2JAWA

Crystal structure of d41n variant of human mitochondrial 5'(3')- deoxyribonucleotidase (mdn) in complex with 5-bromovinyldeoxyuridine 5'-monophosphate
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
194
structure length
194
Chain Sequence
RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 5'(3')-DEOXYRIBONUCLEOTIDASE
publication title Crystal Structures of Human and Murine Deoxyribonucleotidases: Insights Into Recognition of Substrates and Nucleotide Analogues.
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 2jawA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2jawA01
3K1ZA 3B9RA 3AR2A 3ZX4A 5AESA 2AUTA 1L8OA 2G0AA 4UMFA 3PGLA 4AS2A 3VAYA 2P27A 2CN1A 5ALVA 3WKEA 4UW9A 5ALHA 4EX6A 3ESRA 1EK1A 1WPGA 4BYGA 5JJBA 4QQFA 4BX3A 3AR3A 4CF4A 5AKXA 2R8XA 4L6CA 2B0CA 3OTQA 5AW0A 3KOOA 5AM4A 2HF7A 5AVZA 3U13A 2RB5A 3FM9A 2FUCA 3FPBA 4Y2QA 4UM7A 4KN8A 3NALA 2B1RA 1F5SA 1QQ5A 2YY6A 3N5KA 5AW5A 5AVSA 4CE6A 4UASA 4Y2UA 3WKDA 3QLEA 3NASA 2QYHA 4UU0A 5AI4A 3WKAA 2YMPA 4QJBA 1O03A 3OPXA 5AW6A 1TE2A 4UATA 2HSZA 3L8EA 1QQ7A 2FDRA 3R4CA 3R9KA 1Q92A 4E88A 1ZD4A 3I76A 3U19A 5AK4A 4MUMA 2C8LA 5ALOA 3ZUPA 2AGVA 4C4RA 5AW7A 1ZJJA 3WK9A 4C4TA 5AI9A 4CF5A 3J7TA 3AR4A 3RFUA 5AVUA 4OFZA 2IOHA 2G1AA 3WK6A 1U7PA 4DCCA 4DWOA 4IFTA 2FEAA 3QX7A 3ZTYA 1ZD3A 3ONNA 2FPUA 1VFPA 4ZEXA 1L7PA 1T5SA 1ZS9A 4FFDA 4IG4A 2OM6A 3WKCA 2W43A 1Z5UA 4BEWA 4YH1A 4Y2TA 2FPRA 1U2TA 2Q4TA 2GHTA 2G09A 2HO4A 4Y2RA 5ALTA 3SHQA 2I6XA 4UMEA 5ALUA 3UMCA 4DW8A 1RDFA 4Y2XA 3KDPA 3QUQA 2IYEA 4YGYA 5AVXA 1MH9A 3N8GA 1ZRNA 2HCFA 3ESQA 3W5CA 2GMWA 3TLMA 3FZQA 3FVVA 2G08A 2B82A 3IJ5A 2I34A 1YS9A 4HGQA 1LTQA 5AKYA 4FYPA 3OCWA 3W5AA 3FGOA 4GIBA 4KX3A 2GFHA 2YMLA 4EEKA 3UMBA 3KBBA 4YCLA 2B1QA 3BA6A 1L6RA 3ZVLA 4HGOA 2HI0A 3FPSA 4J03A 4L6AA 2B30A 5ALDA 5AKKA 1ZD2P 3EF0A 3ZWDA 3L0CA 2BDEA 5T41A 3L0YA 5ALWA 5ALXA 1L7NA 4I9FA 3DV9A 5A3SA 3QUBA 5AW8A 1VJ5A 1XVIA 3E84A 3L8FA 2AMYA 4YCNA 3A1DA 5AKLA 3ZW7A 2YFYA 2GO7A 2W11A 1NRWA 2FPSA 2JGAA 1ZRMA 2WHEA 3I28A 5ALQA 4NFLA 1SWVA 1TJ5A 3DDHA 3EPRA 4UM5A 1N8NA 2G06A 2YMQA 5ALYA 3ZVMA 2VKQA 4I9GA 1U7OA 3QNMA 3NAMA 5AICA 2CFSA 3NRJA 1SU4A 3QU7A 3ET4A 5ALMA 5AI0A 1T5TA 3NIWA 3NANA 4F72A 5AIAA 2G80A 2I54A 2ZBDA 2WF6A 2R8EA 3WK4A 4UU1A 1PW5A 5AK3A 1Z4IA 2RAVA 3SLRA 2R8YA 3F9RA 5AVTA 1RPZA 3U26A 2YN4A 4OD0A 3CNHA 4BNDA 3QU2A 1Z4PX 2HHLA 5AM3A 2I55A 2C9MA 4XOUA 2P9JA 3OCZA 1Z4MA 1TA0A 4FE3A 5AVQA 1QH9A 3S6JA 1IWOA 1XP5A 2B8EA 3QU9A 2NO5A 3L8GA 4EELA 5AW3A 5AW2A 4OCZA 1RQLA 3SMVA 1Z4QA 1RLOA 3PDWA 4Y2YA 3EWIA 1TJ4A 5AI8A 3M9LA 1FEZA 5AW9A 3E8MA 2OA0A 3WK5A 3N28A 1VJRA 4NWIA 4Y2PA 2FPWA 2PQ0A 3HLTA 2FPXA 2FUEA 1O08A 3NUQA 3BWVA 1RLMA 1RMYA 2WM8A 4KNWA 4XQ0A 1U02A 3AR7A 3SKXA 4KYTA 5AHXA 1RRCA 1XPJA 3QUCA 2ODAA 2X4DA 4NV0A 1K1EA 1L7OA 2DQSA 3L0BA 4AS3A 1RC8A 5ALNA 2WF7A 2WF5A 2YBDA 1EK2A 4CF3A 3MPOA 2I33A 4KNVA 2WF8A 3UMGA 3ZWKA 4ZEWA 2HF2A 2IOFA 2WFAA 2Q5EA 5AK5A 2HOQA 2NYVA 3HYCA 2ZXEA 4NABA 1Z4JA 3OCVA 3N07A 5AIBA 1Z4LA 1J97A 5AKIA 2D2VA 1X42A 1CQZA 1NF2A 4EZEA 3EF1A 4NAVA 5AM5A 2EARA 5AKGA 2ZOSA 5AM0A 3ZX5A 3I6BA 1QQ6A 2BDUA 3PCTA 4BKMA 4BX0A 2YJ5A 1CR6A 2RBKA 4GXTA 3QU5A 5ALIA 4BBJA 1YMQA 2BY4A 2IOFK 3AR5A 2JARA 4RETA 1Y8AA 2P11A 5ALFA 2Q4RA 4DFDA 3ED5A 3WK7A 3U7HB 4UARA 4CNQA 3U7GA 4J2TA 2WF9A 4BEVA 5AVYA 4PNHA 1LVHA 1S2OA 1WZCA 2R8ZA 4XPZA 1YDFA 3ZI4A 3U7FB 3E58A 3PGVA 2C88A 5AI5A 3DNPA 3AR9A 3L5KA 5A3RA 2RARA 1WVIA 1ZD5A 1SWWA 4HGRA 4C4SA 5AKZA 3L1UA 4YIKA 1TJ3A 4UAUA 5AM1A 3UM9A 2JAUA 4YCMA 5IS2A 3OCYA 3IRUA 4EX7A 5AM2A 2ZBFA 1RQNA 2O9JA 1T9ZA 5E0OA 5ALPA 2G07A 1WR8A 3DAOA 2EAUA 3R09A 3SF0A 4JB3A 3WGUA 1N9KA 3QXGA 2HX1A 2CFTA 3MN1A 3B9BA 3IB6A 4O8CA 3WGVA 1Z88A 2EATA 1S8OA 1Z4NA 3AR6A 2MU1A 4EENA 2FI1A 4B6JA 1RKUA 2OBBA 5AKHA 3I1YA 5AVRA 4OHFA 2QLTA 3ZTWA 3GYGA 3SD7A 3KZXA 1YV9A 1RLTA 3KC2A 5AW1A 5AVWA 5AKEA 1RKVA 3U7EB 1NNLA 3ET5A 4XE5A 5AI6A 2NO4A 1RMQA 2I7DA 5ALEA 3ZU6A 2ZBEA 3N1UA 5ALSA 2OYCA 3P96A 2HEGA 4Y2JA 4UAVA 5AKJA 3WKBA 2CFRA 3OCXA 3QGMA 2C4NA 4UMDA 2W4MA 3OCUA 2YJ3A 4Y3UA 1JUDA 2ZBGA 2JAWA 4F71A 2YMMA 5AVVA 2B8JA 3WK8A 3KD3A 5IT0A 3QU4A 1L7MA 5IT4A 2JAOA 3L7YA 2GHQA 4AP9A 4G63A 3MC1A 4BNDB 2PKEA 4UMVA 5ALJA 1Q91A 2YJ4A 3MMZA 4YIHA 3A1EA 1QYIA 5FP0A 5ALZA 1J8DA 1ZOLA 5ALKA 3QYPA 4Y2SA 1YJ5A 4HYTA 4Y2VA 3CZ4A 1U2SA 3B8EA 2HDOA 4RESA 5ALRA 3AR8A 3L1VA 2MSNA 2P69A 1Z5GA 3W5DA 5ALLA 3E81A 4HGPA 1Z4OA 4HGNA 5AK6A 2ZG6A 1RKQA 5A3QA 2YJ6A 4JDPA 3QUTA 1YNSA 4MWOA 3M1YA 1KYTA 4L57A 4BX2A 3A1CA 2AH5A 3ZVNA 1AQ6A 4ZEVA 1L8LA 3SKYA 1Z4KA 3L8HA 4H1WA 4HAIA 3A3YA 5AW4A 3W5BA 3RF6A 2O2XA 3D6JA 5ALGA 4KX5A 1RMTA 4G9BA 2C8KA 2PR7A 2IA5A
chains in the Genus database with same CATH superfamily
