3GZHA

Crystal structure of phosphate-bound adenylosuccinate lyase from e. coli
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
469
structure length
469
Chain Sequence
b'YDIPTTENLYFQGSELSSLTAVSPVDGRYGDKVSALRGIFSEYGLLKFRVQVEVRWLQKLAAHAAIKEVPAFAADAIGYLDAIVANFSEEDAARIKTIERTTNHDVKAVEYFLKEKVAEIPELHAVSEFIHFACTSEDINNLSHALMLKTARDEVILPYWRQLIDGIKDLAVQYRDIPLLSRTHGQPATPSTIGKEMANVAYRMERQYRQLNQVEILGKINGAVGNYNAHIAAYPEVDWHQFSEEFVTSLGIQWNPYTTQIEPHDYIAELFDCVARFNTILIDFDRDVWGYIALNHFKQKTIAGEIGSSTMPHKVNPIDFENSEGNLGLSNAVLQHLASKLPVSRWQRDLTDSTVLRNLGVGIGYALIAYQSTLKGVSKLEVNRDHLLDELDHNWEVLAEPIQTVMRRYGIEKPYEKLKELTRGKRVDAEGMKQFIDGLALPEEEKARLKAMTPANYIGRAITMVDELK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylosuccinate lyase
publication title The structure of phosphate-bound Escherichia coli adenylosuccinate lyase identifies His171 as a catalytic acid.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 184
structure length 469
sequence length 469
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF08328 ASL_C Adenylosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 3gzhA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 3gzhA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 3gzhA02
1DOFA 1GKJA 4EEIA 1FURA 1XWOA 1HY0A 2QGAB 1U15A 3KDYA 4FFXA 4APAA 2PFMA 4MX2A 4C6GA 2YIIA 4HGVA 4ADLA 3NO9A 3QBPA 2OHYA 2PTRA 1YISA 3TV2A 1TJWA 1KQ7A 2RJSA 4V2RA 3RRPA 2E9FA 1GK2A 2VD6A 1C3UA 1TJVA 1GKMA 4CQ5A 1K7WA 5F91A 5EYVA 1TJ7A 1JSWA 3R6YA 3OCEA 3E04A 1FUOA 2O7EA 1J3UA 4NLEA 4EFCA 5F92A 2FUSA 2O7BA 3KDZA 1Y2MA 1YFMA 1FUPA 2RJRA 4FLCA 2NYFA 2PTSA 2X75A 1FUQA 1GK3A 3UNVA 2O78A 3BHGA 1EB4A 2NYNA 2J91A 2HVGA 1B8FA 2O6YA 4C5SA 4NSLA 3GZHA 1VDKA 1K62A 2O7DA 5EYTA 4C5RA 1DCNA 2O7FA 3OCFA 1Q5NA 1T6JA 1C3CA 3CZOA 1YFEA 1AUWA 3GTDA 2QVEA 2PTQA 4BABA 1T6PA 5D6BA 1HY1A 1I0AA 3R6VA 4C5UA 3C8TA 1TJUA 1RE5A 3RD8A 1U16A 5HW2A 3NZ4A 4BAAA 4APBA 3R6QA 4ADMA 4V2QA 1W27A
chains in the Genus database with same CATH superfamily
1DOFA 1GKJA 4EEIA 1XMDA 1XLYA 2D28C 3F4SA 3CI0K 1FURA 2JARA 1XWOA 2JAUA 1HY0A 2QGAB 1U15A 1Z4MA 1Z4JA 3KDYA 4APAA 4FFXA 2PFMA 4MX2A 4C6GA 2YIIA 4HGVA 2FENA 4ADLA 1T9HA 3NO9A 3QBPA 2OHYA 2PTRA 1YISA 3TV2A 1TJWA 3CRW1 1KQ7A 5H8WA 2RJSA 2JAOA 4V2RA 3RRPA 4IQJM 2E9FA 1GK2A 2RCNA 1C3UA 1TJVA 1GKMA 2VD6A 1K7WA 4CQ5A 5F91A 5EYVA 1TJ7A 3F4TA 1JSWA 4YIKA 3R6YA 4L57A 3OCEA 5M0JA 3E04A 1U0LA 2O7EA 1J3UA 4NLEA 4EFCA 5F92A 2FUSA 2O7BA 3KDZA 2I7DA 1Y2MA 1YFMA 1FUPA 4L6CA 3U13A 1Z4IA 2RJRA 2NYFA 4FLCA 1Q92A 2PTSA 2X75A 2D27A 2FELA 1FUQA 