1TJWA

Crystal structure of t161d duck delta 2 crystallin mutant with bound argininosuccinate
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
449
structure length
449
Chain Sequence
TDPIMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLEKISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQLIKTLVERAAIEIDVILPGYDHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNPLDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFSTGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALTPEMLATDLALYLVRKGVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSISPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRELMKKQKEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of duck delta2 crystallin mutants provide insight into the role of Thr161 and the 280s loop in catalysis
pubmed doi rcsb
source organism Anas platyrhynchos
molecule tags Lyase
molecule keywords Delta crystallin II
total genus 182
structure length 449
sequence length 449
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.1: Argininosuccinate lyase.
pdb deposition date 2004-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF14698 ASL_C2 Argininosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 1tjwA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 1tjwA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 1tjwA02
5HW2A 2E9FA 1GKMA 1T6JA 2J91A 2NYNA 4CQ5A 1U15A 1GKJA 3TV2A 2O7DA 1JSWA 5EYTA 1TJVA 3R6YA 2RJSA 2FUSA 2YIIA 2O6YA 4NSLA 1FURA 2X75A 4ADMA 3RRPA 3KDZA 4C5UA 1AUWA 1C3UA 1K7WA 2QVEA 1GK2A 3OCFA 3CZOA 1GK3A 1FUOA 3BHGA 3UNVA 4BAAA 1K62A 1C3CA 4NLEA 1TJUA 1J3UA 4V2RA 1YFEA 2VD6A 4HGVA 2HVGA 2O7EA 1T6PA 2PTRA 1RE5A 1VDKA 1XWOA 2RJRA 3C8TA 4ADLA 4BABA 3NO9A 1EB4A 1YISA 4EEIA 1FUQA 2QGAB 1TJWA 1DCNA 5F92A 2PTQA 1YFMA 2NYFA 1U16A 2O7BA 4FFXA 4C5SA 4FLCA 2PFMA 1W27A 1Q5NA 2PTSA 1TJ7A 3GZHA 1I0AA 3R6VA 3KDYA 3OCEA 3RD8A 2O7FA 1B8FA 4APBA 4C6GA 1HY1A 5D6BA 3QBPA 3R6QA 4EFCA 2OHYA 3GTDA 1HY0A 1KQ7A 3E04A 2O78A 3NZ4A 1FUPA 4C5RA 4APAA 1Y2MA 5EYVA 5F91A 1DOFA 4MX2A 4V2QA
chains in the Genus database with same CATH superfamily
5HW2A 2E9FA 1GKMA 1T6JA 2J91A 2NYNA 1XL7A 4CQ5A 1U15A 4NFLA 1GKJA 4WNLA 2JAUA 3TV2A 2O7DA 2RCNA 1JSWA 5EYTA 1TJVA 4YIKA 2RJSA 3R6YA 2FUSA 2YIIA 2O6YA 3F4TA 4IQJM 4NSLA 1FURA 2X75A 4ADMA 3RRPA 2JARA 1XLYA 3KDZA 4C5UA 1AUWA 1C3UA 1K7WA 2QVEA 3F4SA 1GK2A 3OCFA 2D27A 3CRVA 3CZOA 3CRW1 1GK3A 1FUOA 3BHGA 3UNVA 4BAAA 1K62A 1C3CA 4NLEA 1TJUA 1J3UA 1Z4KA 4V2RA 1IW7D 1T9HA 1YFEA 3CI0K 2VD6A 4HGVA 2HVGA 1MH9A 2O7EA 1T6PA 2PTRA 5M0JA 3U13A 2D28C 1RE5A 