2JAWA

Crystal structure of d41n variant of human mitochondrial 5'(3')- deoxyribonucleotidase (mdn) in complex with 5-bromovinyldeoxyuridine 5'-monophosphate
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
194
structure length
194
Chain Sequence
RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-DEOXYRIBONUCLEOTIDASE
publication title Crystal Structures of Human and Murine Deoxyribonucleotidases: Insights Into Recognition of Substrates and Nucleotide Analogues.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 63
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 2jawA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2jawA01
4Y2SA 1NF2A 3KC2A 1TA0A 1RPZA 2G1AA 3E84A 2YY6A 2G06A 5AVUA 5AI0A 2HSZA 2EAUA 1XP5A 3QGMA 1Y8AA 2P69A 1RLTA 4HYTA 4EZEA 4UAUA 4G63A 1YV9A 1ZS9A 3WKEA 1RLMA 3QUTA 2FPSA 3I6BA 1TJ5A 3AR3A 4OHFA 2HDOA 3ESRA 5IS2A 3KZXA 1Z4MA 2ZOSA 1K1EA 1JUDA 1LTQA 4QJBA 1RMTA 4EEKA 2YN4A 5AKJA 3QU5A 3KOOA 4CNQA 2Q5EA 5ALOA 3K1ZA 2CN1A 4BNDA 5AIAA 3UMCA 3ZVMA 3F9RA 3QUQA 4UM5A 5ALJA 5ALHA 4Y2RA 3U7HB 4UATA 2BDEA 3AR2A 3KDPA 4BYGA 2R8XA 1RKQA 1WR8A 3FPBA 2JARA 2EARA 4YCNA 4NFLA 3HLTA 2WM8A 2I34A 4UMEA 3WK8A 2YJ6A 1L7NA 4QQFA 4AS3A 5ALGA 4J2TA 3RF6A 2OYCA 5ALVA 5AVYA 3I76A 2QYHA 5ALSA 1NNLA 3QNMA 4IG4A 3AR9A 3QLEA 4DFDA 3IB6A 1ZRMA 2YMPA 1SU4A 3DAOA 4YCMA 5ALQA 2PR7A 3EWIA 3SHQA 4I9FA 4KX5A 3M1YA 4UASA 3B9BA 3QU4A 4GXTA 3OCZA 4AS2A 1VJRA 5AM0A 3U7EB 3A1DA 1PW5A 5AW1A 2B8JA 5AVQA 3WK7A 2Q4RA 3OTQA 2JAUA 3BWVA 1RC8A 1KYTA 5ALMA 5AESA 2ODAA 3BA6A 1SWVA 5AW0A 1L8LA 3SF0A 5ALWA 4L6AA 5AVWA 3FVVA 1RDFA 2R8ZA 3OCWA 2FPXA 5AW8A 1ZOLA 1RKVA 2FDRA 2JGAA 2B8EA 2NO5A 3KD3A 5AK3A 1U7PA 3DV9A 4HGRA 2G07A 1Q92A 2ZBEA 3FGOA 1LVHA 4ZEXA 4EX7A 4BKMA 5ALIA 3U26A 3WK9A 1XVIA 4BEVA 4BX0A 2W43A 3CZ4A 3SMVA 3ED5A 2WFAA 1T5SA 2B30A 2HX1A 2WF8A 2G08A 3L0CA 1U2TA 3U13A 5IT0A 2WHEA 5AKIA 3OCVA 5ALLA 1O03A 1T9ZA 3R09A 2I6XA 1Z4PX 5AM4A 2NYVA 3SKYA 3NAMA 2FUEA 5AK5A 3EPRA 3OPXA 2RAVA 5AM3A 4Y2UA 1Z4OA 1Z5GA 3ET4A 3OCXA 2FPWA 2HOQA 4Y2QA 4UAVA 1QQ5A 2PKEA 1QQ7A 2G0AA 2JAOA 3N5KA 5ALYA 3L7YA 3ZW7A 4RETA 4Y2JA 1Z5UA 2P9JA 4EX6A 4UU1A 5AICA 4Y3UA 2HF2A 4NWIA 5ALPA 5AKLA 1YDFA 4YCLA 2FI1A 3AR8A 3E8MA 4NABA 4BNDB 3NALA 3L1VA 2B0CA 2IOFA 2I33A 3ZU6A 3ZTYA 4YIHA 4HGNA 4CF4A 3A3YA 1L6RA 2PQ0A 1L7MA 3L5KA 2Q4TA 4KNVA 4YH1A 2D2VA 4EENA 4OFZA 3ZI4A 3L8HA 1YJ5A 1ZJJA 3L1UA 4YGYA 2ZXEA 2HF7A 5AW6A 4Y2TA 4KNWA 2O2XA 5AW3A 1ZRNA 3L8GA 1QQ6A 5AVVA 2IA5A 3FM9A 1YMQA 2O9JA 4FYPA 2OBBA 3U7GA 2HCFA 5AIBA 3PCTA 4KYTA 3ZX4A 2IOFK 2YJ3A 2DQSA 3OCYA 1RQNA 1Z4JA 3AR5A 1QH9A 4BX2A 1Z4LA 2VKQA 5E0OA 3OCUA 4C4TA 2YJ4A 1EK2A 1YS9A 2MSNA 2B1RA 5AKGA 2HI0A 3N07A 5AVSA 2C88A 2GHQA 1VFPA 3QXGA 1WVIA 5AK6A 5AM1A 4KN8A 4FFDA 2YMMA 2EATA 5ALEA 3W5AA 4Y2XA 4H1WA 3NIWA 4C4RA 3L0YA 1T5TA 4L57A 5AVXA 3KBBA 2G80A 5AHXA 3DNPA 4MWOA 1MH9A 4UU0A 3D6JA 4G9BA 3MPOA 1ZD5A 3L0BA 1L8OA 3FPSA 3WGVA 3IJ5A 4MUMA 1TE2A 2FPUA 3ZWKA 3SD7A 3I28A 4EELA 2GHTA 1U2SA 4UW9A 5A3QA 2CFSA 1CQZA 2ZBDA 3AR7A 4I9GA 3UMBA 4BBJA 1RKUA 4XOUA 5ALXA 3QUCA 5ALTA 2JAWA 4JB3A 2C8LA 1U7OA 2HEGA 5AM2A 3PDWA 2WF5A 1F5SA 1Z88A 4CF3A 2AMYA 3AR4A 2YJ5A 5AVTA 1J8DA 3A1EA 4Y2VA 1N9KA 2B1QA 2W11A 4BX3A 4IFTA 2BY4A 3ET5A 5AW5A 1X42A 2AH5A 4PNHA 3QYPA 5A3SA 1RMQA 2FPRA 1CR6A 4UARA 3HYCA 2GFHA 1ZD3A 1XPJA 4O8CA 3ESQA 2ZG6A 4YIKA 3WKCA 4F71A 3WGUA 4UMFA 1YNSA 5ALFA 5ALRA 2IYEA 1QYIA 3U7FB 1ZD4A 3N1UA 3U19A 5ALZA 4UMDA 4XE5A 3NRJA 2WF7A 3ZVNA 4HGOA 5AKKA 4OD0A 3ZX5A 1O08A 2ZBFA 2NO4A 4B6JA 1L7OA 4Y2PA 3GYGA 3VAYA 3N8GA 3WKBA 3WK6A 4FE3A 4UM7A 1RLOA 1RQLA 3B8EA 3ZUPA 2WF9A 3QX7A 3ZTWA 2HHLA 1Z4KA 5AI5A 5IT4A 4ZEWA 1TJ4A 1S2OA 3ZWDA 2FEAA 2I55A 3NUQA 3MMZA 4BEWA 1VJ5A 2C9MA 2HO4A 3NASA 1RMYA 5AKXA 1WZCA 4F72A 2RBKA 4OCZA 2OA0A 3AR6A 1Q91A 3WKDA 3UMGA 3R4CA 3W5BA 1Z4NA 3EF0A 2GO7A 2IOHA 4XQ0A 4XPZA 3SKXA 1ZD2P 5AKEA 5T41A 3QU9A 5ALDA 3W5CA 2C4NA 4JDPA 3L8EA 4UMVA 2G09A 4DCCA 3FZQA 4HGQA 2X4DA 4ZEVA 2YMLA 1NRWA 3QUBA 2W4MA 2C8KA 3A1CA 3PGLA 2FUCA 5AK4A 3DDHA 2R8YA 3WK4A 3WK5A 3B9RA 4GIBA 4E88A 4NV0A 3SLRA 3ZVLA 2ZBGA 4AP9A 3MC1A 2YBDA 4RESA 4L6CA 1U02A 3RFUA 1J97A 4HAIA 2BDUA 4DWOA 3L8FA 2CFRA 3TLMA 1IWOA 5AI4A 3M9LA 3QU7A 5AVRA 5AI9A 1L7PA 5AW4A 3W5DA 2MU1A 1EK1A 5AW2A 5AVZA 5AKYA 4C4SA 5AKHA 4CE6A 2YFYA 5AW9A 3UM9A 3MN1A 3J7TA 5JJBA 1S8OA 4HGPA 2I54A 4KX3A 5ALUA 2P27A 3IRUA 3R9KA 2OM6A 2P11A 4DW8A 4CF5A 2AUTA 3WKAA 5AKZA 3S6JA 3EF1A 2RARA 5AI6A 2B82A 1AQ6A 3CNHA 4NAVA 3E81A 2CFTA 2RB5A 5ALKA 2I7DA 2AGVA 3N28A 3I1YA 3NANA 5AM5A 3P96A 1WPGA 1TJ3A 1Z4QA 5FP0A 1N8NA 5ALNA 1Z4IA 2R8EA 5A3RA 1RRCA 5AW7A 5AI8A 1SWWA 2WF6A 4Y2YA 3ONNA 3QU2A 2GMWA 2QLTA 4J03A 1FEZA 3PGVA 3E58A 2YMQA
chains in the Genus database with same CATH superfamily
