3GZHA

Crystal structure of phosphate-bound adenylosuccinate lyase from e. coli
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
469
structure length
469
Chain Sequence
YDIPTTENLYFQGSELSSLTAVSPVDGRYGDKVSALRGIFSEYGLLKFRVQVEVRWLQKLAAHAAIKEVPAFAADAIGYLDAIVANFSEEDAARIKTIERTTNHDVKAVEYFLKEKVAEIPELHAVSEFIHFACTSEDINNLSHALMLKTARDEVILPYWRQLIDGIKDLAVQYRDIPLLSRTHGQPATPSTIGKEMANVAYRMERQYRQLNQVEILGKINGAVGNYNAHIAAYPEVDWHQFSEEFVTSLGIQWNPYTTQIEPHDYIAELFDCVARFNTILIDFDRDVWGYIALNHFKQKTIAGEIGSSTMPHKVNPIDFENSEGNLGLSNAVLQHLASKLPVSRWQRDLTDSTVLRNLGVGIGYALIAYQSTLKGVSKLEVNRDHLLDELDHNWEVLAEPIQTVMRRYGIEKPYEKLKELTRGKRVDAEGMKQFIDGLALPEEEKARLKAMTPANYIGRAITMVDELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Adenylosuccinate lyase
publication title The structure of phosphate-bound Escherichia coli adenylosuccinate lyase identifies His171 as a catalytic acid.
pubmed doi rcsb
source organism Escherichia coli
total genus 184
structure length 469
sequence length 469
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF08328 ASL_C Adenylosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 3gzhA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 3gzhA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 3gzhA02
2PTRA 3NZ4A 1GKMA 2J91A 4C5SA 5D6BA 1K7WA 3GTDA 1GKJA 1GK2A 1HY1A 1XWOA 2O7DA 4EFCA 1FURA 3RRPA 3TV2A 1RE5A 1JSWA 1HY0A 4EEIA 1T6JA 3CZOA 2QVEA 1U16A 4APBA 2PFMA 5HW2A 4C6GA 3E04A 1YISA 3OCFA 4FFXA 1DOFA 4BABA 2NYFA 2RJRA 2FUSA 1C3UA 2HVGA 4MX2A 1TJVA 1VDKA 1TJUA 3R6YA 4V2QA 1TJ7A 3KDYA 3UNVA 3R6VA 2O78A 4NLEA 4BAAA 1W27A 4HGVA 1U15A 4C5RA 2X75A 2O6YA 4FLCA 2RJSA 1C3CA 1DCNA 4ADMA 4ADLA 5F91A 1EB4A 2YIIA 2O7EA 1FUQA 3RD8A 2NYNA 1T6PA 4V2RA 1B8FA 1Y2MA 1K62A 1I0AA 3C8TA 3OCEA 2O7BA 4APAA 3R6QA 2E9FA 3BHGA 3KDZA 2VD6A 1KQ7A 1TJWA 3QBPA 1J3UA 1FUOA 2OHYA 2PTQA 1GK3A 1YFMA 4NSLA 1YFEA 5F92A 5EYTA 2QGAB 3GZHA 3NO9A 2O7FA 2PTSA 4CQ5A 5EYVA 1AUWA 1FUPA 4C5UA 1Q5NA
chains in the Genus database with same CATH superfamily
2PTRA 2JAUA 3NZ4A 1Z4IA 1GKMA 2J91A 4C5SA 2D28C 2FENA 3CI0K 5D6BA 1XL7A 2RCNA 1K7WA 3GTDA 1GKJA 1GK2A 1Z4PX 3F4SA 1HY1A 1T9HA 1XWOA 4E88A 1U0LA 2O7DA 4EFCA 1FURA 4NFLA 3RRPA 1RE5A 3TV2A 1XMCA 1IW7D 1JSWA 1HY0A 4MWOA 4EEIA 1T6JA 3CZOA 2QVEA 1U16A 4APBA 2PFMA 5HW2A 4C6GA 3E04A 3OCFA 1YISA 4FFXA 1DOFA 1Q92A 4BABA 2YV5A 2NYFA 1MH9A 2D27A 2RJRA 2VSFA 2FUSA 1C3UA 2HVGA 4MX2A 1TJVA 1VDKA 1TJUA 3R6YA 4V2QA 1TJ7A 3KDYA 3UNVA 3R6VA 2FELA 2O78A 4NLEA 4BAAA 1W27A 3BWVA 4HGVA 3F4TA 1Z4MA 1U15A 4C5RA 2X75A 2O6YA 4A15A 2VL7A 