5FX2A 4C4AA 3QI2A 2IHNA 1U2PA 3P26A 1SCUA 3DO5A 4B2YA 4IO1A 3EZGA 1XRPA 4N7JA 5FUVA 1K6XA 2P9TA 2JA2A 4I6GA 2XYRA 1YZHA 1QG2A 5FO0A 1PEDA 1SQGA 2XRYA 3DW1X 3W5HA 4UW9A 3WKEA 5EP1A 4RTPA 5TGZA 4G01B 4F6RB 3ZZMA 4NLEA 1UBOS 2PYDA 1LI7A 4U6QA 1N2CB 3GCXA 5GM1A 1TCUA 1K89A 3R4VA 1XAGA 4P3OA 4ZRDA 5ICSA 2BYTA 1XTBA 2GSWA 3QPUA 5EJ9A 5DM4A 1D5WA 1C4OA 3B6KA 3HRHA 3MQ4A 3WBKA 1IBKB 4I36A 1Y8QA 4NU8X 1Z37A 1YBFA 4KN8A 1KVQA 4QBKA 4O0MA 5EAIA 1OILA 5NLLA 2AL7A 2FE1A 3NRBA 5EWLB 5AVSA 2DPXA 1RXIA 2PT6A 5J1TB 4GEKA 2Q5HA 2AXQA 3C98A 3TDMA 4EPTA 2R5NA 1OB2A 1XA4A 1ZXBA 1M1YB 2W6ZA 3CEPB 3OBIA 1EWRA 3LBIA 3OOJA 4RGVA 4RM2A 3C4JA 2IELA 1YIAA 2AC7A 1QH0A 2FV8A 1K2WA 4HTFA 1Q1NA 4R3UC 4U9HS 3DKIA 1YRQA 4W82A 4KE9A 5F73A 1PP4A 4LOHA 1V11B 1WTAA 4B81A 1GADO 3LT1A 1H93A 4UEOA 3IAEA 4LMPA 3UC5A 2CDNA 1A8SA 4MW5A 2Y6UA 3O4GA 3LY9A 2QM7A 2H4FA 2Q3CA 4FWIB 2GM3A 1FCJA 3GG2A 3GT7A 3OM0A 2GETA 2Z9DA 4HYQA 4RE5A 4AXBA 5AI9A 1QH1B 4X8OA 4ITRC 4BBZA 1I0ZA 2GRUA 3O4VA 2EJVA 3RFUA 1RQ7A 5TEWA 1Z6TA 4KN9S 3U80A 4C7BA 1QS0B 4YAEA 1GL9B 2ZR8A 1P3JA 2AG8A 1GDTA 2ZIXA 5CCDA 1PZMA 2WSSD 4QTXA 5DHFA 5DSXA 4DCCA 3K31A 3I32A 1ID8A 1I2AA 3PUXA 5JS8A 4QG3A 1M5TA 1EIWA 3T95A 2FPUA 2AFHE 4L08A 3TL2A 5G1NA 3PEUA 1JECA 1QCZA 4YFVA 2PG3A 3QXJA 1T5SA 1RW4A 4IG4A 2OM6A 4L7QA 1N5MA 3QQPA 1M7HA 4RD0A 4PSCA 4XLLA 1W5FA 5KJEA 4EYSA 2K2WA 3KHKA 3PTLA 2WWWA 4FZRA 4AJJA 1ZM7A 5EESA 1C30B 3AU9A 3FTPA 4KE6A 4U5QA 2XWJI 3H2HA 2JI8A 4YREA 3NW9A 2DWQA 3SHQA 3HR8A 3TLGB 5E3HA 2OKCA 4NNJA 2RD2A 3IBCA 1CT9A 2J4CA 1RYEA 3KG2A 2O8EA 3RSQA 4RHUA 2CFCA 5P21A 4QGSA 5CHEA 1D09A 2AEFA 1FRQA 2AB0A 2OCDA 2GMWA 3EFOB 4WOCA 4ZYVA 4JQCA 1NGSA 3SZ3A 5IJ9A 4M37A 4BO3A 3PA8A 2Z5FA 1GT6A 1YK0A 2IW3A 4FZJA 1D7AA 3UMVA 2ZSJA 4TKVA 1XRMA 2PJRA 1EINA 3AW8A 4HGQA 4M22A 4TN1A 4NS1A 2WTAA 2AN3A 3H1PA 4MHOA 1T9DA 4JBLA 4PWYA 2UV8A 5KQRA 4ZJZA 5KOIA 1GEEA 1Z6ZA 2ZPTX 4I14A 3NB0A 2J0VA 4I9NA 2POQX 2Q41A 5EZ6B 1E99A 2A84A 1V7CA 4WLOA 3W8EA 1R7RA 8ADHA 2HJ9A 3R3JA 3MJRA 3U3XA 2IX9A 2QVZX 2F8LA 2B8TA 4WFQA 3NHUA 4DCJA 1Q16A 1HQKA 4WY8A 5EMJA 1P62B 3UH1A 3QMPA 4HZGA 8ATCA 3RQSA 1UBCA 3T94A 3ZWDA 3JD0A 5ADVA 3LVQE 4G4IA 1D6MA 4ZKDA 3KAJA 1ZIYA 1NDUA 3JZFA 1UQRA 1UOPA 3GARA 3QFSA 1OI7A 1BX0A 4G8BA 4JJAA 4DNFA 3MJFA 3QUBA 2NU9B 2ST1A 1O95C 2HH9A 1DAIA 3ANTA 3DFIA 1Y7HA 3DXXA 2JFXA 3QVVA 1KARA 5AHWA 3RHTA 4E2XA 4DSAA 1RXUA 1SUCA 2C31A 3TNLA 1RZUA 3RYIB 1A95A 3WGKA 3BXPA 4XM1A 3QOWA 1FTWA 4OGGA 1N0HA 1RRFA 5FBWB 4TWZA 1YZLA 1Z36A 2ZT6A 4K1XA 1S3SA 3O84A 5ELLA 1XXHE 3RHFA 5C3UA 3IP6A 3TF5A 1RS0A 1C8KA 1VHTA 2V6BA 3LAWA 3PFFA 5A0FA 2PBZA 4PZPA 1IRXA 1G3MA 3WL4A 1FYEA 1DBRA 3GUYA 3DKRA 4X8LA 1EI9A 2XCQA 5D3MB 3I6MA 1SUSA 5C8YF 5I4IA 3AWDA 4HBZA 5T57A 1IN6A 3WK9A 2NXWA 5DSTA 2CV0A 1U7OA 1BFDA 2R751 3VX4A 1DAGA 2ZB2A 3RVOA 4CT0A 4QOJA 5JJLA 1CNMA 3EW9A 3IULA 1D9XA 4NZMA 4WFJA 5DM70 4DVJA 3WO0A 2K4MA 1PHRA 4DVGA 5F78A 3D0OA 3GN1A 1Q0LA 2R66A 3LKBA 2G5CA 3T5CA 3C43A 4BKQA 2C58A 4DXAA 4F72A 1FOEB 3EEYA 4HVAA 3SHTA 4DNQA 1JA1A 3IELA 5BV0A 2VHJA 4DBLE 4EA7A 1O96B 2ZS7A 3M6IA 3U0VA 2PQ2A 3G0OA 1DZIA 2OPBA 4NFYA 3BQ9A 1W0KD 1V8BA 2VWQA 2Y1OA 5IJAA 4D9FA 3MMNA 4DRXB 1KGSA 1O54A 1V2GA 2R6GA 2YN4A 3K1YA 3VU1A 2PUFA 1UXKA 1BQ3A 2A1UB 1V96A 3FFXA 1BFUA 5SY9A 3C87A 1P0CA 2X6QA 3BX1A 4E5KA 1CJMA 2CYCA 4XOIA 5JNVA 2VYCA 1QVWA 5AJWA 1SXQA 3E04A 4URHA 5LDGA 3WNVA 3OI7A 3AFOA 3PYXA 1KI6B 4GOOD 2JLCA 1Y6RA 2D8AA 3MJCA 3GJZA 2RK6A 1GY8A 4K9DA 3FW1A 4URYR 5GV7A 5BRJA 1P18A 1OWPA 2E0IA 3MT0A 5HKKD 5DI3A 3HSSA 3F47A 4C78A 2ZYVX 4H1VA 3IQWA 1DI0A 4Q9DA 4D6PA 2FMTA 1KKMA 4DA6A 4QKQA 1V1RA 3MG9A 1UKYA 2QGFA 3UB2A 4XWWA 5GZ6A 1P44A 1GEGA 2FPWA 2QKYA 4G37A 4Y6OA 3H5NA 3U37A 1OYVA 1Q1GA 2DBZA 1VJTA 1GGKA 2SCUB 3AV0B 3TTTA 4D8TA 3E9NA 3IUEA 4Q9HA 1N6NA 4NXNB 4I08A 1GPYA 1SHTX 4TMKA 4B73A 4EKEA 4A03A 3EIQA 5BOSA 4I1PA 3FPHA 3KWLA 2ZRQA 3M3PA 3KFVA 1MQAA 2HNKA 3V80A 3HJCA 3P9QA 5TF0A 4I3HA 4Y30A 1PQYA 1P3Y1 1TYBE 4XPIB 3VNBA 4BFZA 1FA9A 3VMFA 4MQUA 1XI2A 3CCCA 3OP4A 4WKBA 1SHLA 3FYUB 4CQLB 4PYRA 4YJ2F 4FFBB 1X3SA 3ZV5A 2GAFA 2O7RA 2P6MA 1WW8A 5IABA 2ROQA 5F77A 1L6IA 2Q4DA 3WHLA 4WNAA 3H9EO 1Y4DE 2FWPA 2G0NA 2D00A 4GI3A 5A3QA 1IZ9A 2W83A 3CG4A 4LQLA 4LSGA 4QIHA 2O2JA 4W8OA 5EOVA 3UAGA 5DHTA 1GTJ1 1GL7A 1UFKA 1KDOA 2AE1A 4TTQA 3WLEA 5B1YA 3QE9Y 3WWZA 2C07A 2G40A 2HOQA 2FJUA 4MRMB 4X71A 4CU5A 4EHHA 2ZJYA 4PZLA 1RC0A 1H2XA 2JBAB 4CUZA 4B3MB 2QG4A 2XMBA 1QUFA 4O3MA 1RAFA 4AF8A 3L8YA 3B7WA 4Q00A 2WAAA 3PI7A 1JHMA 1XKTA 3HJAA 4JENA 4XCXA 2OV8A 4PYIA 1EM8B 4Y6LA 4ZDKA 2PZLA 5ENDA 1QGAA 2RBKA 3NBKA 4IRMA 2WJYA 1Y3CE 4CYMA 3OEYA 4I99A 1PF7E 2I4TA 3A10A 1L5HB 4NIMA 2QRHA 4P2BA 1T3LA 4OM7A 3E7DA 4CKBA 3M82A 2H1WA 3GF4A 3BWMA 2WR8A 3TQSA 4ZO7A 5SY6A 2HMWA 2P11A 5ALFA 4PG4A 3WRXA 4W6ZA 3TRHA 2XB6A 3PYMA 2QL5A 5BWLA 1KKLA 1BN7A 3TM5A 3USCS 3UT6A 4INOA 4E3ZA 4TZ6A 1JKJB 2YVQA 4C7OA 2D59A 2G8LA 1DRJA 2NYRA 2PD3A 4PNHA 1WZCA 4PVDA 5EXDA 4II7A 2GVNA 4PLFA 4EEXA 4LV8B 2HRRA 1EQAA 3GA5A 4PFQA 1H2BA 3E58A 3L4BA 4G5RA 3THOA 1X3LA 3QFTA 5EERA 6Q21A 5KNDD 3AR9A 1B0PA 2CHGA 2A9JA 2ZIGA 3KYCA 4GXRA 3UAYA 4PV7A 3G6KA 4D8YA 5CA0F 1JPVA 1SXIA 3PQ3A 4OK6A 5CTAA 1JR3D 3JQBA 5TARA 3UWSA 4NSLA 2C2OA 1Z62A 4RLQA 2RHBA 4C0WA 5JSYA 2O0HA 1RIFA 2A9OA 4X92A 4YJKA 2FYTA 3OZSA 3KLBA 1P2FA 3SICE 4PX2A 1QGOA 3ZW8A 4PINA 4BO9A 5CNJA 1RPAA 1IATA 1YE8A 2CNNA 1PR9A 3R0JA 4ZJUA 4EX7A 5DRTA 3KKZA 1SQSA 3GEGA 3H3XA 4N9QA 5LA6F 4LRYA 4V3BA 5LC1A 3AUAA 1JBEA 4CFYA 5CG1A 