3KE9A 3BMOA 4P0PB 4ZVLA 1UQTA 4FFVA 3VAAA 1WDKA 2WILA 3GRCA 1PBNA 2XA2A 1Z7GA 1I7DA 5TXGA 1PUJA 4E3ZA 2NV2B 3DMPA 5FI3A 5KYVA 1QCCA 3RJ5A 3RG8A 3N53A 2G06A 4TL9A 1QU2A 5BNFA 1JKJB 1UJ6A 3OP4A 3Q9LA 3QOFA 4HMOA 4RANA 1JA1A 2LCFA 1T8UA 2WV9A 3K15A 1KKUA 1ULSA 2AL7A 2BEJA 1KI6A 4Q7MB 3MOIA 3DE5X 1NY5A 3W7AA 4F9EA 3NLLA 4KWEA 4GH5A 3U2QA 3H3FA 1MO3A 1QIIA 2QT9A 4N8DA 2O2SA 3L06A 1L5HA 2AHRA 4AWXA 3PI7A 1G8GA 1GNLA 2XECA 2I99A 2IZOA 2OILA 1VIYA 4U2CA 3K9GA 1PK9A 4ZQCB 3T9CA 3HXKA 5KSPA 1PKEA 4IRUB 3F8WA 1A76A 1ILWA 1TJ5A 1U9JA 2ORWA 2WAOA 3IXQA 3IR5A 3OZ7A 3P4YA 1FFWA 3P94A 5HS6A 1YQDA 3IHLA 3R9IA 3AYXB 2YN2A 3ZZUA 1HG1A 2IYZA 3V4FA 1K7SN 1RC1A 1VI6A 2VSOA 5C18A 3IOCA 1A9RA 1TZBA 2W2LA 4Y1RB 1HQCA 1KI4A 1YB7A 3FMFA 3A58B 3CI0K 4ZVPA 1RCUA 2YZ7A 3EPJA 2GESA 1N2IA 1V9SA 3MD0A 4YAIA 1QMPA 4CEJA 1FXUA 3MTAA 1SCQA 1T9GR 1Y7PA 2BKAA 3ENQA 3N8HA 5BV1A 3AX6A 1EBBA 3II6X 3SYNA 3ELUA 2CUNA 5K3BA 3F4SA 1MN6A 1SD2A 1ISIA 4GMHA 4D80A 3HKDA 2Q5CA 4CT0A 5KX5F 5KYKA 1UZMA 4F9FA 2BDEA 3D1LA 3OIDA 4HPXB 2HMAA 1FTNA 3ZKAA 1MAVA 2F8LA 3Q1KA 4KSBA 4B6PA 2L2QA 1CJVC 3ZWNA 1H3EA 1QIMA 2H5JA 5JDIA 2HXGA 4LHZA 3U61B 1XV5A 4P2GA 2YHIA 1P80A 2ROQA 2Z3ZA 3D6HA 3I83A 4RZQA 4A2PA 1B2RA 2WBLC 3I0NA 5DGXA 2FH5B 1TA9A 2IYRA 2DJ5A 3O90A 3EASA 1WA5A 2OORA 3TX6A 1CNFA 4HUJA 4LOIA 1JHAA 2WPNA 4KPUB 2HBRA 3SC4A 4OLFA 5SY9A 1U3FA 5ALSA 1CFZA 1GPLA 2HK9A 3F3YA 2AFVA 2EW2A 1AQIA 1GRQA 3RFFA 2ZXFA 2P6PA 2IDJA 1SBHA 5ES3A 3T9EA 4IOLA 1CJUC 1YI8A 3OQJA 3HU3A 4FEEA 1P31A 4H27A 1ISJA 4RIIA 4F93B 2UYHA 2BR3A 4NX2A 4HQ6A 3L7NA 4I9FA 4S1OA 1SBYA 3VC7A 3GNLA 1XN4A 4ACAA 3B9BA 3VPBA 2G76A 2C2OA 4LHXA 4G5QA 1J9ZA 2FG7C 1UFQA 3K8OE 3VFDA 4AFNA 1R6VA 5AHWA 3I8SA 4XYMA 4N48A 3E2IA 2NT4A 5E38A 1TEXA 4O3MA 1YR1A 1EFRA 3DL0A 4JC8A 4KQMA 1GM5A 1NP7A 1N8TA 4PBSA 4E5KA 2DKNA 4FMCB 2JAUA 2AUMA 5HZGA 4N76A 1J6UA 4EFLA 4Q4JB 5LYYA 1P2SA 1AK2A 2Y68A 1SWVA 4AKSA 4ENWA 3DZGA 5ITVA 1L8LA 1A7JA 2PX8A 3UJ7A 5ECYA 3TRJA 3O8LA 2GUGA 1MAUA 3WIOA 1AX9A 1Z33A 1E64A 4EI2A 2LBPA 2XGMA 1VKNA 2VQ3A 2IDKA 4B40A 3K9FC 4C22A 1OC4A 2R8ZA 3DV2A 3NHMA 2C9DA 2WWGA 4LY9A 5IULC 1YKFA 1NUQA 4C6RA 1N5DA 4F6RB 3UJHA 3OEHD 1KC3A 5LQMA 3E23A 1XQWA 5EKXA 4GPIB 1W2WB 2O3QA 2XCLA 4Y9SA 5T7BA 2O6LA 1ODJA 2ZIXA 4MS3B 4FKBA 4OAOA 4B75A 1MW9X 4B3HA 4ZV4A 4P80A 1A69A 1QYRA 4H2DA 3TKYA 3D7LA 3AM3A 3FSEA 1MNAA 4BZZA 2I4MA 1XCOA 3MJHA 3DNMA 1QVAA 2OGZA 1MA0A 4MYSA 3B7PA 1GQFA 1QO0D 3A4IA 3OJFA 1E1QD 3RS5A 4Q21A 5DHTA 4QFDA 1X7XA 3VJLA 3LWNA 4CMEA 2AR0A 2OKGA 3A28A 1NW5A 3O8QA 4IHJA 2PTGA 5HEKA 1C8KA 2NU9B 4AWAA 1XNQB 2FMKA 1XRNA 2XUOA 4M0UA 5C1DA 4YRLA 4JLUA 1IMOA 3EEFA 3WLHA 1U2TA 2VJMA 3NDRA 2EU8A 1RBQA 4ZKEA 1XFAA 3B1XA 4WK6A 4B3DA 4R0MA 3K1TA 4JJ4A 1AO0A 1YIDA 2F1OA 1UBCA 2B5OA 3G79A 4WDQA 5EXDA 1K0FA 2XUIA 4AKHA 1E9EA 2NYVA 4ZZ1A 4PQGA 3IDFA 4PSUA 2C9BA 1W5TA 5JUWA 1OI3A 1V4VA 4G1UC 3RVMA 1TF5A 2Z4SA 4Q5IA 4Y6RA 1T35A 1YK0A 4AZ3B 2YIVX 3DHEA 3S68A 2L42A 1N33B 2MSWA 3HQ4O 3IP3A 1UFOA 1V1MA 2PBZA 4XPIB 2A86A 2VNKA 3PPXA 4AW9A 4TRRA 2OXRA 4PXSA 4UM8B 4JBGA 1PCXA 2FEOA 1IRXA 5C51B 1CE8A 4PCUA 5KKNB 1OXUA 2D2IA 2O5CA 5JLAA 2NUTB 1NY6A 2YZ2A 5TARA 3O1IC 1H42A 3GMSA 5EWMA 2VK4A 2BEWA 2GBLA 4R9SA 1J22A 1KZ7B 2NT3A 3S8EA 2C8VA 5GJWC 4KXWA 5FFFA 3IELA 1YGYA 1T43A 3NKVA 5FORA 1F4PA 3FBGA 4V0LA 8GPBA 4FUTA 1VPDA 5C8ZA 1V11A 1JXOA 5G4LA 4TWJA 4JFAA 1QOQB 1RJFA 3UV7A 1I2AA 3QWHA 1EXDA 3NALA 5K0JA 1GKKA 1L8QA 5DLDA 1ZAYA 3F6YA 1EAMA 2G3YA 3ZG6A 1ZISA 2JHPA 1TCCA 1RAIA 2I80A 3FPJA 1QC5A 1PT5A 4QE3A 2QD1A 1YDMA 3ZWMA 4QTTB 1V8ZA 3WZ2A 2BGGA 1DCTA 5I4KA 1YB4A 4F7WA 2MINA 1CUDA 1N6IA 1XROA 3LP6A 5FUBA 3PFGA 5JALA 1R50A 4NMWA 4GMDA 4Q15A 4DA6A 3WG9A 4DPLA 1IQPA 2PPLA 3ADDA 1TX4B 4P98A 3RR2A 3C4VA 1AKYA 3HJBA 1XTVA 1PNOA 3G1WA 3IKLA 5GADl 2FUNB 4ZVRA 1YS7A 2D7CA 1MO2A 2M32A 3H83A 1G5IA 3PHIA 1FX1A 3IE2A 1WEHA 4QDKA 3U1TA 4RVCA 5ITZA 2XOXA 2C3MA 3FI0A 1E2NA 1V16A 4M9ZA 5T4FA 1ZX1A 3DTTA 2I66A 3INTA 4RTLA 4JC0A 3IIMA 5JZOA 4ILEA 3HTXA 4FOLA 5FQNA 3FDJA 1Z4LA 4DJ5X 4RM2A 2ZUEA 1A9QA 1VPEA 4D02A 2W22A 3VR0A 2BP7A 2AN9A 4BASA 2OFPA 3KQSA 3EC1A 4OXYA 3RT7A 2QM8A 1FXWF 1HL3A 1P2DA 4C76A 5EIXA 1XMSA 2GA8A 2VH1A 1NVWQ 4EFKA 1PJCA 1RQ7A 1II0A 4HNVA 5DBFA 4KEAA 3VR4D 2WD8A 2Q99A 4I1SA 4RYDA 2LCQA 3V1YA 5FOXA 4PGHA 4Q9JA 3PUWA 2H51A 3TV2A 3EISA 4OJQA 4X1IB 1L9KA 4YUXA 5FLXA 3TM4A 1ORIA 1ODIA 3OLVA 3ED1A 5DIFA 4F4CA 1TB4A 5J43A 1Q5NA 1JJIA 3ZH2A 1ZSVA 4E94A 3A32A 3HB7A 3OT1A 4DV6B 3ZD7A 1NAIA 1PWYE 3BTVA 2PUGA 1X7WB 2G80A 3CUUA 1F2TB 1EZZA 1CR2A 1RQ2A 2AZMA 4FONA 4WX2B 4UU0A 3JAMA 2CXXA 2JH9A 3F5DA 4A26A 2C82A 3M6IA 1JFFA 3CPJB 4G0UA 3IAHA 3PGJA 4HEA1 2V7UA 1ZKDA 5KNDD 1C80A 1L7XA 4PSKA 2AW3A 3D59A 1FP4B 3O26A 3QM1A 1NU8A 1P1JA 2OCDA 1TK2A 3BB3A 4J4HA 1X80A 4R31A 5E9QA 3U44B 1G8AA 1SCIA 1G1AA 3GGJA 2BKVA 3HY3A 2C1ZA 4MO9A 3IERA 3SD7A 1XK6A 4BV2A 3WLOA 1WO8A 4OUKX 6AT1A 1G20E 1EEHA 2EBWA 2VDUE 3NHRA 3W4JA 2IODA 2VJNA 4XIIA 2B37A 1IW7D 2C2HA 1O6CA 1XWWA 4C07A 1OYWA 2XUHA 1AHHA 3NXSA 3SZGA 1OX4A 3SS7X 2C8LA 3LHKA 2IS6A 1HDIA 1Z68A 4BNJA 2JGMA 3ZCQA 2IXFA 1G8FA 1F5SA 1SXGA 3AR4A 1Y5RA 4YDRA 5B2FA 4UFPA 3M6FA 4MULA 3ZK9A 2BGIA 3SMQA 3U4QB 1AQYA 3OJOA 3A6ZA 3H3JA 2OG2A 3LF2A 1R0WA 4NJEA 1XVLA 4I9NA 4YV7A 3ET5A 3RJMA 2I3AA 1YZUA 1XBTA 1ESZA 2KBEA 2Z4TA 3LGAA 2K2QB 2PJZA 3FBTA 4A36A 2I2BA 4E15A 2GFHA 3G6WA 1YJBA 2VRCD 1TKRA 3SBXA 3Q7TA 5CA0B 4BFUA 1L5MA 1HDYA 3N59A 4PRZA 5DM0A 4KFTA 3UJ3X 4LJYA 