2JAWA

Crystal structure of d41n variant of human mitochondrial 5'(3')- deoxyribonucleotidase (mdn) in complex with 5-bromovinyldeoxyuridine 5'-monophosphate
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
194
structure length
194
Chain Sequence
b'RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-DEOXYRIBONUCLEOTIDASE
publication title Crystal Structures of Human and Murine Deoxyribonucleotidases: Insights Into Recognition of Substrates and Nucleotide Analogues.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 63
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 2jawA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2jawA01
1Z4JA 1ZRMA 2PQ0A 3ET5A 3KD3A 3U26A 5A3QA 3L0YA 1N9KA 3E58A 3D6JA 3ZVNA 3AR7A 5AIAA 4BYGA 4UM7A 3WK7A 1YS9A 2BY4A 3L0BA 5AI9A 3NIWA 5AM2A 2C9MA 2PR7A 3SF0A 2CN1A 3ESQA 2HI0A 5ALIA 2YJ4A 3UM9A 1NRWA 4AP9A 5ALDA 2WF8A 4G9BA 1Q91A 2CFRA 2YJ3A 1SWVA 2G07A 3OCWA 2O2XA 5AKKA 3ZW7A 3KDPA 3QLEA 3IRUA 4FYPA 2EATA 3QYPA 3UMGA 3MC1A 5ALQA 3A1DA 2AMYA 4ZEWA 3B9BA 3ET4A 4C4SA 1TE2A 2NO5A 3QU7A 4ZEXA 3OCZA 3B9RA 3DNPA 5ALNA 4UMVA 4J03A 5AKXA 3R4CA 1SU4A 5IT4A 1S2OA 3FM9A 3A1EA 3RF6A 4BX0A 3AR6A 3KBBA 4C4RA 3DV9A 5ALXA 4UMDA 3SHQA 1Z4NA 2G08A 2P9JA 4OD0A 2HX1A 4DW8A 2X4DA 2ZBFA 3L1UA 1Z5UA 5AK6A 2WF5A 1XP5A 5AW0A 1RMTA 1SWWA 3SLRA 4Y2JA 1O03A 3W5AA 5IT0A 2GHQA 1ZRNA 3QUQA 2B1QA 5ALGA 3QU9A 1MH9A 3QXGA 4RESA 3EWIA 3EF1A 2BDEA 4YCLA 4Y2VA 3ZX5A 4YIKA 3FVVA 3A3YA 1YMQA 3ZTWA 3ONNA 2HF7A 3ZWKA 3ZVLA 4UM5A 3WK4A 3WKCA 1ZD3A 4Y3UA 3M9LA 5AKJA 4BX3A 4Y2QA 5AI4A 2WF6A 5AKLA 3L8HA 2CFTA 3WK9A 3A1CA 5AICA 2R8EA 2WF7A 3AR9A 4BX2A 5AW9A 4JB3A 2JARA 2IA5A 5AW6A 4KYTA 2P11A 2YMQA 1L7OA 1NNLA 5AI6A 1T9ZA 3OCXA 4XPZA 5ALUA 5AW7A 5FP0A 4EZEA 5AI5A 4Y2YA 2GMWA 2R8XA 4KNVA 3FPSA 3E81A 4EENA 5AVUA 1Z4QA 2IYEA 4UMEA 2FPRA 4NV0A 3RFUA 4F72A 1RKUA 3VAYA 4HGRA 3ZI4A 3ESRA 5ALSA 3OPXA 3QUCA 2ZXEA 2GHTA 3MMZA 4OCZA 1LVHA 2IOHA 1L7NA 4EX7A 4PNHA 4NAVA 3U7GA 5AI0A 2P27A 2WFAA 1T5SA 1T5TA 4HGPA 2G09A 1EK1A 1RMYA 2NO4A 5AESA 4Y2TA 5AW8A 2YMMA 2C8KA 2DQSA 1J97A 1RLMA 4UAVA 5AM5A 2I55A 1IWOA 1YJ5A 2G80A 4DCCA 1Z88A 4YH1A 1Z4KA 2JAOA 2P69A 2NYVA 3AR2A 1RQNA 3L7YA 3QUBA 3WKDA 4CF5A 4C4TA 1RMQA 5ALEA 4AS3A 1WZCA 4BKMA 4H1WA 4UATA 2FDRA 5AM4A 2W11A 3BWVA 3ZVMA 1Z4PX 3DAOA 2G06A 1JUDA 2RB5A 1PW5A 1EK2A 3NANA 4YIHA 3KZXA 2QYHA 1RKQA 3WK8A 4CNQA 4MWOA 3N28A 3ED5A 1L8LA 3U19A 2FEAA 5AKYA 1F5SA 4AS2A 4NABA 1QQ5A 5A3SA 4B6JA 3IB6A 2B82A 1X42A 3HYCA 4HYTA 5AVTA 1Z4MA 1YDFA 4Y2PA 5ALJA 5ALMA 2IOFA 3U7FB 4EELA 1ZJJA 2FPUA 1CQZA 2AH5A 2FI1A 2FPWA 3PGVA 2HF2A 4Y2RA 2RAVA 4BEVA 1RDFA 4UMFA 4Y2XA 4L6AA 2HEGA 4IFTA 5ALZA 4XE5A 2I7DA 2FPSA 5ALPA 3WKAA 5AVSA 3E84A 3M1YA 4GXTA 5IS2A 1U7OA 4E88A 3ZU6A 3I6BA 3QNMA 3FGOA 5AKIA 2QLTA 2OM6A 2B1RA 3SMVA 3WKBA 4NFLA 1L7PA 2W43A 4JDPA 3TLMA 1RQLA 2C4NA 5AKEA 3N8GA 2WM8A 3NASA 1Z4LA 5AW5A 3L1VA 1VJRA 3IJ5A 4XOUA 2Q4TA 4FFDA 1S8OA 3CNHA 3QU5A 3I1YA 2VKQA 5AK5A 4NWIA 3OCVA 4F71A 5AW3A 5JJBA 4UW9A 1WPGA 4OFZA 3E8MA 2HOQA 3PDWA 1FEZA 1ZD4A 2W4MA 5E0OA 4BBJA 2ZOSA 2RARA 1NF2A 2G1AA 2YMLA 2ZBDA 1QQ7A 2YN4A 3AR3A 2ZG6A 5ALYA 2ZBGA 3UMCA 5AK4A 5ALOA 2YY6A 3U7EB 1KYTA 3N1UA 1K1EA 3NUQA 3N5KA 3QU4A 3SKXA 3KOOA 2WF9A 5A3RA 5AVYA 1QH9A 4HGOA 5AK3A 1AQ6A 2FUCA 3EPRA 4KX5A 2Q4RA 4ZEVA 3QX7A 3B8EA 3L5KA 1L6RA 3W5BA 3W5CA 3WGUA 4DWOA 1QQ6A 5AKHA 3U7HB 4UAUA 5AM3A 5ALVA 5AIBA 1Z5GA 2B8EA 4IG4A 1RPZA 4G63A 4EEKA 1U7PA 1Q92A 3L8GA 3GYGA 3NAMA 1WVIA 2HHLA 2MU1A 2FPXA 3AR8A 4QQFA 4Y2SA 3AR5A 2HO4A 3UMBA 5AVQA 3ZUPA 3PCTA 1TA0A 2ZBEA 3I28A 5AVVA 4GIBA 2OA0A 4BNDA 5AKZA 3OCYA 5AVRA 2EARA 4J2TA 3WK6A 5AVWA 2Q5EA 2AGVA 3CZ4A 3QGMA 3NALA 3K1ZA 4OHFA 2R8ZA 3EF0A 1ZS9A 1RLOA 4KX3A 4MUMA 4YGYA 4DFDA 2JAUA 3N07A 2HSZA 4RETA 5AW1A 4O8CA 4CF4A 3AR4A 5ALTA 3ZTYA 2B8JA 4CF3A 1WR8A 3PGLA 1RRCA 1O08A 5ALFA 1L8OA 2YBDA 1U2TA 2WHEA 3I76A 3OCUA 3FPBA 3S6JA 4FE3A 4CE6A 4L57A 3OTQA 5ALHA 4EX6A 2R8YA 5AM1A 5AM0A 4UASA 3SD7A 4YCMA 1VJ5A 2C8LA 3L0CA 1RC8A 2IOFK 4BEWA 2JGAA 4I9FA 2PKEA 5ALLA 3SKYA 1XVIA 1YNSA 2MSNA 3L8EA 3P96A 2ODAA 2C88A 3MN1A 1ZD2P 4UU0A 3ZX4A 2YFYA 3MPOA 2B0CA 5AKGA 2I33A 2CFSA 4UU1A 2B30A 5ALRA 3HLTA 3R9KA 3WK5A 1U2SA 3R09A 2YJ5A 4KN8A 1LTQA 3WKEA 3J7TA 2G0AA 2JAWA 4HAIA 2EAUA 2HCFA 5AHXA 1RLTA 1ZD5A 4HGQA 1U02A 5AVXA 2GO7A 3W5DA 1RKVA 1QYIA 4XQ0A 2I34A 3U13A 1L7MA 4UARA 5AVZA 2OBBA 3ZWDA 1CR6A 3F9RA 3BA6A 1Z4IA 2I6XA 5T41A 2D2VA 5AW4A 5AW2A 3KC2A 3NRJA 1XPJA 4QJBA 2O9JA 1YV9A 4I9GA 2YJ6A 1TJ4A 5ALKA 4HGNA 4Y2UA 3QU2A 5AI8A 4BNDB 3WGVA 2HDOA 5ALWA 2FUEA 4KNWA 1J8DA 4YCNA 2AUTA 2OYCA 1VFPA 1Y8AA 2GFHA 2YMPA 1Z4OA 2RBKA 2BDUA 3DDHA 1TJ3A 2I54A 1ZOLA 3QUTA 1N8NA 1TJ5A 4L6CA 3FZQA 3L8FA
chains in the Genus database with same CATH superfamily