2IWHA 3CH5A 1XDBA 4GECA 2XECA 1L1EA 3DJFA 1JQKA 2YXNA 1U28C 1OV6A 3G0DA 2OQ2A 4Q1AA 1AUQA 2QA5A 1NBAA 2ZZKA 3DEZA 2HQOA 4QFDA 1FJGB 1KZ7B 1FUEA 3MELA 2I7VA 4Y9UA 4YEDA 3WIOA 3KSMA 4MO2A 4NV1A 4XGQA 2Z1NA 2X0NA 1VL8A 3NHRA 3O94A 5DNYB 3DYVA 4NCXA 2CUNA 3NAGA 5H9VA 3CVXA 1AB5A 1NYQA 3DCIA 3M6MD 4Q24A 3GPIA 4XSVA 4LK2A 5IDVA 5JXGA 3HFRA 5AJYA 3QQ5A 4A0QA 2ZP1A 3I3SR 1QAOA 4OQEA 2J31A 3KETA 2O1WA 3SFVA 5JR3A 5D7NA 5EG5A 1VM6A 2J3IA 4HQ0A 5F12A 5TQ0B 4DMKA 2O19A 2W2KA 1II0A 3P2EA 4ALNA 5DTQA 1ZONA 3MWLA 3OZVA 1BU8A 3SKVA 1WQ1R 2V6JA 1EP2B 1M67A 2ATEA 2OHHA 4YJFB 2VA8A 5KOYA 1GD1O 1KPGA 4HRVA 4F4UA 4L5JA 2GJ8A 1UEXC 3FIJA 4G0WA 1KYWA 3QHQA 1FFSA 2GGSA 1QZ3A 4PG6A 5D86A 1S4MA 3VZSA 5CDSA 1AO0A 5AXCA 3G9ZA 1GM5A 3E48A 3NYRA 4OXNA 2QD2A 3ZJ5A 4AJKA 1QX3A 4ZEOA 4MWBA 5DHUA 2BBOA 2A86A 3G6WA 4AY2A 4M87A 4KYVA 2V6MA 4UAVA 5FAKA 3I2HA 1C1DA 3LLUA 4MDHA 5TB5A 1ZBDA 3W0LB 3H5WA 5G40A 3MRSA 3L7AA 4I9UA 1ESNA 2C04A 5I9LA 3ZEIA 4JYBA 3QNWA 2JAWA 3V2GA 4BGUA 1P9OA 3OQMA 3LE8A 4TXNA 1H05A 3E70C 4D0RA 3QKSA 5ED4A 1FDVA 1WAMA 5K2OA 2B3DA 4QJ5A 1Y4UA 1YBHA 2D7JA 4I5DA 2CLSA 5CNMA 4BS9A 3HJHA 2JGNA 3HJBA 1UDXA 4LYAA 1ORRA 1FTQA 1C0LA 1PZNA 4GOJA 5TVGA 3TBHA 2WQ6A 2J3QA 3GEPA 3HBJA 3EGEA 3M6FA 3NG1A 2CMGA 4NY1A 5DT9A 5F4ZA 1D2CA 2PT5A 4I2VA 3S70A 3IP9A 4AURA 2B5VA 4YIHA 3B60A 1JU3A 4QNNA 3M6XA 3VDQA 2IYQA 3S2ZA 4X62B 4FN5A 1XD2A 3DW3X 1BGWA 1PWXA 2ZTMA 3EG5A 2BM9A 5DTEA 3RLFA 1KH1A 4WJZA 3ZLTA 4QL3A 2WP8J 2P9QA 5HP4A 1IXRC 1OFIA 4RK4A 3N74A 4Z4CA 2PTGA 2QHXA 2AW3A 3F6BX 4HXFB 3REQA 4RHXA 3IA7A 2QGNA 5A9SB 2CB0A 3BMNA 1DNPA 2AOUA 4RZ2A 1YHYA 2QVBA 5JAZA 4KN5A 5AH0A 3NIFB 2J45A 2IY7A 1KH2A 3PE3A 3TG2A 2SKDA 5FB3A 4FYXA 5BSEA 2QTBA 1MB9A 3LF2A 1QYWA 1QCCA 3LT0A 4QXAA 2RHWA 5EP2A 1MU0A 4OUDA 1OY1A 2CDBA 2V74B 4AZ3B 4C0SA 4WUVA 3L8HA 1U9JA 3KOWA 5JWHA 1MNQA 1FW8A 1FUIA 1KK2A 1KJNA 1U0SY 2P4SA 3NORA 2EVWX 3LBNA 5CT6A 4ZYXA 3OQIB 3K9FC 1RAAA 4D26A 4PN3A 2DPLA 2JAPA 1RWVA 2H31A 4GI2A 1VHLA 3S1AA 1IE3A 4C5CA 1SY7A 2ZWMA 3NHWA 1KI9A 1MC8A 4IIEA 3PG5A 1JR3E 4MA4A 2QY6A 3IPXA 2ZJFA 3HDGA 4BNTA 3LQKA 2JA1A 2YQ5A 3KHSA 3TPCA 3WE7A 1HE4A 2V0NA 4TPKA 2ZPUA 1J20A 3UJ6A 5IHXA 1K9VF 5KYNA 1U15A 1J0CA 4PGGA 1DV2A 3CA8A 4E30A 2BFCB 1SD2A 1INLA 1AUPA 3QF4B 4I50F 4U7GA 2PMFA 3CZPA 3VYVA 5GIOE 2BM1A 1CQXA 1EK1A 2N47A 2PGOA 2GILA 1ORHA 1Q21A 4LQCA 1Q0HA 1E2KA 5HK9A 5T3YA 3NAZA 1XSEA 2BPOA 3AR3A 1JAZA 2DAPA 4CF4A 3HKBA 3A6FA 3RG2A 1VXOA 1ZMOA 3LQYA 5AW0A 2Q5QA 4DLZA 5JMOA 4NPHA 2ZXUA 2E4UA 4AM8A 5I9NA 3JRWA 1X1DA 5JDIC 1VI5A 4CIBA 2A0XA 5LMUB 1KMHB 3GCWA 2EJWA 3N5KA 4JVMA 2FSVC 3V4ZA 3ZGVA 1G8SA 4XQ9A 3ZQJA 3KZMA 3G9UA 4HBGA 2GTIA 2H1IA 4AI6A 1I6MA 2O7QA 2H18A 2XGSA 1VKZA 3IJPA 3CVJA 4UTVA 3OCCA 1MAVA 1TZJA 2PGDA 4QJBA 5HFAA 3L4JA 1PVDA 4XVRA 5EJMA 1FMCA 2Y1WA 4HNTA 4YRSA 1HOXA 3EXHA 5I7VA 1XD9A 3SJBA 2ZUVA 2HSZA 3PDJA 1BH2A 3UK2A 2XIJA 3OJ0A 4D4KA 4DARA 3V4LA 3W4KA 4PSKA 3SLKA 1ISRA 1G19A 1GLNA 4PHCA 4MUMA 1R0ZA 1EFHA 1FVFA 2HXYA 5ALOA 3ZE7A 4C1BA 4D9HA 4DMMA 2I2WA 5FLXA 1NN5A 1L4EA 3E3MA 3AP1A 2ZAYA 3OE4A 2WQZA 2ZIUB 4JUIA 1AS2A 2AN5A 3SS9X 3T7KA 3PVSA 1WHTB 3WYFA 2QI9C 3L40A 3WLLA 4GW3A 1Q0TA 1JLMA 3BWCA 3QXXA 5DLDA 1TT5B 2LWIA 1CFZA 1TIBA 3O2JA 5MDHA 3JQDA 1JPNA 4DWOA 2KBFA 4DRZA 1I10A 1EAYA 3B1YA 4NATA 5CH3A 4IF6A 4MJ3A 3OZ7A 5JYCA 1XCLA 2GCGA 3DPSA 3LZCA 1EDEA 2FSGA 4FKZA 3BUSA 1MH1A 3NKVA 1L7EA 1L7PA 1WXFA 3AG6A 3HBFA 4IJVA 2Z56A 1V5GA 2LCQA 4D79A 2P5YA 3BH7A 3ZHZA 1C0KA 2OWDA 3DOHA 2OGUA 4KQIA 3JX9A 1EPUA 4NJEB 3BSWA 2X8WA 1XQ6A 5LZ8A 4E2YA 1HNXB 3CRNA 1NW4A 2OCLA 3AKCA 4HLDA 1U2TA 4JDUA 1J42A 2JJ2D 1QYVA 2QN1A 5CYPA 5JXWA 4DDHA 1B76A 1G21E 2RGGA 2ZJ1A 2D2XA 2C42A 4ZV4A 5C18A 5CDFE 3TOVA 4IGKA 1PFWA 3FVTA 3NOVA 2D62A 5AVXA 2GH1A 3WLOA 1EX9A 4DV5B 2G77B 3AFMA 1R3UA 4RQAA 4EPVA 5K05A 3KXDA 3R7LA 1P5ZB 1TC2A 2FPGA 3FVVA 3VRHA 4DY6A 1UPXA 3AVYA 2H65A 1F12A 4H16A 1BCSB 2G0TA 1J2EA 4E3WA 4DCNA 3CZ9A 1ECCA 3GLHA 5FNVB 1JIKA 2B7BA 3QOXA 1W5SA 2Q1YA 2REXB 3CWCA 2EG9A 4GLBA 5DHRA 3GU3A 5LP6A 1JIJA 3H2SA 1Q77A 4LI3X 4P0PB 5DGTA 2QD3A 5LUBA 1VG1A 2DG2A 4YCLA 3B3JA 5JBIA 2CDAA 2ODWA 5IK2D 1ZNZA 1GPNA 3L4SO 3R5FA 3TE7A 5C8XA 5KHLB 1LBIA 1LY1A 3JRXA 4NCHA 1V8FA 3RPEA 4G0MA 4DDWA 1L7VC 4EVIA 1T8UA 2BHRA 1IOWA 4KWIA 4P4UA 5I48A 5LYJB 2FZ4A 2PUJA 4HP8A 2ZJ6A 1KETA 1Q6YA 5G1PA 4LIPD 4D45A 3OM1A 4C0JA 3IL2A 4RFVA 3RVPA 4EG7A 1TJUA 1W4RA 1VIVA 3DT6A 4MVJD 4TLMB 4WZBB 4K05A 4I1IA 4QUEA 4WK0B 4OX9Y 4QVGA 1PL7A 3ZGYA 4DC9A 2NPIA 4CCWA 1ZI8A 2I65A 2PZJA 1C7EA 4OQXA 2ETVA 2W00A 3HFSA 4NTZA 3S1SA 1U7UA 3L77A 4UE2A 3GDOA 1QFMA 2XMPA 3QVSA 4MO9A 3TDNA 2VH5R 3T5GA 3H9JA 3LHIA 5IKPA 5CT5A 2JL1A 4DLRA 3PXUA 4E21A 1NI5A 4ASUD 4NFSA 4YVFA 1SWVA 1IONA 3LDGA 3D7NA 4MITA 4I4CA 1VBFA 4UBJA 5FL7A 4A27A 4UM5A 4TRNA 4F96A 5JEEA 4FD2A 4MYCA 2FSSA 3EBLA 3ZVMA 4HVCA 1Y9AA 3KEQA 5B12A 1RI1A 2EIXA 2NU8A 2X23A 1FZQA 3VR6H 2BMVA 2F67A 2ZB7A 1QGUB 3OF2A 3EASA 3QNMA 2Z58A 4QA9A 2FFQA 3WL3A 1ZGHA 1YBVA 2XE6A 3ZZ0A 5M5BA 3UXYA 2PWYA 3SEFA 2BE7A 4JYPA 3HR4A 3IIMA 1UBFA 5AI0A 5KVQA 4CL3A 4YR9A 4TYNA 2IXBA 5U9CA 5K0LA 4JCOA 