2PK3A 3ONEA 4TRJA 3F7NA 5IT9A 4RMHA 2UZ1B 3U4AA 3V3KA 4JYZA 5LXTF 1Q11A 2FMUA 4X0EA 3CHYA 1A97A 5IJZA 5JR3A 2W6ZA 2FJUA 2BKEA 3D6NB 4M46A 3RK4A 3VR6D 1Z56C 3E9DA 1ZD4A 1O94A 2WHPB 3GPDG 1CNMA 2VTEA 2FSGA 5LR6A 2PKWA 2ZYSA 1T91A 2JC3A 1DWQA 1VG0B 3AVOA 3ZX5A 1DGQA 4F85A 2QTGA 1O96A 2JD2A 1P0IA 1ABFA 1GIAA 2OCKA 4I8XA 1RHJA 2ECOA 4PAQA 2FSPA 1KOFA 4URYR 4B6QA 4CIBA 3ZWCA 3ZWPA 1LW6E 4U0KA 3LWZA 4P5PA 1OWMA 4LJLA 3Q8LA 1RXWA 1KFCB 2IHKA 2IUSA 2DWPA 2X8WA 4KWCA 2RHOA 1G63A 2NYAA 3A1UA 4IO0A 3V9PA 3B8EA 4X71A 1J0CA 4A0HA 5HDQA 4JLBA 4OGFA 1PFWA 3NT2A 4WNAA 2JFBA 3SS8A 2WB2A 5EKTA 1TJ4A 4LC9A 4ARSA 5CFRA 2JLRA 3I32A 2JFYA 3QVXA 1CUFA 3NUQA 4JLDA 1PV1A 4V03A 5BUCA 5FAKA 1SHUX 3NASA 4G23A 1XWOA 4AY3A 1AF7A 1JMKC 2CBZA 2CNBA 1Z2CA 3G49A 4BNVA 1MABA 1DC3A 2HUPA 2VWGA 1HT3A 4PZEA 5EOVA 3UY4A 1EIWA 4TV9A 4RELA 1YA4A 4KAAA 1YK1A 3JWIA 4NZOA 1CIJA 5EC8A 3UMJA 3V34A 4DHEA 2J4FA 2FX5A 1JFTA 1CP2A 1QVVA 2D1YA 1E2QA 3AVPA 3LX4A 4Q3BA 4CCAA 1IPEA 5DULA 4V0KA 5ITZB 3K9WA 3W5CA 4KSCA 4OYRA 3UAVA 5K4AA 3OT4A 1MJNA 1JXAA 2JATA 3VOTA 5KOIA 2V1UA 4Q1CA 2Z2IA 3FZQA 4V3CA 4AUNA 1UZLA 4D96A 3GVIA 1KDZA 4B9EA 1R8XA 2IDZA 3A04A 1Q12A 3GT4A 4F4DA 2PTHA 1XHEA 2HD4A 3OF2A 1A9XA 1ZW6A 3WE7A 4UBKA 3QLUA 4P4LA 2PL1A 4HWTA 3SLRA 2ZBGA 2OAEA 4ZT2A 1BGWA 2AE2A 2VP2A 3BZUA 3PC8C 5HIIA 1RJWA 5TT0A 4OQZA 3JW8A 3VDRA 4YQZA 2O7SA 1I4DD 2GN0A 4L75A 5TGDA 4MLCA 2F64A 1MR3F 1CULC 1SKMA 2WIJA 4MEBA 2XNHA 4N6GA 4TLCA 1JJAA 2XNJA 1ZXXA 2GRJA 2P78A 2QT0A 4XDYA 3GT7A 5LVAA 3C7DB 4YPOA 1C4XA 2D4AA 4ZD6A 4G2TA 3NEAA 2VA8A 4CE6A 5J3JA 3QWAA 3VDQA 5FUXA 3R6VA 5IVPA 1EXMA 2IV7A 2VSNA 4G5OA 4CKCB 4XYBA 3VPCA 4FR2A 3CC8A 4MTLA 5DX0A 3UWDA 1J9EA 1QB8A 2E4WA 2ZYVX 3VR5A 4AO8A 1FFXB 3ZDQA 1TT5B 2HCBA 2J85A 2P0AA 4K8RB 4OMDA 2ISSD 4W9NA 5K09A 3UB2A 2VOEA 2W6JD 1FB5A 3G1UA 4UNPA 4BDTA 1OU0A 2AF4C 3HH8A 4QYWA 5B37A 2YX1A 3UGJA 3N2EA 1WDTA 3N05A 1F60A 1M7GA 2CVQA 1V3VA 2AG5A 2DR3A 1OAAA 1LLQA 2EBUA 4X1KA 4CMGA 3OEYA 4TWIA 1KRHA 1IY9A 1ZL2A 2F3PA 1Y1SA 3BG5A 1IVNA 4P3XA 3IH5A 4JQSA 4TTPA 1GEEA 3FUXA 2QP4A 5JHGB 2QG9A 4L8FA 2Q8PA 3I2JA 3IC5A 3HP7A 2J0UA 4PYQA 5HIJA 4N7JA 1E98A 2NSLA 1IPHA 4S0ZA 1VE7A 1PD0A 2Y9PB 2C20A 4CW7A 3ONNA 4GYWA 2IHTA 4RACA 1YU9A 2QLTA 5LNK1 1XQVA 3VZPA 4G1CA 4II2A 1Y7LA 4JELA 4PHTA 5DNDA 2YMQA 4HDAA 1QHHA 3DLAA 2WM2A 2E37A 3B1VA 3M6LA 4HNHA 2G70A 3M6XA 5CLGA 1ESCA 1EFHA 3QQPA 2BEVB 1PG5A 3G9ZA 3GLUA 2A92A 2JFGA 1CY2A 4YXWD 2HR1A 3NQ41 4HDRB 4JVOA 2JCGA 5AVUA 3PIIA 1G5FA 1JDBB 3B1JA 1QYCA 2XCIA 2PKCA 5EWLA 4BQSA 3DC7A 2DULA 5BWCA 1Q0TA 4OB8A 2NSDA 5AI0A 2H3EA 2P77A 4JUBA 2HGSA 1EMDA 2WHXA 3JASB 4DMCA 2RHHA 1KA9H 4M0LA 1BWSA 4NXNB 4Q47A 3K0HA 3TLJA 3B1ZA 3EXHA 2CGEA 4A8JB 4OH7A 4D74A 2D2EA 2OSBA 3KYDB 3A1VA 2SECE 1YL5A 4HVTA 1E2EA 5CLIA 3VPAA 1XTJA 1XU9A 1O8BA 2XQJA 4FOOA 4U7JA 5CX1B 5D5HA 3ZIAD 2Q2VA 1YFJA 1X74A 3TD6A 3JQQA 4II3A 8ABPA 3GCDA 1H5UA 1KSFX 3KZXA 3L0OA 1NXPA 4MQ4A 2B1GA 3R5XA 1KZ6A 4PPNA 2EKBA 4EEKA 1USUA 1JBQA 4EYQA 1LBSA 2QTLA 1TAUA 1E99A 2KW5A 3BMQA 4TL7A 4LHYA 1QGED 4POAA 3Q72A 1MRSA 2AC7A 2FPGA 4LY0A 1CQPA 1KU0A 3UAYA 4CKBB 1GARA 4Q1AA 4M1ZA 3D0KA 2VS1A 1ZHFA 2BM9A 3FUVA 3NM5A 4IAOA 5AMXA 1G20A 1EVYA 1VYTA 4EITA 4Q1VA 5A7FA 2ZB7A 4Y2RA 1NVAA 3LRPA 4ZCLA 1AZSC 4GF5A 3IUYA 2JLQA 2VSYA 4UATA 3RVLA 2GEJA 4E33A 5HQ3A 3RBAA 4G5YA 2VCYA 4GAEA 3ZU4A 1PLLA 3ZQ6A 4DBLE 1RKQA 5EVJA 1YF3A 4YRZA 2AJBA 1U1EA 2X4IA 1O9HA 4QPCA 2BFPA 2QTNA 2EJWA 1H4QA 1REQB 2NV6A 3CCFA 4FGWA 4KO1S 3HLTA 1YC5A 5JXIA 2NTJA 1XI2A 2ZRJA 1RKXA 2FK7A 1E9AA 4RBNA 4UCXA 3OZFA 1BX3A 1Z2OX 5TPWA 1AC5A 3X1KA 1RWMA 3CZPA 1R9GA 3HXLA 2H2DA 2CZQA 4LJ5A 3ICOA 3RF6A 3RW9A 3IEUA 5HTOA 2IP4A 1B6GA 3OE1A 1YRHA 4NHEA 4IDPA 4DA9A 1YDGA 5LQAA 3VKFA 3PE6A 5AXCA 1JJ7A 5EJGA 5M2QA 3TIXB 3WYGA 3FFXA 4U9IS 4CTMA 5KJ1A 3GA0A 3RPEA 5ITSA 2GZMA 2QE7A 4XYEA 4YCMA 4DRYA 4WZBE 2QJWA 3FHJA 2V7XA 4XWOA 3K71B 1I2DA 2YWBA 3OM1A 3F7MA 1HV8A 2I4OA 3BC1A 1NHGA 2QA5A 1KFKB 4IZHA 4JJ8A 3TNFA 4PN7A 4AJIA 2PMCA 1ZHHA 2Y1WA 1Q0PA 3MWEB 4O1HA 4P35A 4D98A 1KK1A 2R6R1 1YQEA 3VH4A 1P61B 2C94A 2XUFA 1H5NA 2BFBB 3LRXA 1N7IA 1NUUA 1YB2A 3CVWA 3FPLA 4DIFA 4PXAA 2AOWA 5I3ZA 4AG6A 4KQWA 4KXVA 1W6UA 1F7UA 3EZ6A 2QRKA 1PR5A 1LZLA 2CVOA 2XMSA 3BCSA 3SEAA 2PSHA 3HV2A 3P71T 2C83A 5EIWA 3ZCSA 2YJZA 4B83A 1YL7A 3OE7A 4DNFA 3OFVA 1JE1A 1L5LA 4C9BA 5AD1A 4GU5A 3BIJA 3M9WA 4MV5A 4PLTA 5GIPE 4CM4A 1UEIA 3EPPA 1GNTA 4OQQA 1JT9A 3H99A 3C8TA 2XTJA 1E77A 4YRDA 1XTZA 2EL7A 1OZHA 1FVXA 4IHJF 4P3KA 4FN4A 3ZU3A 3MTDA 5C4IA 1X0XA 1ADJA 3ZV7A 2CYBA 4MZDA 2Q2OA 4BKMA 1K5HA 2WIDA 3JZAA 5HOEA 1OASA 1V41E 4NZ9A 5D7NA 2W43A 3O8RA 3NKFA 1L7VC 2GZRA 3IR6A 4IDDA 4QASA 3EIHA 2YINC 2SCUB 4O2AF 3S8YA 3ED5A 1C50A 4EMTA 1S02A 4I36A 4D9JA 1EFVB 4D9CA 2IYOA 4LXIA 1E2LA 4JQCA 3T38A 9ABPA 5IT0A 1NXTA 5DMHA 3VDXA 2OUKA 1IOWA 5EERA 3G13A 3CEAA 4G0PA 2GX6A 5CEJA 5AJZA 2GN9A 4L4UA 3T1HB 3OKCA 1FLAA 5A9TA 2QRQA 1VJGA 3Q15C 3CR7A 2CV0A 1IQRA 5DOZA 5IF3A 1NXWA 1DXOA 3N9IA 1OUMA 3KXIA 2DH5A 4IX9A 4DLBA 4F8YA 5IC4A 2ODNA 3RU3A 1OXMA 2VHYA 3RC3A 3RI3A 5CA1F 2VT6A 5EWJA 4BLTA 2O23A 1T6XA 3EOAI 2GXUA 