3GZHA

Crystal structure of phosphate-bound adenylosuccinate lyase from e. coli
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
469
structure length
469
Chain Sequence
YDIPTTENLYFQGSELSSLTAVSPVDGRYGDKVSALRGIFSEYGLLKFRVQVEVRWLQKLAAHAAIKEVPAFAADAIGYLDAIVANFSEEDAARIKTIERTTNHDVKAVEYFLKEKVAEIPELHAVSEFIHFACTSEDINNLSHALMLKTARDEVILPYWRQLIDGIKDLAVQYRDIPLLSRTHGQPATPSTIGKEMANVAYRMERQYRQLNQVEILGKINGAVGNYNAHIAAYPEVDWHQFSEEFVTSLGIQWNPYTTQIEPHDYIAELFDCVARFNTILIDFDRDVWGYIALNHFKQKTIAGEIGSSTMPHKVNPIDFENSEGNLGLSNAVLQHLASKLPVSRWQRDLTDSTVLRNLGVGIGYALIAYQSTLKGVSKLEVNRDHLLDELDHNWEVLAEPIQTVMRRYGIEKPYEKLKELTRGKRVDAEGMKQFIDGLALPEEEKARLKAMTPANYIGRAITMVDELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylosuccinate lyase
publication title The structure of phosphate-bound Escherichia coli adenylosuccinate lyase identifies His171 as a catalytic acid.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 184
structure length 469
sequence length 469
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF08328 ASL_C Adenylosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 3gzhA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 3gzhA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 3gzhA02
4C5SA 2NYNA 2E9FA 3CZOA 1Y2MA 2J91A 1EB4A 1Q5NA 2PFMA 1GKMA 4V2QA 3NO9A 5F91A 1YFMA 4MX2A 4BABA 1FUQA 1C3UA 3C8TA 2HVGA 4FLCA 1FURA 4BAAA 2O7BA 3BHGA 4ADMA 4ADLA 2QGAB 1FUPA 2PTRA 2PTQA 1U16A 1U15A 2FUSA 3OCEA 2O7DA 1XWOA 1TJWA 1DOFA 1HY1A 3RD8A 1GKJA 1HY0A 1TJ7A 5F92A 2O7EA 4NSLA 3KDZA 1AUWA 2VD6A 1K7WA 3GTDA 2O6YA 2RJRA 2QVEA 1GK3A 1GK2A 2YIIA 4C5UA 1TJUA 1T6JA 1W27A 1TJVA 4CQ5A 4EFCA 1T6PA 4C6GA 1KQ7A 1DCNA 4HGVA 3TV2A 1VDKA 1C3CA 2X75A 2RJSA 2PTSA 3RRPA 1YISA 3R6YA 4NLEA 4V2RA 3QBPA 4APBA 4EEIA 3R6QA 3R6VA 4C5RA 3UNVA 3NZ4A 3GZHA 4FFXA 1JSWA 3OCFA 5EYVA 3E04A 2OHYA 1B8FA 1I0AA 5HW2A 2O78A 5EYTA 1J3UA 5D6BA 2NYFA 1RE5A 1YFEA 1FUOA 2O7FA 4APAA 3KDYA 1K62A
chains in the Genus database with same CATH superfamily
4C5SA 4L6AA 2NYNA 1Z4KA 2E9FA 4IQJM 1Y2MA 3CZOA 1XL8A 1Z4JA 2J91A 1EB4A 1Q5NA 2PFMA 1Z4LA 4E88A 1GKMA 4V2QA 3BWVA 3NO9A 1MH9A 5F91A 3U19A 1YFMA 4MX2A 4BABA 1FUQA 1C3UA 3C8TA 2HVGA 1IW7D 4FLCA 1FURA 4BAAA 2O7BA 3BHGA 4ADMA 4WNLA 4ADLA 3CRW1 2QGAB 2YV5A 1FUPA 2PTRA 3CRVA 2PTQA 2JAOA 2JAUA 1U16A 1XMCA 2FELA 2RCNA 1U15A 1XMDA 3CI0K 2FUSA 3OCEA 2O7DA 1Z4IA 1XWOA 1TJWA 1Z4QA 1DOFA 1HY1A 3RD8A 1GKJA 1HY0A 1TJ7A 5F92A 2O7EA 4NSLA 3KDZA 1AUWA 2D28C 2VD6A 1K7WA 4MWOA 3GTDA 1U0LA 2O6YA 2RJRA 2QVEA 1Q91A 1GK3A 1GK2A 2YIIA 4C5UA 1TJUA 