  1GLQ A;  4MF7 A;  4F03 A;  3HYP A;  3D21 A;  2AYT A;  1U87 A;  2OAC A;  1MDI A;  2VM2 A;  2MYG A;  5IMD A;  3SWL A;  4ZBB A;  1WMJ A;  3LSZ A;  1MDJ A;  5G5E A;  5IO0 A;  2GSQ A;  2JL4 A;  3KMN A;  2I9H A;  2E2M A;  2QKE A;  2V2G A;  4BVX A;  3CSI A;  3L4N A;  4QL7 A;  4O5Q A;  4K6X A;  1HNA A;  1EV9 A;  5CRH A;  1EZK A;  4O7H A;  3F8U A;  1H75 A;  1Z6M A;  5G31 A;  2HZF A;  4KA0 A;  1M9B A;  3CBU A;  2MBT A;  2N5B A;  1FVK A;  3A5I A;  3NZN A;  2P5R A;  3PH9 A;  4FH8 A;  4F0C A;  3IV4 A;  4MF6 A;  1ABA A;  1K0D A;  4Z2T A;  4WEY A;  4O5R A;  1SL1 B;  2YJ7 A;  4OO5 A;  2O7K A;  4LL1 B;  4P3Y B;  2ZUP A;  2QSI A;  4PUF C;  5H5R A;  2YWI A;  3F4R A;  3QFB C;  3ERG A;  4K8M A;  2MZC A;  2H1B A;  3KH7 A;  2X49 A;  3GFK A;  3Q18 A;  3EUR A;  4FYC A;  1EGO A;  4NPB A;  2KP1 A;  2LTK A;  3GL3 A;  5B7C A;  1ML6 A;  1UVZ A;  2G0F A;  1MEK A;  3CTF A;  4WR4 A;  4O92 A;  3EIN A;  2IMK A;  4GTU A;  3LXT A;  3TCO A;  3WD6 A;  1JZO A;  4EDZ A;  2R4V A;  1GSQ A;  3N9J A;  4N10 A;  4IN0 A;  2HZE A;  2O87 A;  3GX8 A;  1G7O A;  4ZL7 A;  4ILF A;  5CNW A;  5EPF A;  5AIX A;  3Q19 A;  4XRD A;  3KZQ A;  4V1A p;  4BL7 A;  2JZS A;  5HQP A;  4X43 A;  4POL A;  2A2S A;  2H73 A;  4J56 E;  4EC0 A;  1A0R P;  1TKD B;  5ABR A;  3IE3 A;  1GUL A;  5DCH A;  4IBP A;  1K0B A;  2L57 A;  3DML A;  3UVH A;  4K2D A;  5IIZ A;  3EWL A;  2K9F A;  1WPI A;  5A4V A;  2C1Y A;  4E8E A;  3RAZ A;  3LGC A;  1BAY A;  4JU5 A;  3APO A;  3EU4 A;  1EP8 A;  1THX A;  2H1D A;  1U3I A;  1TDI A;  4NAX A;  3L9U A;  2VCQ A;  1B9X C;  2VLU A;  2HRK A;  1HYU A;  2CA8 A;  1BYE A;  4MLY A;  3WT2 A;  1PL1 A;  1A0F A;  2OKA A;  2OA7 A;  1OKD A;  3JCM L;  4HUA A;  4GLT A;  1ST9 A;  4XS4 A;  1O6J A;  4PQI A;  3I9V 2;  3MNG A;  2L4C A;  3A2V A;  3DWV A;  1CQH A;  1JFU A;  4BL7 B;  2FD3 A;  5IOX A;  1ZGN A;  2DBC A;  3MIX A;  4KDX A;  1IYI A;  2GSS A;  1S3D A;  4KUN A;  1TU8 A;  2B5E A;  2YPM A;  1AUC A;  2X8C A;  1LBK A;  1GNW A;  4IGJ A;  3GRX A;  4OFM A;  1GTI A;  2HLS A;  4MJE A;  1FHE A;  4FIW A;  2E2G A;  2KOK A;  5AGY A;  4V2M A;  4EF0 A;  1TXX A;  1J08 A;  4RI7 A;  2AV4 A;  5ECH B;  3LYK A;  2DJ2 A;  3W8J A;  3CTG A;  2R0C A;  5B6M A;  20GS A;  2C0F A;  3ZFL A;  4MJC A;  2AAW A;  3DVW A;  5IPH A;  4WBR D;  3GHA A;  2B1L A;  3G7I A;  1TTZ A;  1EEJ A;  2MMZ A;  2JSZ A;  2M72 A;  3ISO A;  5IPG A;  