5GTDA 4YI5A 1NW8A 3AF3A 5EJEA 1WJGA 3T7AA 3ZWBA 3WTCA 1HRKA 4YBZA 4M0KA 3NKLA 2XUKA 5FOUA 5B6IA 3KKZA 4C0BA 2B2CA 2PMBA 4DIUA 4IXWA 3AVYA 3LW7A 5D3QA 2NYRA 3A25A 3GFQA 2PYZA 3Q0IA 4TSRA 1X2EA 1RYDA 4U2EA 1NW3A 4BO0A 2DQZA 2XZTA 4GSKA 3RSSA 4CFYA 4CMIB 1MB3A 3WWOA 1HZZA 4KRFA 5AICA 2HF2A 2WUWE 1ZR4A 4ZGBA 1QTQA 1DARA 2A3RA 3M6UA 5FNZA 4BKPA 1KEEA 3H6GA 1NUSA 2WJWA 4G01B 1NC3A 1FF9A 1VCMA 2QSZA 2A0KA 1X19A 3AJRA 1CUSA 4DBZA 1JU9A 3IUEA 4AMVA 4OHWA 4AO7A 5JPCA 3U48A 4OBWA 3O3NB 3OZWA 4RHXA 1JHDA 3OZCA 1E9RA 4WKBA 4B4DA 2RGRA 5H82A 1EFTA 2IOFA 2I33A 1NXXA 4YIHA 2VAVA 5JRZA 4ZRNA 1N2XA 1NN1A 1NM5A 1FUIA 2PQ0A 4OJTA 4Y9TA 3WYEA 4ISCA 2R6AA 4LX0A 5JBNA 1OIVA 3MIZA 1GPH1 1HY3A 1TU4A 1YJ5A 1NMYA 2VHZA 3FFTA 1NFFA 1IAVA 2H0RA 3EGWA 3LCJA 3QXSA 4G0ZA 4L8GA 5BRAA 1E2FA 4R8SA 3I2IA 1LLDA 1YZYA 4ONEA 2BFEB 4GEGA 4U9HS 5H0IA 3ZYCA 3QA3E 2RCYA 3G2NA 3D4PA 4N5IX 1PGOA 4IHKA 1EQ2A 1Z5VA 1HDEA 4HPWA 4BIIA 5E0KB 3EGVA 3UIEA 1HM5A 4FGZA 5EZ6B 3AF6A 3JWJA 1CG6A 1RC0A 1EUYA 1K6IA 2DLCX 1IEWA 2BD0A 2CXHA 3D6UA 3JVVA 1JP7A 2WWVD 4BX2A 3P4UA 4EABA 3TNYA 3VX4A 1C0KA 3EDRA 4CQNA 2B92A 3WX0A 4KR2A 3F3MA 1KL7A 4PQEA 1T9DA 2X1MA 2XT0A 3OEWA 1HO3A 1XEWY 1SVSA 2ZANA 2O4CA 1YS9A 4Q19A 1KY3A 3ES9A 3I37X 4QFBA 5K3AA 4E7PA 5JXJA 2B1RA 2X3YA 2YWDA 4NXMB 4NBLA 3U3RA 4C1BA 3PEFA 4ZRMA 2WOJA 4MRVA 4KPEC 1Z5NA 2JANA 3AFMA 5K0LA 2VRBA 4JP2A 2UVQA 3VSBA 3O1JC 1NV9A 4L76A 2FFBA 3AF1A 3AF5A 4CIWA 2ZATA 3T7CA 1ORVA 1PZEA 1UOOA 4N40A 2E5FA 3Q9SA 4GBMA 4F1WA 1ICEA 2WW8A 3KBBA 1FDTA 3IQFA 3MT8A 3HBAA 1ZXBA 5F5LA 3U7QA 4TWBA 4ZHSA 4ZJZA 2WNSA 2WJGA 1R1DA 3ONDA 1CUZA 1TJUA 2IZ6A 4KYIB 3MINA 1DJNA 1HOXA 1EX7A 4MI6A 4RV9A 4MQFB 4TKZA 4XEUA 3W5JA 4Q4DA 3U5TA 1LF5A 1SKYB 2BFNA 2ZTMA 3HFSA 3NYIA 1W85A 3G8BA 1XDGA 1F51E 1PNVA 2H2AA 2IE8A 1TAGA 3A11A 3FAZA 1CSEE 2AZ4A 1Z18A 1DMRA 4MUFA 1EP1B 5EHXA 1H9CA 3OJWA 4JMPA 4ACBA 2JJ1A 3RHSA 2FMXA 4C3ZA 4KWIA 5E6SB 4CM6A 3M5CA 1NNI1 5I51A 1QGZA 3BILA 1VDKA 3HKEA 4FP9A 4JR1A 4URUR 4E31A 4EJ6A 2ZBDA 5KCMA 2N42A 3F4LA 4NZNA 3J80A 1QG6A 4QZVA 1R5NA 1GKUB 1OLSB 2BUCA 1EG2A 3HCOA 2PNJA 4DADA 5K8JB 5A0VA 3O47A 4UNNA 2AB0A 1UMBB 3P9IA 3EEQA 3V4OA 3ZWVA 4C87A 3TRHA 3OT5A 3Q1LA 4N39A 4PS1A 1DBPA 4G1MB 1J8DA 1QE5A 2C9CA 4QIHA 5E9JA 3JU3A 1NRXA 1FNCA 1UOEA 1NBMD 1O6BA 3PGKA 3HGTA 3IAM1 4KQ1A 2W11A 1UPUA 4YRMA 5LOVB 1C3XA 1R6DA 2Q1TA 1I6MA 1VXOA 4PAOA 3KJXA 2AXPA 3H5TA 1NL3A 3AP3A 1C4OA 4O29A 2HIHA 3JARA 1NVTA 1TVKB 2IOYA 1I7NA 2VN8A 2SICE 2XVMA 2QN6A 4OQYA 4Y67A 3M6WA 1RBZA 4WZBA 3ZCPA 4XKJA 2EGGA 3MS7A 3ACCA 2ZJ2A 3IO5A 3N0RA 2DE0X 3HSKA 4DC9A 1QK5A 1JDBC 1N3YA 1T3SA 4IMRA 1SHZA 4C7OA 2BGRA 1PDVA 3C3BA 1JPVA 3E35A 3QPUA 3VR5H 4BO8A 5BT8A 5I7OA 4TMWA 2I8CA 2ZBFA 3V2IA 1OR8A 4ZYWA 5EUCA 1JEOA 3QF4A 1L7OA 4BV8A 2ODPA 2UYQA 3HFGA 3K32A 5DHSA 5FPPA 5DX8A 2A0WA 3N8GA 4A16A 4BXOB 2Z9DA 1O6ZA 4JSRA 1JNXX 2Y77A 2AOUA 1NP3A 3CM0A 3CNBA 4A8JC 5IDWA 1WW3A 2FPMA 2WDZA 4X93A 1PI3A 4YC7A 4IIXA 3RYIB 3STXA 1IN4A 2ZCJA 2EG9A 2CCKA 3I5MA 5KS2A 1YI0A 3HEAA 4UBMA 1BDIA 4UEOA 4ZDWA 2AI2A 1TTQB 4YCBA 1A04A 5HBGA 1W4BA 2H6EA 1RMYA 4IMJB 3U0BA 3V8BA 2VFAA 1WMSA 2WOOA 3ABZA 3QHPA 1I10A 2RK3A 5CIYA 4HEQA 2EJUA 1RYYA 4HZUB 4CETA 5BWMA 5A4JA 1K3TA 3QKRB 4RORA 5BW6B 4I1PA 2KBFA 4LPKA 2C4VA 1W1WA 1NV8A 1TVMA 4G4SP 4OH1A 1VIAA 3K7EA 4F4IA 3G89A 4OG2A 2PMFA 5DYNA 1P0MA 5HP4A 4IGIA 2V0GA 1G42A 3LIIA 2Z8YA 1EFLA 1W75A 3KPUA 4Z0PA 4DABA 3BXXA 2G4LA 1ORHA 4IVPA 4Z4GA 1ESMA 4UUAA 3BXZA 1T9CA 4D82A 3GU3A 5BXQC 1D2GA 2PCJA 4GC5A 1C30B 1U8FO 5P21A 1J2UA 2YXBA 3QMWA 1EQUA 2XADA 2YMLA 4NMXB 1M5UA 1YCDA 2HV8A 4ZO6A 2C61A 5A71A 2A0XA 2W2VA 2CSUA 1QS0A 3WB1A 4JA0A 4UTZA 2H63A 3BB1A 3DZJA 1U2GA 2CLCX 4Q48A 1M6YA 4W1PA 3EE6A 4LXYA 1A7AA 2BDUA 2PS3A 1SQSA 3IFSA 4DV1B 3MGBA 4NJMB 2FUKA 3V4LA 1JIKA 5D2CA 2W6PA 1U9IC 1UFRA 3L7KA 4HDMB 2X19A 3VUEA 2ZRHA 2UKDA 4FBMA 2WIGA 4L78A 5GPBA 1IN8A 3QXHA 4ZYYA 1FFCA 2AYYA 1EK1A 3H9CA 3Q8MA 1EFPB 1DBIA 2IGTA 4Z53A 1V4BA 1FS6A 2DFNA 3H6KA 5F21A 2DXIA 2E9SA 3C7CB 1YE8A 4EYKA 1I4EB 2QL9A 2A94A 1SY7A 2Z08A 1QNLA 4NAHA 4JUAA 5LZ9A 4LSWA 3RROA 2Y0BA 4RGYA 5EFOA 3W2HA 1OGYA 3VDNB 3EXG2 3NJ8A 4O2BA 3WKAA 3LUHA 3W5HA 4INZA 1ID1A 1D0SA 2WZQA 1PX2A 3CRNA 3BCHA 1YZLA 2EYUA 2QPTA 2N47A 3DKPA 2QN3A 5EIOA 4OHYA 2XBMA 2LZ0A 4OKSA 3CLKA 2AGVA 4NU0A 4EF6A 4QOFA 1MUUA 2X1HA 1TJ3A 1Y8CA 1LDEA 1KI2A 2JGNA 1C2YA 1K62A 2ZVQX 4B43A 1W0JD 9GPBA 1T26A 1Z39A 2VUTA 4Q39A 4BQIA 1XZGA 1X86B 5LUAA 4K9OA 4LW8A 2ZRFA 4BNXA 3ICWA 2Q46A 2ZIWB 5DK4A 4WI1A 3HJTA 1R6TA 2GSDA 3MYRA 1EHYA 4S2EA 5B7QA 1O4VA 2O0JA 2R48A 4Q1BA 2P9BA 3LF1A 3KZCA 5C46F 1E1KA 3GCXA 3PFNA 1M73E 3DDNA 1CUHA 3MLEA 1CYEA 3BGIA 4YYEA 3NV7A 4LGMA 1BX1A 4N3BA 2D0PB 2VYND 4BECA 1E4VA 4RA6B 1IK6A 5LA6F 4HNSA 5DTJA 1R9JA 4RU1A 3D31A 4NS1A 1SUFA 2WVGA 4PANA 3ROTA 3DUWA 1D09A 1DX6A 4CUKA 4L74A 2QG6A 1ND5A 4HC4A 3V80A 3QHQA 1M2NA 3BHJA 4H7FA 2OFXA 1ZUHA 5C8YA 3VRHA 4DWWA 1MX9A 4JBNA 4JODA 2A1UA 4P34A 4RD6A 1KWGA 5HGJA 4HDKA 2QRPA 4JT2A 1K7FB 1U11A 5DGDA 3LNTA 2IEGA 1DC8A 2HT6A 2ZJ3A 4ZT4A 5IUKC 2CUKA 2DETA 4DHWA 5GJBA 3F0TA 4H7PA 2BTEA 1JDNA 1ZH0A 