2A86A 2OM2A 5DBHX 4RKQA 5JAQA 3UUFA 5L45A 2GSWA 4DA4A 3OPNA 3PFBA 1A4RA 1KF0A 5DT9A 4IIDA 1E1LA 5EWLB 2NSLA 1L5HA 3G5MA 1QRSA 2H4ZA 3ZN2A 3LM8A 1SELA 1T8RA 1XFAA 1HNNA 3KK0A 2CXOA 3K8YA 1H2AS 2G88A 5JRJA 4OI0A 3CZCA 1B15A 1XZJA 5I3CA 3FYSA 1H1LA 3NHWA 4PFJA 4HXYA 1R3DA 4OXKA 4F6CA 2P3SA 2AG6A 4I36A 3URMA 3V2HA 2WIAA 5AP9A 1NKTA 3C41J 3WYBA 2PLRA 1WCIB 2C07A 1K5DA 4LDNA 2LW7A 1Q44A 3CF6R 2CVZA 5C9ZA 1WCWA 2EDAA 3DDUA 3OQBA 1A9SA 1Z28A 3AY0A 1JDUA 5FOXA 1L1FA 1E3QA 3HCDA 4DRXA 3ZYCA 1AQJA 1AV6A 1BDBA 3F4RA 2IXTA 1XAJA 3COYA 3H11A 3GGCA 2A5JA 4JP5A 3LTEA 4WFIA 4EW2A 4UOEA 5KHLB 4KWCA 2ZRKA 2D0PB 1CUFA 2O0HA 2J31A 4N5DA 4RD0A 5CXSA 2YICA 4Q4AA 4TN1A 2O7VA 2P4QA 4QWWA 4RDHA 2PFKA 1T2AA 3KB1A 4PICA 5IYZB 1J8QA 2VA9A 1DGQA 3GV0A 1HWYA 3B9BA 1FNDA 3EZFA 1QLWA 3EPHA 2OSVA 4L8YA 3SXJA 1EB8A 2WVJA 4DTCA 1E98A 4ZOBA 3UWOA 1X8JA 4PN3A 3I30X 2Q8QA 4QG3A 4P4SB 2AEMA 3T5CA 1VL6A 3DZFA 4LF6B 2BMFA 3CKMA 5IBCA 1E3MA 2ECQA 1NXWA 2BLLA 1PR0A 4WBNF 1FJHA 2UYGA 3ZDXB 2ZCJA 1FFGA 2XR1A 1RYZA 4J49A 5DM70 1CE8B 1SXJD 3WJ2A 4TUYF 4UMDA 4CMIA 5L4SA 2K2QB 2HUNA 2I67A 1RAFA 1YDWA 2JGKA 3KXDA 5KOHA 3A2KA 1XDWA 3AP3A 4UUMA 3AM3A 5TT0A 2BR4A 4XGQA 5LKRA 1SQ0A 4FX2A 4BOYA 2QSJA 3SZUA 3UWKA 3WIBA 2J5XA 3OZAA 2J6CA 3BD7A 2GBLA 4ZVVA 1TKRA 1OI2A 1MT0A 3OLVA 1JH9A 1OYWA 1UFKA 5L3SB 1BCRA 3FPHA 2VRCA 1P1IA 3WLTA 1QANA 3WFZA 3T5MA 4JUAA 1BHJA 1BSVA 3GVPA 4YCCA 4PLYA 4EB6A 3C3CA 3KKOA 3PEWA 2XXAB 1H8EA 1V1MA 2ZDQA 1OLUB 4AJIA 4BIMA 2DTXA 3OI7A 2VDNB 1PRYA 1IUPA 3GCWA 2HIHA 1YTUA 1RWVA 4JLOA 1SC1A 2C0PA 3LVBA 4XWGA 5CPBA 1E9FA 5K4AA 3A11A 5KYUA 2JCYA 1C4XA 1LK0A 1SC4A 1W46A 2JAXA 3CJQA 1COZA 1FW8A 5AKJA 3VMFA 4C7BA 4LJKA 2Y1XA 3FYDA 2Z30A 3ZDDA 4WVFA 4B4OA 3N2GB 4NBNA 3NVKI 2QTZA 4EGQA 3FNGA 4QGGA 2A30A 4JI8B 1BVYF 3P9SA 2WSLA 5B1IA 1FYWA 1G8YA 3ZEIA 1BH2A 4DAEA 1FE8A 1ZN8A 1DKNA 1FS4A 1H0KA 1NNLA 3NRBA 4IXWA 1FBTA 4YLYA 4FM9A 5CFMA 3TX6A 2PRJA 4IQGA 4GOOD 1SHZA 2CMFA 2FF5A 2WICA 3N6RA 2PVPA 3RU7A 3ZVKA 3JQAA 3GRUA 4KO2S 4P4TA 3ZR4B 2HA3A 1BX3A 3R20A 1PL8A 2ZUDA 1OBVA 3K3PA 2GFQA 4L4ZA 4OX9Y 3AYXB 3EC7A 3ELYA 1EVIA 3AERA 4FW8A 3OQVA 3C6QA 4AT1A 4D9FA 4Q4JB 4O1MA 1E5VA 3P26A 1NASA 2VPXA 2IOHA 1BRTA 1EP2B 7ABPA 1HSZA 1CU1A 4YT5A 5EVCA 3FUVA 2M1XA 3K8OE 3DA8A 4GMXA 4CIYA 1LUAA 5AJWA 2HMYB 1T5SA 2AWNA 1VDZA 1QIDA 1ECBA 4DV4B 3R9WA 5TQJA 3FYUB 4NJMB 1I30A 1KC3A 4CUJA 3PHGA 1Q1ZA 2BFAA 3RIXA 4KHPB 1UMKA 2YJTD 4H1TA 3B6IA 4Q4HA 2OHGA 1J49A 1CDZA 3PCXA 3I2FA 5C8YB 1JFVA 4FFBA 4XWOA 2ENWA 2OG2A 5ANRB 3B5EA 2GYVA 5KHOC 2ZQ5A 4DCCA 1SB8A 1WW8A 3IT3A 3VHQA 2NWQA 5KSWB 2QRKA 4JLUA 2CJYA 3FE2A 3C3BA 2IZZA 3EZ7A 5F7JA 1DZ3A 3T4EA 2Z4RA 2P69A 2O57A 2ZJFA 1JJ7A 1ZL2A 1XCJA 1XMPA 2OD7A 3QUBA 3TKLA 1ORVA 4C4YA 5FV4A 5JNWA 3RLIA 4Q9IA 3VHXB 5ALEA 5DM4A 2SECE 1K0FA 4U2DA 1XZHA 3PXUA 5C5CA 2BGMA 4WOJA 4BKMA 1VSVA 1YH3A 3F71A 1XT6A 1HORA 2IQIA 3DP7A 2LXNA 3P9CA 1SHKA 1ZGBA 3BC1A 5IMBA 3TW6A 4XB6B 1JEAA 3E2MA 3KNZA 5BMVA 5WRFA 2DHEA 3QF4B 2P2GA 3H42B 2ZETA 5FWDA 4MROA 2IH5A 2E4UA 2X0NA 4CR6A 2OC4A 3TPFA 1PF7E 1CUGA 1VKHA 2E3JA 4PX3A 4XWKA 3KZXA 4DR7B 3WL4A 2EKQA 3RUAA 1QV9A 4YXWA 2BE7A 2O23A 3Q88A 3TW8B 4F4FA 3N28A 3IELA 4PZCA 3CF4A 5FPHA 1DAFA 4E4RA 4PAQA 2R7AA 3D6NB 3LQRA 1SC3A 3U3JA 3EFEA 1KRWA 1TJPB 3U56A 3LCUA 3QIAA 3FFXA 1NW4A 2HF8A 5DI3A 1AUOA 4QOJA 4RZXA 3CO0S 2GNAA 5JDIC 5TIIA 1H8ED 1L6IA 4QOEA 2XMBA 3T1VA 2FY8A 1YRHA 1II8A 4Y1RA 5LZ2A 4RU1A 1RU3A 1DTEA 3KPWA 2GYYA 4ENWA 2XMSA 2GBGA 4OQYA 3C8ZA 1JPNA 4I8IA 3FTPA 3WYEA 4DM3A 2OD9A 4DTIA 3SZLA 2CYAA 2PSHA 1W76A 1Q7BA 4BO3A 4QDJA 4RANA 3RAJA 2JKVA 4HQ0A 1RHQA 4LRWA 4NYJQ 1KE1A 3QYAA 1LPSA 4R7ZA 3R3SA 2DBYA 1BIFA 1Z0KA 5C7LO 1H85A 3WRYA 5L4LA 1WOYA 3GZJA 1C2YA 1OV4A 2LD4A 3VR4A 2ZS7A 3AW9A 3ZY5A 3KSZO 5E6UB 1BKSB 3R5TA 1EEHA 3HA5A 3M1YA 5HRUA 4G0ZA 4DCJA 2ETXA 2O8EB 1GUFA 3G88A 1YCHA 2ATEA 4YRZA 3TCXB 3JQAD 3HSKA 2OM6A 5EJFA 4WOCA 3TOZA 2D6FA 5CYPA 2OB2A 4B6QA 1L4GA 3R7BA 3IVAA 2B78A 1V37A 5CX4A 3SJUA 4P84A 2WYVA 4YREA 1GGMA 1VYVA 2COEA 2ATVA 1F8XA 1U8ZA 1K7WA 2C2XA 2XXBA 3EZGA 3PWZA 4TS9A 4TKMA 3EXG1 3P9QA 4KQCA 2DAPA 4CKWB 5EE0A 2PGXA 3R9XB 3LIIA 4DRZA 3WZ2A 3FOEC 4TYNA 3T3EA 3V8PA 1E2NA 4QYTA 1HEYA 3TMKA 1EFPA 1JU3A 3LW7A 4G0QA 5K2MA 4A2WA 4H7JA 3ZLUA 3ZDYB 1SIBE 2L2QA 2B1IA 2C5LA 3D6UA 3QX9A 1F14A 1UXGA 2YWCA 4FOLA 4YS6A 4ARUA 1ECLA 2BEVB 1BEUB 1M6VB 3B36A 1XVUA 1KC1A 4IICA 1XN1A 4JP1A 4K26A 5KYVA 4C21A 5KPDA 3A70A 1BCSA 4Q9JA 4JU9A 2FPPA 2VYVA 3ND9A 1JG7A 3NGLA 1EBFA 2DPXA 1BYUA 2W6MA 3KYDB 4M7WA 2XBMA 3KVRA 2RMKA 1HTBA 1X86B 3ZXYA 5FJIA 1PGNA 2DYKA 3NBUA 4MVJI 4DT1B 4YQFA 4IVQA 3F6SA 3BJRA 4J1NA 1TVKB 521PA 3ERCA 1JDVA 2XRYA 5JS6A 1BVUA 3K6JA 4MVJG 3PR2B 3PV0A 4J0GA 1K8YB 5AUQA 3WIEA 5ALOA 2YY6A 4C1BA 5K9ZA 1NI4B 2QYTA 3MJCA 3Q87B 3N5KA 3FRIA 4OQNA 3MW8A 3NQ41 3MA0A 2LIPA 2XIQA 2Q28A 4Y30A 5JO9A 5AVYA 3VJKA 4AYWA 3LK7A 3CT6A 1TK9A 3CUEF 4ZEVA 2OTCA 2FGKA 4CODB 4UM9B 4IW3B 3V2GA 3W5CA 2QHXA 4JDUA 4PO3X 1DPGA 1N5OX 1IN8A 1DBWA 2C3OA 4M3NA 1E3JA 1V16A 5CDYA 4FYHA 2VN8A 3C6ZA 2RGUA 3CRQA 3KUCA 3ZJVA 1F3LA 3IUEA 2IELA 2I8AA 3TZEA 3FUTA 1MG0A 2FFRA 2ACEA 2E49A 3F9CA 4ALNA 3T3DA 4KR3A 1NVWQ 3THWA 1NR7A 1MH1A 3PITA 3V48A 4BDSA 1I2ZA 3PPIA 2OK8A 3CUKA 3V4PB 5BV7A 1EFRA 1KY4A 3MM4A 1O5IA 5JYCA 4L0QA 3AWDA 1PWHA 4GT1A 1TYBE 1ZRSA 2R7NA 4X1YB 3KQTA 1NXSA 2FPXA 1Z7WA 2OECA 2YXNA 3JYNA 2QN6A 5FLKA 1CZKA 2D1FA 4MKFA 3PXGA 5JR3A 4FZ5A 5JMWA 1NE7A 4NYIQ 4QEZA 3B7WA 