2WIDA 5ESRA 4D3SA 1OLXB 2PX4A 2CV1A 5KNCH 2R00A 2RHTA 2TMKA 3AEUA 1YACA 3BRWA 4R5HA 2XA1A 4IRUB 5HFNA 1Z22A 5K0JA 1WD5A 2VXBA 2NTEA 4TV9F 4A0SA 3ZNPA 3ZWWA 1FSPA 3UJNA 1OD6A 3SQNA 3WJ2A 3HE3A 3PB3A 3QM1A 4WZ6A 4RTQA 2B1JA 1RWKA 3CFYA 2FN7A 4H9GA 3JQEA 4P35A 4NMMA 3NBMA 3ZJUA 1NPDA 1T10A 4EI9A 3Q7PA 5C7IO 3SSNA 2BDTA 4B1FA 4RABA 5B1HA 2I3GA 4RZHA 5LN1A 3QU9A 2G3YA 1JQEA 2NO5A 5IEJA 3R5HA 3O9VA 5JVDF 2YC2C 2BN4A 8ABPA 1C2TA 4L8WB 1NJ8A 3HA3A 3QEMA 3R6TA 3FNIA 4LZNA 4R3WA 1VJ1A 1REQA 1ZN9A 4I4TF 2H54A 5HBGA 4OSPA 2WD7A 4CTKA 2WQ7A 4DTIA 4V0RA 1NM5C 5E2BA 2YZNA 4BFCA 4FS3A 4PQFA 8MHTA 4CKYA 5KAMA 4J07A 4TMXA 4FNGA 2E4WA 3OKPA 4MV8A 5LDDC 1FS5A 4LMAA 1DVRA 5GY7A 1A69A 3PHBE 5IJZA 4OQ4A 4BAUA 2VT2A 5DH9A 2FEWB 2E4XA 3IDOA 1PIWA 2OYSA 3FAKA 1U6JA 2FW0A 2OG1A 3HPRA 3W9YA 2Z98A 3HY3A 1MO3A 3FUUA 3ANLA 3AQ4A 5DN6A 3BJIC 5HIKA 1XYYA 2R97A 5BXYA 2I7CA 1P7CA 3LPDA 4C05A 2Q9BA 3TPZA 3VNQA 2OSBA 4KPEC 1P9RA 4RAQA 2EWWA 4CM4A 2WF5A 2QLBA 1PSWA 2IYRA 1LSSA 3ELYA 4UNRA 5MFZA 1EK2A 3ZKAA 3Q0TA 3QVWA 4JVNA 2CVFA 2QJRA 3MLBA 4KYIB 4ZTBA 4J4BA 5ADHA 1B26A 1NMXA 2E87A 3IT0A 3G3EA 5KNLA 4UULA 4U3JB 1KBQA 1QCDA 1LF5A 1P4GA 1TJPB 1XV5A 3DT8A 3AT1A 3H65A 3FNQA 5ECYA 3EQ2A 3M3DA 4DE5A 3P1JA 4EFNA 1KJJA 1Y9DA 3R74A 4F6RA 3ZZNA 1JXQA 1CYEA 2G7MC 2O2YA 2ZITA 3N87A 5BUSA 5C8DA 1N2CA 2XNDD 5TRTA 2JLWA 3NIDB 2BR3A 3OCVA 3K70B 1ZRSA 5B2ZA 2B5OA 3ZE0B 1SIOA 2JHCA 4RKQA 1UZUA 2PMBA 5JCJD 1E6UA 3HGMA 1AU9A 2QORA 4LCBA 5BR4A 1KXJA 3C6QA 4HJRA 3W9SA 1N32B 5HCIA 3RIXA 5EWLA 4D41A 1C4WA 4LGCA 2BSQA 4B32A 5J3JA 4IIJB 4KL8S 1MEJA 2JLQA 4Y9SA 4IDAA 4DIUA 4GXTA 1DQNA 1EJ6A 1VKOA 2R8RA 1P31A 1E79A 1M1YA 2ORED 3F6EX 3GFPA 4LNUB 4IHJF 2C4KA 1PHPA 1UC5B 1T9HA 3CW9A 5B30A 2PRJA 2YHSA 4KIGA 2CLKB 4GVLA 4JQZA 5DYGA 1V11A 1AX9A 3ZKWB 1TPYA 3JQFA 3K2QA 4POOA 2PCJA 3QTLA 5JAMA 5KJCA 4RIIA 1C1YA 4XRRA 3GV0A 1E2MA 2ZAIA 4I7EA 1EK0A 2N3ZA 4JBNA 4IF4A 1IQPA 3U39A 1PV4A 2O2GA 3J80A 3HUEA 3W5JA 4Q7QA 1IM8A 3UA4A 1FP7A 1B23P 2MMCA 3EZ7A 1QH1A 4ES6A 2D1YA 5DMHA 2IEZA 4RH0A 4LDPA 3NBFA 1VA5A 4BFTA 4C20A 3W8NA 3FKSD 1C0IA 3HB9A 1QS0A 4H7PA 4TTJA 1Q1BA 4WJKB 1KK0A 2K6GA 1XEWX 2IYNA 3KX2A 4KBGA 4I50B 1BWRA 1Y3IA 1SG6A 4U6SA 1K98A 1J0DA 4PFKA 1U8AA 3C7CB 1SZCA 4MW0A 3ZW9A 3ZD7A 1KEZA 1G0OA 1TKCA 1PJBA 1RAGA 1UKZA 2Q29A 5E1MA 4WBNF 5A06A 3GZNB 1E5QA 1X86B 1VIYA 1KOFA 1PJ8A 3HN7A 4OFBA 1RQNA 5HIIA 2H1RA 2NX2A 4F8JA 3LRTA 4CM9D 2VHWA 3RFFA 2QW0X 1WDWB 4UEQA 1C30A 4R8KA 1VBNA 3CRW1 1VLHA 3DOFA 3OUTA 2R7LA 5EHGA 2X2PA 4KRYA 4PGFA 3GOQA 4Z3KA 4XVCA 1JHRA 3TLGA 3TE6A 1RJWA 2ZPAA 1GNPA 5C7LO 1NBHA 3ZGLA 3OFJA 1U5AA 4L07A 3VYTB 3W05A 2W2TA 4BMZA 3F46A 3OIWA 2N0SA 1XDDA 2IYYA 1L4HA 3JYPA 3QEBZ 1SKUA 3DFUA 3EFOA 4MOWA 5KSZA 4EJSB 2PGNA 1BJKA 1TIPA 2MU1A 2XQVA 3JQ7B 2NUAB 4H15A 4K6OA 2AFIB 1XVLA 4EENA 1BVHA 4DEXA 1JJFA 1O2DA 3TH5A 3LDAA 2I87A 5ITSA 1K68A 4NULA 3I8OA 3CLUD 4OHFA 4US1R 5HUJA 4TVKA 2XE4A 2V1XA 4C7VA 2AIRA 3SD7A 4CDMA 1YTLA 5B4TA 2A1IA 3E15A 4FS8A 2ODQA 4HHEA 1MCZA 4TSRA 2JB9A 3ET5A 5K3BA 3OBBA 1JXOA 4NBRA 4E5NA 2AQ8A 3GJXC 1XVAA 3EVBA 4B87A 4TT3A 4BNHA 3V4RA 2Q1UA 3KO8A 4DJAA 2P1ZA 4DZZA 2CUKA 3F73A 2PVSA 1XQ9A 2WHRA 4NVRA 4AUKA 3ENVA 1RXCA 3SLGA 1E2LA 4NZNA 5KKCA 1VSUA 1TEZA 5TXGA 4DIOA 4S0ZA 2J8ZA 2EF1A 1N4AA 1XKQA 1GU1A 3HEMA 1VI6A 3A1TA 4MVJP 1YWGO 4DV2B 4GZMA 1CJTC 3BWBA 2GN6A 1AHHA 2NU9A 2NVBA 2PWZA 1W46A 3AFIA 3EIXA 1BDJA 3A2LA 4C6RA 5ITVA 1V39A 1YZKA 2DF8A 3H18A 5A4DA 1AMUA 1X39A 5H59A 3H1GA 3ICVA 3VR3D 4F71A 3RYIA 3EAFA 4K03A 1VGQA 3SGLA 2B8JA 2EGHA 3ZYZA 1T3GA 1LDGA 2PU5A 5FEMA 5FYDA 2XWBF 1SBTA 3AONB 3F8SA 3P4XA 3ICQB 1IXSB 1QYCA 1E4OA 1W48A 2AEEA 2W6JA 3CKKA 3MCUA 3QU4A 4HNSA 4J0QA 4ZVNA 3RVMA 2JCVA 1RQXA 2OQRA 2W98A 3G5LA 3UT5B 1ORTA 1DWPA 3K2IA 4RWZA 3PS9A 3NBXX 4KRXA 3MGGA 5D3MA 3O83A 4GRIA 4DADA 3IILA 1W9HA 2VBGA 4X44A 1XXLA 1AURA 2HJHA 3NTRA 3PDIB 1F7UA 4X1YB 4CR7A 4HN4B 2WYVA 3K2EA 5T4HA 1X1QA 1ULBA 2IYTA 2PL3A 4Z7JA 3EVTA 2JIRA 5CCEA 1V47A 3KB6A 1KY4A 4FYHA 1LDNA 4BNKA 2FEKA 3Q7RA 1D2MA 2RHDA 4EVSA 3GP3A 3JQAD 1U7ZA 3QWFA 5EFOA 2WPDA 3TUJC 1DG9A 2ZJ7A 4BLUA 1O96A 1R2QA 1U0NA 2NGRA 4ZCIA 3H3JA 1L0BA 3N0XA 3THSA 4X6LA 2IXAA 3IPCA 4HGPA 2FJPA 3SHWA 3O2QB 3ZWCA 1G8MA 4DRXA 4EARA 3L7IA 1TECE 3QUTA 1E0SA 3NCTA 3RAPR 9ATCA 5KVCA 1HNWB 1N1DA 3X2SA 2A1UA 4YY3B 4XW2A 1HDZA 2WM2A 5T4EA 3LRPA 1XYVA 4EHDA 3EUFA 4F4DA 1L4BA 4BFLA 3EPHA 3O82A 4CEIB 1Q0PA 3PE4A 2CL5A 5IC5A 5CLQA 4BNZA 1C8LA 2D0OB 2PBRA 2VTKA 2V9CA 1EFVB 5K0NA 1Z0ZA 3M9WA 4ESEA 1KI6A 1JLSA 2PQMA 2H1HA 3O95A 1ESEA 1ZN8A 3KFXA 4WCFB 5DISB 3AVXA 4CGYA 4F2GA 5DM0A 5HZKA 3S7ZA 2Q49A 1JALA 4A5SA 4NK4A 4Z1MA 5ITWA 3PSHA 2ZUUA 4RL6A 3KOXA 3SWWA 1VLMA 4LKOA 3OZFA 2VP9A 4FOOA 4GOKA 3F97A 5IBRA 3ZX4A 4CV0A 3ZLJA 1RYYA 4BEBA 4D80A 2H1SA 1TFUA 1L8OA 2SCUA 1PEKE 2B5WA 4AY4A 1QX4A 4M1WA 1LBTA 2ZQYA 3O7WA 2HV8A 4IILA 3FSGA 1NBMA 3Q11A 1PRYA 3QOYA 3F7NA 1T9GR 4TS4A 4U00A 4X60A 3RYFB 1N1GA 1SZDA 2Y0CA 4CCAA 4D5GA 3PFNA 4J16A 4FFRA 3IQXA 3KXIA 3LU1A 4JZKA 4XPIA 2RC5A 5LLSA 1E18A 3AF6A 3HVUA 3OTQA 5FLKA 5AVKA 2YV4A 2D4AA 5AVZA 3HJUA 2D13A 3ESZA 3FYUA 