1GU7A 1L4LA 3P4XA 3S1AA 2XYVA 1FU4A 3KQUA 2CWDA 3C3EA 1KPHA 4Q03A 3AKCA 1ZGCA 3TQFA 4YJGA 4HWSA 4OYHA 1XVVA 3GQBB 4KR0A 3ND6A 5FNVF 3L7BA 3V33A 5DV9A 4P7JA 4DDTA 1RMTA 3LHDA 3USZA 4ZHQA 4HX2A 3WMWA 5SYMA 2JEZA 4QYIA 3PPVA 2VTKA 2HW8A 3RYTC 3ZY2A 2VBIA 4WMLA 4G3XA 1Z0SA 4X63A 2BM8A 4LE2A 4CG0A 3TDKA 3FPFA 3BSSA 2C2YA 3MQ4A 4O0LA 1U5AA 4MIKA 1BS2A 2WVJA 1LLCA 4DVJA 2RH9B 1BMFA 2XZPA 4JBXA 3LOUA 4ITUA 1U0OC 2B8WA 3U7HB 4KGVA 5FPTA 4B80A 4JGGA 4DSUA 4LZAA 4EJSA 2PGDA 1DC4A 1FFYA 1IJFA 2BTOA 2IE0A 4L3WA 1T1JA 3SR4A 4XUGB 2PGNA 4Z4FA 2FWRA 4MS4B 1Z74A 1TUGA 3HKBA 3GL9A 5TQJA 5KTOA 2VNSA 4JR2A 4RV5A 1BCRB 1UPXA 3FDFA 3JALB 1CJMA 4V39A 3UAOA 1K7YA 2YJ6A 1Q22A 4IKOA 2WNHA 3CVJA 3WIBA 5AK0A 2FRXA 3OQOA 3CEHA 3PC7A 3VKVA 3ZXYA 16PKA 2KYRA 4TKVB 3UCXA 4EB8A 4QDXA 2YW9A 4O4IF 5DN6A 2GCPA 2RCNA 1QV6A 4RCVA 4D8YA 2BKUA 3PUHA 2PHZA 1IVSA 4TQUS 4LWPA 1PQPA 1L4MA 1SUEA 2XI4A 1IHYA 3DAOA 3O73A 5I48A 3KQPA 3LZDA 4PLFA 4N3GA 2MYTA 1BXGB 3A8TA 4FI3F 4KHPB 1E8NA 2Q8NA 5LM3A 2FZLA 4XGQA 4HNQA 2HU5A 3GRZA 1NX6A 4UPDA 2FOLA 3SGLA 4IDAA 4LXQA 4YJ3B 4KO4S 4LJSA 2CD9A 5EEHA 4DMMA 3QU4A 3HEBA 3QVUA 3O8BA 2QGAB 3ZVRA 1KQGA 1EWTA 2ZIEA 4JGBA 1U8AA 1ZNWA 3T06B 4D3DA 5K0SA 2Y6UA 4BKOA 3FTQA 3UZUA 2J7KA 4NTZA 3G1TA 1ZI9A 1AUWA 3K9NA 3SSOA 5B6PA 3EIQA 2ADOA 4DQLA 4YTEA 5CBPB 1H8EA 1UXHA 1ZNYA 2J9FB 1E5LA 1A9ZA 2JEYA 4Z99A 3IT0A 3THWA 2GK4A 4V0ME 2BMEA 1GEGA 4LK3A 1GO2A 2RGCA 5GJVC 3UJAA 5AW0A 1L7BA 5L7YA 4BQQA 3R5KA 1N2JA 3JZIA 3JYNA 2W6OA 4MQUA 4G9EA 2I3ZA 5J47A 4PC3A 4R0NA 1SQ0A 2GJ4A 5AW8A 4IQ8A 3EXEA 4TTVA 5D1NA 3K1AB 2BHNA 3KOYA 1U7PA 4S1VA 3RKSA 5DIZA 1YWGO 2CJPA 1KZ4A 3H1BA 4W5TA 1Q92A 5AJXA 2H1IA 2G8NA 4YP6A 1GRVA 4A73A 1QBGA 2MTBA 4BAZA 3OLWA 4OQFA 1M8GA 1ESNA 5C8DA 1TQ8A 1BCSB 3CX6A 5D84A 4IZIA 4YJ2A 2OZPA 1XPUA 1XNRB 4JN6B 5DBIA 3TDMA 2QQEA 4AMYA 3ZY5A 2C98A 4KQEA 4V1CA 3HXOA 1IB6A 2UDPA 1UJNA 1YCFA 3SMVA 4GYYA 2MSEB 2V58A 5F7ZA 4Z0TA 1U0GA 1E2MA 4YFYA 3WBFA 4PNZA 6REQA 1Q1AA 3HCCA 4W1SA 1WAMA 2GSWA 2YICA 2GYVA 3CEJA 4HWRA 4JLPA 4AG5A 3M2PA 1NOKA 2PZKA 3FFWA 4O4HF 3R1IA 5J2TA 1O03A 4CPDA 3QELA 4NOKA 1JZQA 2RGGA 1XTBA 3SSMA 1IE3A 4HZIA 3BJMA 1RZRD 2ZSEA 4G8CA 1BQ4A 1PS8A 3I04A 1TLFA 3STYA 1P4GA 4ZFNA 4ZODA 4ER0A 1BRTA 1R4NA 3B9QA 3C3YA 3CPEA 4ROTA 2APJA 5EJFA 3SKYA 2QVZX 2ACWA 1QH8B 2BUBA 1P72A 3NAMA 4L02A 4MCAA 3UO8B 1VPLA 2GVZC 2XB4A 3JQGA 4ZCQA 2H1HA 1HX7A 2C1XA 3WWEA 1NUTA 4LV5B 3A1NA 5EZYB 1Z4OA 5CJPA 3SJUA 2XCUA 4EPXA 5JT1A 2GERA 4QFMA 1BA3A 2D5IA 2GTHA 2HB6A 3GVCA 4BQFA 1YFLA 1IUKA 4PLWA 4D4JA 1YOVA 5IKEA 2GPTA 3N5KA 2NUAA 3VYUB 1E2UA 2G9NA 2RD2A 4Y2JA 3IE1A 4B2YA 2QRVB 1UCFA 3ZZ1A 3VYVA 5I7HA 4RC9A 1BHSA 1ZK2A 1Z7WA 1THGA 3NU1A 3QE4A 4M76B 1PS0A 3IP1A 3R3UA 5CJ2A 5F7XA 1QB7A 1RJDA 4LQ4A 4OY3A 4WCVA 2YY5A 4YP0A 3MMXA 4ENVA 4RGBA 5I7FA 3GP8A 1YDFA 4AMBA 3R7NA 5CT8A 3TLKA 4YX9A 2CLSA 3E8MA 4ZOBA 5D6NA 4BNDB 1VP3A 2EDAA 4ZV7A 4ZO8A 1QAQA 1NNEA 3ZI7A 4M6WA 2JPDA 4MUEA 1GA4A 2HMWA 4EEZA 1ZDMA 4YYZA 3WFIA 2DU8A 4YH1A 5HUHA 1AUVA 1XZNA 3TCNA 4WBNA 5JSUA 2M9MA 2CEAA 2HHCA 2Q62A 2RHRA 1CQXA 2H29A 2UZIR 3BE6A 3L1UA 1YC2A 4P4NA 2HF7A 5G1OA 4ZC1A 5AW6A 2V7QA 3RIHA 4Y2TA 2FPKA 4KNWA 4DA7A 1UQUA 3OZDA 2WR8A 1CZOA 2AUNA 2X0KA 1G2PA 3R0VA 1JHQA 1N0IA 4YRCA 3UWKA 3W06A 3WRVA 2QTVB 2P6UA 2HZ7A 2YZKA 2IX9A 3S2SA 5KTSA 1PVDA 5J59A 1JFRA 4IUBS 2AKYA 4Q02A 4TTRA 1G6HA 1D1PA 1YDHA 3OI7A 4IGFA 4LWQA 3F4RA 4YAUA 2CT8A 2P6RA 2GYUA 3FGPA 4I1IA 4GW3A 3UVEA 3V7FA 4AO6A 4B3TB 1T1GA 2QLFA 3OEED 2J7PD 4TN1A 2ZR7A 4U9UA 3PKJA 3UBMA 2RFLA 2YJ4A 2Z56A 4GWLA 4JP3A 1EK2A 3D5QA 4C0LA 4P33A 2CLOB 3OJ0A 3PYMA 2OHJA 4LYJA 4L22A 4OXQA 3TTUA 3ZJ5A 3STVA 2AX4A 1WLYA 2G28A 4TSFA 1T0HB 4BAUA 1VHLA 1RNLA 1YFZA 1ZYUA 2YC2C 3AP2A 3E22B 2OYSA 2PRZA 2YQ5A 4TXHA 1GGFA 4X84A 1PRYA 1ZJ4A 3NWBA 5BNZA 1ZM7A 1BWRA 4Y1FA 4JI3B 1J07A 4MWCA 5EJ2A 3EY4A 4W5QA 2YN0A 2OBNA 1O9GA 3T3OA 3O74A 2P2ZA 4BMSA 1OZFA 3H9BA 4G5RA 5FUMA 5CNKA 2IUTA 3FHTA 1JEQB 4GR5A 4EHKA 5JMWA 3IESA 1XDDA 2J8ZA 3D4LA 4G9BA 5LWHA 1V8PA 1X7ZA 1UPAA 5AJWA 2G9UA 2HDWA 2AOVA 2VUIB 3W4KA 1SEPA 1WUJS 5B3JA 2XW6A 3HUEA 2IOQA 2QL7A 4RZHA 2OD9A 1N32B 1VC2A 1W87A 3Q8WA 4RLFA 4B4VA 1ORDA 3TE7A 4ED9A 1R74A 1MV5A 4MQ6A 4FQ8A 3AUTA 1LXCA 3EJWA 3IMCA 3RSOA 4JZYA 1P18A 2PH7A 5EKDA 3W8NA 3ELDA 2EHDA 2LXNA 1T9KA 2G6BA 1UXOA 5G53C 2WWYA 2LRHA 1TZCA 1JLKA 5FWYA 1YR9A 4HH4A 2OZVA 4XQGA 3ZLJA 4H6PA 5AM2A 3IQIX 2DAPA 2P6MA 4CF3A 4D8UA 2ZJBA 4JVSB 1Y9AA 3DE6X 4G1FA 4LYFA 2EZ8A 2A78A 2UAGA 3ECCA 4JLJA 1DEXA 2O52A 1HTWA 3JRWA 4Z9YA 4OX9Y 5GM1A 2PSJA 5B6JA 4PNHA 2BW0A 4MVYA 5CVVA 1E0KA 1M2WA 2OO7A 5J40A 5JE8A 3RLFA 2FQXA 2WTMA 4BPRA 3ZUGA 2X3UA 2V3WA 4UARA 3IO3A 4QPDA 4EEIA 1MG0A 1KMHA 4HEA6 4KV9A 3C6XA 1AS3A 4OHRA 2ODWA 4FXOA 1H0HA 1XAHA 2RDMA 3LBYA 4FHZA 5KYGA 3DUFA 3V7UA 1XJWA 1K4MA 1PN3A 2LKCA 2NO0A 3A4MA 3OQ1A 7ADHA 1UMCA 3UAWA 2QTTA 1KQNA 3H4MA 1UPBA 3TBFA 4B32A 5LU9A 3KVNA 1XD2A 2NVBA 1T3TA 4ZU6X 2EZ4A 5BVGA 1T0UA 4X65B 2IPLA 4XYLA 3U7FB 3VTAA 2B25A 1PP4A 5ALZA 3L05A 5LPNA 3D6MA 3PXBA 5AKKA 4OD0A 4OL0A 4HT3B 1U1DA 4HOYA 4O4JF 2DQYA 1HNNA 1QM5A 3OUZA 5K0NA 3BA1A 3D2LA 