1Z3E A;  2NPB A;  1U6T A;  2FWE A;  3TJB A;  1GL8 A;  4LL4 B;  5EL8 A;  1K3O A;  1OE7 A;  3UOM A;  4BPY A;  5J5N A;  2YWN A;  3LEF A;  2L59 A;  2HSM A;  3C1R A;  4YKF A;  1O8X A;  3TRP A;  1EWX A;  4FYU A;  3L78 A;  2FLS A;  3LJR A;  1RK4 A;  3BCK A;  6GSS A;  4MAB A;  3M0F A;  1FW1 A;  1VF2 A;  2H8L A;  2YCD A;  3ZLP A;  1GSS A;  3GV1 A;  2CVK A;  3UAR A;  3HJM A;  2YNX A;  5KOX A;  5DAK B;  2JU5 A;  3GH6 A;  5F0G A;  3MSZ A;  1ERU A;  3IAS 2;  5L71 A;  3O76 A;  4ZB9 A;  5JCG A;  3FZA A;  5A4U A;  1MTC A;  5ID2 A;  3ZFB A;  4JR4 A;  3CMI A;  3GIX A;  5LCZ A;  5B8A A;  1NHO A;  2HFD A;  2J9H A;  2TRC P;  3TKS C;  1AQX A;  1X5C A;  5F07 A;  2UZ8 A;  1F9M A;  3ED3 A;  4V2N A;  2JZR A;  1T3B A;  3MWH A;  3UJ1 A;  3O3T A;  4PUA A;  4KCA A;  5ECS A;  1PL2 A;  1T1V A;  1TK8 B;  1FO5 A;  1K0A A;  3CXG A;  5HFG A;  3DYR A;  4V1A g;  2VLT A;  3P2A A;  3GH9 A;  3KD0 A;  5H5S A;  4CDO A;  5BRT A;  3ME7 A;  2R3X A;  4K7N A;  3CSH A;  3AY8 A;  4HZ2 A;  5FT3 A;  4YKG A;  2WDU A;  2N5F A;  1U88 A;  3GX0 A;  4JR6 A;  1J0F A;  4YH2 A;  2WJU A;  4TRX A;  4HOJ A;  3FRC A;  5IMA A;  3ZTL A;  2HRA A;  2FA8 A;  4F2I A;  3ZRD A;  1AQV A;  1AAZ A;  2K18 A;  4MJA A;  2F51 A;  2N5A A;  3VWX A;  4GST A;  5J3R A;  2B5X A;  1XCC A;  1X5E A;  5D8I A;  1YEX A;  2VAF A;  3PR8 A;  1XBS A;  1YKC A;  2IPA A;  4PUR A;  1PX7 A;  4MCU A;  3L9V A;  5INY A;  2HXK A;  3EPT A;  1K0C A;  3IK9 A;  1NHY A;  1GUM A;  1GWC A;  1OC8 A;  1S3A A;  3CYN A;  5KN2 A;  4XS1 A;  3GL5 A;  2HRF A;  4I5Q A;  4TR4 A;  1ILO A;  3BJ5 A;  5IO2 A;  2X8H A;  3HZ4 A;  5AIS A;  4AJ6 A;  4I97 A;  5CYY A;  2GLR A;  5CRG A;  3DXB A;  2I81 A;  4ID0 A;  3TGZ A;  1B4Q A;  1XW6 A;  5J41 A;  4HEA 2;  1O85 A;  1ZCP A;  3TKR A;  3HCZ A;  5ECI B;  4DSS A;  1X9M B;  3F4S A;  3EMP A;  2B5Y A;  2LKU A;  5ECP B;  2QC7 A;  2NTO A;  1PKW A;  3H4K A;  2OE0 A;  1VF1 A;  2GGT A;  2H72 A;  2VCW A;  4QL9 A;  4IQ1 A;  2DKH A;  1M2A A;  3FYG A;  1EOH A;  1WJK A;  1YDK A;  3GMF A;  1A8L A;  3HDC A;  4NHZ A;  2C3T A;  4JE1 A;  1B4P A;  4GQC A;  3ZIT A;  4XCS A;  4EIQ A;  3RPP A;  3M9K A;  4ZL8 A;  1GNE A;  2P31 A;  2GT5 A;  2WCI A;  3ZIJ A;  1NM3 A;  3ZVJ A;  2I3Y A;  1X0R A;  4ZB6 A;  2H19 A;  2L6D A;  5IM9 A;  2OAD A;  2H01 A;  1B8X A;  2C8U A;  3UEM A;  3FEU A;  1K0M A;  1F6M C;  4MA9 A;  3TJG A;  1M0U A;  2IJY A;  2IMF