3GZHA

Crystal structure of phosphate-bound adenylosuccinate lyase from e. coli
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
469
structure length
469
Chain Sequence
YDIPTTENLYFQGSELSSLTAVSPVDGRYGDKVSALRGIFSEYGLLKFRVQVEVRWLQKLAAHAAIKEVPAFAADAIGYLDAIVANFSEEDAARIKTIERTTNHDVKAVEYFLKEKVAEIPELHAVSEFIHFACTSEDINNLSHALMLKTARDEVILPYWRQLIDGIKDLAVQYRDIPLLSRTHGQPATPSTIGKEMANVAYRMERQYRQLNQVEILGKINGAVGNYNAHIAAYPEVDWHQFSEEFVTSLGIQWNPYTTQIEPHDYIAELFDCVARFNTILIDFDRDVWGYIALNHFKQKTIAGEIGSSTMPHKVNPIDFENSEGNLGLSNAVLQHLASKLPVSRWQRDLTDSTVLRNLGVGIGYALIAYQSTLKGVSKLEVNRDHLLDELDHNWEVLAEPIQTVMRRYGIEKPYEKLKELTRGKRVDAEGMKQFIDGLALPEEEKARLKAMTPANYIGRAITMVDELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of phosphate-bound Escherichia coli adenylosuccinate lyase identifies His171 as a catalytic acid.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Adenylosuccinate lyase
total genus 184
structure length 469
sequence length 469
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF08328 ASL_C Adenylosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 3gzhA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 3gzhA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 3gzhA02
1GKMA 3BHGA 2X75A 3QBPA 1TJUA 2O7DA 1EB4A 2RJSA 3R6VA 1HY0A 1K62A 5HW2A 4MX2A 3R6YA 2QVEA 3RRPA 3NZ4A 1FUOA 1TJVA 2J91A 1W27A 2E9FA 2FUSA 1DOFA 4EFCA 2NYNA 2YIIA 2PTQA 3OCFA 1FUPA 4BABA 1VDKA 1TJWA 2PFMA 1Y2MA 2RJRA 4EEIA 1C3CA 2VD6A 1YFMA 5F92A 2O7FA 1GKJA 4FLCA 4HGVA 3TV2A 4C5SA 1J3UA 4C6GA 1YFEA 1RE5A 3RD8A 5EYTA 1FURA 4C5UA 1U15A 3UNVA 1TJ7A 1XWOA 4V2RA 4APAA 2NYFA 1Q5NA 3KDYA 2O78A 1HY1A 4ADLA 5D6BA 2PTRA 3C8TA 1KQ7A 3OCEA 2O7EA 2QGAB 4APBA 2OHYA 4NSLA 5EYVA 5F91A 1AUWA 2O6YA 1K7WA 4V2QA 4BAAA 1GK3A 4FFXA 3GZHA 3R6QA 3E04A 1YISA 2O7BA 1T6JA 1GK2A 1I0AA 4NLEA 3CZOA 1U16A 1B8FA 3GTDA 1C3UA 4C5RA 4CQ5A 1JSWA 4ADMA 1FUQA 2PTSA 3NO9A 1T6PA 2HVGA 1DCNA 3KDZA
chains in the Genus database with same CATH superfamily
1MH9A 4YIKA 4MUMA 1GKMA 3BHGA 2X75A 3QBPA 1TJUA 4L57A 2O7DA 1EB4A 2RJSA 3R6VA 1HY0A 1K62A 5HW2A 4MX2A 1XMDA 3R6YA 1Z4QA 2QVEA 3CRW1 3RRPA 2VL7A 1FUOA 3NZ4A 3F4TA 3U13A 1TJVA 2J91A 3CRVA 1W27A 2E9FA 2FUSA 1DOFA 1XLYA 4EFCA 2NYNA 2YIIA 2PTQA 3OCFA 1FUPA 4BABA 5H8WA 4WNLA 1VDKA 1TJWA 2PFMA 1Y2MA 1U0LA 2RJRA 4EEIA 1C3CA 4E88A 2VD6A 1YFMA 1Z4LA 2JAUA 5F92A 2O7FA 1T9HA 2I7DA 2VSFA 1GKJA 2JAWA 4FLCA 4HGVA 3TV2A 1Z4MA 4YIHA 4C5SA 1J3UA 3F4SA 1Z4IA 1YFEA 4C6GA 1RE5A 1Q91A 1Z4PX 3RD8A 1Z4KA 1XL8A 5EYTA 1FURA 1Z4JA 4L6AA 4C5UA 1XL7A 3CI0K 1U15A 