4WNLA 4FLCA 2RJSA 1C3CA 1DCNA 4L6CA 4ADMA 4ADLA 5F91A 1EB4A 2YIIA 3F4RA 2O7EA 4YIHA 1FUQA 1XLYA 3RD8A 2NYNA 1T6PA 3U13A 4V2RA 1B8FA 1Y2MA 1K62A 1I0AA 3C8TA 3OCEA 2O7BA 4YIKA 2JAOA 4APAA 3R6QA 2E9FA 3BHGA 3KDZA 3U19A 4L57A 4MUMA 3CRW1 1Z4QA 2I7DA 2VD6A 1KQ7A 1TJWA 1Z4JA 3QBPA 1J3UA 1FUOA 2OHYA 1XMDA 2PTQA 1GK3A 1YFMA 2JARA 4NSLA 1YFEA 5F92A 5EYTA 2QGAB 3GZHA 1XL8A 3NO9A 4IQJM 2O7FA 5M0JA 2PTSA 2JAWA 5H8WA 4CQ5A 4L6AA 1Z4KA 3CRVA 5EYVA 1Z4LA 1Q91A 1AUWA 1FUPA 4C5UA 5M0IA 1Q5NA
chains in the Genus database with same CATH topology
2PTRA 3NZ4A 1GKMA 2J91A 4C5SA 5D6BA 1K7WA 3GTDA 1GKJA 1GK2A 1HY1A 1XWOA 2O7DA 4EFCA 1FURA 3RRPA 3TV2A 1RE5A 1JSWA 1HY0A 4EEIA 1T6JA 3CZOA 2QVEA 1U16A 4APBA 2PFMA 5HW2A 4C6GA 3E04A 1YISA 3OCFA 4FFXA 1DOFA 4BABA 2NYFA 2RJRA 2FUSA 1C3UA 2HVGA 4MX2A 1TJVA 1VDKA 1TJUA 3R6YA 4V2QA 1TJ7A 3KDYA 3UNVA 3R6VA 2O78A 4NLEA 4BAAA 1W27A 4HGVA 1U15A 4C5RA 2X75A 2O6YA 4FLCA 2RJSA 1C3CA 1DCNA 4ADMA 4ADLA 5F91A 1EB4A 2YIIA 2O7EA 1FUQA 3RD8A 2NYNA 1T6PA 4V2RA 1B8FA 1Y2MA 1K62A 1I0AA 3C8TA 3OCEA 2O7BA 4APAA 3R6QA 2E9FA 3BHGA 3KDZA 2VD6A 1KQ7A 1TJWA 3QBPA 1J3UA 1FUOA 2OHYA 2PTQA 1GK3A 1YFMA 4NSLA 1YFEA 5F92A 5EYTA 2QGAB 3GZHA 3NO9A 2O7FA 2PTSA 4CQ5A 5EYVA 1AUWA 1FUPA 4C5UA 1Q5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PTR A;  3NZ4 A;  1GKM A;  2J91 A;  4C5S A;  5D6B A;  1K7W A;  3GTD A;  1GKJ A;  1GK2 A;  1HY1 A;  1XWO A;  2O7D A;  4EFC A;  1FUR A;  3RRP A;  3TV2 A;  1RE5 A;  1JSW A;  1HY0 A;  4EEI A;  1T6J A;  3CZO A;  2QVE A;  1U16 A;  4APB A;  2PFM A;  5HW2 A;  4C6G A;  3E04 A;  1YIS A;  3OCF A;  4FFX A;  1DOF A;  4BAB A;  2NYF A;  2RJR A;  2FUS A;  1C3U A;  2HVG A;  4MX2 A;  1TJV A;  1VDK A;  1TJU A;  3R6Y A;  4V2Q A;  1TJ7 A;  3KDY A;  3UNV A;  3R6V A;  2O78 A;  4NLE A;  4BAA A;  1W27 A;  4HGV A;  1U15 A;  4C5R A;  2X75 A;  2O6Y A;  4FLC A;  2RJS A;  1C3C A;  1DCN A;  4ADM A;  4ADL A;  5F91 A;  1EB4 A;  2YII A;  2O7E A;  1FUQ A;  3RD8 A;  2NYN A;  1T6P A;  4V2R A;  1B8F A;  1Y2M A;  1K62 A;  1I0A A;  3C8T A;  3OCE A;  2O7B A;  4APA A;  3R6Q A;  2E9F A;  3BHG A;  3KDZ A;  2VD6 A;  1KQ7 A;  1TJW A;  3QBP A;  1J3U A;  1FUO A;  2OHY A;  2PTQ A;  1GK3 A;  1YFM A;  4NSL A;  1YFE A;  5F92 A;  5EYT A;  2QGA B;  3GZH A;  3NO9 A;  2O7F A;  2PTS A;  4CQ5 A;  5EYV A;  1AUW A;  1FUP A;  4C5U A;  1Q5N A; 
#chains in the Genus database with same CATH topology