1VDKA 1Q91A 1XWOA 1Z4MA 2RJRA 3BWVA 3C8TA 4ADLA 4BABA 3NO9A 1EB4A 1YISA 5H8WA 1Z4IA 5M0IA 4EEIA 4E88A 1FUQA 2QGAB 1TJWA 4L6AA 1DCNA 4MWOA 4YIHA 4MUMA 1Z4LA 5F92A 2YV5A 2PTQA 3F4RA 1YFMA 4L57A 2NYFA 1U16A 2O7BA 1Z4QA 4FFXA 4C5SA 2FELA 4FLCA 4L6CA 1Q92A 2PFMA 1U0LA 1XMDA 4A15A 2JAWA 1W27A 2VSFA 1Q5NA 2PTSA 3U19A 1TJ7A 3GZHA 1XL8A 2FENA 2I7DA 1I0AA 3R6VA 2VL7A 3OCEA 3KDYA 3RD8A 2O7FA 1B8FA 4APBA 4C6GA 1HY1A 5D6BA 3QBPA 3R6QA 4EFCA 2JAOA 1XMCA 2OHYA 3GTDA 1HY0A 1KQ7A 3E04A 2O78A 3NZ4A 1FUPA 1Z4PX 1Z4JA 4C5RA 4APAA 1Y2MA 5EYVA 5F91A 1DOFA 4MX2A 4V2QA
chains in the Genus database with same CATH topology
5HW2A 2E9FA 1GKMA 1T6JA 2J91A 2NYNA 4CQ5A 1U15A 1GKJA 3TV2A 2O7DA 1JSWA 5EYTA 1TJVA 3R6YA 2RJSA 2FUSA 2YIIA 2O6YA 4NSLA 1FURA 2X75A 4ADMA 3RRPA 3KDZA 4C5UA 1AUWA 1C3UA 1K7WA 2QVEA 1GK2A 3OCFA 3CZOA 1GK3A 1FUOA 3BHGA 3UNVA 4BAAA 1K62A 1C3CA 4NLEA 1TJUA 1J3UA 4V2RA 1YFEA 2VD6A 4HGVA 2HVGA 2O7EA 1T6PA 2PTRA 1RE5A 1VDKA 1XWOA 2RJRA 3C8TA 4ADLA 4BABA 3NO9A 1EB4A 1YISA 4EEIA 1FUQA 2QGAB 1TJWA 1DCNA 5F92A 2PTQA 1YFMA 2NYFA 1U16A 2O7BA 4FFXA 4C5SA 4FLCA 2PFMA 1W27A 1Q5NA 2PTSA 1TJ7A 3GZHA 1I0AA 3R6VA 3KDYA 3OCEA 3RD8A 2O7FA 1B8FA 4APBA 4C6GA 1HY1A 5D6BA 3QBPA 3R6QA 4EFCA 2OHYA 3GTDA 1HY0A 1KQ7A 3E04A 2O78A 3NZ4A 1FUPA 4C5RA 4APAA 1Y2MA 5EYVA 5F91A 1DOFA 4MX2A 4V2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HW2 A;  2E9F A;  1GKM A;  1T6J A;  2J91 A;  2NYN A;  4CQ5 A;  1U15 A;  1GKJ A;  3TV2 A;  2O7D A;  1JSW A;  5EYT A;  1TJV A;  3R6Y A;  2RJS A;  2FUS A;  2YII A;  2O6Y A;  4NSL A;  1FUR A;  2X75 A;  4ADM A;  3RRP A;  3KDZ A;  4C5U A;  1AUW A;  1C3U A;  1K7W A;  2QVE A;  1GK2 A;  3OCF A;  3CZO A;  1GK3 A;  1FUO A;  3BHG A;  3UNV A;  4BAA A;  1K62 A;  1C3C A;  4NLE A;  1TJU A;  1J3U A;  4V2R A;  1YFE A;  2VD6 A;  4HGV A;  2HVG A;  2O7E A;  1T6P A;  2PTR A;  1RE5 A;  1VDK A;  1XWO A;  2RJR A;  3C8T A;  4ADL A;  4BAB A;  3NO9 A;  1EB4 A;  1YIS A;  4EEI A;  1FUQ A;  2QGA B;  1TJW A;  1DCN A;  5F92 A;  2PTQ A;  1YFM A;  2NYF A;  1U16 A;  2O7B A;  4FFX A;  4C5S A;  4FLC A;  2PFM A;  1W27 A;  1Q5N A;  2PTS A;  1TJ7 A;  3GZH A;  1I0A A;  3R6V A;  3KDY A;  3OCE A;  3RD8 A;  2O7F A;  1B8F A;  4APB A;  4C6G A;  1HY1 A;  5D6B A;  3QBP A;  3R6Q A;  4EFC A;  2OHY A;  3GTD A;  1HY0 A;  1KQ7 A;  3E04 A;  2O78 A;  3NZ4 A;  1FUP A;  4C5R A;  4APA A;  1Y2M A;  5EYV A;  5F91 A;  1DOF A;  4MX2 A;  4V2Q A; 
#chains in the Genus database with same CATH topology