4CQLA 2X15A 1FNCA 4FFBA 4K9PA 4C4YA 3AUXA 2MDTA 3V6LA 5GOZA 1E96A 2D2IA 3KLOA 2GJ4A 2Q6KA 3DZBA 1LDMA 1E6MA 1LWNA 3OY7A 1F1BA 4RPIA 4UE3S 1XGKA 3X43A 4CE6A 1C1XB 1Y37A 1EVZA 5D2CA 1MQ9A 3QK7A 3OIGA 1UJ4A 2IH4A 1NMQA 2EFEB 3NT4A 4S1VA 1LI4A 1NVBA 2WUDA 1IOLA 3DUWA 2CEAA 3DMYA 4LXHA 2VPYA 3TV2A 4KQWA 4KBFA 4MRMA 4UNQA 2DFTA 4UATA 4BE4A 4KR7A 3P2OA 4OREX 4XEHA 4A8JB 3L8EA 3R4CA 3A6ZA 3NM6B 4P3XA 3VPAA 1YUNA 2JBAA 4RGYA 3H8VA 3UF0A 5AK4A 5JVDB 3CN7A 3LP5A 1JT2A 4EI8A 5CBPB 2GT1A 1U1FA 2YY5A 2B4QA 2JRLA 3KU1A 5HW2A 4IDHA 4LN1A 4OLHA 3D43A 1EM8A 3R5SA 4R8LA 4LXYA 5A71A 3TLCA 1ZR4A 3FVRA 2FAXA 2P6OA 4K9QA 3GHHA 1MJGA 1ZX1A 2DUWA 5JO9A 1NXSA 4DLLA 5KOJB 2X13A 1L5HA 1A9OA 3KL4A 2C4MA 4U2CA 1WOMA 2WSLA 3PCXA 5G0WA 2P3OA 1SCDA 1NUHA 4ZQEA 4IFTA 3OX3A 4O4LB 2Q5FA 3ONNA 3NTXA 5BWOA 5I7EA 3DD1A 4NCAA 1IYZA 4DQVA 3T5BA 1PJ2A 5I9SA 3WLAA 3N7AA 4QOEA 2W8BB 3AX6A 3IPYA 1JKJA 5LXTF 1I1QB 1U0BB 5EJ7A 4YMVA 3ZCQA 1ACJA 2QRZA 5EZSA 1RR6A 2PRSA 5TMEA 3D81A 1JR6A 1PYGA 2XIQA 3MXOA 1KAGA 4PYKA 3ZV4A 5LZ2A 4BIMA 1JIXA 1XEWY 4ENTA 2BKLA 4B31A 2W2OA 2Y1KA 3KJHA 2DB3A 3ICCA 3WYNA 3AY6A 1BRTA 3GLQA 4MQEB 4E7OA 5JC1A 3QUQA 1RLJA 2VNKA 2ZSIA 2ZUCA 3QY9A 4RF2A 1A8PA 1XRRA 1EBFA 4YB8A 3N70A 3H04A 3H1FA 1ISJA 3SJUA 1GTVA 3U16A 1GHTA 2BZGA 1P5HA 1PG2A 2DHDA 2ORYA 3TEMA 4ZZ3A 2Z6AA 1T8RA 1XLVA 2H0RA 1FPQA 2NNWB 2JGDB 4FX5A 4MCJA 3DD5A 4OAPA 4P38A 4Q05A 2QOEA 4XDHA 4FOTA 2VDKB 1N34B 2I34A 3MT7A 5THQA 2D0PB 3WNCA 4ETIA 2J6IA 1M2JA 2I78A 3O1HB 4HATA 4JUFA 1J8QA 1ZBQA 2DJIA 1MG5A 1F0KA 5IYZF 4E5PA 1Z63A 2GFHA 3AF1A 4HC4A 1I7LA 1G3RA 2JKVA 4N7MA 5FPQA 3VR1A 2EYUA 2XRFA 3DHWC 3DHYA 5KEIA 2LP4Y 4W1QA 3VR4A 2WSIA 3MERA 1A2QA 1N3YA 1T2UA 3VUFA 1B2RA 2X5JO 2HI0A 3AO0B 1LNQA 3GBSA 4X6XA 4WZAB 2CWWA 4LRWA 1SPBS 2JASA 2H6EA 3PQ5A 4TM8A 3X1XA 4JKOA 4GM4A 2IQ5A 1UQTA 3H5LA 3PEVA 3N3AC 3PUZA 1J9ZA 4FPXA 2CMHA 4G9GA 5TQ0A 1VKRA 3KKPA 4C0HA 1TJNA 2MWMA 2Q27A 2AQIA 2XRMA 3IQEA 2QF7A 4S1TA 1VMKA 3SJCA 3ZW7A 2X0RA 4NF2A 4YJFA 4E70A 4ZVKA 2WJVA 2GO7A 1F4PA 4QU5A 4TRMA 3QEOA 2A2ZA 1ZM9A 4X00A 5I7UA 1XCOA 4MV5A 5EQTA 1ZH0A 4XD2A 5H3CA 3C8HA 4DC1A 3GX1A 3D6UA 4XYLA 4ZCMA 3CWZA 1VCIA 1ZRMA 4JLDA 5A5GA 1L1QA 2GAIA 4X66B 1O9BA 3TK1A 3HI4A 3HTXA 1EDZA 3CISA 4A6PA 4KCGA 2A7XA 3RJ9A 4D8WA 2I4MA 1CR4A 1DX6A 1U94A 3LLSA 2GS9A 1BEUB 3QEKA 4GEGA 1OVGA 4MB6A 4QUIA 3WYDA 3IQFA 4GRDA 4FWBA 3RVJA 1XMIA 2AOTB 2DR3A 4PAQA 3VSEA 3ZK7A 4WK4B 4D82A 2OP0A 2HY7A 4JSTA 1ST3A 5F91A 1U2QA 1UPCA 2YOGA 3ORHA 4N18A 1GLVA 4W5OA 2BFFB 2F3UA 5AHOA 1PNRA 2HWWA 4ND6A 3EULA 1CEEA 2HLDA 4CMCA 1DQYA 3THRA 4DWWA 2WF6A 2J07A 5DB4A 2RCYA 3SLRA 2R8YA 3PP8A 3TMAA 1I32A 2OORC 4H6VA 1NVKA 1QE0A 2C5EA 4H4EA 3GAFA 3L05A 1NQVA 4LV5B 4UUMA 2VPPA 3U7JA 4JLKA 1C50A 5AM3A 1I3LA 2QE7D 1ZVQA 2P35A 3FE2A 1LK0A 4L72A 3CJTA 1TVEA 5HR5A 4B4UA 4WNIA 5D3ZA 2P9JA 2YWEA 4M21A 3VNVA 2FN4A 1HUQA 1PU2A 1M0TA 1SEPA 3AM5A 3CMMA 3IBFA 3DKPA 4U02A 1OOEA 3TFOA 2QRPA 1P9NA 5AW2A 4FMDF 2OD2A 2PKQO 4RC9A 2GN9A 3M9LA 4MKXA 4CIXA 4LCJA 5EC8A 3RSOA 3S2SA 3EQ9A 4CKWB 1HTTA 2X2OA 5A9SA 5B3JA 4NLLA 2ZVPX 1D6JA 1XU9A 4I81A 4ZI5A 2X14A 1YD7A 4LA4A 1GNLA 2EGGA 3B2EA 3V4PB 2L2QA 3H4MA 4C29A 1TUBB 1AN9A 2D5CA 2OQIA 3CH7A 1A4IA 4I8DA 4K6HA 5BSRA 3X2EA 1DWUA 1HL7A 5L4LA 3ZQ6A 2QX8A 2PS9A 3I1IA 4IVNA 1E0DA 3JALB 4AZ3A 2XDQB 4PHFA 4ZAWA 3I6ZA 2H9YA 3PHJA 1DP4A 3VFDA 4M9UA 2IW1A 2EV9A 2WM8A 3PUVA 5BUQA 5BV2P 3LCRA 4Q1BA 3T7TA 3ETEA 1HRKA 5LLTA 1JXAA 3GJRA 3OQIA 4P54A 2WAMA 1J5EB 1CJKC 3TD9A 2QTZA 4QJ4A 3L0BA 1O6CA 1OASA 1GA4A 3RSCA 5CEEA 4JLOA 5EUCA 1U8XX 2JCYA 2B35A 1LLFA 4CF3A 1ZQ9A 3FHLA 4YQFA 3G7UA 4E6EA 4R2HA 5K6AA 4EGJA 5KZMB 4GYKA 2BFCA 4DLUA 3QF4A 2HNBA 1GZ3A 4JI6B 3O0DA 3GO4A 3RR2A 1H4VB 2XUDA 4DSUA 3FFBA 1WUIS 1QE3A 5C35A 2Y76A 3BK2A 3HCWA 1M7BA 4LOKA 2OK7A 1KGDA 2NYVA 1MF7A 2I8LA 1MTOA 2WU3A 4P36A 4U4AA 3RIEA 4OQPA 5JS6A 2P6PA 4NZYA 1KC1A 3QKIA 2DX7A 4L78A 1QC5B 5FBZA 1R0KA 1Y89A 4KFTA 5AIBA 4CTJA 2Q2WA 2QN2A 2XGOA 5KWEA 3QMMA 4HAYA 1WOYA 4CMIB 1RXVA 1KMHA 1Q15A 1W25A 4UAGA 3BE6A 1GPH1 5FI3A 4DV7B 5KHOC 1QRSA 3WLFA 4BX9A 1KAHA 1KAEA 4E03A 2HC9A 2XOKD 4I66A 2VJMB 4ZVOA 5BN4B 3WYAA 4DB2A 3CUKA 5FOWA 3DDWA 3WC4A 4CR8A 3ZDEA 1E8MA 2Y9PB 4G36A 4BGVA 1W34A 2FMKA 3IVGA 1JEJA 2WMNB 4OG2A 2EKPA 4HB3A 2IS4A 4APAA 2ESRA 2YHUA 1BZYA 1I4EB 1O97D 2XD9A 3EIEA 3WK7A 4DIFA 1TL7C 1NXXA 5FUQA 2QVYX 2QW8A 1E1YA 2DECA 2OM2A 2XZDA 1A50B 2AYXA 4DJFC 1LSOA 3C3KA 1Y1TA 4NEGA 4G0PA 1Z25A 2Z4SA 4R8MA 1NJSA 2BM8A 2DHQA 1NFFA 2HGZA 4ZAXA 4BUZA 3AVPA 2W93A 3V3KA 2XCUA 3F96A 4A2CA 2EDCA 2A92A 2C9CA 4B46A 5AI5A 1PJQA 3L6EA 1WHTA 4ZYTA 3D0RA 1GRNA 4OKNA 3AF5A 2VXOA 1JHPA 5A3RA 4IO0A 1HV8A 1KEWA 2J3EA 3UFXB 1TT5A 1DIOB 1OUMA 3D9QX 4WWHA 2R3SA 4INAA 4B74A 3C3JA 4WLNA 4FNMA 3V42A 4S1OA 5IJ0B 2C1EA 3NFRA 3FYDA 4CHGA 4HUTA 3T7AA 1P2GA 2XDAA 5HDQA 1XLTC 1YNOA 3C15C 2BHSA 2DUNA 2OZKA 3T06B 3C70A 4HH1A 1Y3BE 5IU6A 4J0GA 2A1TS 4MCIA 1TAHA 4UPEA 4K9RA 1MQSA 3OT1B 1A71A 5K8TA 2HPVA 4D9KA 4UTOA 4NJEA 2G07A 1BMDA 1SR8A 1YRLA 2J1LA 3OLVA 4GX0A 2IYVA 1F4LA 3MCAA 2LKCA 2M6KA 1BS9A 4YXFA 5J1SB 3THXB 1WSBA 1EX7A 2EBHX 