1TJWA

Crystal structure of t161d duck delta 2 crystallin mutant with bound argininosuccinate
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
449
structure length
449
Chain Sequence
TDPIMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLEKISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQLIKTLVERAAIEIDVILPGYDHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNPLDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFSTGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALTPEMLATDLALYLVRKGVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSISPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRELMKKQKEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Delta crystallin II
publication title Structural studies of duck delta2 crystallin mutants provide insight into the role of Thr161 and the 280s loop in catalysis
pubmed doi rcsb
source organism Anas platyrhynchos
molecule tags Lyase
total genus 182
structure length 449
sequence length 449
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.1: Argininosuccinate lyase.
pdb deposition date 2004-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF14698 ASL_C2 Argininosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 1tjwA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 1tjwA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 1tjwA02
3QBPA 3OCEA 1T6JA 5EYVA 3NZ4A 2PFMA 3R6YA 1W27A 3OCFA 2PTQA 1U15A 1GK3A 3KDYA 2VD6A 3TV2A 4MX2A 1GK2A 1K62A 1TJ7A 2RJSA 3KDZA 2PTSA 3GTDA 1FURA 4NSLA 2RJRA 3C8TA 2O7DA 1U16A 1YFMA 2NYFA 3RRPA 1DCNA 4FFXA 4C5RA 1DOFA 4BAAA 1T6PA 3R6QA 1TJUA 1FUPA 1KQ7A 1C3UA 1B8FA 1EB4A 2O7EA 3RD8A 2J91A 4V2QA 5HW2A 2YIIA 2O6YA 2QGAB 4ADMA 2OHYA 4APAA 4FLCA 1JSWA 2E9FA 1Y2MA 4APBA 4C6GA 1XWOA 4V2RA 2PTRA 5D6BA 4NLEA 1Q5NA 1TJVA 3BHGA 1YFEA 1YISA 3CZOA 2X75A 1GKMA 4HGVA 4BABA 5F92A 1HY0A 1K7WA 1RE5A 4EFCA 1FUQA 1TJWA 4C5UA 1GKJA 4ADLA 3GZHA 3UNVA 1AUWA 5F91A 3NO9A 3R6VA 2O7FA 1VDKA 4C5SA 1C3CA 2NYNA 2O7BA 3E04A 4CQ5A 1I0AA 2HVGA 4EEIA 1FUOA 2FUSA 2QVEA 5EYTA 1HY1A 2O78A 1J3UA
chains in the Genus database with same CATH superfamily
2FELA 1Q92A 3QBPA 2FENA 3OCEA 1T6JA 5EYVA 3NZ4A 2PFMA 3R6YA 1Z4IA 1W27A 3OCFA 2PTQA 1U15A 1XMCA 1XLYA 1GK3A 3KDYA 2VD6A 2O78A 3TV2A 3CI0K 4MX2A 1GK2A 1Z4MA 1K62A 1TJ7A 2RJSA 3KDZA 5H8WA 4E88A 1T9HA 2PTSA 4YIHA 5M0JA 3GTDA 4L6AA 3F4SA 1XL7A 1Z4LA 1FURA 4NSLA 1MH9A 4MWOA 2RJRA 2I7DA 4NFLA 3C8TA 2O7DA 1U16A 1YFMA 2NYFA 3RRPA 1DCNA 4FFXA 1Z4QA 4C5RA 1DOFA 4BAAA 2D28C 1T6PA 3R6QA 1TJUA 1FUPA 1KQ7A 1C3UA 1B8FA 1EB4A 2O7EA 3RD8A 2J91A 