1TJVA 1T6JA 1W27A 4CQ5A 2JARA 4EFCA 5M0IA 1T6PA 1XL7A 4C6GA 1KQ7A 1DCNA 4NFLA 1T9HA 4HGVA 3TV2A 3F4RA 1VDKA 3U13A 1C3CA 2D27A 2X75A 2RJSA 2FENA 2PTSA 3RRPA 2JAWA 1YISA 3R6YA 4NLEA 4V2RA 4YIKA 3QBPA 4APBA 4EEIA 3R6QA 3R6VA 4YIHA 4C5RA 5H8WA 3UNVA 3NZ4A 4A15A 3F4SA 3GZHA 4FFXA 4L6CA 1JSWA 3OCFA 5M0JA 5EYVA 4L57A 3E04A 1Z4MA 2OHYA 3F4TA 1B8FA 1I0AA 2I7DA 1Z4PX 4MUMA 5HW2A 2O78A 1XLYA 2VSFA 5EYTA 1J3UA 5D6BA 2NYFA 1RE5A 1YFEA 1Q92A 1FUOA 2O7FA 4APAA 3KDYA 1K62A 2VL7A
chains in the Genus database with same CATH topology
4C5SA 2NYNA 2E9FA 3CZOA 1Y2MA 2J91A 1EB4A 1Q5NA 2PFMA 1GKMA 4V2QA 3NO9A 5F91A 1YFMA 4MX2A 4BABA 1FUQA 1C3UA 3C8TA 2HVGA 4FLCA 1FURA 4BAAA 2O7BA 3BHGA 4ADMA 4ADLA 2QGAB 1FUPA 2PTRA 2PTQA 1U16A 1U15A 2FUSA 3OCEA 2O7DA 1XWOA 1TJWA 1DOFA 1HY1A 3RD8A 1GKJA 1HY0A 1TJ7A 5F92A 2O7EA 4NSLA 3KDZA 1AUWA 2VD6A 1K7WA 3GTDA 2O6YA 2RJRA 2QVEA 1GK3A 1GK2A 2YIIA 4C5UA 1TJUA 1T6JA 1W27A 1TJVA 4CQ5A 4EFCA 1T6PA 4C6GA 1KQ7A 1DCNA 4HGVA 3TV2A 1VDKA 1C3CA 2X75A 2RJSA 2PTSA 3RRPA 1YISA 3R6YA 4NLEA 4V2RA 3QBPA 4APBA 4EEIA 3R6QA 3R6VA 4C5RA 3UNVA 3NZ4A 3GZHA 4FFXA 1JSWA 3OCFA 5EYVA 3E04A 2OHYA 1B8FA 1I0AA 5HW2A 2O78A 5EYTA 1J3UA 5D6BA 2NYFA 1RE5A 1YFEA 1FUOA 2O7FA 4APAA 3KDYA 1K62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C5S A;  2NYN A;  2E9F A;  3CZO A;  1Y2M A;  2J91 A;  1EB4 A;  1Q5N A;  2PFM A;  1GKM A;  4V2Q A;  3NO9 A;  5F91 A;  1YFM A;  4MX2 A;  4BAB A;  1FUQ A;  1C3U A;  3C8T A;  2HVG A;  4FLC A;  1FUR A;  4BAA A;  2O7B A;  3BHG A;  4ADM A;  4ADL A;  2QGA B;  1FUP A;  2PTR A;  2PTQ A;  1U16 A;  1U15 A;  2FUS A;  3OCE A;  2O7D A;  1XWO A;  1TJW A;  1DOF A;  1HY1 A;  3RD8 A;  1GKJ A;  1HY0 A;  1TJ7 A;  5F92 A;  2O7E A;  4NSL A;  3KDZ A;  1AUW A;  2VD6 A;  1K7W A;  3GTD A;  2O6Y A;  2RJR A;  2QVE A;  1GK3 A;  1GK2 A;  2YII A;  4C5U A;  1TJU A;  1T6J A;  1W27 A;  1TJV A;  4CQ5 A;  4EFC A;  1T6P A;  4C6G A;  1KQ7 A;  1DCN A;  4HGV A;  3TV2 A;  1VDK A;  1C3C A;  2X75 A;  2RJS A;  2PTS A;  3RRP A;  1YIS A;  3R6Y A;  4NLE A;  4V2R A;  3QBP A;  4APB A;  4EEI A;  3R6Q A;  3R6V A;  4C5R A;  3UNV A;  3NZ4 A;  3GZH A;  4FFX A;  1JSW A;  3OCF A;  5EYV A;  3E04 A;  2OHY A;  1B8F A;  1I0A A;  5HW2 A;  2O78 A;  5EYT A;  1J3U A;  5D6B A;  2NYF A;  1RE5 A;  1YFE A;  1FUO A;  2O7F A;  4APA A;  3KDY A;  1K62 A; 
#chains in the Genus database with same CATH topology