3UNVA 1TJ7A 5M0IA 1XWOA 4V2RA 4APAA 2NYFA 1Q5NA 3KDYA 2O78A 5M0JA 1HY1A 4L6CA 4ADLA 4MWOA 5D6BA 2PTRA 3C8TA 1KQ7A 2JAOA 3OCEA 1XMCA 2O7EA 2D27A 2QGAB 4APBA 2OHYA 2FENA 4NSLA 1IW7D 5EYVA 2YV5A 5F91A 1AUWA 2O6YA 1K7WA 4V2QA 4BAAA 2D28C 2JARA 1GK3A 4FFXA 3GZHA 3R6QA 3E04A 1YISA 2O7BA 4A15A 1T6JA 1GK2A 1I0AA 4NLEA 3CZOA 2FELA 1U16A 1B8FA 3GTDA 1C3UA 4C5RA 4CQ5A 2RCNA 1JSWA 4IQJM 4ADMA 1FUQA 2PTSA 3NO9A 4NFLA 3U19A 1T6PA 2HVGA 3F4RA 1DCNA 1Q92A 3KDZA 3BWVA
chains in the Genus database with same CATH topology
1GKMA 3BHGA 2X75A 3QBPA 1TJUA 2O7DA 1EB4A 2RJSA 3R6VA 1HY0A 1K62A 5HW2A 4MX2A 3R6YA 2QVEA 3RRPA 3NZ4A 1FUOA 1TJVA 2J91A 1W27A 2E9FA 2FUSA 1DOFA 4EFCA 2NYNA 2YIIA 2PTQA 3OCFA 1FUPA 4BABA 1VDKA 1TJWA 2PFMA 1Y2MA 2RJRA 4EEIA 1C3CA 2VD6A 1YFMA 5F92A 2O7FA 1GKJA 4FLCA 4HGVA 3TV2A 4C5SA 1J3UA 4C6GA 1YFEA 1RE5A 3RD8A 5EYTA 1FURA 4C5UA 1U15A 3UNVA 1TJ7A 1XWOA 4V2RA 4APAA 2NYFA 1Q5NA 3KDYA 2O78A 1HY1A 4ADLA 5D6BA 2PTRA 3C8TA 1KQ7A 3OCEA 2O7EA 2QGAB 4APBA 2OHYA 4NSLA 5EYVA 5F91A 1AUWA 2O6YA 1K7WA 4V2QA 4BAAA 1GK3A 4FFXA 3GZHA 3R6QA 3E04A 1YISA 2O7BA 1T6JA 1GK2A 1I0AA 4NLEA 3CZOA 1U16A 1B8FA 3GTDA 1C3UA 4C5RA 4CQ5A 1JSWA 4ADMA 1FUQA 2PTSA 3NO9A 1T6PA 2HVGA 1DCNA 3KDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GKM A;  3BHG A;  2X75 A;  3QBP A;  1TJU A;  2O7D A;  1EB4 A;  2RJS A;  3R6V A;  1HY0 A;  1K62 A;  5HW2 A;  4MX2 A;  3R6Y A;  2QVE A;  3RRP A;  3NZ4 A;  1FUO A;  1TJV A;  2J91 A;  1W27 A;  2E9F A;  2FUS A;  1DOF A;  4EFC A;  2NYN A;  2YII A;  2PTQ A;  3OCF A;  1FUP A;  4BAB A;  1VDK A;  1TJW A;  2PFM A;  1Y2M A;  2RJR A;  4EEI A;  1C3C A;  2VD6 A;  1YFM A;  5F92 A;  2O7F A;  1GKJ A;  4FLC A;  4HGV A;  3TV2 A;  4C5S A;  1J3U A;  4C6G A;  1YFE A;  1RE5 A;  3RD8 A;  5EYT A;  1FUR A;  4C5U A;  1U15 A;  3UNV A;  1TJ7 A;  1XWO A;  4V2R A;  4APA A;  2NYF A;  1Q5N A;  3KDY A;  2O78 A;  1HY1 A;  4ADL A;  5D6B A;  2PTR A;  3C8T A;  1KQ7 A;  3OCE A;  2O7E A;  2QGA B;  4APB A;  2OHY A;  4NSL A;  5EYV A;  5F91 A;  1AUW A;  2O6Y A;  1K7W A;  4V2Q A;  4BAA A;  1GK3 A;  4FFX A;  3GZH A;  3R6Q A;  3E04 A;  1YIS A;  2O7B A;  1T6J A;  1GK2 A;  1I0A A;  4NLE A;  3CZO A;  1U16 A;  1B8F A;  3GTD A;  1C3U A;  4C5R A;  4CQ5 A;  1JSW A;  4ADM A;  1FUQ A;  2PTS A;  3NO9 A;  1T6P A;  2HVG A;  1DCN A;  3KDZ A; 
#chains in the Genus database with same CATH topology