3B6IA 3VH3A 4BQIA 5JSFA 4HUQB 1HETA 4KHZA 4D96A 2ASVA 2DWCA 3QBVA 3OJEA 1JSWA 1NNSA 2LR0A 2EERA 1JA0A 4A3SA 5KUTA 3OO1A 4EIWA 4N48A 1X8XA 1PGNA 3I2FA 4N9WA 5T64A 2FQQA 3GRZA 3I61A 2C4TA 3NKFA 3PHIA 4PSDA 2AC4A 3A7DA 4Q4AB 4E5MA 2PO5A 3ROXA 2GXUA 2PRKA 4WEQA 3WGVA 3B1XA 4FMCF 4NOLA 1K88A 3ZCPA 1PUXA 3B5EA 3PQFA 3SEQA 4C0LA 2EZTA 2QRNA 4L76A 1BCSA 2QMEA 5DBIA 1I4DD 4BRWA 2FPIB 4C4PA 3UIEA 2FPPA 2CFIA 4LV6A 5FR2A 4QUJA 1EXDA 4YX9A 5FNVA 1Z82A 5C8ZA 2VP4A 1MX9A 4YRLA 1MJFA 2WD9A 1JKIA 2Q2QA 3PPXA 1T6BY 1EA5A 1DKUA 2HMSA 5DK6A 4U9UA 2XTMA 3N0WA 4QXOA 3GEEA 4TLLB 4FJ2A 4M0EA 4BMNA 4UTRA 1CWUA 2CVZA 1UP6A 3WMXA 1AQJA 3U7EB 3ILYA 2WMDA 5JCOA 4MIOA 4CR6A 1Z3IX 2LIPA 2FZLA 1AQLA 3B8HA 3Q6NA 4UE6A 4ADSG 5AI6A 3VO9A 3SYKA 2Q5IA 4FLEA 3I73A 4QASA 5TNXA 3P0EA 4RW0A 1AF7A 1O87A 3E9YA 2MJLA 4XGRA 3VR0A 3ZU6A 3KVNA 5LYJA 1G0NA 2QS9A 2OGZA 5JNTA 1HWYA 2D06A 3GTDA 2J6HA 1BA3A 2ZSUA 3R3HA 4KWCA 4WZBA 1QLHA 4UZFA 1RZVA 2UAGA 4MQFB 4IQGA 4W5WA 4E46A 1COWD 1BEEA 1I36A 4JP3A 4M0MA 3DZIA 3CGWA 1MB3A 3JQRA 2PVCA 3AI7A 2YJ3A 2CXHA 3OZCA 4IP0A 1LK7A 5PNTA 3RUEA 2WJ4A 3ZHYA 4ZRNA 5DJ5A 1Y1SA 2WOJA 1FSFA 4C43A 4MRSA 2XT9A 3KOYA 4XSHA 2Q4EA 3T52A 1GZ6A 3FMFA 1JI3A 1OZ0A 3HV2A 1UOOA 1R6VA 1Z0AA 3T4PA 1G20B 3KUKA 1T1IA 2VA9A 4G63A 1Q7TA 5L3QB 4TQUS 3RB8A 3KXKA 2V98A 3CF0A 3K0CC 1BAPA 1CR2A 1PTJC 2DRIA 1QGUA 2FZEA 4HDKB 4IRXA 3OO0A 1EFRD 4Q7LA 1QKJA 4KW7A 1J8DA 2DHEA 4IWNA 1M6WA 1QORA 1W9MA 3OPNA 5ALKA 1YJ5A 4Y2VA 4BU0A 1J3UA 1KDTA 3P45A 3TOXA 3TSOA 4ARAA 4O1HA 5BRAA 1OLXA 1FNMA 2WTBA 1PL0A 2ZATA 4KFUA 2B98A 2ZYAA 1WCIB 3JQGB 3ZY3A 4R1LA 5IYZB 2KHZA 1VQ1A 3E8XA 4LQDA 2FSHA 1QZXA 2YVLA 5KVVA 3H1AA 1RE1A 3ROKA 1V95A 2KMLA 1ZZEA 2IYOA 2WT8A 5F3DA 5T5QA 3EA5A 4KLCA 5SZHB 4BE7B 3LMKA 4DBVO 3T34A 1RP7A 1R27A 4Q9JA 4O1MA 3ZVNA 1G1AA 1V8OA 5C5EA 1MBZA 4OH7A 5I7FA 1E9BA 4Z4IA 4BNYA 3ZU5A 3RTAA 1MJ5A 4HSEA 2YYAA 1KYQA 4KQFA 1LF0A 1MXFA 3LCMA 1M66A 5KB3A 2NUPB 1NJ5A 1IY8A 2QZSA 4WUTA 1X1EA 2H3HA 4MSUA 3W3AH 1N77A 3ZU3A 3FLMA 1LLUA 4WGGA 4P32A 4RDCA 3K1AB 3SYTA 1SOMA 3TB6A 2HV9A 2QP3A 4L8YA 4OQLA 1G3IA 4ZVLA 1ZJ6A 2XOEA 5E4YA 2JGMA 5JATA 5T7BA 3HWRA 2C8KA 2P9GA 1IUNA 2X8AA 4M8SA 3ZWQA 1NLYA 2PR7A 1M3SA 1M83A 5IVPA 1S6YA 1B16A 3B9RA 3PR2B 4JC8A 1FFCA 2QAJA 5A02A 1S7GA 5MGBA 1A8QA 4JY7A 1P1CA 4QARA 2JLRA 3ZWNA 4MARA 4IJQA 3DPIA 1SVNA 1X80B 1N78A 5JG7A 3A28A 2HWXA 2B21A 2IU3A 2C5AA 2WWYA 1JG4A 3O4RA 3ERCA 3PA6A 1ZIPA 2H2GA 5CGQB 1P6XA 3ZVRA 1P74A 2HHJA 1EQ2A 3QRWA 4J7XA 5EIHA 4REQB 3GIDA 2PUVA 2E6UX 1Q22A 2GVZC 3JW8A 4TVOA 1MJGM 3OFKA 2PTQA 1OI3A 1K0UA 1VMEA 4YRQA 1DC4A 2WE8A 3G2NA 2F8MA 1CF4A 4HNUA 3M5WA 3IHKA 3DZDA 4Q93A 1S2IA 4U3JA 4JC0A 4V0MA 3TQFA 3ROEA 5A2GA 4BQQA 3ZCUA 4C89A 1ABFA 1CF2O 3PRHA 4WLUA 2IPLA 3M8KA 4KUHA 3SHVA 4AJ1A 3TWOA 4OXRA 2W7TA 2OQVA 5E4JA 3BGDA 4CI9A 4ENPA 3AZOA 4AS1A 4EG5A 2IITA 2GNAA 5FTJA 1KA9H 4XIGS 3RQIA 3O31A 3EA4A 3SHFA 2JGEA 4CLDA 2XVXA 2FW6A 3QJGA 4BZWA 3B9PA 2BI8A 4NBUA 3KJZA 5T4FA 3ZPXA 4BPBA 1ZJJA 5DGHA 1N75A 4GC5A 4Y2GA 3VR6A 4L28A 1LNSA 4A8PA 3AR4A 3KQUA 3UWPA 3WG9A 4IQJM 1R3DA 4IIJA 3WFZA 2R6JA 4BP9A 1KEUA 2GD0A 2PH3A 4O5AA 5DWQA 1FXWA 2JC3A 1EJ2A 1V3QE 3R0QA 1USIA 1IZYA 3OE1A 4BDSA 2ZRJA 4EP1A 3PNPA 1X1AA 3WWDA 1M1ZA 4LNUA 1NR5A 4ZJYA 1IZ8A 1W36D 1GQYA 1SG0A 3FPJA 3OMXA 5C8VA 1O5IA 3RLIA 3RODA 3ZKWA 8LDHA 1EE2A 1GQFA 4DY4A 4EPRA 4DYVA 1MA0A 2EZUA 2NZWA 3ENZA 2PL5A 2UVDA 1AMOA 2H59A 2V59A 2CXQA 3C7TA 1AHIA 3WNBA 1R9MA 4F21A 4XWOA 3WP0A 1L4LA 3WKCA 1GG9A 3NDPA 3PIIA 4FDMA 5K7SA 1XTKA 4V39A 3VYWA 3OPVA 1UDBA 1B6SA 3I12A 4KXXA 2ILTA 1YC5A 2VG8A 1YR3A 4FMPA 2QLFA 4IIYA 4DHWA 3MTAA 4UOEA 2RI0A 2JIBA 4P81A 1JHQA 1L5OA 3GJ6A 3WLTA 5AQ1A 1O5TA 3MCWA 1PX2A 1SXJB 5CLJA 4E4TA 3OLQA 2V45A 2C57A 4PO3X 5AOAA 2D7DA 3AVQA 4F5YA 1QO0A 4I50A 4RXMA 5FOXA 4X0EA 1LWOA 4BHTA 2L18A 2QPAA 4YNBA 4W7IA 5ARDA 2Z0MA 3T41A 3JSXA 3FTNA 3BMOB 1BJTA 1P17A 2VZLA 4YLEA 3C4QA 1TCVA 3GZNA 2VCHA 2BKUA 3IJ5A 1I5RA 5TJHA 1FRZA 1OGYA 1YB6A 3TZCA 3ZS9A 4AUMA 4QDKA 3TTXA 2PLFA 4BLVA 4B7AA 3ISVA 1LI5A 3G68A 1D6SA 4K6GA 4DDMA 4XI9A 3FCYA 4M1QA 4OK5A 1KI8A 1ADFA 3KQWA 4DR1B 5GJCA 2YNMA 1NL3A 5TQJA 7ADHA 1YJ8A 4XRGA 3W2EA 4JIMA 2M6RA 3B1VA 1UINA 4KQXA 4A5OA 1EVLA 3PXDA 4OF4A 1VECA 4MQBA 3DUFB 5COQA 4DA4A 4XYMA 2XBMA 2CVOA 2C5FA 2NVOA 1UAYA 1DZ3A 1TM7E 2EKZA 3H7IA 1OWNA 3MINB 3NBAA 4MGKR 5C46F 1JQAA 4ZAGA 2XKKA 2B30A 4PZYA 1ZSNA 1TVMA 1DBIA 2ECKA 2PWBA 3LX4A 3IBSA 5AKKA 5CD1A 4EJSA 2JFYA 4HVLA 4QOHA 1GARA 5K0GA 1W0JA 2NUAA 3JQ7A 2QRQA 2EFDB 2PH7A 2AFIA 3RADC 2RIRA 1X92A 2MCFA 3BDVA 1EBBA 3K5PA 1QOPB 3EWNA 4AL4A 5HX7A 1ZAYA 2F8TA 4MK4A 5BYJA 4UM9B 2G9QA 2AMYA 3OJOA 5E1DA 2J59A 4I1UA 4ISBA 4C7MA 1G2PA 1ODKA 3L6BA 4HWTA 4MXDA 5LQSA 3ZU2A 4EFLA 2GZ3A 3KLNA 1NRWA 2Z3WA 2VDUE 5FOSA 3FRJA 4PPFA 1PAUA 3NM4A 1XEFA 4FYVA 5IFLA 4GX2A 4EY7A 2F9FA 4S1PA 5C5IA 4RDXA 4J9VA 4I9GA 4E09A 1D2HA 3AILA 4F5EA 4NOMA 3UV6A 2ZI5A 3WJAA 1IHDA 3OIFA 4LYHA 3ILHA 4MI3A 3PGA1 3TSWA 3UJCA 3WTCA 5FOVA 3ZY4A 4E1AA 4FB4A 3NRJA 5SZJA 1Z6QA 4ZALA 2YCBA 1BHQ1 2WJGA 2WJZB 3LUGA 3R5XA 3T15A 3UN1A 4BQNA 3ET4A 2OKGA 1ORVA 