 4C5S A;  4L6A A;  2NYN A;  1Z4K A;  2E9F A;  4IQJ M;  1Y2M A;  3CZO A;  1XL8 A;  1Z4J A;  2J91 A;  1EB4 A;  1Q5N A;  2PFM A;  1Z4L A;  4E88 A;  1GKM A;  4V2Q A;  3BWV A;  3NO9 A;  1MH9 A;  5F91 A;  3U19 A;  1YFM A;  4MX2 A;  4BAB A;  1FUQ A;  1C3U A;  3C8T A;  2HVG A;  1IW7 D;  4FLC A;  1FUR A;  4BAA A;  2O7B A;  3BHG A;  4ADM A;  4WNL A;  4ADL A;  3CRW 1;  2QGA B;  2YV5 A;  1FUP A;  2PTR A;  3CRV A;  2PTQ A;  2JAO A;  2JAU A;  1U16 A;  1XMC A;  2FEL A;  2RCN A;  1U15 A;  1XMD A;  3CI0 K;  2FUS A;  3OCE A;  2O7D A;  1Z4I A;  1XWO A;  1TJW A;  1Z4Q A;  1DOF A;  1HY1 A;  3RD8 A;  1GKJ A;  1HY0 A;  1TJ7 A;  5F92 A;  2O7E A;  4NSL A;  3KDZ A;  1AUW A;  2D28 C;  2VD6 A;  1K7W A;  4MWO A;  3GTD A;  1U0L A;  2O6Y A;  2RJR A;  2QVE A;  1Q91 A;  1GK3 A;  1GK2 A;  2YII A;  4C5U A;  1TJU A;  1TJV A;  1T6J A;  1W27 A;  4CQ5 A;  2JAR A;  4EFC A;  5M0I A;  1T6P A;  1XL7 A;  4C6G A;  1KQ7 A;  1DCN A;  4NFL A;  1T9H A;  4HGV A;  3TV2 A;  3F4R A;  1VDK A;  3U13 A;  1C3C A;  2D27 A;  2X75 A;  2RJS A;  2FEN A;  2PTS A;  3RRP A;  2JAW A;  1YIS A;  3R6Y A;  4NLE A;  4V2R A;  4YIK A;  3QBP A;  4APB A;  4EEI A;  3R6Q A;  3R6V A;  4YIH A;  4C5R A;  5H8W A;  3UNV A;  3NZ4 A;  4A15 A;  3F4S A;  3GZH A;  4FFX A;  4L6C A;  1JSW A;  3OCF A;  5M0J A;  5EYV A;  4L57 A;  3E04 A;  1Z4M A;  2OHY A;  3F4T A;  1B8F A;  1I0A A;  2I7D A;  1Z4P X;  4MUM A;  5HW2 A;  2O78 A;  1XLY A;  2VSF A;  5EYT A;  1J3U A;  5D6B A;  2NYF A;  1RE5 A;  1YFE A;  1Q92 A;  1FUO A;  2O7F A;  4APA A;  3KDY A;  1K62 A;  2VL7 A; 
#chains in the Genus database with same CATH homology
 4C5S A;  2NYN A;  2E9F A;  3CZO A;  1Y2M A;  2J91 A;  1EB4 A;  1Q5N A;  2PFM A;  1GKM A;  4V2Q A;  3NO9 A;  5F91 A;  1YFM A;  4MX2 A;  4BAB A;  1FUQ A;  1C3U A;  3C8T A;  2HVG A;  4FLC A;  1FUR A;  4BAA A;  2O7B A;  3BHG A;  4ADM A;  4ADL A;  2QGA B;  1FUP A;  2PTR A;  2PTQ A;  1U16 A;  1U15 A;  2FUS A;  3OCE A;  2O7D A;  1XWO A;  1TJW A;  1DOF A;  1HY1 A;  3RD8 A;  1GKJ A;  1HY0 A;  1TJ7 A;  5F92 A;  2O7E A;  4NSL A;  3KDZ A;  1AUW A;  2VD6 A;  1K7W A;  3GTD A;  2O6Y A;  2RJR A;  2QVE A;  1GK3 A;  1GK2 A;  2YII A;  4C5U A;  1TJU A;  1T6J A;  1W27 A;  1TJV A;  4CQ5 A;  4EFC A;  1T6P A;  4C6G A;  1KQ7 A;  1DCN A;  4HGV A;  3TV2 A;  1VDK A;  1C3C A;  2X75 A;  2RJS A;  2PTS A;  3RRP A;  1YIS A;  3R6Y A;  4NLE A;  4V2R A;  3QBP A;  4APB A;  4EEI A;  3R6Q A;  3R6V A;  4C5R A;  3UNV A;  3NZ4 A;  3GZH A;  4FFX A;  1JSW A;  3OCF A;  5EYV A;  3E04 A;  2OHY A;  1B8F A;  1I0A A;  5HW2 A;  2O78 A;  5EYT A;  1J3U A;  5D6B A;  2NYF A;  1RE5 A;  1YFE A;  1FUO A;  2O7F A;  4APA A;  3KDY A;  1K62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...