3HY6A 2HA4A 3B3GA 2Y0BA 2JH9A 3X43A 2AOUB 1J39A 1GNLA 2PX0A 2FX5A 4M88A 4RPJA 4ETNA 3HJGA 2QT0A 4IQ0A 2FG7C 1GGFA 2Z8YM 4GR5A 4IVPA 3THSA 4D5EA 3IFSA 2JIRA 4GOXA 3GLGB 1V1RB 4BBAA 4G5SA 1QRTA 4EM6A 2GCPA 2EZ8A 2PTGA 3E3MA 3BOSA 3FTQA 3JALB 4QGAA 4X0EA 4ZAWA 4BBZA 1UJCA 3W77A 1GEGA 5HW0A 2F43A 3VO9A 3OLCX 3NB0A 3H87A 4DCMA 1IZYA 4M8KA 5D8DA 4PVCA 5FBVB 5EC8A 2Z5VA 1S4MA 2IYWA 3RARA 3QGMA 3NALA 4OB8A 4D44A 3RB8A 3QSYA 4HYEA 4TTTS 2GCIA 3KJZA 2QGZA 3KKQA 3KSDO 1O94C 3UWMA 3AESB 1RLOA 3VR4D 4NBSA 5AXBA 3OEEA 4JH0A 3UIEA 1VMAA 3H99A 1U0BB 3QXJA 3GPLA 4HH1A 4CEJB 2PPVA 3DWIA 2H63A 1DB3A 4MV5A 4DUPA 5CA1A 2DMRA 2XTMA 4FLEA 4QPZA 2HSZA 1ZC4A 3KKPA 4HN9A 2JG3A 1E4OA 4KAAA 1QU3A 1BOOA 4G0XA 1S2IA 3EUAA 1C9NA 2CJWA 2WE7A 4ILEA 4X1OA 121PA 1FLVA 3ND6A 1CG6A 2RHBA 1PT8A 2YJGA 3H18A 1EBUA 3WRXC 4ZV7A 3ZBPA 3SU8A 1RIIA 5TMPA 2JLCA 2ZRIA 5M34A 2M6KA 2WHEA 3B6JA 2G5PA 3IXLA 2EBFX 4HFNA 4B2IA 5EJEA 1MO3A 4OXRA 1UAYA 3S4YA 3TVYA 1O97C 2R84A 3I01M 1HDOA 1LI5A 2YFQA 4GOND 2P6PA 4HB2A 4XWAA 3ZU4A 4QUJA 2ZZKA 3VDXA 4NQRA 3VJRA 3LX6A 1IM2A 1KE2A 1T5HX 1KO5A 2FSVC 2RJOA 3A6HA 3BSYA 4HN2A 4IP0A 2OCXA 4OOFA 3SD7A 1FFXB 2WAMA 3HBNA 3DWEX 4B8WA 3EQ6A 3TTUA 2GT1A 4C0JA 1JG4A 5D3QA 1EUQA 2YOFA 4UUAA 4IVNA 4KQHA 1D6JA 1P77A 1SHJA 1UXIA 2AWOA 4AKGA 1TO6A 3DE7X 2VYVD 1LCIA 4FGUA 3I8XA 4B46A 2PG3A 3WDMA 3SKYA 3ZZ1A 3A0UA 5COBA 4AKTA 3HFGA 3ZG6A 3SOZA 2OFXA 2P2YA 4YROA 1XNGA 3EXIB 3E1GA 5JPCA 3PE4A 2QZJA 1FDRA 5JMOA 3LLSA 1XAIA 1ENYA 4GQBA 4Z9YA 3JZAA 3DOHA 4RIGA 2J9FB 3ZEAA 1NVDA 1MAAA 1TU0A 2Z5GA 5DB4A 2GPSA 1E89A 1GTVA 4ER6A 4I14A 4CIXA 1CKEA 1YQ9A 5DM1A 3DKVA 4HXEB 3QW4B 3LHFA 3FCUB 1I01A 1Z0ZA 1KJZA 4D81A 1R0YA 3PD7A 2G0AA 2C2ZA 5TVKA 2WV7A 4F5DA 3KDAA 4FMPA 1DKQA 4DQUA 4FB4A 1U7DA 4LXXA 4L8GA 3HDYA 2IS2A 3PQDA 3RANA 1XHLA 4NYMQ 2FP3A 2N47A 2UUPA 4DCTA 1WETA 1E0JA 3JWHA 1ZIYA 2C4TA 3RFCA 1R4NA 2QVLA 4FGKA 1AQNA 1WJGA 3EX7C 1RCFA 1XX6A 3OAAA 1T6BY 3LKVA 4DZZA 2PV0A 5AW2A 1EFRD 2JEYA 2CFCA 4AMBA 3IEVA 4OL0A 4N49A 4FHCA 4K2HA 1HY3A 4H4CA 2QN3A 4BJ5A 5CCXA 1FURA 2OESA 2VXCA 2P9GA 3ICVA 2V54A 1KPIA 1A7AA 2G1JA 4LMRA 3VO8A 1AOXA 2FPIA 3LT4A 4A0RA 4F4DA 3PFGA 3FAKA 3Q2KA 5DHTA 4F8YA 4OBBA 3K9HA 5H8WA 2FWAA 1Y0BA 1GKKA 2PUGA 4B8ZA 4YFYA 1YIDA 4MINA 1CUAA 3H16A 4KMRA 1N9GB 4TM7A 1E8DA 3NCHA 1WUTA 2IXFA 4FFVA 1U5AA 5C7OO 1E96A 2IEIA 5FPKA 2A35A 4AUKA 1GQ2A 1GG2A 1SJ9A 3IXQA 3EDOA 4HBGA 4IX9A 4D46A 1ZVJA 2E6UX 3FNQA 3VPGA 4CM8B 7MDHA 3AL2A 2E87A 1Z4OA 1QUEA 4KRGA 4LBWA 3MAJA 5KI6A 2EF1A 1FSPA 1T0JB 5J43A 1AN9A 5DXJA 4JELA 2AVDA 4B17A 3LW8A 4R9RA 5IDYA 3JYHA 1NG9A 4TZTA 1OROA 3DOOA 3R7WB 1VLHA 2Q0HA 1CF2O 1PS8A 3V9AA 4AZ0B 2CMHA 4P7GA 5ENDA 1DPFA 3VI4B 4YPVA 4CG2A 2I4NA 3J81A 5B1YA 4PZAA 1QG0A 1TU3A 3FHCB 4HGZA 3AJRA 2R6ZA 5AOCA 2ZE7A 2IYQA 4JP2A 3EUWA 1ZM3A 3PXDA 4OP2A 4JVNA 4RFVA 4YMGA 3PNBA 1ML4A 5JAUA 4RJ2A 2X1LA 2QRLA 3EIWA 3O38A 1JQAA 3TFOA 4KPEC 2WJPA 2VYCA 2ZCUA 2YYAA 5TS3A 5ARDA 1KI6B 3WGMA 1YQWA 3OT1A 4XSVA 3V46A 1BWPA 3FJ1A 4A27A 2DPGA 1ONBA 1G7SA 4TVKA 4DIUA 1G5FA 5M2QA 1KVUA 3HBLA 1FP1D 2ESRA 3MPUA 4EZIA 2X2OA 4ZYYA 1U99A 2BCEA 4L0DA 1EESA 1TU4A 4OG2A 5H82A 2A1UB 4IPTA 5F5LA 4ZOLB 3UT0A 3ZIUA 1D1SA 3IMFA 1CZNA 1ONSA 1SWVA 1U2DC 3G5AA 1TD9A 4NBVA 1BE1A 1M8GA 4YJKA 5DK6A 3GLKA 1O2DA 2FMIA 5T5QA 2QMQA 3RVBA 2RKOA 2AE1A 4KH1A 2O4UX 4M22A 2EATA 3E82A 4D3FA 4EG8A 1WB4A 2B7CA 1DBRA 5DWVA 3VTKA 4NMLA 3ZD7A 2QORA 1G6HA 2WDPA 1DCNA 3ET4A 1TE2A 3HLKA 1U8TA 2XNHA 1L5GB 5A4MS 5ARBA 5JNUA 2J3DA 5LMCA 1F1JA 1LX6A 1Y3BE 1L5KA 2YW2A 3IT1A 3QK7A 3DNPA 3REGA 2DE0X 3PHIA 3TMAA 1OFUA 1WXFA 4ZK2A 4IMJB 1VG8A 3U4MA 3HXMA 4BE9A 3RVMA 2NAFA 1E1NA 2VJDA 3KOMA 4P08A 2PMBA 5AK0A 5MF6A 4UQOA 4HR7A 5JPDA 2HEIA 3H5AA 4MS4B 3U48A 2X5XA 4WERA 2HD4A 1M2GA 2ZUFA 4OA5A 2R7KA 1ZR2A 1ODLA 4S2EA 4YRFA 5ILQA 3SLRA 3K5IA 2OZKA 3DV0A 2GWHA 3QUQA 4ASUA 2BONA 4XASA 2IPXA 2R5WA 1X7DA 3PXCX 3OAAD 1IN5A 4P2GA 3RV3A 3KTAA 4ZMRA 4G8BA 3AM5A 3TQSA 3NHUA 1FTWA 1C3OA 2HIGA 3QELB 4OHYA 3EZXA 3PNQA 4JHLA 4M1QA 2PZAA 3H5OA 1SU6A 5K45A 1E7QA 1I3MA 5FH9A 1OB5A 3QYFA 2GLTA 4J3FA 2YRWA 4CCAA 2AJ8A 1SZPA 1NY6A 4AU1A 3W1WA 4ZYTA 4RZSA 2X1MA 5JEEA 3JZDA 2PUHA 1H2RS 4MV0A 5BSEA 2PRIA 1ODFA 2RAPA 1ZKMA 5DBEX 3KAPA 5EUQB 3U7IA 4MPJA 3E35A 1J24A 1M5UA 2FHSA 1W36C 5EFOA 3MRTA 2CZGA 4WGFA 1LF0A 1IY9A 2PZLA 3HHEA 1H4VB 2CUNA 3DM9B 1MRZA 1OC4A 2HM7A 4PXSA 3UB4A 4BB9A 3G7SA 3TO5A 1UAAA 3MRXA 3O21A 5HQ3A 2PU5A 2QTVB 4MQBA 4QREA 4RAQA 4BECA 3GBSA 1AK1A 4F72A 3ZWYA 1C7JA 1EWTA 1XROA 2FR1A 4FSXA 2OD2A 1XPRA 3AKYA 1GKIA 4LIPD 3BK2A 4C3UA 1N3YA 1W4LA 2XLBA 3QPVA 1LK5A 3RU9A 3UCXA 4B4DA 1JW9B 1WMDA 2R5FA 1C9JA 1LVHA 2JK1A 1DKUA 3EIQA 3Q3VA 3T1QA 4EFDA 3NTUA 4KR2A 2CNLA 3RAPR 3RSOA 3GFOA 3LIPA 5F5XA 4NK5A 5FWYB 1ZIPA 3RS8A 3QVMA 3OZIA 1T5TA 1E18A 2NO4A 2A0FA 3RF7A 2YMMA 1VMKA 4LUCA 3BGSA 1Q1BA 3IV6A 5SY4A 1NRXA 4LW8A 2BKAA 1BVRA 2VTEA 5KNBH 3ONWA 4QO8A 1O6GA 4MUGA 2NVBA 4URYR 2VUUA 2PLNA 3BH7A 5DX0A 3LCVB 5D01A 1BW9A 3HYNA 4L8FA 1X1RA 5AHKA 2JAOA 2PL1A 3I1FA 2AJBA 1PK7A 3JQ7A 3KEQA 3H6HA 4MJXA 4P1ZA 5BQFA 1RXVA 3D31A 3VNVA 4G41A 2FOLA 2XOKD 1QORA 