 1MH9 A;  4YIK A;  4MUM A;  1GKM A;  3BHG A;  2X75 A;  3QBP A;  1TJU A;  4L57 A;  2O7D A;  1EB4 A;  2RJS A;  3R6V A;  1HY0 A;  1K62 A;  5HW2 A;  4MX2 A;  1XMD A;  3R6Y A;  1Z4Q A;  2QVE A;  3CRW 1;  3RRP A;  2VL7 A;  1FUO A;  3NZ4 A;  3F4T A;  3U13 A;  1TJV A;  2J91 A;  3CRV A;  1W27 A;  2E9F A;  2FUS A;  1DOF A;  1XLY A;  4EFC A;  2NYN A;  2YII A;  2PTQ A;  3OCF A;  1FUP A;  4BAB A;  5H8W A;  4WNL A;  1VDK A;  1TJW A;  2PFM A;  1Y2M A;  1U0L A;  2RJR A;  4EEI A;  1C3C A;  4E88 A;  2VD6 A;  1YFM A;  1Z4L A;  2JAU A;  5F92 A;  2O7F A;  1T9H A;  2I7D A;  2VSF A;  1GKJ A;  2JAW A;  4FLC A;  4HGV A;  3TV2 A;  1Z4M A;  4YIH A;  4C5S A;  1J3U A;  3F4S A;  1Z4I A;  1YFE A;  4C6G A;  1RE5 A;  1Q91 A;  1Z4P X;  3RD8 A;  1Z4K A;  1XL8 A;  5EYT A;  1FUR A;  1Z4J A;  4L6A A;  4C5U A;  1XL7 A;  3CI0 K;  1U15 A;  3UNV A;  1TJ7 A;  5M0I A;  1XWO A;  4V2R A;  4APA A;  2NYF A;  1Q5N A;  3KDY A;  2O78 A;  5M0J A;  1HY1 A;  4L6C A;  4ADL A;  4MWO A;  5D6B A;  2PTR A;  3C8T A;  1KQ7 A;  2JAO A;  3OCE A;  1XMC A;  2O7E A;  2D27 A;  2QGA B;  4APB A;  2OHY A;  2FEN A;  4NSL A;  1IW7 D;  5EYV A;  2YV5 A;  5F91 A;  1AUW A;  2O6Y A;  1K7W A;  4V2Q A;  4BAA A;  2D28 C;  2JAR A;  1GK3 A;  4FFX A;  3GZH A;  3R6Q A;  3E04 A;  1YIS A;  2O7B A;  4A15 A;  1T6J A;  1GK2 A;  1I0A A;  4NLE A;  3CZO A;  2FEL A;  1U16 A;  1B8F A;  3GTD A;  1C3U A;  4C5R A;  4CQ5 A;  2RCN A;  1JSW A;  4IQJ M;  4ADM A;  1FUQ A;  2PTS A;  3NO9 A;  4NFL A;  3U19 A;  1T6P A;  2HVG A;  3F4R A;  1DCN A;  1Q92 A;  3KDZ A;  3BWV A; 
#chains in the Genus database with same CATH homology
 1GKM A;  3BHG A;  2X75 A;  3QBP A;  1TJU A;  2O7D A;  1EB4 A;  2RJS A;  3R6V A;  1HY0 A;  1K62 A;  5HW2 A;  4MX2 A;  3R6Y A;  2QVE A;  3RRP A;  3NZ4 A;  1FUO A;  1TJV A;  2J91 A;  1W27 A;  2E9F A;  2FUS A;  1DOF A;  4EFC A;  2NYN A;  2YII A;  2PTQ A;  3OCF A;  1FUP A;  4BAB A;  1VDK A;  1TJW A;  2PFM A;  1Y2M A;  2RJR A;  4EEI A;  1C3C A;  2VD6 A;  1YFM A;  5F92 A;  2O7F A;  1GKJ A;  4FLC A;  4HGV A;  3TV2 A;  4C5S A;  1J3U A;  4C6G A;  1YFE A;  1RE5 A;  3RD8 A;  5EYT A;  1FUR A;  4C5U A;  1U15 A;  3UNV A;  1TJ7 A;  1XWO A;  4V2R A;  4APA A;  2NYF A;  1Q5N A;  3KDY A;  2O78 A;  1HY1 A;  4ADL A;  5D6B A;  2PTR A;  3C8T A;  1KQ7 A;  3OCE A;  2O7E A;  2QGA B;  4APB A;  2OHY A;  4NSL A;  5EYV A;  5F91 A;  1AUW A;  2O6Y A;  1K7W A;  4V2Q A;  4BAA A;  1GK3 A;  4FFX A;  3GZH A;  3R6Q A;  3E04 A;  1YIS A;  2O7B A;  1T6J A;  1GK2 A;  1I0A A;  4NLE A;  3CZO A;  1U16 A;  1B8F A;  3GTD A;  1C3U A;  4C5R A;  4CQ5 A;  1JSW A;  4ADM A;  1FUQ A;  2PTS A;  3NO9 A;  1T6P A;  2HVG A;  1DCN A;  3KDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...