 2PTR A;  2JAU A;  3NZ4 A;  1Z4I A;  1GKM A;  2J91 A;  4C5S A;  2D28 C;  2FEN A;  3CI0 K;  5D6B A;  1XL7 A;  2RCN A;  1K7W A;  3GTD A;  1GKJ A;  1GK2 A;  1Z4P X;  3F4S A;  1HY1 A;  1T9H A;  1XWO A;  4E88 A;  1U0L A;  2O7D A;  4EFC A;  1FUR A;  4NFL A;  3RRP A;  1RE5 A;  3TV2 A;  1XMC A;  1IW7 D;  1JSW A;  1HY0 A;  4MWO A;  4EEI A;  1T6J A;  3CZO A;  2QVE A;  1U16 A;  4APB A;  2PFM A;  5HW2 A;  4C6G A;  3E04 A;  3OCF A;  1YIS A;  4FFX A;  1DOF A;  1Q92 A;  4BAB A;  2YV5 A;  2NYF A;  1MH9 A;  2D27 A;  2RJR A;  2VSF A;  2FUS A;  1C3U A;  2HVG A;  4MX2 A;  1TJV A;  1VDK A;  1TJU A;  3R6Y A;  4V2Q A;  1TJ7 A;  3KDY A;  3UNV A;  3R6V A;  2FEL A;  2O78 A;  4NLE A;  4BAA A;  1W27 A;  3BWV A;  4HGV A;  3F4T A;  1Z4M A;  1U15 A;  4C5R A;  2X75 A;  2O6Y A;  4A15 A;  2VL7 A;  4WNL A;  4FLC A;  2RJS A;  1C3C A;  1DCN A;  4L6C A;  4ADM A;  4ADL A;  5F91 A;  1EB4 A;  2YII A;  3F4R A;  2O7E A;  4YIH A;  1FUQ A;  1XLY A;  3RD8 A;  2NYN A;  1T6P A;  3U13 A;  4V2R A;  1B8F A;  1Y2M A;  1K62 A;  1I0A A;  3C8T A;  3OCE A;  2O7B A;  4YIK A;  2JAO A;  4APA A;  3R6Q A;  2E9F A;  3BHG A;  3KDZ A;  3U19 A;  4L57 A;  4MUM A;  3CRW 1;  1Z4Q A;  2I7D A;  2VD6 A;  1KQ7 A;  1TJW A;  1Z4J A;  3QBP A;  1J3U A;  1FUO A;  2OHY A;  1XMD A;  2PTQ A;  1GK3 A;  1YFM A;  2JAR A;  4NSL A;  1YFE A;  5F92 A;  5EYT A;  2QGA B;  3GZH A;  1XL8 A;  3NO9 A;  4IQJ M;  2O7F A;  5M0J A;  2PTS A;  2JAW A;  5H8W A;  4CQ5 A;  4L6A A;  1Z4K A;  3CRV A;  5EYV A;  1Z4L A;  1Q91 A;  1AUW A;  1FUP A;  4C5U A;  5M0I A;  1Q5N A; 
#chains in the Genus database with same CATH homology
 2PTR A;  3NZ4 A;  1GKM A;  2J91 A;  4C5S A;  5D6B A;  1K7W A;  3GTD A;  1GKJ A;  1GK2 A;  1HY1 A;  1XWO A;  2O7D A;  4EFC A;  1FUR A;  3RRP A;  3TV2 A;  1RE5 A;  1JSW A;  1HY0 A;  4EEI A;  1T6J A;  3CZO A;  2QVE A;  1U16 A;  4APB A;  2PFM A;  5HW2 A;  4C6G A;  3E04 A;  1YIS A;  3OCF A;  4FFX A;  1DOF A;  4BAB A;  2NYF A;  2RJR A;  2FUS A;  1C3U A;  2HVG A;  4MX2 A;  1TJV A;  1VDK A;  1TJU A;  3R6Y A;  4V2Q A;  1TJ7 A;  3KDY A;  3UNV A;  3R6V A;  2O78 A;  4NLE A;  4BAA A;  1W27 A;  4HGV A;  1U15 A;  4C5R A;  2X75 A;  2O6Y A;  4FLC A;  2RJS A;  1C3C A;  1DCN A;  4ADM A;  4ADL A;  5F91 A;  1EB4 A;  2YII A;  2O7E A;  1FUQ A;  3RD8 A;  2NYN A;  1T6P A;  4V2R A;  1B8F A;  1Y2M A;  1K62 A;  1I0A A;  3C8T A;  3OCE A;  2O7B A;  4APA A;  3R6Q A;  2E9F A;  3BHG A;  3KDZ A;  2VD6 A;  1KQ7 A;  1TJW A;  3QBP A;  1J3U A;  1FUO A;  2OHY A;  2PTQ A;  1GK3 A;  1YFM A;  4NSL A;  1YFE A;  5F92 A;  5EYT A;  2QGA B;  3GZH A;  3NO9 A;  2O7F A;  2PTS A;  4CQ5 A;  5EYV A;  1AUW A;  1FUP A;  4C5U A;  1Q5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...