3GZHA

Crystal structure of phosphate-bound adenylosuccinate lyase from e. coli
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
469
structure length
469
Chain Sequence
YDIPTTENLYFQGSELSSLTAVSPVDGRYGDKVSALRGIFSEYGLLKFRVQVEVRWLQKLAAHAAIKEVPAFAADAIGYLDAIVANFSEEDAARIKTIERTTNHDVKAVEYFLKEKVAEIPELHAVSEFIHFACTSEDINNLSHALMLKTARDEVILPYWRQLIDGIKDLAVQYRDIPLLSRTHGQPATPSTIGKEMANVAYRMERQYRQLNQVEILGKINGAVGNYNAHIAAYPEVDWHQFSEEFVTSLGIQWNPYTTQIEPHDYIAELFDCVARFNTILIDFDRDVWGYIALNHFKQKTIAGEIGSSTMPHKVNPIDFENSEGNLGLSNAVLQHLASKLPVSRWQRDLTDSTVLRNLGVGIGYALIAYQSTLKGVSKLEVNRDHLLDELDHNWEVLAEPIQTVMRRYGIEKPYEKLKELTRGKRVDAEGMKQFIDGLALPEEEKARLKAMTPANYIGRAITMVDELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of phosphate-bound Escherichia coli adenylosuccinate lyase identifies His171 as a catalytic acid.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Adenylosuccinate lyase
total genus 184
structure length 469
sequence length 469
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF08328 ASL_C Adenylosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 3gzhA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 3gzhA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 3gzhA02
1C3CA 2O7EA 5F91A 3OCFA 3NZ4A 2RJSA 4BAAA 1DOFA 1Y2MA 2YIIA 4C5SA 2PTRA 1YFMA 4EFCA 4V2RA 4BABA 4CQ5A 1GK2A 2RJRA 2NYNA 2E9FA 1Q5NA 1RE5A 1TJ7A 4ADLA 1XWOA 3E04A 3TV2A 4C6GA 1EB4A 1U16A 3GTDA 1W27A 3R6YA 1DCNA 1JSWA 4NSLA 4V2QA 1GKJA 1J3UA 1GKMA 2O6YA 1GK3A 2J91A 3UNVA 2O7DA 1K62A 3KDZA 2O7BA 2HVGA 2O78A 2QVEA 1FUQA 1I0AA 3OCEA 2QGAB 3NO9A 5HW2A 2O7FA 5D6BA 2X75A 1AUWA 3KDYA 1T6PA 1K7WA 3BHGA 1KQ7A 5EYTA 3CZOA 1T6JA 4FLCA 4EEIA 1YISA 3RRPA 1HY1A 1HY0A 1U15A 4HGVA 3C8TA 4FFXA 2VD6A 5F92A 1C3UA 1FUPA 3QBPA 4MX2A 2PTQA 2FUSA 4ADMA 4APBA 3GZHA 1FUOA 4C5UA 5EYVA 4NLEA 4C5RA 2PFMA 2OHYA 2PTSA 3RD8A 1B8FA 1FURA 1TJWA 2NYFA 1TJVA 1VDKA 3R6QA 1YFEA 1TJUA 3R6VA 4APAA
chains in the Genus database with same CATH superfamily
1C3CA 5M0IA 2JAWA 2O7EA 5F91A 3OCFA 3NZ4A 2RJSA 4BAAA 3U13A 1Q91A 1DOFA 4E88A 1Y2MA 2YIIA 4C5SA 3CRVA 2PTRA 1YFMA 2JARA 4EFCA 4V2RA 1Z4LA 1Q92A 4IQJM 4BABA 1Z4IA 4CQ5A 1GK2A 2RJRA 2NYNA 1Z4KA 1T9HA 4L57A 2VSFA 2JAOA 5H8WA 2E9FA 4NFLA 1Q5NA 1RE5A 1TJ7A 4ADLA 1XWOA 3E04A 3TV2A 4C6GA 1EB4A 1U16A 1XL8A 1MH9A 2I7DA 3GTDA 1Z4PX 1W27A 3R6YA 1DCNA 1JSWA 4NSLA 2FELA 4V2QA 1GKJA 1J3UA 1GKMA 2O6YA 1GK3A 2J91A 2VL7A 3UNVA 2D28C 2JAUA 2O7DA 1K62A 3KDZA 3CI0K 2O7BA 2FENA 1Z4JA 4L6AA 2HVGA 2O78A 2QVEA 1FUQA 1I0AA 3OCEA 2QGAB 2D27A 3NO9A 5HW2A 2O7FA 