3OKFA 3NBZC 4FDTA 1XZ8A 1VHTA 3HP7A 5CVJA 2IP2A 1I4OA 3HDHA 3NP7A 4K86A 3ZI7A 4AS3A 5HWSA 5EP4A 5CX1A 5HKOA 5EPEA 2O6HA 1FMCA 3HCPA 2JZCA 3I6ZA 3QPDA 4LSZA 4G1UC 4QLOA 3PDHA 2Z56A 4W7HA 3L01A 3TEFA 4E94A 4R1TA 2W2TA 2AFHB 4QELA 3SDZA 1TJUA 4L73A 1NQVA 1IXKA 3ZUGA 3KLBA 2HJWA 2P2CA 4PFKA 4ZVNA 4DAOA 1Y82A 4LI0A 2I2AA 2HBZA 4KQIA 2JCVA 1ZXBA 4OXYA 5HQJA 2VAXA 3CI0K 4D4JA 3C7CB 3KZOA 4OH7A 1PEYA 4P32A 1GQSA 1L8LA 2BZ0A 2CNOA 3A9UA 1QZTA 5J1SB 4YRKA 3IYLW 3P5SA 3TWOA 3GZ4A 2OHJA 2RGNC 2WSBA 2JGDA 5BMVF 4KXMA 1WBBA 1CDEA 2UVQA 3SSOA 4LZPA 3UJAA 3BXOA 4DQXA 2GK7A 5FD8A 4EAQA 3WBKA 2QW8A 3B7GA 4NCJA 2JJQA 4YRCA 4IIGA 2IYTA 3BS4A 3LVFO 1T8YA 1B74A 1PS0A 2O2CA 3Q7SA 4HWSA 4M0MA 4X7PA 3QMMA 5DN6A 3LRXA 5J2TA 5BT8A 3S8YA 2BGIA 5I9LA 3JVEA 4TTIA 3ZCQA 4OFWA 4DMGA 3OZ7A 4KYUA 2IOYA 3K9CA 5JY1A 1FNMA 1O3YA 4BNUA 4DWVA 3NDBB 2VJCA 4BKPA 2VDLB 1WZNA 4BKQA 4CIAA 2VK2A 4OMDA 1T25A 1UMCB 4FINA 4PF1A 3QLUC 2FZ5A 3QVWA 4MWDA 3S2ZA 3CN9A 1KDPA 2ORVA 2I7DA 3OU6A 5TVGA 4M0PA 5IC5A 1KTVA 1GFZA 1TTPB 2R4TA 1FXWF 2R4UA 3ESCA 3KKEA 3NOVA 4HWTA 2RHGB 1DT5A 3JAKA 4BLPA 2XQFA 4X66B 1OZ0A 5DO9A 1UMDA 4OQQA 1E2KA 4DNFA 3R9IA 1D8TA 3T34A 5HJ5A 2ZYRA 3RYCB 1O8BA 2EW1A 4NFHA 1UBFA 1KJQA 4FMDB 1G8SA 3I8OA 2DTDA 1GT6A 2B4AA 4CUKA 1G2PA 2XUDA 3GEIA 3MTGA 4I5IA 2XIJA 3UKJA 4W4TA 2CNWA 3MAAC 3LO8A 3MWDB 1KIMA 1HETA 3CSSA 5JVDB 5BT9A 1QK5A 2JGJA 1YK1A 2UZIR 1EGHA 2QK4A 2WM8A 3DMFA 2FVXA 3QTBA 5DIZA 1EXMA 4E5YA 3AHCA 2E1RA 1H9BA 2KM1A 2ODPA 2Q4EA 1M8JA 1MAHA 1YT5A 3M9WA 3Q41A 3KHUA 4LV6A 5GJCA 1OH8A 3HA2A 1U4SA 4N0MA 2EYUA 2LGJA 5MGNA 2Q0QA 1YVRA 2B35A 3SOPA 3TRKA 1KIFA 2O3TA 2VDWB 3Q3HA 4L72A 2HPAA 3KJXA 3OIVA 1B6SA 3QBDA 4XWWA 4PQRA 3WWPA 2FW0A 2X41A 2R48A 4RL4A 1YBMA 3LUDA 4N9WA 4TYQA 4ZI7B 1QDUA 3MJDA 4ALJA 5K6AA 2QBYA 1GVNB 1WW2A 3RSLA 1OGJA 2QI9F 5KQSA 2WM9B 4CG3A 1J7KA 4TRNA 1ISJA 2G1AA 1AXEA 2FMFA 2VSNA 3IBCA 4MCAA 4U7DA 2BZ1A 1TZBA 1PYOA 4G0MA 3CVJA 3T9CA 2VDVE 5K05A 1MFPA 2JZOA 2OBXA 3UW1A 1EAMA 2XWPA 2XDQB 3WLEA 1DRJA 2F9FA 3Q7PA 4FJ2A 3MUFA 4PU0A 4E5NA 4QTYA 5C80A 4PG6A 4FIZA 1KI3A 2PJRA 5KTKA 1T4MA 1ZP6A 2ZI3A 1UBHS 2OOKA 4O0MA 3I62A 1IUKA 3JRNA 3C3XA 5DDIP 3PBKA 1QH9A 3D8UA 4LGMA 3KKMA 1LDEA 4YVFA 1R5BA 3SI7A 3K6KA 5DYGA 1PX0A 1QUFA 4XWYA 3LC0A 3OKCA 5KQGA 3WGUA 4PNZA 1ZEJA 2ZRQA 1OTYA 1PDVA 3CBQA 1OXSC 1SN7A 1H93A 1SUDA 4K05A 4R2LA 3UAGA 5L3QB 1ILEA 4O6VA 4Z8YA 1MJ5A 4HSEA 2JFBA 2QUBA 2I7TA 3UB2A 1WPQA 1Z6TA 3CZRA 3ZW8A 2QN8A 2Q2VA 3AEQB 3BDVA 4MUJA 4K7JA 3L4JA 1PGQA 4PC7A 3S44A 1VJ0A 2VQFB 2MU1A 3FI0A 2J4CA 2OQRA 1FYVA 1C2TA 4X8MA 2DUJA 3QEJA 3WV4A 1R12A 4ZYVA 2VQEB 4O02B 5REQB 1IHYA 1TX4B 2A4KA 3HJTA 3NETA 4HN4B 1R0CA 3GBVA 3GVIA 3ASUA 1EXDA 3GOHA 3IE2A 2Q3BA 4XLLA 1L8XA 1MD9A 1B42A 1JTFA 5DWQA 2A7QA 5DN6D 3KZMA 1LQ2A 3MBIA 1GV0A 4FTWA 1PV2A 3IHWA 3V42A 3FZGA 1SKUA 4MO9A 4A0GA 4DR4B 3A9WA 3SZMA 1FMFA 3KQOA 4KIFA 3ICCA 3S1LA 4CBVA 1NYLA 3PC3A 4M1WA 4M83A 3HU1A 2RGYA 2ZJ3A 4LJLA 1ZH4A 1C3CA 1F60A 3EXAA 2PM8A 1TZJA 1BA3A 2I4MA 5IAAA 4O4JA 4UJ3A 4MRVA 3GAFA 4IGKA 4V0SA 4LY6A 1Z2EA 4GRIA 4NG5A 3DDZX 1IEVA 1QV7A 1SRRA 4O1HA 1T3ZA 3P5BA 3CHYA 4CXMA 1HZZA 1Y4AE 4I3FA 5C7IO 3SC3A 1DSSG 2HK8A 3LQ4A 4Y18A 5E7QA 4A2CA 2BGLA 5EE1A 4L02A 1IUNA 2G1UA 2NPFA 4IM7A 1UJ2A 2ZATA 4V38A 4ESHA 2ZT8A 1NULA 3A04A 1Z08A 2R60A 1GPBA 1O57A 1MOZA 2Y6UA 4GZ5A 4TLBA 4WZBE 4DR1B 4WUTA 2SBTA 1M34E 2CNWD 1L7QA 4NPHA 3UMJA 3UUEA 3MJVA 4FHZA 1QCCA 4RK4A 2BZGA 4D8WA 2NP6A 2O8BB 3HXOA 2ODTX 4L5CA 5EZYB 1E5XA 1QX3A 3R23A 3JCZA 4N7RA 5CIWA 2QUKA 5DTIA 4AD8A 5JJIA 3JQDA 3WMFA 5I7WA 1DQRA 5EIAA 3CFYA 1WCIA 1XSEA 5E9WA 5EJMA 3WNBA 4L16A 3U9SA 1VCHA 1P62B 1T4CB 1E1QA 2P9TA 2CEKA 2O5VA 1M2OB 2IYRA 3TJZA 1CFJA 2FN7A 2N3ZA 2OR3A 3H4TA 3QMVA 3N8DA 5CA1F 2POCA 1L4LA 4IIBA 4ARZA 4KLZA 3VKFA 2GSDA 2L0XA 4XM0A 3QM1A 3UK2A 2WAXA 3EZ6A 3FWYA 4Q1FA 8AT1A 4Z4QA 1XZMA 3QEMA 5DYNA 4R7GA 5EMMA 4RJJA 3WNQA 3JYPA 4TSFA 5BYAA 5LP6B 3GLIE 3CQ9A 3DEJA 3Q6MA 5H68A 5IYZA 3PF8A 4BQFA 4CL3A 3A6FA 2ZIAA 4XA8A 3ZGNA 1HDCA 1V5IA 2YFYA 3CVOA 1JSWA 4NNJA 4B4WA 4BMDA 2GAFA 2YFHA 1ZRHA 1Z63A 4Y8VA 2BI7A 1FZQA 1E2IA 1L1EA 5TLSA 2DG2A 1W6UA 2REQA 3OETA 1GCAA 3GUZA 4KQ6A 4Q15A 2I6GA 1M75A 2XW6A 2C94A 4MRNA 4HXFB 3PWTA 1CE8A 4BVFA 2CT8A 3DBRB 5SYNA 3PL1A 4IZOA 1RQXA 4M1SA 4RM2A 2EGGA 2NZ2A 3F0TA 4HWGA 2FR8C 3RU3A 1V8OA 4KPUA 3QVKA 3FH0A 3MCVA 4X1IB 5AD1A 3ZY4A 4M21A 1IBCA 1KAQA 3BEDA 2PXCA 4KSCA 2QTTA 4ZIRB 5F2OA 4HKTA 5JCJD 3SBXA 3JV7A 4KQ1A 2DLDA 2HC9A 1MO5A 1MQ8B 4G2NA 4PZPA 5F9HA 3E9QA 2OGSA 2BKEA 5LQNA 4C2TA 1E79A 3RBVA 3NRJA 1JEYA 1OLUA 2ZWAA 3A9CA 1USWA 3G8YA 5JZ9A 3AZOA 5KAMA 3AH8A 1B1CA 1QZXA 4R0MA 5LKAA 2ZS9A 4ENVA 1BWRA 3EW9A 4W82A 4UDNA 1WABA 2HJVA 1T4DA 4ZFNA 3N2GA 4D4GA 4TTJA 2C9BA 2HDNB 3PJEA 3PC6A 1V5WA 4U4AA 2JIPA 3NJ4A 1RAEA 3MBKA 1XMJA 2JK0A 4BS9A 5CXQA 1PJLA 3T99A 4PE5B 1R88A 4DXDA 1XNJA 1KKMA 4W9MC 3LUHA 5K8CA 3UMYA 1M54A 3K8ZA 3LOUA 1BQ3A 4TL6A 4TT3A 1NONA 3GCDA 1EVKA 3KJGA 4HFJA 5E2AA 4HQRA 1J22A 1UBUS 1ZM9A 3A9SA 4U8GA 4QJIA 1GZVA 5EHQA 5LFAA 3WG9A 3ZHQA 3THXA 1M0EA 4OX9B 4HEQA 4CKEB 2NTJA 3IH5A 2ZJ1A 1C7FA 2D2IA 2V4UA 