2BLNA 2POCA 3KAKA 4U6NA 4Y2PA 1VRCA 2ZWMA 1PJLA 2OWDA 2GCNA 1T8TA 3D64A 2ORIA 3EFOA 1TT7A 3OF3A 5F2EA 4YP9A 4DC0A 2LDBA 4K9QA 1T2UA 5BR4A 1RLOA 1QKJA 5C7OO 4X6YA 2Q0XA 3FVWA 3O8NA 2I91A 2BZ1A 3WOVA 3R2JA 4HGVA 2HHLA 3ZTWA 2NO6A 4GP6A 4IRMA 4KUGA 4C0WA 1S2OA 2ZIZA 4MDHA 3DE2X 2FEAA 2C77A 3CCCA 4EB3A 2R96A 1IDOA 1WZUA 3H04A 1KJ9A 2N9UA 2HO4A 4XB2A 5CCEA 1AM4D 1S4QA 5BQOA 1VB5A 1JG1A 3AFIA 4MYCA 4TTSA 3LTEA 5BSWA 5JIBA 2I2DA 1BEZA 2GBPA 2EJVA 2QMUA 1Q7GA 1S6YA 2C9OA 1R4ZA 2JDIA 3IAEA 1ZITA 1Q91A 4LZWA 4RIGA 3GBVA 3IBSA 5B1EA 1UKBA 1UM9A 2HCJB 4BGIA 2E49A 3C1AA 4C1NA 2FN7A 3FZNA 1KGSA 1Z35A 3O0DA 3QY9A 4AZTA 1QF6A 4Y6SA 1VI5A 1UKYA 3LCMA 2M6RA 4MW6A 5CK4A 5AKEA 3F97A 3NNDA 1MT0A 1PG0A 4MGIR 4DRXA 3TRDA 1F2VA 1U2PA 1RXEA 2QLLA 3A26A 3AI2A 3I9V6 4KGXA 1UKZA 4NNJA 1I5RA 4BLSA 3NEPX 5HIMA 2A3NA 4KP7A 1LZKA 3DOFA 3MG9A 4OSPA 4R54A 1Q16A 4TT3A 3H4TA 1MLDA 4UTVA 1SOMA 2I76A 2ONCA 4PM4A 5CG1A 1UMDA 2BGMA 3DVAA 4MQEA 3THXB 1VCHA 4X8MA 3TZBA 2XMGA 1FDSA 2GJ9A 1A5ZA 2C92A 3ZNOA 2DHDA 5ICEA 1V1RA 4A0QA 1A0OA 2QYSA 3AY6A 3IUQA 4RZIA 4WE3A 4E2XA 4H6VA 3WDMA 1ZSNA 2FOIA 5IPFA 2V65A 5GONF 1F2DA 5BXYA 1J2YA 3GGCA 1S7GA 4M1OA 3IDOA 5TGTA 4BMZA 4PY2A 1OLXA 4LV6A 2OOSA 1PHPA 4HF7A 3PUIA 2R1TA 4DJJA 5HJEA 5JS6A 1ISHA 4QO7A 4O2BF 1YKSA 3IUSA 3K09A 2MU1A 4PNPA 2REQA 3CLTC 2GYWA 4Z4EA 1SC3A 3BIOA 1JLSA 5FOSA 1JALA 1LEHA 2ZRIA 3IULA 4CKYA 1XCLA 4HGPA 3DMDA 1FLDA 3OICA 3QKTA 4LOAA 3MQ2A 2FU5C 4B47A 1EP2B 2N1MA 4PZYA 5J1TB 3R9KA 2P11A 1TDJA 2W58A 1N3IA 2JG3A 1K9SA 4TTJA 1VPWA 4MWGA 3UANA 3W6UA 3EMBA 2C42A 5GMOA 3E61A 1MC4A 1WCYA 1UAAA 5A03A 3INRA 1RHKA 1QYWA 3NEYA 4MO2A 2ETXA 1PZXA 4K9RA 3P9QA 2HJVA 4PRLA 2DMRA 5JAIA 2Z6UA 1XDWA 4KTTE 4NP6A 3LMKA 1Q7RA 2CMHA 2RB5A 1HA3A 4C2TA 1F4VA 1Z0DA 5F9FA 3ICVA 1V5GA 2IXTA 2A5JA 1PS9A 3GMIA 1UP6A 1E3WA 1EXWA 1E20A 1V3QE 1G6Q1 2R8EA 1NQOA 1PJQA 2G1UA 2FPLA 4U2GA 5IRCD 1RYEA 1XD9A 3RKRA 3DMGA 4RTQA 1MNQA 3WY9A 1UDRA 3ZIUA 1GZ7A 2ZE5A 2OG1A 5ESXA 5KYUA 1FC0A 2J5RA 3JR7A 5THXA 5EL0A 2BGLA 1TMYA 3WA6A 1SC4A 1J25A 5SZHB 4B0PA 3CG0A 4NH0A 4DCPA 1NZJA 4W82A 1VECA 4OQ4A 1DV2A 2LWIA 2QRZA 2E1PA 5FAXA 3T41A 3F6SA 3VC3A 1KRXA 1V0JA 1SHKA 3GEPA 4HN2A 5JVDA 2G1AA 3H2HA 2D1SA 3ASZA 1XRSB 2VPXA 4BB9A 3TGPA 4DUYB 2V59A 1SVNA 1MFZA 4D41A 1IXYA 2W2NA 1AQUA 4LBZA 4HH1A 2NVUB 1AQLA 1YBVA 3D1VA 2KQUA 2QPLA 4LNUB 3KQYA 2XH8A 4WESA 1P44A 4DSNA 1FNDA 1G21B 4RPKA 2YV3A 4Z9AA 1I01A 4I55B 1YZQA 2AJTA 4ADMA 3PEWA 2F48A 3VVMA 4MVJG 4PG5A 4DBVO 2ZDQA 1KETA 1UC9A 4KLNA 2OYRA 4BWFB 2WA1A 1AXRA 1SR8A 9LDTA 3P7MA 4EATA 1JVBA 3GJQA 1WZNA 5COBA 1QE0A 1SCAA 4BMPB 2G1JA 3VR1A 2XR1A 4NMLA 1PQ4A 5HCUA 4AJ9A 4L4XA 4P3YA 1LTQA 1EVIA 4EYOA 1XEFA 1W4RA 1LSSA 4RF3A 2OESA 2EFHB 1IWBB 3Q3IA 3RHFA 4H15A 3WIDA 3HB4X 2E82A 2XYPA 3QU5A 4GD3Q 3KUUA 1LJ8A 4CNQA 2Q3EA 3U6KA 1MPXA 1UMKA 3HKCA 4LDJA 2WUEA 4FJ1A 3TN7A 3BKWA 3Q87B 4KC0A 2C3PA 4MZXA 1J21A 1U3CA 4B5KA 3B13B 1UBNA 2W70A 3MRXA 4GI5A 2GD1O 2BFFB 1NLFA 3KLOA 3EGXB 2YJGA 3EG9B 2XGJA 1NMQA 2Z9BA 4DJDC 3H1FA 3O4HA 3CSDA 3P2OA 4KL8S 2C3YA 2QQ0A 2O2YA 4JJAA 1P1HA 4CQLB 3FPBA 2YHUA 5JD5A 1A72A 5FKJA 3CO0S 3F1KA 1ECJA 2H2IA 1Z82A 2I6GA 2NZWA 2VPPA 4OXXA 4XD7D 5ENDA 3V46A 3VR2D 1O5TA 1GAQA 1CQJB 2RHTA 4J4TA 1QYXA 2I4TA 5EZ5A 2R1VB 3A9VA 1L7NA 4RPIA 3GZJA 3TJZA 2P7IA 3GLGB 3DC2A 1UBHS 4WEQA 1JFSA 4N54A 5IDQA 3H1TA 3GOHA 1Z6PA 5K7SA 1OBHA 2BJVA 4GKAA 4A4DA 3VXKA 1ODSA 5JSHA 2R87A 2BJWA 1P60A 1E0DA 1C14A 2JIZA 4QYSA 4X1YB 4QXRA 1VBNA 1KTIA 5EQFA 1EUDB 3Q3GE 2YXEA 4MUKA 2JKZA 1Y9DA 1APBA 1QDEA 5K9ZA 2FLVA 3LHSA 3SIRA 2GKSA 2HBZA 4U7WA 1IAQA 3MUNA 1LD3A 1H2ZA 5LUBA 4MH0R 5F23A 4FS8A 2ASEA 5CH5A 3I6QA 3U7IA 3QV1A 3OM9A 1UT8A 1DLJA 1L7QA 3KZOA 4F9GA 2XZLA 3DXFA 1A9PA 1I4WA 3M6MD 5FL7A 3SQOA 3UT5A 5JROA 2O6HA 4DUZB 1Y5MA 1IPFA 1VJRA 2Z43A 3WV5A 1Z0FA 1MGOA 5CD9A 2O8BB 1ZKMA 4HGYA 4E13A 4JI0B 3PNQA 3IMEA 1PT9A 3QSYA 1OZGA 2IHUA 1AMOA 1AQJA 3RBVA 2RGNA 5HE9A 2X5KO 5TJHA 4OQEA 1EM8A 1NONA 5JJKA 3L01A 1S2GA 1QHYA 2IUYA 4Q3DA 1QGOA 3UGTA 1GUFA 3QEOA 3SF0A 2Q3HA 2O59A 3BMNA 5LP6B 4YJ2F 4TVBA 5FLKA 5CAEB 4QC2A 2ZYRA 4O2LA 3U9SA 5AVWA 3KIPA 5L3SB 3VKGA 1LSJA 4D3ZA 3ZHVA 2IUUA 2PTQA 3LWDA 3CZCA 2YW2A 4G85A 5FWAA 2HFJA 4J3FA 5SZIA 4BFCA 3G7SA 1W19A 4DWJA 6LDHA 6Q21A 2Z6VA 3TINA 1EDOA 4YJHB 3SYKA 3H1PA 1JWAB 3BGVA 3BJZA 4IJUA 1OVGA 3OQ6A 1D1QA 3MA0A 4P58A 2C00A 1KIAA 1N1GA 4FGLA 4OK6A 2BHSA 5JI2E 5J2TF 1XNGA 3FUCA 4ZOCA 2ZBPA 2AOXA 3IKMB 1OTXA 4FEYA 1PFKA 3UV3A 3CXRA 2GBFA 3BWMA 3JQRA 2A5GA 5DLYA 4MS1B 3ZHBA 3QJYA 1Y7TA 4PAGA 1ZOSA 2XDYA 1Q7EA 1MH1A 5CDGA 2K7FA 4X5OA 3BGDA 2BISA 5I7VA 5LLDA 3DF7A 5BN1A 2PL9A 1ONSA 3UHJA 4A8HA 3G7NA 5CVTA 1EINA 2F62A 2Q5IA 5L7TA 4P93A 4LISA 2VP5A 5CK5A 2CLMB 1MX3A 2RJNA 1EEXB 1YRQA 4KIWA 1PFUA 4UJ3A 4WTOA 3EVGA 2CNKA 1E7QA 3KE8A 4BMDA 1H23A 1RJ9A 4CKXA 3EDCA 1V35A 2OR3A 1JQKA 2A7XA 4NBVA 4QDTA 4D9FA 1UOPA 3W90A 3W3AD 1GAEO 4AB1A 3A3NA 4UBJA 5IJ9B 2SNIE 1ZVKA 4P08A 4RABA 2IS1A 3DHNA 3QQ5A 4AF7A 1F0PA 2CVPA 2JVJA 3LQKA 3MRVA 3T9AA 3RAPR 2WK1A 3IPLA 4N5LA 2RAVA 1UJCA 3FZEA 3F4TA 2J6BA 3GJ0A 1Z5GA 4GMFA 2FPWA 2XZDA 4FWTA 1EHCA 