4YIHA 5D6BA 1XLYA 2X75A 1AUWA 3KDYA 4MUMA 1T6PA 1K7WA 3BHGA 1KQ7A 1XMDA 5EYTA 3CZOA 4L6CA 4YIKA 1T6JA 4FLCA 4WNLA 4EEIA 1YISA 1Z4QA 3RRPA 3CRW1 1HY1A 1HY0A 1U15A 4HGVA 3C8TA 3F4TA 4FFXA 2VD6A 5F92A 3F4RA 5M0JA 4A15A 1C3UA 1FUPA 3QBPA 4MX2A 2PTQA 2FUSA 4ADMA 3U19A 1XMCA 2YV5A 4APBA 3GZHA 1FUOA 4C5UA 5EYVA 4NLEA 1XL7A 4C5RA 2PFMA 1Z4MA 2OHYA 4MWOA 2PTSA 3F4SA 3RD8A 1FURA 1TJWA 1B8FA 2NYFA 1TJVA 1IW7D 1U0LA 1VDKA 3R6QA 2RCNA 1YFEA 3BWVA 1TJUA 3R6VA 4APAA
chains in the Genus database with same CATH topology
1C3CA 2O7EA 5F91A 3OCFA 3NZ4A 2RJSA 4BAAA 1DOFA 1Y2MA 2YIIA 4C5SA 2PTRA 1YFMA 4EFCA 4V2RA 4BABA 4CQ5A 1GK2A 2RJRA 2NYNA 2E9FA 1Q5NA 1RE5A 1TJ7A 4ADLA 1XWOA 3E04A 3TV2A 4C6GA 1EB4A 1U16A 3GTDA 1W27A 3R6YA 1DCNA 1JSWA 4NSLA 4V2QA 1GKJA 1J3UA 1GKMA 2O6YA 1GK3A 2J91A 3UNVA 2O7DA 1K62A 3KDZA 2O7BA 2HVGA 2O78A 2QVEA 1FUQA 1I0AA 3OCEA 2QGAB 3NO9A 5HW2A 2O7FA 5D6BA 2X75A 1AUWA 3KDYA 1T6PA 1K7WA 3BHGA 1KQ7A 5EYTA 3CZOA 1T6JA 4FLCA 4EEIA 1YISA 3RRPA 1HY1A 1HY0A 1U15A 4HGVA 3C8TA 4FFXA 2VD6A 5F92A 1C3UA 1FUPA 3QBPA 4MX2A 2PTQA 2FUSA 4ADMA 4APBA 3GZHA 1FUOA 4C5UA 5EYVA 4NLEA 4C5RA 2PFMA 2OHYA 2PTSA 3RD8A 1B8FA 1FURA 1TJWA 2NYFA 1TJVA 1VDKA 3R6QA 1YFEA 1TJUA 3R6VA 4APAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C3C A;  2O7E A;  5F91 A;  3OCF A;  3NZ4 A;  2RJS A;  4BAA A;  1DOF A;  1Y2M A;  2YII A;  4C5S A;  2PTR A;  1YFM A;  4EFC A;  4V2R A;  4BAB A;  4CQ5 A;  1GK2 A;  2RJR A;  2NYN A;  2E9F A;  1Q5N A;  1RE5 A;  1TJ7 A;  4ADL A;  1XWO A;  3E04 A;  3TV2 A;  4C6G A;  1EB4 A;  1U16 A;  3GTD A;  1W27 A;  3R6Y A;  1DCN A;  1JSW A;  4NSL A;  4V2Q A;  1GKJ A;  1J3U A;  1GKM A;  2O6Y A;  1GK3 A;  2J91 A;  3UNV A;  2O7D A;  1K62 A;  3KDZ A;  2O7B A;  2HVG A;  2O78 A;  2QVE A;  1FUQ A;  1I0A A;  3OCE A;  2QGA B;  3NO9 A;  5HW2 A;  2O7F A;  5D6B A;  2X75 A;  1AUW A;  3KDY A;  1T6P A;  1K7W A;  3BHG A;  1KQ7 A;  5EYT A;  3CZO A;  1T6J A;  4FLC A;  4EEI A;  1YIS A;  3RRP A;  1HY1 A;  1HY0 A;  1U15 A;  4HGV A;  3C8T A;  4FFX A;  2VD6 A;  5F92 A;  1C3U A;  1FUP A;  3QBP A;  4MX2 A;  2PTQ A;  2FUS A;  4ADM A;  4APB A;  3GZH A;  1FUO A;  4C5U A;  5EYV A;  4NLE A;  4C5R A;  2PFM A;  2OHY A;  2PTS A;  3RD8 A;  1B8F A;  1FUR A;  1TJW A;  2NYF A;  1TJV A;  1VDK A;  3R6Q A;  1YFE A;  1TJU A;  3R6V A;  4APA A; 
#chains in the Genus database with same CATH topology
