3GZHA

Crystal structure of phosphate-bound adenylosuccinate lyase from e. coli
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
469
structure length
469
Chain Sequence
YDIPTTENLYFQGSELSSLTAVSPVDGRYGDKVSALRGIFSEYGLLKFRVQVEVRWLQKLAAHAAIKEVPAFAADAIGYLDAIVANFSEEDAARIKTIERTTNHDVKAVEYFLKEKVAEIPELHAVSEFIHFACTSEDINNLSHALMLKTARDEVILPYWRQLIDGIKDLAVQYRDIPLLSRTHGQPATPSTIGKEMANVAYRMERQYRQLNQVEILGKINGAVGNYNAHIAAYPEVDWHQFSEEFVTSLGIQWNPYTTQIEPHDYIAELFDCVARFNTILIDFDRDVWGYIALNHFKQKTIAGEIGSSTMPHKVNPIDFENSEGNLGLSNAVLQHLASKLPVSRWQRDLTDSTVLRNLGVGIGYALIAYQSTLKGVSKLEVNRDHLLDELDHNWEVLAEPIQTVMRRYGIEKPYEKLKELTRGKRVDAEGMKQFIDGLALPEEEKARLKAMTPANYIGRAITMVDELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylosuccinate lyase
publication title The structure of phosphate-bound Escherichia coli adenylosuccinate lyase identifies His171 as a catalytic acid.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 184
structure length 469
sequence length 469
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF08328 ASL_C Adenylosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 3gzhA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 3gzhA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 3gzhA02
3GZHA 1FUQA 2OHYA 2O7EA 1EB4A 1TJUA 1TJVA 1W27A 4BAAA 1VDKA 1I0AA 5HW2A 2O6YA 1GK2A 4NLEA 1TJWA 4CQ5A 1HY1A 5F91A 3R6VA 4C5UA 4FFXA 2QGAB 1Q5NA 3QBPA 2PTRA 2QVEA 4APBA 2YIIA 4C6GA 3R6QA 3E04A 2NYNA 5F92A 4C5SA 1JSWA 3RRPA 4NSLA 2HVGA 2O7BA 4FLCA 3UNVA 3C8TA 1Y2MA 2O7DA 1GK3A 2NYFA 5EYTA 3BHGA 2RJRA 1U16A 3NZ4A 3R6YA 4EEIA 4C5RA 1T6JA 2J91A 1HY0A 4V2QA 1TJ7A 1YFMA 1C3CA 1U15A 1FURA 4BABA 4ADLA 4EFCA 2FUSA 2VD6A 3GTDA 5D6BA 3NO9A 3KDYA 3OCFA 4HGVA 1C3UA 1AUWA 2RJSA 3TV2A 4APAA 1DOFA 4MX2A 2O7FA 3RD8A 1YFEA 1B8FA 1YISA 2E9FA 1K7WA 2PTSA 3OCEA 1RE5A 1XWOA 2X75A 1GKMA 1FUOA 4ADMA 1KQ7A 1K62A 1FUPA 2PTQA 3CZOA 2PFMA 1T6PA 2O78A 1DCNA 3KDZA 4V2RA 1J3UA 1GKJA 5EYVA
chains in the Genus database with same CATH superfamily
2JAUA 3GZHA 1FUQA 2D28C 2OHYA 2O7EA 5H8WA 5M0IA 1EB4A 1XMDA 1TJUA 1TJVA 1Z4QA 1W27A 1Q91A 4IQJM 4BAAA 1VDKA 1I0AA 5HW2A 2O6YA 1GK2A 4NLEA 4MWOA 1TJWA 4CQ5A 2RCNA 1HY1A 5F91A 3R6VA 1Z4PX 4C5UA 2JAWA 2FELA 4FFXA 4YIHA 2QGAB 1Q5NA 3QBPA 2PTRA 2QVEA 4APBA 2YIIA 4C6GA 3R6QA 3E04A 4A15A 2NYNA 5F92A 2D27A 4C5SA 1JSWA 3F4TA 4E88A 3RRPA 4NSLA 2HVGA 2VSFA 2O7BA 4FLCA 3UNVA 3C8TA 1Y2MA 2O7DA 1GK3A 2NYFA 5EYTA 2I7DA 3BHGA 2RJRA 1U16A 1Z4KA 3NZ4A 1Z4JA 2YV5A 5M0JA 3R6YA 3F4SA 4EEIA 4C5RA 3CRVA 1T6JA 2J91A 1HY0A 4V2QA 1TJ7A 1YFMA 1C3CA 