4YJDA 1M2OA 1HF3A 2X5OA 3HBMA 1N5RA 2X1LA 5DXFA 1QQ7A 5ANRB 4J3NA 3JYQA 3B82A 1YIOA 4OV6B 2VATA 3UFXA 2QNIA 2ORED 3AVQA 2FN9A 1V9CA 4WZAB 5D8DA 5LDHA 5EP1A 4DEYA 1LRLA 3EXFB 3VI4B 1I3OA 3S2YA 3WRYA 5JO9A 4NWIA 4RX1A 2FVXA 2LW7A 2W7TA 4WBNF 1RLUA 2GFIA 3REQA 4BNKA 3ZXIA 4MUJA 1D5CA 1OA0A 1HE4A 4L50A 3VU1A 4B81A 5IZCC 3WGIA 2WM9B 1EUCB 2GHIA 4YR7A 5IJWA 1OHHD 3MTGA 4GPZA 2P90A 2PU7A 2IIVA 3ER8A 2ZRMA 2G04A 5FPYA 1J1IA 1LB1B 1LNQA 1Y8RA 3DL2A 3ZTTA 1GCGA 4WXYB 1FRNA 3RHZA 3KJZA 1PG2A 1I9CA 1L6RA 1S89A 4GM4A 3UH1A 5HZKA 1W44A 2PKQP 1UIMA 4GMGA 5A9SB 2GAAA 3DBOB 3ORRA 3FSGA 1XRRA 1N5OX 2OECA 4WGFA 4FT2A 2OHHA 5K0FA 2RB4A 3X1MA 2HREA 2MR5A 3CKYA 4OEHA 3STTA 1JDJA 1N75A 2O2XA 4AZVA 5EINA 3CVXA 4FKZA 1QRRA 1V6SA 2GWRA 3DSRA 5KOJB 4DAOA 3JVUA 5KX5B 1YMVA 3I9FA 3BFPA 1ORWA 3V97A 5EE0A 3V00A 4D3XA 5KKCA 4MVJD 4KMSA 4RZXA 5TVGA 4HO1X 1A27A 3TTXA 4Z7JA 2PS0A 4JLKA 3S81A 2PSEA 2TMYA 2XSZA 5JZ9A 3C8DA 3QBJA 3L9WA 3QI2A 1OREA 1RQNA 3H3XA 3G2JA 4MV1A 2TECE 3AR5A 1IOZA 4P92A 4UU7A 1IHXA 3GZNB 1KIFA 4K0RA 4ZO7A 4YRRA 9ATCA 4HSEA 1B3BA 3MILA 1DELA 1QR6A 1RYMA 3OCUA 3SF8A 4UNRA 2Y76A 1QIJA 2ZSDA 1R10A 3H9QA 1TYDE 3IVCA 2ZI4A 3SEZA 2BZ0A 1KE1A 5CVJA 3GRFA 1ZP6A 2GHQA 3B85A 1NPTO 2JCXA 4A1OA 3NI2A 4B7ZA 1IB0A 1OT5A 4XM1A 2ZE6A 3CZ5A 3JS5A 3K4PA 4XEHA 2WY2D 4C4XA 1XU4A 1IH8A 1M7HA 2B4RO 4MHSA 1OB5A 4I5FA 1X8JA 1LRKA 3ELWA 4O59O 3GLFE 3IVXA 1Q0SA 3QLJA 4DREA 3NB0A 3BXOA 4BU0A 5T5QA 5HMLA 1HT1E 5T8KC 1SXQA 4V02A 2JLAA 3P2KA 3DVQX 3MUFA 3REOA 5LIPA 3IA2A 4MINA 3F1LA 5IBQA 1KAGA 4LSZA 1XDUA 1ZD5A 4JJZA 1E96A 1DDGA 2VL7A 2WP8J 3HCRA 2I78A 3KXKA 4HNGA 4YNBA 3I73A 5EJ4A 1JR2A 3HZRA 4MYHA 3SX4A 3W9UA 2XIQA 1PX0A 1GA1A 1WB5A 4RLHA 2NU8A 3SXUA 1FSFA 3N2LA 3VHQA 1XMPA 3FF1A 4FSHA 4MKGA 4EYSA 2CFSA 3OD5A 4EHJA 3HNPA 1JQDA 4GMXA 2AT1A 1I51A 4RIHA 1KO5A 2NSYA 4NPHA 1NWCA 4RF2A 3ZD9A 4DN6A 2W71A 3UJNA 3FCEA 5E95A 3UB4A 5J23A 1V43A 2CZGA 4C20A 3F6BX 1X92A 2AQKA 2AMYA 2JZCA 5IK2A 3OZXA 1KYWA 1P91A 4NCAA 3QMVA 2L17A 3D5TA 1XF1A 4IZ6A 1ZK1A 4DUGD 4MA0A 3KQLA 3IVGA 3A9TA 2J33A 5C52B 3CXUA 3PSAA 2WDPA 2EL9A 3KB1A 4E1VA 2NXWA 4C5BA 1T5IA 3CINA 2HY7A 5JRJA 5KTPA 1R4MB 3O31A 3PXUA 5TF4A 1N1EA 4R98A 4RS4A 4BNMA 3AGQA 2PXCA 1ENZA 3BD9A 3OZSA 4JB8A 1ZD3A 4JUDX 3FOFC 4RDHA 1KQ3A 2IUFA 2RI6A 3HO6A 3WBBA 3PT5A 3ABSB 4YT5A 1VL2A 2Q5FA 1FPQA 4KMRA 5EJ9A 1BVHA 3PG5A 1QTNA 3GFGA 4QM7A 4MV9A 2HLPA 3C3JA 5DYWA 3ILVA 1QR2A 4PX9A 4TLLB 3HCBA 1L1RA 3JQFA 1E9DA 1G1MA 2OHXA 3AP1A 3AWDA 3Q0EA 3H2IA 4I4LA 4LS3A 3CUSA 4TQAA 5BN4A 4LF6B 4EG1A 2B3TA 1DC6A 2VYCA 2WF7A 3OPYA 3LS2A 4KVFA 4EY4A 4Q16A 3ORYA 1IK4A 4EUHA 4MVJE 4FUQA 1VBMA 4KO3S 2XKKA 2C2ZA 4LJ7A 2HJGA 2X75A 2JGIA 5K01A 1AV6A 2AG8A 4REQB 2OAGA 2PGIA 5JADA 4EIWA 4P4UA 3FOBA 1LX7A 1X1QA 1HRDA 2B94A 3D3WA 3G8YA 4HZGA 5G0TA 3AILA 5A3VA 3ZV6A 4E5PA 5F64A 4PTYA 3QX7A 4Q1EA 3C5VA 3C3CA 1R5JA 4RFVA 3L8CA 4ZK6A 4EVIA 1Z6AA 4TKLA 1VSUA 3PHJA 2H1OA 1Z7YA 1ATZA 2FPIB 2GZDA 4NLEA 2B20A 1CUIA 4XDGA 1Q17A 4DIDA 3CUTA 3IURA 4N0QA 2CF6A 5IBRA 3ABRB 3O4JA 1QXSA 1EDDA 4Z51A 2I29A 4BVEA 1R8YA 1KQPA 3H0EA 3DEJA 4INJA 1LV8A 4Y1EA 1N3LA 2ORYA 3W5BA 3KEGA 2BFCB 3H19A 1Y3FE 4OVKA 5K6AC 1MOPA 1T2CA 1U80A 2G77B 3GUHA 4GOLD 4JL6A 1UOQA 3NZEA 4MHOA 3QU9A 3OOWA 3GGDA 4APBA 2C59A 1DU4A 1KDRA 4R2WA 1CR1A 1HEIA 4NZYA 1PV2A 3CLTD 4ZVKA 1F8YA 4YV0A 1PO7A 3FG9A 3NO4A 4UHFA 1UBOS 4GXNA 1ZXLA 2PZGA 4H7DA 1P8AA 4MK4A 1E4EA 4QU5A 4HLDA 5DW0A 1GNVA 5CEFA 4RW0A 3F6PA 1WL8A 3MWLA 1IY8A 4I6EA 3GT0A 3HLKA 2YDYA 3T95A 4BZPA 1YOBA 3RTAA 2V7GA 4I1UA 4D6PA 4L6CA 3MWDA 3RFUA 2Q8QA 3C16C 3NT5A 3TPCA 4OB6A 5DTIA 4DWOA 3NCHA 3MRSA 2NQTA 3KQKA 3SC2A 3L49A 1OMOA 1TO2E 4JU9A 4N8SA 2HJ9A 4D0GA 4ZGGA 3TQHA 1NVVQ 2OKCA 2WG2A 4LZPA 4TYPA 1VYUA 4PYMA 3ASUA 3HCAA 5AVRA 4A03A 2A2ZA 4CLHA 3DZ8A 3QIVA 1H0RA 1PFQA 1X8KA 2J0VA 3E4CA 2FV8A 2CLLB 4O6VA 3LXMA 3G88A 3F98A 3HHEA 121PA 1BMTA 2QTBA 4P2BA 3U3OA 4OFBA 3UM9A 1DOHA 3HJNA 1B6SA 3X2SA 2JK1A 4U4AA 5JC8A 3EGDB 2GZ3A 1G2IA 4B3XA 3U37A 2NUBA 2R00C 2E5LB 2DOKA 4IIFA 2QJOA 1KR5A 3JZFA 3G5AA 3TR6A 3F7TA 1YXMA 1J2EA 2GDZA 4IDFA 3IRUA 1GT6A 2OM6A 1ZESA 4MKFA 4DW8A 1GITA 4HV4A 1NQUA 1MHTA 2WUDA 4XX1A 3DKVA 3KVVA 1A8HA 3V4VB 2HPAA 2XYRA 4URXR 1XDBA 4BO4A 3KPWA 3IUBA 4BGEA 2O7QA 3MZ0A 4KI7A 3ZBUA 1TJPB 3FF4A 1MF7A 4WY2A 5E9AA 5KMGA 1AUOA 3TRKA 1P62B 5IANA 3UMMA 2GKOA 3NWPA 4ZC8A 4BCBA 1R37A 5IAEA 1H9BA 2YJNA 3L1JA 3JYLA 4UEKA 2ZYGA 2B69A 4GLLA 1GGMA 1SC6A 2AI3A 5LP6C 4YCDA 4Z3OA 3AJAA 4NSNA 2D8AA 4GG1A 3HP1A 3OZIA 3I5XA 4ALKA 1XJ0A 3G3EA 5TMDA 1FE8A 1PR2A 1SCNE 3BIXA 4GQAA 2X76A 1FDOA 4EW1A 4CBVA 1W76A 1XKTA 2UVPA 2QX8A 2AFRA 2E4XA 2VTBB 1C41A 1DBVO 3C48A 3E7DA 5C5DA 4NDAA 2Q5QA 1GLGA 3V8VA 5HKOA 1G8HA 3MWFA 5JYBA 4V3BA 4H0CA 4HLCA 3IQWA 1EUZA 2RONA 3QX8A 2D62A 1TMKA 4TUYA 1LPNA 1WG8A 4UVEA 1K8XB 2WKRA 4B3FX 1RPZA 3RTEA 4G37A 4XLTA 3GLIE 4GNRA 4C7MA 1QGUB 2XTMA 1JILA 1SBZA 4OXIA 2JIRA 4DWVA 1RZUA 3CB2A 1U6KA 2DFKB 2XXBA 4E2FA 2EAUA 4JJGA 1SN7A 2VBFA 5A5VA 1TYAE 4XA8A 4EZEA 3LGXA 1UC4B 3OLXA 5DCUA 1W29A 5JSYA 1BE8A 4N9QA 3TLEA 4EKNB 1DE0A 4HRXA 4LQDA 3WKEA 1IY1A 5M04A 2FPSA 