1W27A 1GK3A 3UNVA 2O78A 3BHGA 4A15A 1EB4A 2NYNA 2J91A 1XMCA 2HVGA 3U19A 1B8FA 2O6YA 4C5SA 2YV5A 1Q91A 4NSLA 1Z4KA 3GZHA 3CRVA 1VDKA 1K62A 4NFLA 4E88A 1XL8A 2O7DA 5EYTA 4C5RA 1DCNA 4MUMA 2O7FA 1XL7A 3OCFA 1Z4LA 1Q5NA 1Z4QA 1T6JA 4MWOA 2JAWA 1Z4PX 3F4RA 1C3CA 1IW7D 3CZOA 1YFEA 1AUWA 3BWVA 3GTDA 2QVEA 2PTQA 4BABA 1T6PA 5D6BA 1HY1A 1I0AA 3R6VA 4C5UA 3C8TA 1TJUA 1RE5A 1MH9A 3RD8A 5M0IA 1U16A 5HW2A 3NZ4A 4YIHA 4BAAA 2VL7A 4APBA 3R6QA 4L6AA 4ADMA 2VSFA 4V2QA 4WNLA 1FUOA
chains in the Genus database with same CATH topology
1DOFA 1GKJA 4EEIA 1FURA 1XWOA 1HY0A 2QGAB 1U15A 3KDYA 4FFXA 4APAA 2PFMA 4MX2A 4C6GA 2YIIA 4HGVA 4ADLA 3NO9A 3QBPA 2OHYA 2PTRA 1YISA 3TV2A 1TJWA 1KQ7A 2RJSA 4V2RA 3RRPA 2E9FA 1GK2A 2VD6A 1C3UA 1TJVA 1GKMA 4CQ5A 1K7WA 5F91A 5EYVA 1TJ7A 1JSWA 3R6YA 3OCEA 3E04A 1FUOA 2O7EA 1J3UA 4NLEA 4EFCA 5F92A 2FUSA 2O7BA 3KDZA 1Y2MA 1YFMA 1FUPA 2RJRA 4FLCA 2NYFA 2PTSA 2X75A 1FUQA 1GK3A 3UNVA 2O78A 3BHGA 1EB4A 2NYNA 2J91A 2HVGA 1B8FA 2O6YA 4C5SA 4NSLA 3GZHA 1VDKA 1K62A 2O7DA 5EYTA 4C5RA 1DCNA 2O7FA 3OCFA 1Q5NA 1T6JA 1C3CA 3CZOA 1YFEA 1AUWA 3GTDA 2QVEA 2PTQA 4BABA 1T6PA 5D6BA 1HY1A 1I0AA 3R6VA 4C5UA 3C8TA 1TJUA 1RE5A 3RD8A 1U16A 5HW2A 3NZ4A 4BAAA 4APBA 3R6QA 4ADMA 4V2QA 1W27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DOF A;  1GKJ A;  4EEI A;  1FUR A;  1XWO A;  1HY0 A;  2QGA B;  1U15 A;  3KDY A;  4FFX A;  4APA A;  2PFM A;  4MX2 A;  4C6G A;  2YII A;  4HGV A;  4ADL A;  3NO9 A;  3QBP A;  2OHY A;  2PTR A;  1YIS A;  3TV2 A;  1TJW A;  1KQ7 A;  2RJS A;  4V2R A;  3RRP A;  2E9F A;  1GK2 A;  2VD6 A;  1C3U A;  1TJV A;  1GKM A;  4CQ5 A;  1K7W A;  5F91 A;  5EYV A;  1TJ7 A;  1JSW A;  3R6Y A;  3OCE A;  3E04 A;  1FUO A;  2O7E A;  1J3U A;  4NLE A;  4EFC A;  5F92 A;  2FUS A;  2O7B A;  3KDZ A;  1Y2M A;  1YFM A;  1FUP A;  2RJR A;  4FLC A;  2NYF A;  2PTS A;  2X75 A;  1FUQ A;  1GK3 A;  3UNV A;  2O78 A;  3BHG A;  1EB4 A;  2NYN A;  2J91 A;  2HVG A;  1B8F A;  2O6Y A;  4C5S A;  4NSL A;  3GZH A;  1VDK A;  1K62 A;  2O7D A;  5EYT A;  4C5R A;  1DCN A;  2O7F A;  3OCF A;  1Q5N A;  1T6J A;  1C3C A;  3CZO A;  1YFE A;  1AUW A;  3GTD A;  2QVE A;  2PTQ A;  4BAB A;  1T6P A;  5D6B A;  1HY1 A;  1I0A A;  3R6V A;  4C5U A;  3C8T A;  1TJU A;  1RE5 A;  3RD8 A;  1U16 A;  5HW2 A;  3NZ4 A;  4BAA A;  4APB A;  3R6Q A;  4ADM A;  4V2Q A;  1W27 A; 
#chains in the Genus database with same CATH topology