1N8NA 3V97A 2ZWPA 3RUPA 3COJA 4DLUA 3CV3A 2VSOA 2WYOA 2E4ZA 3GUCA 4JGIA 5F76A 2FLKA 2Z2JA 3K0EA 4ZV4A 5KWVA 4MAFA 4HUTA 1M34A 4TZ0A 1QF7A 3UPUA 4Q4JA 3ZNOA 3E5MA 4QFMA 1ZDMA 4M36A 1HBJA 3ODPA 5CMLA 3MLEA 4N6GA 2QT9A 5DRTA 5FUWA 3T5BA 5KSOA 4JLSA 4PYNA 2V3WA 1KMCA 1VKJA 2HRQA 3DXFA 3EGCA 3G8AA 2IE0A 4ETWA 2E5FA 3S1AB 5TRTA 4RTPA 1IW7D 1K6JA 4NJMA 4OHWA 3PQFA 3ZNPA 1GSOA 3GHYA 1MEOA 2H1CA 1NR5A 4AULA 4DMMA 1E3WA 3HVRA 5BSRA 2WV9A 2HI0A 3SR3A 1E1QD 4O4HF 1ORIA 3HJUA 3NBQA 3QKIA 1W5FA 3R6TA 3VSAA 4DPKA 5TMEA 1QIKA 3OOSA 3AT1A 3GLIA 3HWSA 1NOJA 1U0TA 2QEQA 4R2XA 3TOCA 5K99A 2N1MA 2JFYA 2H17A 1CS4C 5BNIA 5C4IA 1P2UA 1ZJ6A 4R0NA 2VPYA 1ETUA 5L51A 3HMKA 4B09A 4FWTA 1GY8A 1F5NA 1M1YB 4GMHA 4F7WA 2A92A 1I3CA 4LI3X 4YAGA 1PR6A 4WUVA 5EXDA 1XWWA 4I50F 2PZKA 3EEFA 1ECGA 5LQJA 3DLAA 5CFRA 1EXWA 4J03A 2EKBA 3IAS6 4R2JA 2DWUA 4WD3A 1H65A 4RJIA 5IJXA 2V4ZA 1SU4A 2YRFA 3QF4A 2AZTA 5GTDA 4HRVA 2XB2A 1OTXA 3RF6A 3DV9A 3MVEA 1YNOA 1JYSA 1HRKA 1Z4NA 1I4TD 2P4HX 3HVUA 3KJFA 3VV2A 3HTXA 4C3ZA 1U5CA 1DJMA 4DW8A 2RGWA 1XDZA 2F3SA 5EUCA 3TW8A 4LRYA 2EWWA 4NU6A 2XJ4A 5F77A 1RRPA 2HR1A 1PUIA 4RHUA 5K3FA 5EJ4A 5E3JA 3ENNA 3UCFA 3FDJA 2IYFA 1ZRNA 1VB5A 3WHLA 3DS8A 4X92A 1VIVA 1VRWA 1STOA 4YGXB 4ZCQA 3MS2A 1VKZA 2BT4A 3L0OA 3OA2A 1A77A 1QXSA 1IJBA 3O8OA 3BIXA 4M0UA 1FDWA 4DWJA 2O8BA 3G9ZA 5TPWB 1E79D 3LL7A 5EG5A 2DPHA 5CM9C 2PD6A 2IYXA 4L28A 1SD5A 4QYIA 3G2PA 1QDEA 4CL8A 4KVFA 3ZZUA 2Z58A 5CLIA 4KDRA 1SC6A 4M87A 1N3IA 1QG6A 2O8NA 4FT4A 5AI4A 2I65A 3HO6A 3A36A 3CLSD 1PI3A 3DTTA 2AI1A 3O8NA 1J33A 2XYRA 5AICA 5KSZA 1UMBB 3DF9A 4KGZA 2ANBA 4X54A 2C8VA 4C0QC 5JYDA 3MJTA 2B1GA 2AB0A 1PK9A 1JEOA 4AZ3A 3IPLA 4C7XA 4BPRA 2VTBA 3Q8WA 1BMFA 3UJ3X 2GCEA 4ESEA 4IQ4A 1TYCA 1G6Q1 1KBQA 1HT3A 2HSGA 2P11A 4GF5A 4RTLA 2PV7A 4TYWA 2BUCA 4R9NA 2J6BA 3KUDA 4BMSA 1E9AA 3E18A 3VPBA 3IQHX 4M9XA 2X1HA 1JXQA 1ZQ1A 2O8EA 3E81A 1A9PA 3UBTA 2IYEA 1EAYA 3EA4A 4R84A 1CW2B 2XYQA 1KJ9A 4JL6A 1OOEA 1TM2A 3GDFA 3MOSA 1UBSB 3OKAA 4JOCA 4PQEA 2I6TA 1I2BA 1VGVA 1QK3A 3TAHA 1NOKA 3ZDBA 4REQA 2BE9A 4JJ8A 2OZEA 3HJCA 4WKBA 3PDJA 3L04A 3RRFA 2Q6LA 1N7JA 3L1IA 2YY5A 3KQWA 3QKUA 4YUWA 3GFFA 4KPGA 2CL7X 2Q2NA 5A1TA 1E99A 2PWYA 1IHUA 1UODA 2PQ2A 4MR8A 4CM9D 1AO0A 1Q2XA 1Y6JA 3W6PA 4L15A 3U4QA 2CDAA 3KG2A 1M6VA 3E8XA 4TRJA 1ANKA 2IY7A 3WIVA 2H4WA 3FWHA 1RCTE 3ZY2A 4D0SA 5J40A 2HGSA 1R27A 2JLRA 3NAGA 3TL3A 3W1EA 4EUNA 4ACBA 5JALA 1AU9A 1G41A 1MIOB 2PX4A 2Q1XA 1KEWA 3KYDA 4YAWA 4AURA 4ENPA 1K63A 1T9GR 1P7WA 3DPUA 3KAKA 3UAOA 4GX0A 3ZK9A 4DT1A 1F0PA 1JIIA 4IGAA 3GMDA 4AECA 3AR2A 4HLUC 2HPHA 4B2YA 4M8NE 3G89A 1J9EA 3UZUA 2GJ9A 2UV8A 1UFRA 4UPEA 1NI4A 4UVIA 3SE7A 5EUMA 4Z9AA 2ZTUA 2OCPA 1X74A 1GZ4A 2QLBA 4LGCA 1A9OA 1EM6A 1Z0AA 3DE0X 5CVUA 4LF8B 1E6WA 4LMPA 3PX3A 3DKRA 3HUEA 3P2IA 3BWVA 5LB4A 2HCTA 3IAM6 1ZUHA 5J1TB 4RYDA 2OBNA 3K2QA 1TF2A 1ZJWA 2PH1A 4MCIA 4BNIA 3TQTA 4XB1A 4AVYA 5I8WA 4CIWA 2CFIA 3IP3A 2J9XB 1XU9A 3DFZA 3ESXA 4GWKA 5TJHA 2WNHA 1E59A 1R9GA 3WADA 2E48A 1GPUA 3BCSA 3WRXA 1OFIA 3HEMA 3GARA 2G04A 1JH8A 2XT6A 3ED5A 3M0EA 1N1DA 4U9HS 5JCOC 3ZDZB 2C04A 4C0HA 2GN6A 1M1XB 1QHHA 1N8SA 3A4VA 1SVMA 3BWDD 4CMBA 1NRJB 1U9JA 2OORC 4UHHA 3HPRA 4ZI2A 2PFMA 1MGPA 4OP3A 2ERYA 3C6YA 2IHKA 5F1KA 3WDKA 3R75A 5LU8A 3N53A 1KVSA 2X14A 3N0VA 4GMKA 3I9V1 4BCCA 3KV3O 4CU2A 2WM3A 3U7FB 1Y8ZA 3MJRA 1IMJA 1J4AA 4D9NA 5KQLA 3EVZA 1A9XB 5AVOA 3VSBA 3ABIA 1W5AA 3JALA 2QUAA 4IIHA 5D6OA 4GDFA 3I2HA 3BG5A 4I6JA 5TQ2A 4G5FA 2RHHA 4H27A 1HDZA 1VE9A 2CHGA 1VLZA 2H2IA 3BIJA 4Y2XA 1BMFD 4LJ6A 2IIPA 3FYCA 4QU5A 2ZIZA 4L78A 3SQMA 1GZHB 4J0JA 5EJ7A 4G67A 1QFMA 3OOJA 4JR1A 3FFAA 3AESA 1OLOA 1VHJA 3H2GA 1CEXA 1GARA 4I9UA 2BEJA 4GL4A 5G4KB 1MN6A 1PVVA 3TW0A 3FMOB 3HUDA 4DUYB 2ECOA 3FN4A 4HMPA 4G56A 2DH6A 4LZWA 5FPTA 1TAGA 4CEJA 2H31A 4QE3A 3UMSA 4AP5A 5IF3A 2D0IA 1QG2A 2V98A 2L82A 5DLYA 5T4FA 2W43A 3OFKA 3LKBA 1U28C 2WPDA 3F3YA 2ZTLA 2Q46A 4WSOA 2Z43A 4C08A 1V7QA 4WNAA 3IP7A 4XYMA 5EQJB 5DFAA 3OFND 3D7SA 2DERA 2GEFA 5KYXB 3HWX1 3V4OA 3FNEA 1HYGA 1ZN2A 3UGKA 4ZJYA 4Q05A 4XOUA 5DM60 2YWJA 4IHJB 3K5PA 3R7AA 1AKUA 1MAUA 2RGDA 3LPMA 3LQKA 2O20A 3Q7IA 4MHOA 4RK6A 5AJYA 2PZ8A 3C8UA 4I0WB 2PJZA 1F2DA 5K20A 4Q1VA 2JI9A 2VKQA 5AW3A 1FFXA 2VO1A 2ZE6A 5AXCA 3UXYA 2ZBRA 1BROA 2C83A 1EDDA 2JRLA 4P4GA 5CYOA 5BUQA 2OENG 4DKXA 3KJQA 4W5RA 3MK31 3PQ3A 1PL0A 3PPVA 3ZE8A 3IOBA 2PMCA 3ZBUA 1NBOA 2INGX 3TAUA 1S5PA 1FFBA 1L4HA 3M4XA 3L4BA 4GR4A 2XA9A 3NH6A 1WXEA 5G2OA 5T4HA 1XRRA 3HGTA 2BP7A 3C1TA 3N3AC 3NEPX 4XYEA 1W85A 4B8YA 2GM4A 3NM5A 3KQLA 2QZSA 3U7EB 5F2KA 4ZVSA 4E7PA 2MOKA 3QBJA 1Y6FA 3P19A 2DOKA 3TR5A 3SN6A 3LP5A 2DX7A 3AU8A 3F73A 1I3LA 1VE1A 3PTLA 4LG1A 1KI1A 2WB2A 5U4XA 4EPVA 3L9XA 3P0RA 5FB3A 5GZ6A 3BXEA 3QX7A 1CCWA 4AYTA 3KTDA 1QNFA 3DMYA 3W0LB 2IP1A 4OGLA 4R98A 3ZCXA 3GMTA 2EDCA 3TMYA 5L95A 3RC9A 2SKEA 1H3FA 1SBHA 3QXCA 1H3NA 2QRGA 4PGGA 3EEQA 1VJCA 1LW6E 2W90A 4G65A 2I2BA 4BJHB 5JI3E 3AUXA 3I3SR 3L49A 2DCMA 2V7VA 3VQTA 4YRSA 2PKQP 2IQ5A 3O74A 3QHPA 2JFWA 2WHYA 1C0EA 4I7EA 2GFIA 4N0PA 3RYFB 5KDDA 3NAMA 1A2OA 1ZUD1 3TR0A 2V7WA 3O1JC 1DEXA 4KDFA 4BCDA 2ZRLA 4ND2A 