 1C3C A;  5M0I A;  2JAW A;  2O7E A;  5F91 A;  3OCF A;  3NZ4 A;  2RJS A;  4BAA A;  3U13 A;  1Q91 A;  1DOF A;  4E88 A;  1Y2M A;  2YII A;  4C5S A;  3CRV A;  2PTR A;  1YFM A;  2JAR A;  4EFC A;  4V2R A;  1Z4L A;  1Q92 A;  4IQJ M;  4BAB A;  1Z4I A;  4CQ5 A;  1GK2 A;  2RJR A;  2NYN A;  1Z4K A;  1T9H A;  4L57 A;  2VSF A;  2JAO A;  5H8W A;  2E9F A;  4NFL A;  1Q5N A;  1RE5 A;  1TJ7 A;  4ADL A;  1XWO A;  3E04 A;  3TV2 A;  4C6G A;  1EB4 A;  1U16 A;  1XL8 A;  1MH9 A;  2I7D A;  3GTD A;  1Z4P X;  1W27 A;  3R6Y A;  1DCN A;  1JSW A;  4NSL A;  2FEL A;  4V2Q A;  1GKJ A;  1J3U A;  1GKM A;  2O6Y A;  1GK3 A;  2J91 A;  2VL7 A;  3UNV A;  2D28 C;  2JAU A;  2O7D A;  1K62 A;  3KDZ A;  3CI0 K;  2O7B A;  2FEN A;  1Z4J A;  4L6A A;  2HVG A;  2O78 A;  2QVE A;  1FUQ A;  1I0A A;  3OCE A;  2QGA B;  2D27 A;  3NO9 A;  5HW2 A;  2O7F A;  4YIH A;  5D6B A;  1XLY A;  2X75 A;  1AUW A;  3KDY A;  4MUM A;  1T6P A;  1K7W A;  3BHG A;  1KQ7 A;  1XMD A;  5EYT A;  3CZO A;  4L6C A;  4YIK A;  1T6J A;  4FLC A;  4WNL A;  4EEI A;  1YIS A;  1Z4Q A;  3RRP A;  3CRW 1;  1HY1 A;  1HY0 A;  1U15 A;  4HGV A;  3C8T A;  3F4T A;  4FFX A;  2VD6 A;  5F92 A;  3F4R A;  5M0J A;  4A15 A;  1C3U A;  1FUP A;  3QBP A;  4MX2 A;  2PTQ A;  2FUS A;  4ADM A;  3U19 A;  1XMC A;  2YV5 A;  4APB A;  3GZH A;  1FUO A;  4C5U A;  5EYV A;  4NLE A;  1XL7 A;  4C5R A;  2PFM A;  1Z4M A;  2OHY A;  4MWO A;  2PTS A;  3F4S A;  3RD8 A;  1FUR A;  1TJW A;  1B8F A;  2NYF A;  1TJV A;  1IW7 D;  1U0L A;  1VDK A;  3R6Q A;  2RCN A;  1YFE A;  3BWV A;  1TJU A;  3R6V A;  4APA A; 
#chains in the Genus database with same CATH homology
 1C3C A;  2O7E A;  5F91 A;  3OCF A;  3NZ4 A;  2RJS A;  4BAA A;  1DOF A;  1Y2M A;  2YII A;  4C5S A;  2PTR A;  1YFM A;  4EFC A;  4V2R A;  4BAB A;  4CQ5 A;  1GK2 A;  2RJR A;  2NYN A;  2E9F A;  1Q5N A;  1RE5 A;  1TJ7 A;  4ADL A;  1XWO A;  3E04 A;  3TV2 A;  4C6G A;  1EB4 A;  1U16 A;  3GTD A;  1W27 A;  3R6Y A;  1DCN A;  1JSW A;  4NSL A;  4V2Q A;  1GKJ A;  1J3U A;  1GKM A;  2O6Y A;  1GK3 A;  2J91 A;  3UNV A;  2O7D A;  1K62 A;  3KDZ A;  2O7B A;  2HVG A;  2O78 A;  2QVE A;  1FUQ A;  1I0A A;  3OCE A;  2QGA B;  3NO9 A;  5HW2 A;  2O7F A;  5D6B A;  2X75 A;  1AUW A;  3KDY A;  1T6P A;  1K7W A;  3BHG A;  1KQ7 A;  5EYT A;  3CZO A;  1T6J A;  4FLC A;  4EEI A;  1YIS A;  3RRP A;  1HY1 A;  1HY0 A;  1U15 A;  4HGV A;  3C8T A;  4FFX A;  2VD6 A;  5F92 A;  1C3U A;  1FUP A;  3QBP A;  4MX2 A;  2PTQ A;  2FUS A;  4ADM A;  4APB A;  3GZH A;  1FUO A;  4C5U A;  5EYV A;  4NLE A;  4C5R A;  2PFM A;  2OHY A;  2PTS A;  3RD8 A;  1B8F A;  1FUR A;  1TJW A;  2NYF A;  1TJV A;  1VDK A;  3R6Q A;  1YFE A;  1TJU A;  3R6V A;  4APA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...