 1DOF A;  1GKJ A;  4EEI A;  1XMD A;  1XLY A;  2D28 C;  3F4S A;  3CI0 K;  1FUR A;  2JAR A;  1XWO A;  2JAU A;  1HY0 A;  2QGA B;  1U15 A;  1Z4M A;  1Z4J A;  3KDY A;  4APA A;  4FFX A;  2PFM A;  4MX2 A;  4C6G A;  2YII A;  4HGV A;  2FEN A;  4ADL A;  1T9H A;  3NO9 A;  3QBP A;  2OHY A;  2PTR A;  1YIS A;  3TV2 A;  1TJW A;  3CRW 1;  1KQ7 A;  5H8W A;  2RJS A;  2JAO A;  4V2R A;  3RRP A;  4IQJ M;  2E9F A;  1GK2 A;  2RCN A;  1C3U A;  1TJV A;  1GKM A;  2VD6 A;  1K7W A;  4CQ5 A;  5F91 A;  5EYV A;  1TJ7 A;  3F4T A;  1JSW A;  4YIK A;  3R6Y A;  4L57 A;  3OCE A;  5M0J A;  3E04 A;  1U0L A;  2O7E A;  1J3U A;  4NLE A;  4EFC A;  5F92 A;  2FUS A;  2O7B A;  3KDZ A;  2I7D A;  1Y2M A;  1YFM A;  1FUP A;  4L6C A;  3U13 A;  1Z4I A;  2RJR A;  2NYF A;  4FLC A;  1Q92 A;  2PTS A;  2X75 A;  2D27 A;  2FEL A;  1FUQ A;  1W27 A;  1GK3 A;  3UNV A;  2O78 A;  3BHG A;  4A15 A;  1EB4 A;  2NYN A;  2J91 A;  1XMC A;  2HVG A;  3U19 A;  1B8F A;  2O6Y A;  4C5S A;  2YV5 A;  1Q91 A;  4NSL A;  1Z4K A;  3GZH A;  3CRV A;  1VDK A;  1K62 A;  4NFL A;  4E88 A;  1XL8 A;  2O7D A;  5EYT A;  4C5R A;  1DCN A;  4MUM A;  2O7F A;  1XL7 A;  3OCF A;  1Z4L A;  1Q5N A;  1Z4Q A;  1T6J A;  4MWO A;  2JAW A;  1Z4P X;  3F4R A;  1C3C A;  1IW7 D;  3CZO A;  1YFE A;  1AUW A;  3BWV A;  3GTD A;  2QVE A;  2PTQ A;  4BAB A;  1T6P A;  5D6B A;  1HY1 A;  1I0A A;  3R6V A;  4C5U A;  3C8T A;  1TJU A;  1RE5 A;  1MH9 A;  3RD8 A;  5M0I A;  1U16 A;  5HW2 A;  3NZ4 A;  4YIH A;  4BAA A;  2VL7 A;  4APB A;  3R6Q A;  4L6A A;  4ADM A;  2VSF A;  4V2Q A;  4WNL A;  1FUO A; 
#chains in the Genus database with same CATH homology
 1DOF A;  1GKJ A;  4EEI A;  1FUR A;  1XWO A;  1HY0 A;  2QGA B;  1U15 A;  3KDY A;  4FFX A;  4APA A;  2PFM A;  4MX2 A;  4C6G A;  2YII A;  4HGV A;  4ADL A;  3NO9 A;  3QBP A;  2OHY A;  2PTR A;  1YIS A;  3TV2 A;  1TJW A;  1KQ7 A;  2RJS A;  4V2R A;  3RRP A;  2E9F A;  1GK2 A;  2VD6 A;  1C3U A;  1TJV A;  1GKM A;  4CQ5 A;  1K7W A;  5F91 A;  5EYV A;  1TJ7 A;  1JSW A;  3R6Y A;  3OCE A;  3E04 A;  1FUO A;  2O7E A;  1J3U A;  4NLE A;  4EFC A;  5F92 A;  2FUS A;  2O7B A;  3KDZ A;  1Y2M A;  1YFM A;  1FUP A;  2RJR A;  4FLC A;  2NYF A;  2PTS A;  2X75 A;  1FUQ A;  1GK3 A;  3UNV A;  2O78 A;  3BHG A;  1EB4 A;  2NYN A;  2J91 A;  2HVG A;  1B8F A;  2O6Y A;  4C5S A;  4NSL A;  3GZH A;  1VDK A;  1K62 A;  2O7D A;  5EYT A;  4C5R A;  1DCN A;  2O7F A;  3OCF A;  1Q5N A;  1T6J A;  1C3C A;  3CZO A;  1YFE A;  1AUW A;  3GTD A;  2QVE A;  2PTQ A;  4BAB A;  1T6P A;  5D6B A;  1HY1 A;  1I0A A;  3R6V A;  4C5U A;  3C8T A;  1TJU A;  1RE5 A;  3RD8 A;  1U16 A;  5HW2 A;  3NZ4 A;  4BAA A;  4APB A;  3R6Q A;  4ADM A;  4V2Q A;  1W27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...