1U15A 1FURA 3F4RA 4L6CA 4BABA 4ADLA 4EFCA 3U13A 1Z4MA 2FUSA 1T9HA 2VD6A 1XLYA 3CRW1 3GTDA 2JARA 1U0LA 5D6BA 3NO9A 3KDYA 3OCFA 4HGVA 1C3UA 1AUWA 2RJSA 3TV2A 4APAA 1Z4LA 1DOFA 4MX2A 2O7FA 3RD8A 1YFEA 2JAOA 3U19A 1B8FA 1YISA 2E9FA 4L57A 1IW7D 1K7WA 3OCEA 2PTSA 1RE5A 1XWOA 1XL7A 2X75A 1GKMA 1FUOA 4ADMA 3BWVA 1KQ7A 1K62A 1FUPA 1MH9A 2PTQA 3CZOA 1Z4IA 2PFMA 1XMCA 1T6PA 1XL8A 1DCNA 2O78A 2FENA 4WNLA 3KDZA 2VL7A 1J3UA 4V2RA 4L6AA 3CI0K 1GKJA 4MUMA 4YIKA 1Q92A 4NFLA 5EYVA
chains in the Genus database with same CATH topology
3GZHA 1FUQA 2OHYA 2O7EA 1EB4A 1TJUA 1TJVA 1W27A 4BAAA 1VDKA 1I0AA 5HW2A 2O6YA 1GK2A 4NLEA 1TJWA 4CQ5A 1HY1A 5F91A 3R6VA 4C5UA 4FFXA 2QGAB 1Q5NA 3QBPA 2PTRA 2QVEA 4APBA 2YIIA 4C6GA 3R6QA 3E04A 2NYNA 5F92A 4C5SA 1JSWA 3RRPA 4NSLA 2HVGA 2O7BA 4FLCA 3UNVA 3C8TA 1Y2MA 2O7DA 1GK3A 2NYFA 5EYTA 3BHGA 2RJRA 1U16A 3NZ4A 3R6YA 4EEIA 4C5RA 1T6JA 2J91A 1HY0A 4V2QA 1TJ7A 1YFMA 1C3CA 1U15A 1FURA 4BABA 4ADLA 4EFCA 2FUSA 2VD6A 3GTDA 5D6BA 3NO9A 3KDYA 3OCFA 4HGVA 1C3UA 1AUWA 2RJSA 3TV2A 4APAA 1DOFA 4MX2A 2O7FA 3RD8A 1YFEA 1B8FA 1YISA 2E9FA 1K7WA 2PTSA 3OCEA 1RE5A 1XWOA 2X75A 1GKMA 1FUOA 4ADMA 1KQ7A 1K62A 1FUPA 2PTQA 3CZOA 2PFMA 1T6PA 2O78A 1DCNA 3KDZA 4V2RA 1J3UA 1GKJA 5EYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZH A;  1FUQ A;  2OHY A;  2O7E A;  1EB4 A;  1TJU A;  1TJV A;  1W27 A;  4BAA A;  1VDK A;  1I0A A;  5HW2 A;  2O6Y A;  1GK2 A;  4NLE A;  1TJW A;  4CQ5 A;  1HY1 A;  5F91 A;  3R6V A;  4C5U A;  4FFX A;  2QGA B;  1Q5N A;  3QBP A;  2PTR A;  2QVE A;  4APB A;  2YII A;  4C6G A;  3R6Q A;  3E04 A;  2NYN A;  5F92 A;  4C5S A;  1JSW A;  3RRP A;  4NSL A;  2HVG A;  2O7B A;  4FLC A;  3UNV A;  3C8T A;  1Y2M A;  2O7D A;  1GK3 A;  2NYF A;  5EYT A;  3BHG A;  2RJR A;  1U16 A;  3NZ4 A;  3R6Y A;  4EEI A;  4C5R A;  1T6J A;  2J91 A;  1HY0 A;  4V2Q A;  1TJ7 A;  1YFM A;  1C3C A;  1U15 A;  1FUR A;  4BAB A;  4ADL A;  4EFC A;  2FUS A;  2VD6 A;  3GTD A;  5D6B A;  3NO9 A;  3KDY A;  3OCF A;  4HGV A;  1C3U A;  1AUW A;  2RJS A;  3TV2 A;  4APA A;  1DOF A;  4MX2 A;  2O7F A;  3RD8 A;  1YFE A;  1B8F A;  1YIS A;  2E9F A;  1K7W A;  2PTS A;  3OCE A;  1RE5 A;  1XWO A;  2X75 A;  1GKM A;  1FUO A;  4ADM A;  1KQ7 A;  1K62 A;  1FUP A;  2PTQ A;  3CZO A;  2PFM A;  1T6P A;  2O78 A;  1DCN A;  3KDZ A;  4V2R A;  1J3U A;  1GKJ A;  5EYV A; 
#chains in the Genus database with same CATH topology