1XL8A 4V2QA 5HW2A 4A15A 2YIIA 2O6YA 2QGAB 4L57A 4ADMA 2OHYA 1Z4JA 4APAA 4FLCA 1JSWA 2E9FA 1Y2MA 4APBA 4C6GA 5M0IA 1XWOA 4V2RA 2D27A 2PTRA 2YV5A 5D6BA 3U19A 4NLEA 1Q5NA 1TJVA 3BHGA 1IW7D 1YFEA 1Q91A 1YISA 3CZOA 2X75A 2JAUA 1GKMA 1U0LA 3BWVA 4HGVA 4BABA 5F92A 1HY0A 1K7WA 1RE5A 4EFCA 1FUQA 1TJWA 4C5UA 1GKJA 2JAOA 4ADLA 1Z4PX 3GZHA 3F4TA 2VSFA 2JAWA 3UNVA 1AUWA 4WNLA 4MUMA 5F91A 1XMDA 3NO9A 3R6VA 4L6CA 2O7FA 2RCNA 1VDKA 4C5SA 1Z4KA 3CRVA 3U13A 1C3CA 2NYNA 4YIKA 3CRW1 2O7BA 3E04A 3F4RA 4CQ5A 1I0AA 2HVGA 4EEIA 4IQJM 1FUOA 2FUSA 2QVEA 5EYTA 2VL7A 1HY1A 2JARA 1J3UA
chains in the Genus database with same CATH topology
3QBPA 3OCEA 1T6JA 5EYVA 3NZ4A 2PFMA 3R6YA 1W27A 3OCFA 2PTQA 1U15A 1GK3A 3KDYA 2VD6A 3TV2A 4MX2A 1GK2A 1K62A 1TJ7A 2RJSA 3KDZA 2PTSA 3GTDA 1FURA 4NSLA 2RJRA 3C8TA 2O7DA 1U16A 1YFMA 2NYFA 3RRPA 1DCNA 4FFXA 4C5RA 1DOFA 4BAAA 1T6PA 3R6QA 1TJUA 1FUPA 1KQ7A 1C3UA 1B8FA 1EB4A 2O7EA 3RD8A 2J91A 4V2QA 5HW2A 2YIIA 2O6YA 2QGAB 4ADMA 2OHYA 4APAA 4FLCA 1JSWA 2E9FA 1Y2MA 4APBA 4C6GA 1XWOA 4V2RA 2PTRA 5D6BA 4NLEA 1Q5NA 1TJVA 3BHGA 1YFEA 1YISA 3CZOA 2X75A 1GKMA 4HGVA 4BABA 5F92A 1HY0A 1K7WA 1RE5A 4EFCA 1FUQA 1TJWA 4C5UA 1GKJA 4ADLA 3GZHA 3UNVA 1AUWA 5F91A 3NO9A 3R6VA 2O7FA 1VDKA 4C5SA 1C3CA 2NYNA 2O7BA 3E04A 4CQ5A 1I0AA 2HVGA 4EEIA 1FUOA 2FUSA 2QVEA 5EYTA 1HY1A 2O78A 1J3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QBP A;  3OCE A;  1T6J A;  5EYV A;  3NZ4 A;  2PFM A;  3R6Y A;  1W27 A;  3OCF A;  2PTQ A;  1U15 A;  1GK3 A;  3KDY A;  2VD6 A;  3TV2 A;  4MX2 A;  1GK2 A;  1K62 A;  1TJ7 A;  2RJS A;  3KDZ A;  2PTS A;  3GTD A;  1FUR A;  4NSL A;  2RJR A;  3C8T A;  2O7D A;  1U16 A;  1YFM A;  2NYF A;  3RRP A;  1DCN A;  4FFX A;  4C5R A;  1DOF A;  4BAA A;  1T6P A;  3R6Q A;  1TJU A;  1FUP A;  1KQ7 A;  1C3U A;  1B8F A;  1EB4 A;  2O7E A;  3RD8 A;  2J91 A;  4V2Q A;  5HW2 A;  2YII A;  2O6Y A;  2QGA B;  4ADM A;  2OHY A;  4APA A;  4FLC A;  1JSW A;  2E9F A;  1Y2M A;  4APB A;  4C6G A;  1XWO A;  4V2R A;  2PTR A;  5D6B A;  4NLE A;  1Q5N A;  1TJV A;  3BHG A;  1YFE A;  1YIS A;  3CZO A;  2X75 A;  1GKM A;  4HGV A;  4BAB A;  5F92 A;  1HY0 A;  1K7W A;  1RE5 A;  4EFC A;  1FUQ A;  1TJW A;  4C5U A;  1GKJ A;  4ADL A;  3GZH A;  3UNV A;  1AUW A;  5F91 A;  3NO9 A;  3R6V A;  2O7F A;  1VDK A;  4C5S A;  1C3C A;  2NYN A;  2O7B A;  3E04 A;  4CQ5 A;  1I0A A;  2HVG A;  4EEI A;  1FUO A;  2FUS A;  2QVE A;  5EYT A;  1HY1 A;  2O78 A;  1J3U A; 
#chains in the Genus database with same CATH topology