A;  3PPU A;  5CP1 A;  3UAP A;  5DAL B;  4ECB A;  4A5P A;  1XXU A;  4KAE A;  2BJX A;  2OBK A;  4EKZ A;  2H76 A;  5HR1 A;  2VCZ A;  3KGK A;  3GSS A;  4MH2 A;  3HJO A;  2VO4 A;  4IJ3 A;  3C1S A;  4OD7 A;  2AB6 A;  2KP2 A;  1U3A A;  3KCM A;  1XW5 A;  2RUF A;  3GST A;  3M9J A;  1JZR A;  3HXS A;  2HT9 A;  1G7E A;  4YQM A;  2OBI A;  1A2M A;  1GSD A;  1E2Y A;  2LQO A;  2DJJ A;  2A4H A;  4ZXG A;  1PN0 A;  4G2E A;  1G6W A;  1UA5 A;  2VLV A;  1DSB A;  4HU9 A;  4YQV A;  2H6Z A;  2H0G A;  4D73 B;  4TW5 A;  4G0L A;  1AC1 A;  1TP9 A;  3K8N A;  1GSU A;  4ZIL A;  5CRW A;  2HE3 A;  2YWM A;  5IMV A;  4IQJ M;  2PU9 C;  3IDV A;  2PVO C;  5F06 A;  4GF0 A;  4TR0 A;  1J9B A;  5E4W A;  4BVY B;  2MMN A;  2XPE A;  3WGD A;  2JAC A;  3LXZ A;  3RPN A;  3A3T A;  4N0V A;  3TUE A;  2E7P A;  3DEX A;  1GLP A;  2L5L A;  4NXI A;  3EYT A;  3KIJ A;  1XPV A;  3GTU B;  5HFK A;  4KCE A;  2YOI A;  4X1U A;  4BA7 A;  3QFA C;  2IMD A;  3D6I A;  4HJ2 A;  3TJK A;  2F9S A;  3PIN A;  3ME8 A;  4EVM A;  4ECJ A;  17GS A;  4Q5F A;  2NVL A;  1X9S B;  4BVX B;  2PMT A;  4KSM A;  3VFI A;  2DKI A;  3BCI A;  1OYJ A;  1XOA A;  2XHF A;  2VL9 A;  3VWW A;  3VI7 A;  2LUS A;  5KN1 A;  2EC4 A;  3U6V A;  4MK3 A;  6GSV A;  5DAL A;  3Q6O A;  1RQM A;  3SBC A;  4EL1 A;  1XWA A;  2IFQ A;  1KNG A;  3F6F A;  1SJZ A;  3KEB A;  2H1A A;  2V1M A;  2O89 A;  3UVT A;  4PNF A;  1OC9 B;  13GS A;  2V6O A;  3H1N A;  4TVE A;  4Q5Q A;  2X8G A;  3GKN A;  1ZYE A;  1G0T A;  9GSS A;  1Q4J A;  3G7Y A;  4PNG A;  3KH9 A;  4OO4 A;  4EE0 A;  3RBT A;  2NDO A;  4F0B A;  1OC9 A;  3QR6 A;  2DMM A;  8GSS A;  3HVS A;  1QQ2 A;  2OJL A;  2VD1 A;  7GSS A;  2FWG A;  3VI5 A;  5JWR B;  4I6X A;  3HA9 A;  1QXH A;  1FG4 A;  1AXD A;  2H75 A;  2K6V A;  1GSE A;  5BMU A;  2WZ9 A;  3IBH A;  1SK2 A;  4JBB A;  3P7X A;  10GS A;  5CAX A;  2KUC A;  4HI7 A;  4XS6 A;  4ISD A;  2YJH A;  3TKS A;  1WE0 A;  1ERV A;  3M1G A;  1PN9 A;  1SD9 A;  4KW6 A;  2HI7 A;  4K7I A;  2WGR A;  5LNK e;  2HZE B;  3KJY A;  2X99 A;  2B7J A;  2DC5 A;  2QA2 A;  2O8V B;  1E6B A;  3GKK A;  4CY6 A;  3UL3 A;  4WF4 A;  4L5O A;  6GSU A;  1YY7 A;  2OE3 A;  3IPZ A;  4DVC A;  2KLX A;  4PGT A;  5KN3 A;  3E3E A;  2I4A A;  3MAK A;  3I69 A;  1DE1 A;  1SEN A;  3KP9 A;  4AGS A;  1T00 A;  1XVW A;  3N5O A;  3KTB A;  2YAN A;  2D27 A;  4Z7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...