3R0ZA 4KKXB 3LDGA 3GLFA 1ZN7A 2D0IA 3GLHE 3H6HA 2P3SA 3IV9A 3L4BA 1ISSA 1QSGA 5BVHA 1AA6A 2RHCA 2ECKA 3GPCA 4K6GA 2IYQA 5LXTB 1N77A 1O1YA 2P1DA 3K8ZA 3M89A 3MAAC 4RHUA 1P1BA 3P0HA 2PMWB 1J99A 1MEEA 5F2NA 1GKYA 3ESXA 4MVCA 5FR2A 2VDOB 3VM6A 3ZW9A 2XNDA 2I2AA 1OFGA 2J46A 3TR5A 5JDCA 1MVOA 1W5EA 3ETEA 1L1EA 1ELOA 2OFOA 4CQMA 4ZCIA 1SHJA 1Z5WA 4DQKA 3MYYA 2GCOB 4IM7A 4QRHA 1ZJYA 2OQ2A 3F9RA 3QTBA 5DSZA 2VHTA 3M8KA 3SHTA 4BWYA 4XVCA 5TQ0B 4LWZA 5EYPB 1Y4ZA 3COSA 1UBTS 2HQRA 2DPXA 3PR3A 2Q6TA 4G89A 2CBGA 1P5HA 5DWDA 5AVZA 3OZTA 4HAOA 1PZGA 5JAMA 4HJXA 4HK4A 1WQ3A 2G40A 1ANKA 2HQBA 4P4TA 4QTUB 4RKQA 2JARA 4AD8A 1X70A 1JB1A 3I42A 4UAJA 4B76A 3HL0A 3N6RA 2AQ8A 3GW8A 3EXIB 4A15A 1B3RA 2I34A 2I3DA 3OX3A 4NRDA 2Q7DA 3EGEA 3RT1A 1VZ3A 2H52A 2FZ5A 2JIPA 3R7WB 1JA0A 2XA9A 4LHWA 4QQFA 1RWQA 3UOGA 4EKYA 4PCAA 4HBGA 2QI9F 1NJ2A 2YWJA 3KTFA 3T15A 1XHLA 1RLIA 2ZIVB 2YUTA 3QZUA 1YRLA 1ZY2A 3COWA 5I3CA 2X8JB 2F59A 2X4GA 5E4YA 4MLDA 1AOXA 1R0RE 2O2IA 3IUMA 2Y05A 2DYKA 3JATB 4F4UA 4DSZA 1M34E 3PR1A 4H4EA 1YA8A 3MCZA 4BLVA 2PZLA 4W8GA 1XZDA 3VZBA 1Q7TA 2EV9A 3CO5A 2P5SA 2PV7A 2QU8A 4XJVA 4CKEA 2P4EA 3VDMA 5BQ3A 1FTSA 3IAFA 4LF7B 2EGUA 2XDQA 4AP5A 4Z1MD 2O8DA 3K70C 2AMJA 1GYPA 3AERA 4L5AA 1PW5A 3KTOA 1G7RA 3TXYA 4C0HA 1EKXA 5AW1A 1H0SA 2B8JA 4JOQA 4H4DA 4X8OA 3CLSC 2BCGY 4NCNA 4ZYTA 2YWXA 4TTTS 3LUCA 1M6NA 1V7ZA 1KYTA 2ZUCA 2Q1UA 1LPBB 4J6FA 1XTKA 5IFKA 1TU0A 4B3RB 1CFJA 2PAFA 4L9SA 2CJXA 3GJRA 3R9XA 3ZDZB 2J0SA 1NJGA 1E60A 1GRNA 2W2XA 1UJ2A 3T35A 4I6JA 4NBRA 2Z6AA 4D3YA 2JBHA 2ZYWX 5DBOA 1F3LA 2JJQA 2JJ8A 5FR1A 1BHJA 4E0BA 3CNQS 4QOGA 1RKVA 1IMJA 1G98A 1E2BA 3KD3A 1OILA 4ID9A 3RYFA 2CNDA 1WS6A 4LWOA 2P9GA 4RVSA 3FFBA 4CL3A 3O2QB 2G07A 4IIGA 1W4ZA 3V8PA 3W04A 1JSXA 1YB5A 3VHXB 3NP9A 2Q0HA 1IUPA 2BFDA 3DYIA 2VF8A 1AKWA 1M6VA 3I2GA 1F6DA 1RWKA 3LL7A 3BOSA 3ND7A 3S7ZA 1IULA 3EIUA 3PVSA 5BQ5A 2QVXX 2GN4A 3IAS1 2W8BA 3ZY3A 2BFOA 4WT7A 3FCAA 2CDCA 3ITKA 3BZWA 3NHKA 3FGZA 3INYA 5B12A 3BMOB 2Z57A 1I0AA 1W1UA 5KWEA 3TMAA 4Q9KA 3R5JA 5IHPA 2FPPA 2JBAA 1ZUNA 1X1DA 2P3LA 4X7BA 5E6UA 4FDUA 1J8FA 3MVEA 2NO1A 3GFSA 5HK9A 2WPDA 4AF8A 1Y5IA 5DNVA 2G88A 1I4OA 3ZGZA 1V3UA 1NASA 3E1GA 3MEQA 3OIYA 3LYLA 4JIMA 5E3JA 4RZUA 3CJQA 1Z0IA 4YRGA 3LA6A 4YT8A 2Q7OE 5A5FA 5B4UA 1L5VA 1QIDA 4IIVA 5JEEA 1KI6B 3C1OA 1QVRA 1YFKA 5HOQA 2XB9A 2WT9A 4REOA 2R7MA 4N3CA 4HB2A 1L5HB 3I72A 2AWNA 4BWGA 1KEUA 2Q7XA 5FBWB 5DZSA 2KE5A 3T1OA 3TF5A 2WU0A 3ET4A 4RL6A 3OCXA 4CKZA 5CLFA 1OGIA 1QQ5A 1C5KA 2IZ1A 2C7BA 3T61A 3I6IA 4EHBA 5TVKA 5JAOA 5JY1A 4AYWA 4BUZA 3JY6A 1ACJA 2WAYA 2I4LA 1N2GA 1KDYA 3DFUA 1GZ6A 3CUKA 4K0KB 1GZ3A 2A5YB 2OT3B 2PZMA 2B36A 1MVLA 3GRVA 1PR1A 4I99A 4MQMA 2PJUA 4PHHA 1TD9A 2DPYA 5ARBA 3HA5A 4UD6A 1MV8A 1ODTC 2XUPA 5AKLA 3PZBA 2IK8A 2PRSA 4YP7A 3JAKA 5HFNA 4YMLA 2WG1A 2Y0CA 1T2AA 3A3KA 4ZCTA 4URWR 4MRSA 4CEJB 2NNWB 4NABA 4RVGA 1JWLA 1U8YA 1CP3A 2DTDA 1QWSA 3IHWA 3L6UA 1QX3A 5HGXA 2GM9A 2OVFA 3T3MB 3E1KA 4UTRA 2F1JA 1LA2A 3FHLA 3HKDB 1GL9B 3L4SO 1LNSA 3Q7IA 3FDIA 4G4JA 1DZIA 4P6VF 3VSEA 1FYEA 2ZDGA 3PPWA 4U00A 4W8OA 5G1NA 1IXSB 2D2XA 2OFFA 1BGVA 1KWKA 5H1YA 1E7SA 1GXSA 2KX7A 2ATVA 2AEEA 3TX2A 3DOHA 1G7SA 2BH9A 1PR3A 1ZVMA 1MJGM 3CH5A 1G66A 1CJBA 1S9HA 4Q37A 5EZSA 3S2FA 3WLJA 4MVWA 2WZCA 4Q7KA 4F11A 2QE6A 2YHIB 5JCZA 2FG6C 3FZYA 1VQ1A 3PQDA 3NAQA 7MHTA 2AEFA 3ESAA 4G8JA 3PGMA 3PRHA 4XGNA 3ZZNA 5ICSA 3KK0A 3MLAA 2F17A 4WOKA 3ZX4A 5B7GA 4RKRA 3A70A 4NZZA 2DQSA 3CIOA 4IQ0A 1M0WA 1TZ2A 4Q7EA 4UVDA 5ESRA 2VQSA 4CYMA 4D1YA 4EGFA 4J1NA 1I7LA 3L6EA 4UHCA 3GLIA 1JKFA 1M2VA 2KM1A 5EIFA 4PQRA 4C0QC 5I45A 3Q3HA 3FCUB 4HXYA 1O5IA 2AC4A 1ZCJA 4C4PA 2VI5A 3LXUX 2GAFA 1BS1A 1CY1A 1R16A 2ZS9A 4LEIA 2R4QA 4WCFA 3AEKA 1DFHA 1H8HD 3FPAA 4P7BA 4PHGA 2BRUA 4WJKB 4MQBA 2JCSA 3RUCA 1S3IA 2IYYA 1KS9A 1XTSA 3L4EA 1SVLA 4TGLA 5AM1A 3V4RA 4R5MA 4BVKA 1I2BA 3OLQA 1BXZA 5B4VA 5H59A 3NMUF 2C2XA 1VMIA 3GNTA 1VE6A 2EATA 4IIHA 5ALEA 3GLHA 3TOZA 5BV0A 3W5AA 4ZV9A 4F8JA 4XIYA 2ICAA 2WSSA 1R6BX 4H4CA 5B7NA 1QDLB 2JNWA 5TQ2B 4XIGS 3GZ4A 1J24A 4FKMA 1D6SA 1WMEA 4LX8A 4V0SA 3TIVA 4CV2A 4FGJA 3FLEA 2YV1A 2VK2A 1N6RA 1EWQA 2QR5A 2HBYA 2ZBUA 3EIWA 2R8OA 4KACA 5C8XA 1UFVA 1T9AA 1V39A 1HYQA 4MDYA 5ERXA 1NW9B 5JZVA 5K0EA 3LVBA 1YGPA 1GPAA 3C3XA 4NPCA 4GQIA 3H9JA 4GOXA 4PYIA 3SEQA 3UMBA 1TTHA 1RKUA 2ZIXB 4CEIA 4L15A 1N2SA 3T3NA 4UEWA 3T1YB 3QUCA 5JW6A 2C5GA 2MOKA 3MLBA 5H7XA 3UCEA 4OKNA 2E18A 3DS8A 2D0DA 1QYVA 2JI4A 2V8BA 1PR0A 2HEGA 3M83A 3O9VA 1GVHA 2H5LA 4FVTA 4QHSA 1U7XA 3NHSA 3W9YA 4CN9A 1NF8A 2ZVDA 3NHWA 4NKRA 1TQ6A 5DLEA 4E12A 3LKDA 3DOJA 4R4JA 1X7XB 4G09A 4OQNA 3O8QB 4IHJB 3E8SA 4LE1A 1V8BA 4EVSA 3AM1A 4LF5B 1OBFO 2QM7A 2BBSA 4MPJA 4AECA 2VJMB 3NHYA 2QENA 1YE5A 3L46A 5H4HA 1PWEA 3ECAA 3HYCA 3U3KA 5HUQA 2D1TA 2ATIA 4XR4A 1JEYA 1DHTA 3D1JA 1M10A 3ESQA 4JJKA 4XH9B 4RXMA 5CPFA 2FQQA 3TL2A 4RH0A 5LZ4A 3VTFA 3RKUA 3GTDA 3N2YA 1M34A 2Z2KA 4RJTA 4F3NA 4A1FA 1RRPA 1W30A 5CDHA 3PTAA 2ZWAA 3ML1A 3HDYA 1US8A 1ETUA 2V4MA 4JA2A 4JLOA 4RFLA 1NJ1A 2DBZA 3TOCA 3A36A 3R7SA 5HCNA 3QPCA 2XXAB 1V1MB 2QQFA 3KETA 3Q3VA 1DAHA 1M1XB 1TMOA 3ZVNA 1H6CA 1MB0A