1AB6A 3BHGA 1QR6A 1PK8A 3L01A 4JU9A 3MJ4A 4DOMA 1OGIA 4QPDA 3IEPA 5TT0A 4P86A 1NQXA 3GJYA 3JQ9A 2NVWA 2TYSB 3AVOA 3ILVA 4FT4A 3GMDA 3UT5A 3ZQKA 4HFMA 1UADA 2P4EA 2C5GA 2O6HA 3PEFA 3LQ2A 5AVTA 4BJHB 3JWGA 3UWDA 4Z9XA 3QV1A 5K3OA 3R7WB 3QENA 1D0IA 2Q6TA 3GVCA 2OECA 5HF9A 3QU2A 3MS7A 4NNPA 3W9BA 4R0NA 3Q9NA 2OY0A 4BP3A 3VZQA 3PDIA 4M1MA 4TKLA 1SK8A 1CUGA 1ZN2A 4X1YA 5AVQA 2H11A 1Q12A 4Q12A 1IL0A 1Y8RB 3EIOA 2IKQA 4ZOCA 2A9VA 4MR9B 3R41A 1L5KA 1B74A 1SCBA 2H17A 2O20A 2GPWA 2ORWA 4QRHA 1ZA1A 4EY4A 3BWDD 1O95A 5LQNA 2UVQA 1JJAA 3EZXA 4AX8A 4BWYA 1ZGCA 3IAAA 4AJOA 2XBLA 4BJ1A 4DR5B 4YMTA 3I04A 1GAXA 2H4WA 3DL4A 3JS5A 1V5WA 2AD5A 1EK6A 2EL9A 3IDQA 2YXBA 3OE7D 1J24A 1SFRA 3TINA 1M2NA 2WWRA 3HBAA 2Z1DA 3HWWA 5JLJA 2FEPA 3EFHA 4NC9A 1JNYA 3RJMA 2F17A 3CKMA 3W7VA 3ZNOA 1R6DA 4K1LA 3ANXA 4B80A 4CEIA 4XR4A 4FN4A 3T9BA 3LV8A 1SUEA 1ABBA 1EFVA 2CZCA 4KIJA 4EHIA 3BZUA 3PNMA 3LHFA 4KC0A 1NVAA 4BJ6A 3QMVA 4G4SP 4WCFA 3WQRA 1H6BA 4RE6A 2P1DA 1T0UA 3LCJA 4KXFB 4U7TB 1C9DB 3DQPA 5JY1A 3FGPA 4JCCA 2OOKA 4ZU6X 1C81A 1LW7A 4FSHA 3NI2A 4QECA 3HABA 4U6NA 4J1NA 3M81A 4RA6B 5H68A 2NT4A 2YBDA 3WO1A 3WDMA 4DIEA 1NPYA 1CHNA 4NCJA 5I9MA 1QFYA 2V8BA 4MPJA 4BWGA 1CUBA 2JK0A 1T34A 1YE3A 3IIEA 1MR3F 3R8CA 4GE0A 3H1EA 3IAS6 1G9TA 2G1PA 2G36A 1YS4A 1GG5A 3MQFA 1QAMA 4RHTA 3C1UA 5CGZA 1TX4B 2BGIA 2Q5EA 3RYFA 4AJNA 5KYKA 4JR1A 1G18A 3HYCA 4C30A 3JZMA 1E4EB 4PPYA 1Z4JA 1GCAA 1JNXX 1UOEA 2VNIA 3CLSC 4H0NA 1NKVA 1FX1A 1GSAA 1ECBA 3ORRA 5HJ5A 1MW8X 4QZVA 1F14A 3FFTA 1Z4LA 1C8BA 4WESB 3L93A 3RVKA 1Q3HA 2HDWA 4OQDA 4L8VA 1PFKA 1Z0SA 2BI7A 4EITA 1U2RA 3RU2A 3B3QA 3JYOA 1DELA 1X9IA 2R7AA 3H8JA 5AM5A 4C3UA 2HWKA 2A0FA 5BOVA 2QE6A 4KGXA 3C16C 1C1XA 1OFUA 3JV7A 4JJIA 1DEXA 2LNDA 2OBXA 1F8FA 2I4IA 2XUJA 1FQKA 5HJ7A 1TDJA 3QU5A 3ZDQA 4HPWA 3SHOA 2RHHA 4FC6A 3SX2A 5K8JB 1WP9A 4XIJA 4JEUA 5DWDA 5F1YA 3X1WA 2VXYA 4B2LA 4BBJA 1TB4A 5J4VA 2IOFK 1PWHA 4GWKA 1JKFA 1H6CA 2MR5A 5IM5A 4KXQA 2XY4A 1SG9A 4EFKA 1EGHA 1CZKA 5B7QA 3BXOA 3RTGA 1EXNA 5BSHA 2XHZA 3ED5A 4F93B 5KWSA 1KJIA 4A82A 2Q5OA 2ZZMA 4MINA 5DU2A 1AKMA 2P91A 4G5HA 4Q1CA 3RO7A 3PD7A 3QFHA 4FJ1A 3V8BA 5JVDA 2MTBA 4IFEA 2P9YA 4TT8A 2DCMA 4WD3A 5CBPA 3FRHA 4L4YA 1S2OA 5E6RB 2GASA 1SEVA 4CM5A 3TRDA 1KFEB 3U7FB 1DWOA 1QIMA 1VBMA 2FMUA 4R7GA 4B9EA 5CNIA 3LUCA 4ND3A 1GO2A 1P75A 1UPFA 3RKUA 1ULHA 1KVUA 4ARZB 5EJ5A 1BD4A 1WNFA 5KOJA 3L18A 3BCRA 2BISA 2Y77A 1MXHA 2XTJA 4KWHA 4KGZA 2XXBA 3Q5EA 3USZA 3Q0EA 3O38A 2O6LA 4O4LA 1JX6A 1YFJA 3G1WA 3LRXA 2VP0A 2JKZA 5U1PA 1QMPA 4BVJA 4YCMA 1KBZA 2W8BA 5ECWA 3HB5X 1JLRA 1GUAA 3IHTA 4CHTA 1JFSA 5JS1A 4D0NA 1M6VB 5FF9A 3JASB 3WRWA 2G4LA 3U4AA 1P1IA 2NZJA 4ZQGA 1ZGJA 3ZE1B 3UK6A 2JI9A 2A94A 6NULA 5A0VA 2DFPA 3CX3A 3LDHA 3ONFA 1L8AA 1P0FA 2JFHA 3EAQA 1KU0A 4MQEA 4O4HB 3R9IA 1E7SA 3TSZA 1CY4A 4ZAFA 4DR2B 4RFLA 3L49A 4LFBB 1FK8A 1M54A 2FQXA 1M2FA 2PUHA 3PJDA 1FL9A 3ZZTA 2VWGA 1SBYA 1ZC3A 3AHIA 8OHMA 2JHAA 2GO1A 1WSDA 2V8OA 3IVRA 3LC1O 3JR3A 4KAAA 4PCLA 3VDNB 2JBWA 2PM8A 2YIVX 3WZ2A 1LVUA 2V7UA 2H48A 3WQSB 1RI5A 2BCJQ 4B3FX 1HYQA 3WGTA 1S3GA 1R00A 1PQPA 3I1YA 4D0GA 1DKRA 4QLOA 3FX2A 2IZOA 1ESDA 4YBRA 4QDTA 3K6JA 4BP1A 1Y6FA 4R2IA 1JBQA 1RLTA 3CXUA 2Q3BA 4KWTA 4WK6A 4JI5B 3W4IA 3R8FA 4R9NA 3LCCA 4LF6B 4M60A 2E9SA 3F5QA 5DHQA 5I47A 2JCSA 5DOVA 5IH3A 2AFRA 1E6KA 2E2WA 2W6QA 3LYUA 2PX2A 1VL1A 4LC0A 5IUJC 1MGOA 2GTPA 1MOSA 2G88A 1BSVA 4WZAA 1CS4C 2Q1SA 1GPKA 3ZQ4A 5FTKA 4MDEA 1ADCA 2YYYA 4OKIA 1OKKA 2NW6A 3OLZA 2E4VA 3CF2A 1N7IA 4JC5A 5DE3A 3H83A 3RKRA 4TRJA 3JD3A 2ZULA 5IVDA 4BTEA 1GDHA 4N6GA 3I58A 5JTTA 2F1RA 1FP2A 2VQSA 2HJVA 3EBOA 1I51A 1SKBA 3EEFA 3KNZA 2PTSA 4WVLA 2WUWE 4YACA 3V55A 4XASA 3AKEA 4C04A 1C7JA 3REOA 2GPYA 2IV7A 2QQFA 2R2GA 1EP1B 4R2LA 1E2EA 1QXSA 3COPA 5D3KA 4KQMA 3VZRA 2J6CA 4WDQA 3ER9A 1NSFA 2ZWIA 1AQYA 5EZQA 3N76A 1DRVA 2WVHA 2LBPA 4G1FA 3WYGA 2VT7A 4UMVA 3VMMA 2GAAA 1SZPA 2PSDA 3MMZA 2V1UA 4YRCA 5IF9A 3AJRA 2AOTA 2NSLA 3DEHA 3IAS1 4CPDA 5JZSA 5FPYA 3MMXA 3GOHA 4QAQA 4JHXA 2ZJ4A 3VHLB 5AYVA 2JFUA 5CB4F 4U7DA 6REQB 1OA1A 2BFFA 2EFJA 2L82A 3NNDA 4LMRA 4B83A 1EX1A 2ZJ8A 3RRNA 3CZ4A 4B5KA 2I3DA 1Q57A 2HHCA 3D8TA 3MGAA 4NFHA 4KV7A 721PA 5SZIA 5EI5A 1YOVB 3L1VA 4B6OA 1OSNA 1WHSB 2IIBA 4ER7A 1JDTA 1TRKA 1W76A 2HAEA 3PKZA 3WA7A 1GCIA 2OENG 3DWGA 3B78A 3P52A 2IUTA 4K8RB 2YJ6A 3KEFA 4WINA 3DDZX 3K05A 4PPGA 3OD5A 4R8SA 4KTTE 4ZT2A 4RXUA 4JI2B 3GD5A 5JNWA 1H8HA 3G02A 3LO8A 1NNUA 1UK7A 3K30A 3AHJA 1Y5MA 2KWIA 3NETA 1F60A 4FEYA 4N3GA 3CNNA 4PVCA 3A3YA 5DKFA 4GOXA 4ZZ0A 2VQ6A 4MP8A 1RJ9B 1XZHA 1QO7A 1KSFX 2QL6A 2QR2A 3O74A 4FBGA 4BIIA 1MNAA 1AH2A 3C45A 1PZFA 3DT9A 1C7IA 3V4VB 5H5JA 1VP3A 4ZOLF 3VU8A 1RADA 1Z5ZA 3KOZA 1PR5A 4N1AA 3A4VA 4CKWA 4YAUA 2ACKA 4HG2A 3I0MA 4HH4A 3FMGA 4LJ8A 4D9IA 1SN7A 4EI7A 3Q85A 2E1RA 3H5AA 3EGXB 2ZR7A 2VZ8A 3M4JA 3AR2A 4FR2A 4FW9A 2I71A 1J8FA 3DDOA 5B3AA 3PJRA 1JEDA 1TUBA 3RWBA 2HJRA 4CXMA 1PJ3A 1A9TA 3BK7A 4TS9A 3UBTA 1UJMA 1WBDA 3PCRB 1N2EA 4G09A 1EWYA 2JNWA 4AG3A 3DE1X 1VKNA 2XDQA 1JG7A 1ZWLA 1XRNA 2ZROA 3GT0A 2X8LA 3JALA 1FS4A 1Y9ZA 3PC2A 4UDNA 5FFMA 4GOMD 4OV6B 2V7WA 4X64B 3U7RA 