 2JAU A;  3GZH A;  1FUQ A;  2D28 C;  2OHY A;  2O7E A;  5H8W A;  5M0I A;  1EB4 A;  1XMD A;  1TJU A;  1TJV A;  1Z4Q A;  1W27 A;  1Q91 A;  4IQJ M;  4BAA A;  1VDK A;  1I0A A;  5HW2 A;  2O6Y A;  1GK2 A;  4NLE A;  4MWO A;  1TJW A;  4CQ5 A;  2RCN A;  1HY1 A;  5F91 A;  3R6V A;  1Z4P X;  4C5U A;  2JAW A;  2FEL A;  4FFX A;  4YIH A;  2QGA B;  1Q5N A;  3QBP A;  2PTR A;  2QVE A;  4APB A;  2YII A;  4C6G A;  3R6Q A;  3E04 A;  4A15 A;  2NYN A;  5F92 A;  2D27 A;  4C5S A;  1JSW A;  3F4T A;  4E88 A;  3RRP A;  4NSL A;  2HVG A;  2VSF A;  2O7B A;  4FLC A;  3UNV A;  3C8T A;  1Y2M A;  2O7D A;  1GK3 A;  2NYF A;  5EYT A;  2I7D A;  3BHG A;  2RJR A;  1U16 A;  1Z4K A;  3NZ4 A;  1Z4J A;  2YV5 A;  5M0J A;  3R6Y A;  3F4S A;  4EEI A;  4C5R A;  3CRV A;  1T6J A;  2J91 A;  1HY0 A;  4V2Q A;  1TJ7 A;  1YFM A;  1C3C A;  1U15 A;  1FUR A;  3F4R A;  4L6C A;  4BAB A;  4ADL A;  4EFC A;  3U13 A;  1Z4M A;  2FUS A;  1T9H A;  2VD6 A;  1XLY A;  3CRW 1;  3GTD A;  2JAR A;  1U0L A;  5D6B A;  3NO9 A;  3KDY A;  3OCF A;  4HGV A;  1C3U A;  1AUW A;  2RJS A;  3TV2 A;  4APA A;  1Z4L A;  1DOF A;  4MX2 A;  2O7F A;  3RD8 A;  1YFE A;  2JAO A;  3U19 A;  1B8F A;  1YIS A;  2E9F A;  4L57 A;  1IW7 D;  1K7W A;  3OCE A;  2PTS A;  1RE5 A;  1XWO A;  1XL7 A;  2X75 A;  1GKM A;  1FUO A;  4ADM A;  3BWV A;  1KQ7 A;  1K62 A;  1FUP A;  1MH9 A;  2PTQ A;  3CZO A;  1Z4I A;  2PFM A;  1XMC A;  1T6P A;  1XL8 A;  1DCN A;  2O78 A;  2FEN A;  4WNL A;  3KDZ A;  2VL7 A;  1J3U A;  4V2R A;  4L6A A;  3CI0 K;  1GKJ A;  4MUM A;  4YIK A;  1Q92 A;  4NFL A;  5EYV A; 
#chains in the Genus database with same CATH homology
 3GZH A;  1FUQ A;  2OHY A;  2O7E A;  1EB4 A;  1TJU A;  1TJV A;  1W27 A;  4BAA A;  1VDK A;  1I0A A;  5HW2 A;  2O6Y A;  1GK2 A;  4NLE A;  1TJW A;  4CQ5 A;  1HY1 A;  5F91 A;  3R6V A;  4C5U A;  4FFX A;  2QGA B;  1Q5N A;  3QBP A;  2PTR A;  2QVE A;  4APB A;  2YII A;  4C6G A;  3R6Q A;  3E04 A;  2NYN A;  5F92 A;  4C5S A;  1JSW A;  3RRP A;  4NSL A;  2HVG A;  2O7B A;  4FLC A;  3UNV A;  3C8T A;  1Y2M A;  2O7D A;  1GK3 A;  2NYF A;  5EYT A;  3BHG A;  2RJR A;  1U16 A;  3NZ4 A;  3R6Y A;  4EEI A;  4C5R A;  1T6J A;  2J91 A;  1HY0 A;  4V2Q A;  1TJ7 A;  1YFM A;  1C3C A;  1U15 A;  1FUR A;  4BAB A;  4ADL A;  4EFC A;  2FUS A;  2VD6 A;  3GTD A;  5D6B A;  3NO9 A;  3KDY A;  3OCF A;  4HGV A;  1C3U A;  1AUW A;  2RJS A;  3TV2 A;  4APA A;  1DOF A;  4MX2 A;  2O7F A;  3RD8 A;  1YFE A;  1B8F A;  1YIS A;  2E9F A;  1K7W A;  2PTS A;  3OCE A;  1RE5 A;  1XWO A;  2X75 A;  1GKM A;  1FUO A;  4ADM A;  1KQ7 A;  1K62 A;  1FUP A;  2PTQ A;  3CZO A;  2PFM A;  1T6P A;  2O78 A;  1DCN A;  3KDZ A;  4V2R A;  1J3U A;  1GKJ A;  5EYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...