2JVJA 3GGGA 3C7TA 3HI4A 1BC5A 5AHWA 2GA9A 2R2AA 1L5WA 3BE4A 3CISA 2GX6A 4AJ9A 3OX4A 4QPCA 1U2ZA 3DAGA 5AVQA 2PRYA 1SXQA 3PCTA 3CZAA 2O2SA 4KE9A 3CX3A 1I1QB 1AJEA 1EDOA 1U5BB 3DTVB 2AV6A 4GIBA 2FFBA 3VPDA 2ZSKA 4JJAA 1E1MA 4O59O 2Y0EA 3SEFA 2EX1A 2A9JA 3H9UA 3HV2A 1DQNA 4GR9A 2F3TA 1V2HE 4M89A 4QBFA 4Q00A 4UXHA 1FUEA 4H77A 3WZMA 4C14A 4UOZA 2DQYA 5F98A 1QLHA 4H7IA 3W5JA 2RHCA 4JX8A 4CV3A 4F2PA 3H0CA 4J0HA 4CM8A 4AUMA 1JQ3A 2CVPA 4JLPA 4M4SA 4NBWA 1NYQA 1ZOOA 2AMVA 4HDOB 1R5JA 4KQFA 5HUQA 4F3TA 1NPYA 3M6XA 3OH8A 3SFTA 2A9OA 3Q7QA 2XV1A 4BFYA 3V8QA 3ZE9A 4YGYA 3R7WA 2C58A 2V55B 3JASA 1Y9AA 3MB5A 4HX2A 4HVLA 4N54A 3IA7A 4RS4A 4IQJM 2AN1A 3U5TA 2VJOA 1Q14A 2ZJYA 2H57A 2PUJA 4TSRA 1FDVA 3DYVA 4Z49A 4A6PA 4TV9B 4H3KB 2WPDD 4U9UA 2CSXA 1EJ6A 1EX1A 2QNBA 5E3IA 4B7ZA 4O4JF 4ROSA 2GPJA 4TTAA 3ZCTA 1KI6A 3LYHA 1S8AA 4ZZ0A 1N1GA 4AXBA 4EQ6B 2FDCA 4JB0A 2H00A 5LZ7A 1K5HA 4LOAA 1ZW1A 2FZGA 2V59A 3U3MA 2HNBA 4YP5A 2A1UA 3VC1A 4ZOLA 4MWZA 5H4GA 1FFDA 3CB4A 1C8BA 1G8JA 1ZGGA 1Y5RA 2Y1GA 3PGMA 3S29A 2DKFA 3ZCRA 3WSWA 4X93A 5CAEB 4BEWA 5HJEA 1V7PC 1PT7A 1R18A 3RQSA 1P9LA 8ATCA 1KSHA 3KEFA 1DXYA 3TOSA 5LQCA 3GJZA 1PR4A 3NBYC 1ZLXA 2ZIGA 2CLEB 2ONKA 1GUYA 1ZD2P 3ETEA 4QTXA 4UHJA 4Q7LA 1BN6A 4UU0A 3ZX4A 3HWRA 5LWHA 3RADC 4KAFA 2A57A 2CMKA 4GGOA 3EGVA 5JSZA 2J6IA 4D8TA 3CH5A 2PO7A 5A9TA 3T7AA 2EV9A 1A97A 2J3MA 4WEQA 2CVFA 3CTPA 3R09A 1U04A 2C1EA 2JS7A 1XWOA 1D0SA 2ILVA 3I73A 4KO1S 4N6OA 3RVKA 5ICEA 4RQTA 1ZO8A 3O1HB 4MS4A 3EFBA 3O4FA 4TXLA 1P61B 1RLTA 2QTWB 3AHGA 1IM8A 1VIDA 5FAXA 1KDVA 4MKXA 5DCYA 4LYGA 4QU9A 4F3NA 4ZT4A 4JLBA 2HU5A 2H1OA 3BSSA 2CL6X 5F64A 1X8XA 2J0VA 3ROGA 3GAZA 1TLTA 4FYVA 4L4SA 4EVRA 5I9MA 1W35A 4IRXA 3M82A 3PUKA 4PZZA 5EJ8A 3M6AA 4R1SA 5T41A 1CUVA 2JD1A 2XGSA 1T34A 5FF9A 3RASA 5BNTA 2HCJB 2EBWA 2XWJI 2MJLA 5TPZD 1XRSB 1OW3B 2WABA 4I8DA 4FU0A 1QONA 3D59A 4RVNA 5B12A 3MCTA 5CXUA 1LU9A 3B38A 4NECA 4ENUA 4H3SA 2NVWA 4V0KA 4MKGA 4WASA 1C29B 1KPHA 3PXXA 4B7UA 3UPTA 1XTJA 3R5XA 5DGCA 1BHQ1 3HXPA 5ALKA 1MFZA 5GONB 5B2EA 5C1OA 3FVWA 5TF4A 3TB6A 4AJLA 3N2KA 1VHDA 1JT2A 1YASA 2Y1CA 2P30A 5G0WA 4A5SA 3R3ZA 3Q3GE 4D9IA 2ZJZA 4ID9A 5DW3A 5FL7A 4PNEA 1A50B 1P7ZA 2H4XA 2JC3A 4KGDA 3OTGA 4R9UC 3VTFA 3RVLA 3W4KA 2J7KA 5ALWA 4J2HA 4JEUA 3BWBA 2GPWA 3FLAA 4Y7DA 5F73A 2AEEA 3SZRA 5KQRA 3U31A 3HJBA 1Y8AA 3P9YA 4HRXA 3M3DA 3RSCA 4D43A 1L3BA 2D5CA 2WD7B 3WI7A 1SVKA 4N03A 4AIRA 4DYVA 2RH9B 5IX8A 5JH7B 4GUDA 2PYDA 2GILA 3B60A 2IXEA 4MNTA 4OLHA 4QUGA 4RY8A 1GFIA 4QODA 5JLAA 4L5BA 4QOSA 3ZKAA 1XHFA 2VJKA 2VDJA 2O1XA 2P9QA 2YHBA 3GEPA 1PJTA 3P9KA 4HO1X 4M86A 3QEOA 1TCBA 2YC4C 2PQ0A 4ZALA 4AUNA 1GHTA 4ZK6A 4LXYA 3HB9A 1V41E 1M74A 2GPBA 1VMIA 2PVCA 1F20A 4B3IA 4QPNA 1URPA 2A0WA 4PX2A 1Y9DA 1XTQA 4ZT3A 4CQJA 4UZFA 5ITSA 3VTAA 1W30A 2ENUA 3M6WA 3UFXB 3L0BA 3D6FA 3ITKA 4MO2A 4HPJB 4Q03A 3H1TA 5HS6A 2JRCA 3ANYB 3ZDQA 4B43A 4DHWA 3MOIA 3AM1A 1VE5A 3GF4A 1I0IA 4OBWA 4EG4A 3H13A 4B33A 3AIIA 2OGZA 1HE5A 5SZJA 4QYSA 4AP9A 1A8HA 5A5DA 1WLSA 3N59A 4Y67A 2Y92A 1X7YB 2NIPA 2HPZA 5JXJA 2R0QC 3WR5A 1ZGHA 2G07A 4Q3CA 4QGBA 2O2XA 2JFUA 3PQCA 5IVKA 1SUFA 3FCYA 1V11B 3DF7A 4INOA 1GLVA 1QCZA 2X22A 4JLAA 1HLGA 4K8RB 4XFDA 3K35A 2HV9A 2BFCB 4Q4LA 3KWMA 2RH8A 1NN5A 1J2JA 2F3UA 1QB8A 3TUJC 4PSUA 4DIEA 1YJCA 4CF7A 3OMXA 1XUOA 1REQB 2NO5A 3BL8A 3QPCA 5BOSA 1RBZA 1BDIA 3QU7A 3PUZA 4TMTA 1JXMA 1Z62A 4NU8X 4GPEA 2XVZA 2XGJA 2IS4A 5D6NA 5D7NA 5BVHB 1DG9A 2BWJA 5BVGB 1ZA2A 4J1TC 5E7IA 1K2WA 1LBHA 3P71T 5F4BA 2IYLD 4TV8A 3LGXA 5F23A 4H7FA 2AFHA 2FOXA 3SFZA 3QKWA 4C88A 1NNUA 2JAHA 3WMEA 3IEPA 3BFVA 4MGZR 4OSEA 1N5DA 3ZWWA 2O07A 2NUBA 3I64A 3EAGA 1PJZA 3L1UA 3L7DA 2R79A 2PY6A 3EWSA 4ZT2A 3PNMA 3UFBA 1SG6A 5DCWA 5FXMA 2FEMA 4CV2A 1HZJA 1SWWA 3G3EA 3EIFA 1T0PA 1O03A 3NBXX 5KEIA 5CRIA 2V1UA 2BFNA 3MINB 4X91A 2I2WA 2I1WA 3QU9A 4LWQA 2WQ6A 1AT1A 1A8PA 1R0WA 3L06A 1QVRA 3R3JA 1QC5B 4G89A 2ZROA 4R4JA 4YCLA 1N2ZA 2O7QA 4RO0A 4TQ9A 1I51A 1JEEA 4WGGA 3ONNA 2P2SA 1PUJA 2FE1A 5DHSA 2FJUA 1OKKA 2KW5A 3PEFA 2IGTA 4YJ3B 5D3KA 2EJCA 1HKHA 1NSFA 3HKBB 1V5GA 1E0DA 2HSDA 3TZKA 3EVTA 5JARA 3ZU3A 2CVQA 1ZGCA 3DGEC 4GI3A 1QFJA 2WU3A 2FXVA 3E7XA 2VIIA 2WF7A 4RD1A 4ZVPA 4ZQIA 3SSNA 1UMCA 4JB3A 5FL7D 5L7YA 1IBSA 2FFQA 3FOCA 3BMXA 1UBJS 3PXAA 4HSGA 4BTEA 1SGWA 4OYYA 1L7OA 3T7JA 2VNAA 2OSBA 3QFTA 4KOAA 4PLZA 1QRRA 1EM8B 2ZTSA 3CA8A 2VJLA 1ULHA 2GLXA 3OIGA 4M49A 1JR4A 5TEWA 2X8AA 5MN6A 3CVYA 3NXSA 3EIXA 1K3FA 1TT5B 4ITUA 2IV2X 5HW2A 4V3CA 1SXJC 3RSHA 5IU6A 1E2BA 4LDQA 3NOOA 4BN0A 1RWXA 4NV0A 3RFUA 5ADVA 2FSSA 1JFRA 3WL3A 4DEXA 5J3JA 3GGSA 3VYVA 4FT2A 4TT8A 4PW0A 1MQ9A 4J0QA 1W8DA 3EZLA 1AN0A 3JQPA 1XMOB 3GRFA 1F06A 2FETA 2O05A 3QUCA 2EVWX 3C6KA 2WYWA 5DBGA 2GCNA 4URVR 4P8RA 2QX8A 4YV0A 1ZD1A 2ONZA 1QHIA 4QFDA 1T4BA 2P27A 3NNNA 2QYSA 2J9YB 2R1VA 3A4YA 4RTNA 3D7NA 4BVHA 3Q4GA 4QHTA 1XLTA 4REMA 3TLKA 1JU9A 4LHYA 3PJGA 4EGAA 1FCJA 2VDWA 3CUSA 2C8KA 3SIRA 1LSJA 1P74A 2P67A 4EMBA 1Z45A 1D1TA 4R1OA 4N1AA 1N6RA 2ZIFA 1AHNA 3AOEA 2GRAA 2IDKA 2BGTA 5A6VA 3BHIA 3DL0A 4JT2A 3DKIA 5C5DA 1SUBA 4YH1A 3EVGA 4DUGA 3UCEA 1N33B 3TRFA 2BHSA 3VFDA 4X41A 