1OWOA 4FU0A 4D43A 4KR3A 2RGXA 1V6AA 1OU0A 3OM9A 3D02A 1S8FA 3IP5A 3AHHA 3FOCA 2FOLA 4OP2A 5ED0A 4DQLA 4Z3DA 4F8YA 2NV0A 4R41A 5LMNB 5T67A 4PNPA 4US0R 5E38A 3VC1A 4MZDA 4LRSB 2RB5A 4LBZA 4MLZA 1CJSA 3PD0A 5AO9A 1U3VA 3LH5A 1HRDA 1QAQA 1PLJA 4IH1A 4EUKA 3LUPA 3K15A 4QJ3A 1FP6A 2AOVA 4U63A 1Q1ZA 2W2XA 5FRDA 2ZJ0A 2X77A 4AFNA 2QYHA 2YFHA 1WXQA 3PFKA 4LXGA 4AN1A 2X7HA 3M1LA 5IMBA 3AVUA 2H4HA 2NP7A 4QBTA 4PHTA 4DIMA 3AVTA 1IQRA 4Z0HO 4GM0A 4RPHA 3ZC3A 5GINE 1W6RA 3C3BA 2A7QA 5IULC 1THGA 2O2ZA 4AMGA 1O5OA 1Q92A 1QC5A 1R4ZA 5DBEX 1I2MA 3ZXYA 2WY2D 3LSTA 2EBUA 4HQFA 3NWPA 1WCV1 2BGNA 2WUVA 4CMIA 1QHFA 3TLKA 1YRWA 2RBEA 4YP6A 2EP5A 3T61A 4GLLA 1JMKC 1Y5NA 3WISA 3KSUA 2HSGA 3Q87B 1UKBA 2VJMA 3NP9A 5BN4A 4LSMA 4FD3A 1Z2CA 4XCQA 4ZQHA 4ETWA 5AVUA 4UBMA 1E3TA 2ALJA 2VRWA 1E2HA 3JWJA 4GZ3A 3IJRA 3NEJA 4EJFA 2FEAA 3H2IA 3PWSA 2IF0A 4FUQA 4HEJA 3C85A 1K66A 3DB1A 2ONCA 3GPDG 4WACA 5EZ5A 5BMVB 4RPGA 1VFPA 4OQNA 1QJCA 1ZS9A 1CBUA 1U8YA 2OV2A 3N2KB 4UHJA 2FWRA 4ZCLA 4XVHA 2FFHA 3X3HA 4XWAA 1E4VA 1PO7A 3U3OA 1GA1A 1X77A 3KQPA 4X91A 2I5PO 3SE0A 1XZGA 2NV6A 3B38A 2VEDA 3EDQA 3IFSA 4ZVRA 4DC0A 5LYYA 3LS2A 4IDEA 1PFUA 2G09A 1V37A 3FDFA 2GB4A 3EPJA 1N2GA 1R16A 1O0CA 2VZ9A 4DW8A 3C4VA 1QGDA 3QVMA 4JB0A 3UFXA 4BNXA 1KI4A 2DXIA 2I6TA 4IKPA 4R1UA 1FTSA 2GHIA 5JXJA 2AMVA 4WEOA 3K8QA 2CVQA 3NVDA 4IQ8A 3PNSA 4RKFA 4YT5A 4C2BA 4DXHA 5IJ0A 1DGQA 1WS6A 3FZQA 2QMOA 3JQBC 1GZVA 3OQ1A 4OMUA 5K6TA 4K0KB 1WDLA 4M83A 2YWHA 1IUKA 3RS3A 3Q40A 2VJBA 3AI3A 2F4NA 2FXVA 1NZDA 2GF0A 1GZUA 4L73A 3OT1A 3HMKA 1LTQA 1IEWA 4TUYF 5AKYA 4FYPA 1VLZA 1WXHA 3ASZA 1G16A 2G1KA 3JR7A 2QQGA 4MMYB 2IUSA 3WWOA 1UXJA 3QW4B 3GXOA 2ZI9A 1AHPA 4O2RA 4HUQA 1O6BA 5KYTA 3U6BA 4LZZA 1RRVA 5EQFA 4YAFA 4ND8B 2Y1LA 3AB3A 4IJWA 3DF9A 3CR7A 3RCBA 3V1LA 4L2IB 4WI1A 1NP7A 4BKRA 4K40A 2HDNB 1GR1A 3N58A 2IHVA 2K2QB 3EGOA 3LKZA 4JBGA 4O25A 1MABB 4Q4AA 5ALDA 5C0OE 3RBXA 1TIKA 4FCCA 3NNNA 4YWHA 1CRWG 1G5RA 3NDIA 4P22A 5IVIA 4DREA 4M88A 3AI2A 3WA6A 2W9XA 2COEA 4DGSA 3DAYA 2VF5X 1JKMA 4I9FA 3MCVA 1ZH4A 2FPIA 3DV9A 4MV9A 2OAGA 4COOA 4CRWB 4YDQA 3ECCA 3H05A 2HMUA 1Y7IA 1K6EA 1OB5A 1G98A 3GQBB 4IQ0A 2PKWA 3N6RA 4PRLA 1MB4A 4XEUA 3RFCA 2WW8A 5ECDA 3TKAA 4HQLA 3Q0IA 3AJ8A 5KAPA 3FB1A 3UGQA 4YQYA 4R2WA 1CSEE 3N0RA 1XRLA 4G41A 2D1QA 3RREA 3KV3O 2O1EA 3E3AA 4KVGA 3IGFA 3MHPA 4JITA 3P9KA 4J91A 4AIRA 1X7GA 1QANA 3CIOA 4QYWA 2IV3A 3G5UA 5ALYA 1E98A 3CZQA 1H2YA 4LRUA 3P5SA 5KDLA 3HBNA 2I8AA 3B13B 3ENQA 3M6LA 3R2JA 1P19A 2NZXA 4LTNA 1OT5A 4R9SA 5JAOA 1N4DA 3NVKI 1NVVQ 4MQFA 2WM3A 2P78A 1NBWB 4RTOA 3GMTA 1T13A 1YFZA 3LOQA 2GR9A 2MYNA 2XVZA 3TW8B 1DC8A 4K3VA 5EE1A 5EQDA 1BYUA 4GNKA 2CJWA 4IUBS 1LCIA 3CT4A 2V55B 1VDKA 4KXYA 1W5EA 1UAAA 1Z83A 3ICWA 4BO5A 1TEHA 2TMYA 3D3JA 3JZAA 4KXUA 4RTJA 3BE4A 1I14A 1Z4IA 1SK9A 1ZOSA 3UKJA 1ZJ4A 3ON5A 4X54A 1A5ZA 1E3DA 3FOEC 1G20A 3PNQA 4BMPB 1NW7A 5B2EA 3JVDA 4G0QA 4M0DA 5AHRA 2JLSA 5L3QA 5CU7A 3SY8A 4XTRA 2GZAA 1CVRA 1U3DA 3N6VA 3K1TA 4HDKA 2PEZA 5HCNA 5CLIA 2ENUA 1G2OA 1FYWA 5K4AA 5IAAA 1Y1KE 4L74A 1IWOA 4WVFA 4BLPA 1VDZA 2QXTA 2YIMA 4LHVA 1H6DA 5AW3A 4Y9RA 2AHRA 1XCMA 4AZ0A 4OHVA 1H42A 3REFA 4WPGA 2VAVA 3OJCA 2IXDA 3EWIA 1WCIA 3JQGA 4RD3A 1D1PA 5IFKA 1O77A 5IYZA 5DP1A 2QTNA 2DPHA 3B1ZA 4L1KA 3UXHA 4B84A 4QELA 3ONVA 3RNOA 5KDDA 4CDNA 4Z6KA 2GNOA 2WV9A 4UREA 1GSHA 3T8YA 1M1UA 3C5EA 4DM3A 1UEJA 2XVMA 4WOJA 3HL0A 1UC4B 3OLWA 4TXMA 5AXAA 5J2UF 3LYHA 3HUUA 1JG1A 1HFEL 1LS1A 1VA4A 2C2YA 1R1DA 3HBMA 5AR1A 2PAAA 3SS7X 4PC6A 4EA8A 4EKGA 3OTOB 2FRDA 3GGDA 1CTQA 3PUHA 1JVNA 3RBZA 2GUWA 3LW7A 2NT3A 4TLCA 4ZRMA 4K9OA 1CVIA 4KNWA 4R5MA 1QQAA 2NUPA 1MN6A 2O54A 1YQEA 2ATXA 4WCVA 3MYRA 5AHXA 1PYDA 2QD5A 3IR7A 4E2WA 2DQSA 1ST2A 2X5KO 1Y1PA 4F6CA 2O8CB 2Z2ZA 1MDFA 1FFXB 2DMRA 4PW0A 4UBLA 5KQGA 1RC8A 3F6SA 3ZDYB 4OJYA 1E9CA 4Q7JB 2QROA 3RVRA 1PFYA 3T1YB 2GCPA 2XDWA 2W4QA 1TNDA 4DTCA 2H06A 3PDCA 3LUKA 1F38A 2XKJE 4H08A 4H7EA 2DOKA 5FUWA 3U5ZB 4MKFA 3WV5A 5J4HA 2XMRA 2Z4TA 4JN6B 5LMCA 3L6RA 4OA5A 1DPGA 5HBRA 3IT2A 1XTIA 2P1RA 1X80A 4EJMA 2ID9A 3PUYA 3CU5A 1RRGA 1DCNA 2RK3A 1MIOB 1H1LB 3IHWA 4H0FA 4REMA 4GFDA 5EXEA 1TF5A 1SHJA 1BJRE 3C6YA 3KT0A 3SK0A 4I4LA 2VDWB 3EZ6A 3UK0A 5CB4B 1IVSA 3A6HA 4UHDA 1NUSA 3PLNA 1NQWA 3U1VA 2GZRA 5AKIA 1P7YA 4REQA 4D4JA 4Q4HB 2F1JA 1Q7GA 1SCJA 2Q45A 2DJ5A 1GDDA 4D56A 3B20A 4DN6A 5ABPA 3OEHA 3IP3A 3TGPA 5FAXA 3MB8A 5A6SB 2PNFA 2JEYA 1CR6A 1JA9A 2JH8A 3HGQA 1HLDA 2F62A 4RLHA 5E1OA 3TR6A 1N2SA 5JAUA 2JVJA 1IUPA 3WY9A 1DIGA 1AS3A 4B3IA 1NASA 3OPYI 2YWCA 1QMGA 2YS7A 4INZA 3NKLA 4IW3B 2F00A 2BUCA 4R16A 4GL2A 4GI5A 1YJBA 4DLNA 4JQOA 4QPZA 3ZD9A 2FN8A 3ELWA 3QI7A 1AA6A 5JCXA 5D8DA 4DCSA 3EXHC 5LVAA 3U5TA 3GUZA 4UHEA 1KP9A 1FSGA 2QX6A 4FYMA 2A4MA 4JOCA 1F3LA 1KQPA 4GPD1 4JJFA 3ZI4A 5IDXA 4DKJA 2J4FA 1I5EA 3CWQA 3QWIA 5PGMA 4GZLA 1L9XA 1S3FA 2F4VB 2PZKA 2UYOA 3IUNA 3NDBB 1FXUA 2GDJA 4JBYA 1H4SA 2MYUA 1H4TA 1HE3A 3A3OA 4RMHA 3CVVA 2FX3A 3CVYA 2UXBB 1QF7A 5F52A 3IMGA 3L1UA 1YFKA 4WECA 5EJFA 1JGTA 1MO2A 2G82A 2F9LA 3IQDB 5F35A 2QI9F 5FEUA 1AO3A 4UVGA 4LDRA 3N59A 5ICEA 2O1XA 621PA 3BIFA 4MUFA 3VOAA 1I6WA