 2FEL A;  1Q92 A;  3QBP A;  2FEN A;  3OCE A;  1T6J A;  5EYV A;  3NZ4 A;  2PFM A;  3R6Y A;  1Z4I A;  1W27 A;  3OCF A;  2PTQ A;  1U15 A;  1XMC A;  1XLY A;  1GK3 A;  3KDY A;  2VD6 A;  2O78 A;  3TV2 A;  3CI0 K;  4MX2 A;  1GK2 A;  1Z4M A;  1K62 A;  1TJ7 A;  2RJS A;  3KDZ A;  5H8W A;  4E88 A;  1T9H A;  2PTS A;  4YIH A;  5M0J A;  3GTD A;  4L6A A;  3F4S A;  1XL7 A;  1Z4L A;  1FUR A;  4NSL A;  1MH9 A;  4MWO A;  2RJR A;  2I7D A;  4NFL A;  3C8T A;  2O7D A;  1U16 A;  1YFM A;  2NYF A;  3RRP A;  1DCN A;  4FFX A;  1Z4Q A;  4C5R A;  1DOF A;  4BAA A;  2D28 C;  1T6P A;  3R6Q A;  1TJU A;  1FUP A;  1KQ7 A;  1C3U A;  1B8F A;  1EB4 A;  2O7E A;  3RD8 A;  2J91 A;  1XL8 A;  4V2Q A;  5HW2 A;  4A15 A;  2YII A;  2O6Y A;  2QGA B;  4L57 A;  4ADM A;  2OHY A;  1Z4J A;  4APA A;  4FLC A;  1JSW A;  2E9F A;  1Y2M A;  4APB A;  4C6G A;  5M0I A;  1XWO A;  4V2R A;  2D27 A;  2PTR A;  2YV5 A;  5D6B A;  3U19 A;  4NLE A;  1Q5N A;  1TJV A;  3BHG A;  1IW7 D;  1YFE A;  1Q91 A;  1YIS A;  3CZO A;  2X75 A;  2JAU A;  1GKM A;  1U0L A;  3BWV A;  4HGV A;  4BAB A;  5F92 A;  1HY0 A;  1K7W A;  1RE5 A;  4EFC A;  1FUQ A;  1TJW A;  4C5U A;  1GKJ A;  2JAO A;  4ADL A;  1Z4P X;  3GZH A;  3F4T A;  2VSF A;  2JAW A;  3UNV A;  1AUW A;  4WNL A;  4MUM A;  5F91 A;  1XMD A;  3NO9 A;  3R6V A;  4L6C A;  2O7F A;  2RCN A;  1VDK A;  4C5S A;  1Z4K A;  3CRV A;  3U13 A;  1C3C A;  2NYN A;  4YIK A;  3CRW 1;  2O7B A;  3E04 A;  3F4R A;  4CQ5 A;  1I0A A;  2HVG A;  4EEI A;  4IQJ M;  1FUO A;  2FUS A;  2QVE A;  5EYT A;  2VL7 A;  1HY1 A;  2JAR A;  1J3U A; 
#chains in the Genus database with same CATH homology
 3QBP A;  3OCE A;  1T6J A;  5EYV A;  3NZ4 A;  2PFM A;  3R6Y A;  1W27 A;  3OCF A;  2PTQ A;  1U15 A;  1GK3 A;  3KDY A;  2VD6 A;  3TV2 A;  4MX2 A;  1GK2 A;  1K62 A;  1TJ7 A;  2RJS A;  3KDZ A;  2PTS A;  3GTD A;  1FUR A;  4NSL A;  2RJR A;  3C8T A;  2O7D A;  1U16 A;  1YFM A;  2NYF A;  3RRP A;  1DCN A;  4FFX A;  4C5R A;  1DOF A;  4BAA A;  1T6P A;  3R6Q A;  1TJU A;  1FUP A;  1KQ7 A;  1C3U A;  1B8F A;  1EB4 A;  2O7E A;  3RD8 A;  2J91 A;  4V2Q A;  5HW2 A;  2YII A;  2O6Y A;  2QGA B;  4ADM A;  2OHY A;  4APA A;  4FLC A;  1JSW A;  2E9F A;  1Y2M A;  4APB A;  4C6G A;  1XWO A;  4V2R A;  2PTR A;  5D6B A;  4NLE A;  1Q5N A;  1TJV A;  3BHG A;  1YFE A;  1YIS A;  3CZO A;  2X75 A;  1GKM A;  4HGV A;  4BAB A;  5F92 A;  1HY0 A;  1K7W A;  1RE5 A;  4EFC A;  1FUQ A;  1TJW A;  4C5U A;  1GKJ A;  4ADL A;  3GZH A;  3UNV A;  1AUW A;  5F91 A;  3NO9 A;  3R6V A;  2O7F A;  1VDK A;  4C5S A;  1C3C A;  2NYN A;  2O7B A;  3E04 A;  4CQ5 A;  1I0A A;  2HVG A;  4EEI A;  1FUO A;  2FUS A;  2QVE A;  5EYT A;  1HY1 A;  2O78 A;  1J3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...