3WQBA 1XTKA 3C1OA 3IQDB 5JRDS 1X2EA 4UCFA 2ZQYA 1KQOA 3IHTA 4XIYA 3IQGX 2VHYA 5FOVA 2P41A 3WYAA 4IDFA 1O6ZA 3WX0A 2PQMA 1P60A 4TGLA 3KVNA 2MSWA 1T8TA 4NEGA 3EQ9A 4RXUA 1JAYA 2R62A 3ROQA 4XQ9A 5CA0F 4ZCPA 2DM6A 3T9EA 4DCNA 4D9CA 2G1KA 3KB6A 3C5VA 2VHQA 5IW8A 2UU9B 4QG7A 2RB5A 3RC3A 2ZTVA 1NW8A 1XZGA 4E15A 1LNSA 5EKUA 2QNIA 5L3QA 3WRWA 4YIHA 1CQPA 3OJLA 2XDAA 4G25A 3HP4A 4URXR 3IAXA 4EL0A 1JLHA 3O92A 1PTKA 3CEPB 1AY0A 3JVDA 3TKYA 3UATA 1ZXXA 3LU1A 2IZ6A 4MJ7A 3RIYA 2BI8A 3NS7A 3KT3A 4BV9A 3NYIA 5REQA 8OHMA 4BZXA 3D3JA 1GAEO 2XMPA 3B85A 5KKNB 1P7CA 5DH9A 4ZVTA 1U1GA 3OQPA 4RE6A 4CM5A 1BMDA 2Z3ZA 3TRHA 3ZXSA 4EG3A 2VBCA 5I7UA 2F00A 1ZVKA 2MSLA 1JWLA 1DWOA 2JF0A 4PGFA 4Z0TA 3ROXA 5HILA 1T43A 2SCUA 5IJAA 4ZKDA 1C1HA 1HG1A 5TV2A 2J0UB 4Y9DA 4Y7CA 3WQRA 2FKNA 3CC8A 3CWZA 1RI1A 3DFUA 3L6CA 3U4IA 4UC0A 3IUSA 2BSAA 4HUQB 4B4VA 2Y2UA 4R71A 2GD6A 1Q1NA 2X13A 4YMIA 3W8EA 1MRNA 4CDGA 3BX1A 3LPDA 3RS9A 1ZI6A 2QJOA 2CXTA 4PS0A 3IEUA 4EUEA 3IOYA 4ALLA 5B4TA 2VPTA 4NENB 1BS9A 2ZZNA 3GNTA 3FPJA 1XPOA 2GJ8A 2J7PA 2A0UA 2Q7XA 2XZPA 4G5RA 1XKLA 3QNMA 1BJKA 4I2VA 4JFRA 4NMHA 2VHEA 3L18A 4JD5A 4MP3A 4XGRA 3RYIA 3SYKA 4C4PA 1RM5A 3CPSA 4HJRA 1IZ0A 2GJSA 4LZLA 3RS2A 3RWOA 5P21A 3CZMA 3IKVA 2F3PA 3NJ8A 3B48A 4COOA 3A27A 4XLTA 5ADUS 1CPYA 4BE4A 3PSHA 3ICWA 1IG3A 2H7VA 1FFSA 2HA7A 1G19A 3G0BA 4LSWA 5DLQC 3TLGB 3G9XA 4F1WA 3QEBZ 1CULC 1TJYA 4QXAA 5YASA 1DX6A 4XJTA 5EZYA 1XKTA 1B8NA 1KRHA 3R3UA 3N0TA 3BZBA 2UXCB 5JHGB 4XD7A 1J2EA 2NO9A 1WUJS 2FSIA 3IUBA 1LVUA 4BP9A 3R2JA 2B20A 1OMOA 1KAEA 2HADA 5B55A 1T4CA 4W6QA 4LKOA 1OT3A 1M2OA 2X7HA 2NPIA 5C32A 1BU5A 2Z3VA 4HQ6A 5DULA 3A58B 5CXXA 1UOOA 3GOQA 3IV9A 1LZLA 3ESZA 3VKWA 5E0OA 3K6SB 1TQDA 3K32A 1N78A 1TK2A 1F38A 2GKGA 2RARA 3FGNA 4NDAA 3THRA 1U15A 3DVLA 4DUGD 5LP6A 3W3ZB 1MJGA 3FMVA 5JPIA 3UOAB 2Y1WA 1WZUA 4QSMA 5LLSA 2ZTMA 3VX4A 4WJZA 4FW9A 5AK4A 4AF8A 4H15A 1JE0A 5SYMA 1QIGA 4XCVA 1NT4A 3IC5A 4AMUA 5KU7A 3C3YA 3N1UA 5B7QA 1EJBA 2VPIA 4LQDA 2E18A 3SKXA 3FRHA 3V1KA 1Z12A 1EQ2A 4JLNA 3OLZA 3NTRA 3A6LA 5B1HA 5IFLA 2GEDA 3G13A 4DPLA 2ZXUA 2W2QA 3DBRA 2GAIA 3D3KA 4QDKA 4F4HA 5JS1A 3WGOA 3EFOB 1V25A 3N8IA 4QXQA 1GG5A 1J5EB 1ZY2A 4JXKA 1GA6A 2P5YA 4MP8A 1Q95A 5AKHA 5JCZA 2RD2A 4S3MA 1SA0B 5CVTA 4X1IA 3WV5A 2BW0A 4FFWA 3I1IA 4YXFA 2CDCA 2OAQ1 3GI1A 4Q34A 3PIIA 4QZVA 1CVIA 3A4MA 1X9IA 4U7WA 4AJNA 4N6NA 5I3ZA 3Q0EA 3FPFA 4PV7A 4AQYB 3C1AA 1WVIA 5HOQA 1SD2A 2XCQA 4POAA 2DFKB 2FUG1 2WTAA 5HF8A 1WDWB 2Z6VA 2C9YA 3T5AA 3K71B 4Z7QB 2ZJ6A 1IDN1 4BKUA 1J9ZA 1PWZA 3CN7A 1SG0A 3CWQA 3CR7A 4ZP1A 1QAQA 4DMKA 5I6DA 4IH4A 3STWA 1CRQA 3BJMA 3EQ2A 3H3XA 1JDZA 2ZBEA 4EJSB 1SQFA 2XF2A 5DGXA 5CR9A 3PKJA 1U3TA 1T5OA 3K96A 2XA1A 3DEFA 4XFJA 1OZAA 5BP7A 4OSPA 4B4KA 3HKEB 1OXUA 1Q1AA 4YMHA 3NHLA 1KZ9A 1UWLA 3B53X 4JITA 2ASEA 2G36A 4F92B 3PFHA 2B5OA 2R8ZA 5EHGA 3FW1A 5TMBA 1ZWLA 3R7NA 5EUBA 3S70A 1DBIA 2I7CA 1U7HA 2JATA 2WG1A 4GUAA 4UHFA 5AQEA 3UQZA 4RH1A 4B81A 3H9BA 4CCYA 2J7PD 4C0LA 4DJFC 3P0JA 4WNIA 4ZVRA 3R8XA 4DFDA 3ZI0A 4PLWA 1PR2A 3RSGA 4R1MA 1GGEA 5KVVA 2NO0A 1PQYA 2H0AA 3BAZA 4OXXA 3GRKA 3NPAA 3ETLA 2BBWA 1IHDA 4MSUA 2VSQA 3WGTA 5J4VA 1N8TA 3SNKA 1ECJA 2WILA 4JASB 1A69A 1P91A 2EG9A 2A67A 2WJ3A 4MARA 4YCBA 3TI7A 2WU4A 3UK7A 2CSUA 1MZVA 2CWWA 1UADA 1VZ3A 1KOJA 2GM3A 3DDSA 3OURA 4KTVE 1QIEA 3S1AA 3CX7A 1QRDA 4AB1A 5KS2A 1HG0A 4CKCB 1X19A 1E3TA 2EFCB 2OT3B 3GCGA 4B76A 4DV0B 4XD7D 4C7VA 1IHPA 1JVSA 5TQ0A 3VKGA 2I3ZA 2BGKA 3HP1A 1SM4A 3PJDA 2VT7A 5L7WA 2CV1A 3ZDCA 2J0QA 3HA3A 5KOIA 1JEDA 3OUTA 3E1KA 1NVFA 3AG6A 4RNCA 1KO7A 1N9ZA 5JSFA 1ZLYA 4EECA 2A0KA 4LNAA 4LQCA 4ZT5A 3TINA 1TGYA 2VP5A 1YWGO 3VU8A 4NXMB 1DC6A 1A5BB 4I9FA 2NU7A 2IPNA 2X5NA 4PG7A 3TIFA 1E7WA 4M0CA 2PMEA 3D02A 1FMLA 2GBPA 4L0CA 5HRAA 1UBNA 1JQEA 1MB2A 1LTHR 1M1YA 3JQRA 3NXKA 3DVRX 2AC4A 3WRYC 3F98A 5KMGB 4R9SA 1R7RA 3DGFC 1SIWA 5FFMA 5CCBA 1Z0DA 2W6PA 4EW1A 1XZIA 1NWCA 3GJYA 3VO2A 1GNPA 5KYGA 1U8FO 1WCYA 1G2IA 1DX9A 1W73A 1YBVA 1U2SA 1KEZA 4KN8A 4HY3A 1K66A 1LTQA 3MTAA 3NTXA 5TGDA 4UULA 3GRPA 3AEUB 2QRVA 3MGAA 1UL1X 3MD0A 1VCNA 5BN5B 1XNQB 4D4MA 2DGDA 4R1UA 5AHXA 1QJCA 5L8VA 1NPDA 2WZDA 4A10A 4CKXA 3U60B 2GB4A 3PRJA 1SKBA 1NN3A 2QI9C 4PGMA 1CRWG 3ZJTA 1SVOA 2CUKA 2W83A 1FU4A 1IXRC 1NUAA 4NTZA 1UOEA 3NHAA 1FYDA 1I6MA 5JS7A 4YUZA 1XDUA 4GAEA 5TPWA 1NI3A 4L6IA 1KYQA 4HEA6 2E4WA 2EIXA 1I5OA 2WTUA 1RT9A 2VYNA 3EJWA 4Z1OA 1E64A 5F9MA 3R8FA 2ZRCA 1PT6A 3GO4A 3RJMA 1UT8A 5G1OA 3HYSA 2H1LA 2W93A 3EH1A 4K9KA 2VZ8A 1UMBA 3UWPA 4CTOA 1H94A 4M38A 2P77A 3IJEB 1YL5A 4ZYZA 2ZYGA 3QFFA 3VH3A 3QU2A 3W5UA 1FTGA 4RV9A 2ZM5A 4NLLA 1H66A 1P2DA 3FFBA 5IXSA 1TJVA 1F2UB 3F6PA 4H6VA 4OJKA 4WCDA 3ZBQA 3DLHA 1Z7BA 4MR7A 1LA2A 1YFZA 1HSOA 3WS7A 4ZC1A 1KDTA 4FZ3A 3SS7X 1NVMB 3MGCA 4A92A 1I9CA 3MJSA 2I3DA 3R24A 2OXCA 4OQFA 5M04A 3PUIA 1QKJA 1KQ7A 4FDAA 4JA2A 4E2FA 1HEUA 2DY1A 2FLVA 2ZIXB 3I9FA 3QZUA 1NVBA 4TKZA 1PGPA 2O19A 1SCQA 1PLKA 3TD6A 4IFBA 2IY8A 1OXBB 1YRWA 3ET5A 1LH0A 4TTPA 3VZCA 3U26A 2GH1A 2K5UA 1B0AA 3E58A 4BO7A 1BYIA 1T6ZA 2XBUA 3GGDA 4WPGA 3WGJA 5ICSA 1GCIA 5LQKA 3QY9A 5AJZA 4W5QA 2OO3A 4ND7A 1ZN9A 3UUWA 