 5HW2 A;  2E9F A;  1GKM A;  1T6J A;  2J91 A;  2NYN A;  1XL7 A;  4CQ5 A;  1U15 A;  4NFL A;  1GKJ A;  4WNL A;  2JAU A;  3TV2 A;  2O7D A;  2RCN A;  1JSW A;  5EYT A;  1TJV A;  4YIK A;  2RJS A;  3R6Y A;  2FUS A;  2YII A;  2O6Y A;  3F4T A;  4IQJ M;  4NSL A;  1FUR A;  2X75 A;  4ADM A;  3RRP A;  2JAR A;  1XLY A;  3KDZ A;  4C5U A;  1AUW A;  1C3U A;  1K7W A;  2QVE A;  3F4S A;  1GK2 A;  3OCF A;  2D27 A;  3CRV A;  3CZO A;  3CRW 1;  1GK3 A;  1FUO A;  3BHG A;  3UNV A;  4BAA A;  1K62 A;  1C3C A;  4NLE A;  1TJU A;  1J3U A;  1Z4K A;  4V2R A;  1IW7 D;  1T9H A;  1YFE A;  3CI0 K;  2VD6 A;  4HGV A;  2HVG A;  1MH9 A;  2O7E A;  1T6P A;  2PTR A;  5M0J A;  3U13 A;  2D28 C;  1RE5 A;  1VDK A;  1Q91 A;  1XWO A;  1Z4M A;  2RJR A;  3BWV A;  3C8T A;  4ADL A;  4BAB A;  3NO9 A;  1EB4 A;  1YIS A;  5H8W A;  1Z4I A;  5M0I A;  4EEI A;  4E88 A;  1FUQ A;  2QGA B;  1TJW A;  4L6A A;  1DCN A;  4MWO A;  4YIH A;  4MUM A;  1Z4L A;  5F92 A;  2YV5 A;  2PTQ A;  3F4R A;  1YFM A;  4L57 A;  2NYF A;  1U16 A;  2O7B A;  1Z4Q A;  4FFX A;  4C5S A;  2FEL A;  4FLC A;  4L6C A;  1Q92 A;  2PFM A;  1U0L A;  1XMD A;  4A15 A;  2JAW A;  1W27 A;  2VSF A;  1Q5N A;  2PTS A;  3U19 A;  1TJ7 A;  3GZH A;  1XL8 A;  2FEN A;  2I7D A;  1I0A A;  3R6V A;  2VL7 A;  3OCE A;  3KDY A;  3RD8 A;  2O7F A;  1B8F A;  4APB A;  4C6G A;  1HY1 A;  5D6B A;  3QBP A;  3R6Q A;  4EFC A;  2JAO A;  1XMC A;  2OHY A;  3GTD A;  1HY0 A;  1KQ7 A;  3E04 A;  2O78 A;  3NZ4 A;  1FUP A;  1Z4P X;  1Z4J A;  4C5R A;  4APA A;  1Y2M A;  5EYV A;  5F91 A;  1DOF A;  4MX2 A;  4V2Q A; 
#chains in the Genus database with same CATH homology
 5HW2 A;  2E9F A;  1GKM A;  1T6J A;  2J91 A;  2NYN A;  4CQ5 A;  1U15 A;  1GKJ A;  3TV2 A;  2O7D A;  1JSW A;  5EYT A;  1TJV A;  3R6Y A;  2RJS A;  2FUS A;  2YII A;  2O6Y A;  4NSL A;  1FUR A;  2X75 A;  4ADM A;  3RRP A;  3KDZ A;  4C5U A;  1AUW A;  1C3U A;  1K7W A;  2QVE A;  1GK2 A;  3OCF A;  3CZO A;  1GK3 A;  1FUO A;  3BHG A;  3UNV A;  4BAA A;  1K62 A;  1C3C A;  4NLE A;  1TJU A;  1J3U A;  4V2R A;  1YFE A;  2VD6 A;  4HGV A;  2HVG A;  2O7E A;  1T6P A;  2PTR A;  1RE5 A;  1VDK A;  1XWO A;  2RJR A;  3C8T A;  4ADL A;  4BAB A;  3NO9 A;  1EB4 A;  1YIS A;  4EEI A;  1FUQ A;  2QGA B;  1TJW A;  1DCN A;  5F92 A;  2PTQ A;  1YFM A;  2NYF A;  1U16 A;  2O7B A;  4FFX A;  4C5S A;  4FLC A;  2PFM A;  1W27 A;  1Q5N A;  2PTS A;  1TJ7 A;  3GZH A;  1I0A A;  3R6V A;  3KDY A;  3OCE A;  3RD8 A;  2O7F A;  1B8F A;  4APB A;  4C6G A;  1HY1 A;  5D6B A;  3QBP A;  3R6Q A;  4EFC A;  2OHY A;  3GTD A;  1HY0 A;  1KQ7 A;  3E04 A;  2O78 A;  3NZ4 A;  1FUP A;  4C5R A;  4APA A;  1Y2M A;  5EYV A;  5F91 A;  1DOF A;  4MX2 A;  4V2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...