1PKXA 3FDXA 1P2SA 4F6LA 1DP4A 3EISA 4D9BA 4ETMA 5B36A 5CTJA 1WB6A 2P35A 2F1KA 4YO8A 1ZHFA 4WRRA 3AYZB 3NH9A 4ZHSA 5HIAA 3DVQX 1HE2A 3BBPA 3AWIA 4HTFA 4HNVA 5BSMA 2QVYX 5KCZA 5M29A 3GLVA 5EPOA 4DADA 4CTMA 5DHPA 2G71A 4JUDX 3KOWA 3LDHA 2NXCA 1NXTA 2W2KA 4N5MA 1Q91A 4NYJR 3BMNA 1OXTA 3D1LA 4HDKB 3BQMB 3L6DA 4UEQA 1CS0B 1KEEB 3CRVA 3O9MA 4C7MA 3KALA 1E9BA 2BRUA 1F8YA 2H5LA 4R31A 2R85A 4RENA 1EFDN 4NQZA 1RPTA 3UK1A 2Q45A 3V8BA 3KQHA 1RTKA 2HK9A 1U3GA 2AK3A 4KSBA 1K6IA 4BAGA 4DSUA 2AG1A 3CPEA 3G8BA 3C87A 4ZEWA 1WQ3A 2VATA 1Q11A 4TSKA 2AFIB 4PRLA 5F3WB 2NUPB 4DDMA 2I3AA 1EVZA 1FVHA 2BV3A 2ZI6A 3G0DA 3V34A 3O26A 5C4MA 5ENZA 3ZDAA 4Z86A 4KZKA 2CKMA 4REOA 3UH1A 3CVVA 1KH2A 3QJYA 3T3NA 1JIKA 1JKMA 1LQUA 4BX0A 1UP4A 3FCEA 1GGJA 4NZNA 4YY3B 5IASA 1QHNA 2EFDB 2WZBA 1P4GA 1QO7A 4BNGA 3JYLA 1JVNA 5E4FA 1E3EA 1Y6GA 3ICPA 5D5HA 2YNMA 2G8LA 1TVCA 4A8TA 1CJVC 1Z68A 1CHNA 2N9UA 1J2YA 2XYVA 3QE2A 5E0KB 4L76A 4GKJB 3ILHA 3QE3A 4R05A 4KXQA 1RJ9B 3VR5H 1KJIA 1F51E 2GCOB 2QF7A 4OK3A 3NEYA 4DPMA 4ZHQB 1FNCA 1G9TA 3OT5A 3PHHA 3D0RA 1PFWA 3OQIB 4TV8F 5B4VA 5KQMA 4D25A 3DZIA 1NUPA 2OHOA 4MGKR 5A4DA 2DQKA 1WMBA 2NU9A 3CX6A 2VYND 2NPOA 5DP1A 4RBNA 4CFSA 1WY7A 3H9JA 4II2A 4EP1A 2Z8XA 4P5EA 1J6UA 5DEOA 1A9XA 2AVNA 3CF2A 3L8HA 4RW0A 3SJZA 3AVXA 4K03A 3IT2A 4CQLB 5B6IA 1V8DA 4X94A 4YJ2A 4MKZA 2HW8A 1N6KA 4V0LA 2GN9A 1S7CA 1NUUA 2CEAA 4B7XA 4BX2A 1A8IA 3P4UA 4G0OA 5GIOE 3OMLA 5DHUA 3EBOA 4KO4S 4CQMB 5JCPA 1OR8A 5JQGA 1K7EB 3BCHA 2HHAA 4MGHA 4MEJA 1YQQA 3F7NA 3ER8A 5BRJA 4DABA 3TQCA 4DILA 3WBJA 1QDLB 3AU9A 3JQCA 3DE3X 3K92A 4AJ4A 5J2UB 5LYJF 2HU8A 5BSVA 4WESA 3TAXA 2TECE 3A3KA 1JQJC 2H1WA 3OPYI 2QM0A 4GLFA 4P5PA 4Y6LA 1C30B 1TYZA 4W1PA 5EQDA 1TI7A 4BFVA 821PA 5LM3A 1T1EA 2DFNA 3GLGE 1JG2A 3WGNA 2C4WA 3GLHE 4CLOB 3UJ8A 4QHYA 4URUR 1TM4E 5KNBA 4QD3A 3DZHA 5KYXA 2YBEA 3O2QB 1N7IA 1WL8A 4EFLA 3RAEC 4R81A 5DYYA 2D0OB 4IHJA 4K0KB 1D2GA 3RJTA 4HGPA 1QH1B 1WVMA 1EK1A 3U6KA 2H2WA 4O5OA 3IRVA 4HNAB 4PC1A 2WFZA 4AKEA 1ST2A 2ZBQA 2DUNA 3QBTA 5DXFA 1PWEA 1YJ5A 3EQ7A 5EN4A 3GPDG 5SZHB 1AIPA 2Q1TA 1M0SA 3KT6A 1U7UA 4I1PA 2JJ1A 4XRRA 5CP8A 4D80A 1A9TA 4L22A 3R40A 4OB6A 4C78A 5BQ3A 5EJ6A 3UJNA 3NVAA 4UTXA 1KI4A 4FOOA 3WIUA 4UFPA 1JLSA 3K16A 1HO3A 3C0KA 2WWXA 1WQ4A 1UBEA 3GUVA 3OE5A 4LTDA 4U7TB 3V3KA 1D2NA 1NLFA 3TSYA 4H1VA 3GH3A 2P3LA 4P81A 1TZ2A 5TR9A 4DMFA 2ZJAA 4D57A 3TXXA 1G21E 3UT5A 2HQSA 2FWBA 3ER9A 3WLJA 4RL6A 4ND8A 1PJBA 1LX7A 3JARB 3MIIA 4OLFA 3RVOA 4BNXA 3G6WA 3B2EA 4K46A 3H2BA 1GTJ1 5A7GA 1E4YA 1R4ZA 3NANA 1MRSA 5H70A 3RTGA 3TTVA 4FKMA 2X2EA 4BO5A 1RC1A 3A3OA 1CB7A 4JZYA 2Q99A 3T4XA 2YNMD 1G3IA 4Z0PA 1QYVA 3U0VA 4JY7A 3O8LA 1MEEA 1TCCA 3A9RA 1SUEA 4FN4A 1FY2A 4JVMA 4OK6A 1E8NA 2G77B 4QOHA 5F21A 5I8ZA 2JBHA 4LOLA 4OI4A 4ZKEA 5LQAA 3K0CA 5CVVA 4M8LA 5FTNA 3K9GA 4NZYA 4F4IA 3ZY3A 2Z6AA 3HB1A 3ZWOA 5I7VA 3NBFA 5IJ0B 2NNWB 5ES4B 1X42A 1BRMA 1HA3A 2C0CA 2NZVG 2IUFA 4B6SA 2P8JA 4LYDA 3OQHA 2B5VA 1IXYA 4N4AA 4M37A 5BR4A 4KQEA 4LRQA 4FPXA 4BMCA 2HL6A 3FYTA 4OHMA 4LJRA 2AH5A 1LY1A 5KZMB 1XRMA 4RABA 3JVIA 1QG4A 1MAWA 4TWAA 2XD9A 3QEKA 2XUHA 1KGSA 1Z6AA 3DQPA 1OH6A 4WY2A 3ULKA 3NONA 5HOEA 3I42A 3EGIA 1K6XA 1MT3A 4UNPA 3ZHZA 5BNZA 2XHZA 2WB4A 2QGNA 4QBKA 2II6A 1X8LA 1Z5WA 2DJIA 2M9MA 4GOKA 3SPXA 1QNLA 3ZNQA 2PUVA 3R44A 4WTOA 2G40A 2W22A 3F2IA 4A6XA 4S1OA 3E84A 2YWFA 5JEDA 1C1XB 2ZSIA 1U1CA 2QW0X 3FBTA 2UUCB 2VTDA 4NYMR 5J4HA 5EERA 5JD4A 3GLGA 1PR3A 1XTTA 3PR1A 1UKAA 4K5QA 3CCFA 4KFTA 4GPBA 5F3RA 4EMSA 1IUOA 2Q6KA 1RI3A 1E1YA 1Q16A 1ZIXA 3GLHA 2PJDA 2JIQA 2FA9A 3AUKA 1GL7A 5LCXA 2ZYIA 4L5YA 3QVOA 1HNWB 3DMNA 1NY5A 2XJ9A 2C4NA 1NJ2A 3QXXA 1ZZGA 2VZEA 2HHHB 2I2FA 1RZ3A 2XE4A 4L9SA 5EIBC 5BXYA 5KNBD 4INAA 3AVOA 2IXGA 2NZUG 4IYJA 5DK4A 5IEBA 3UJCA 3VPSA 3GEGA 3ZU2A 1OUMA 5BSUA 3GJ3A 4HAOA 2IHUA 2V9CA 3ZE6A 1XRQA 2G3YA 1Y4DE 3F4KA 3S7TA 3IMGA 3DXXA 5LJIA 5BR8B 4IRUB 1GR1A 2VDRB 4UW9A 4YR7A 2W2LA 3UKOA 4BMZA 4WJKB 5FNVB 1RLUA 3N74A 3P2MA 4YJFA 2PXHA 5H02A 1G4HA 1LJUA 4J91A 3MZ0A 2JJ1D 2I80A 4G24A 4X20A 2QRMA 3EXEB 1UKCA 4C29A 2BAGA 3VO1A 1HDRA 1KY2A 1U2QA 4NE9A 3H5IA 4F38A 2BEWB 3ADCA 1ONOA 4A0QA 4CM4B 3UMCA 1A9RA 1AKEA 5AJTA 4DN6A 5EEGA 3KQPA 4MW6A 4S0XA 1NVVR 1TMKA 2H1FA 2ID8A 4FNGA 3EDCA 4UQPA 4BLOA 4ZYXA 4AFNA 4UEKA 1BX1A 1G21A 4G5XA 3FHOA 2WJGA 4JGGA 4JOSA 5KINB 1MNQA 2VC2B 4QGFA 2VAPA 3SQWA 4HGOA 1YB2A 2IUUA 4D9JA 5IUNC 2R11A 1GDTA 1UM9B 3SR0A 3IXMA 5HXAA 2BUAA 3BWEA 3GJ8A 2EJBA 4DWOA 2C1ZA 4JT8A 4BVJA 2QX7A 2WHPB 3AO0B 3X1KA 1N2CB 2DBRA 3GA7A 1CNFA 4B1FA 3U6BA 3LY5A 2R4QA 1Z0UA 5FUBA 4G85A 2DPMA 2QMHA 2QT1A 3HVKA 3A1UA 3JQ6A 4QPDA 5HDBB 5K0ZA 2VBIA 1CXZA 3N2ZB 3GNLA 1U8XX 2V58A 3GVCA 3G2LA 3PX2A 1BGXT 3IPRA 1Y4ZA 3O9VA 4MR9A 4UUOA 2QLFA 4P80A 3RS5A 4XR4A 3IOMA 4MVJA 5T3UA 3MHPA 2ZP1A 3B6KA 3ENWA 4M0EA 5FR1A 3WSTA 4MB0A 5ITWA 3AONB 3RKUA 1Z5PA 3L6RA 4XR9A 2GZMA 4MS1A 1D3AA 4JI3B 4LRSB 2CK3A 1ZINA 1QP7A 3F1KA 1YDMA 1ZM4A 1W2HA 2LV8A 2WAAA 3QQPA 4K6MA 3SF8B 1H4SA 4AW9A 4E0BA 2F6RA 1QOQB 4RJKA 4U7PB 4N5NA 3E9DA 1VPTA 5F1YA 1JBEA 5ILGA 5HJ2A 4ZV9A 1ZK2A 1GQRA 3LDGA 2EARA 3HBMA 4XW2A 3C7DB 4A8HA 1ELO