1TJWA

Crystal structure of t161d duck delta 2 crystallin mutant with bound argininosuccinate
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
449
structure length
449
Chain Sequence
b'TDPIMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLEKISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQLIKTLVERAAIEIDVILPGYDHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNPLDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFSTGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALTPEMLATDLALYLVRKGVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSISPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRELMKKQKEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Delta crystallin II
publication title Structural studies of duck delta2 crystallin mutants provide insight into the role of Thr161 and the 280s loop in catalysis
pubmed doi rcsb
source organism Anas platyrhynchos
molecule tags Lyase
total genus 182
structure length 449
sequence length 449
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.1: Argininosuccinate lyase.
pdb deposition date 2004-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF14698 ASL_C2 Argininosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 1tjwA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 1tjwA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 1tjwA02
2QGAB 1DCNA 1TJWA 1HY0A 1TJVA 4APBA 1YFEA 1W27A 2PTSA 1B8FA 4FFXA 3E04A 2O6YA 3R6QA 2NYFA 4ADMA 3QBPA 1C3CA 4CQ5A 1Q5NA 2RJRA 2QVEA 2HVGA 5EYTA 2J91A 1FUQA 4FLCA 4NSLA 1TJ7A 1RE5A 3RD8A 2PFMA 1FUOA 4ADLA 2PTRA 4C5UA 5EYVA 4EFCA 1AUWA 3R6YA 2FUSA 4NLEA 4MX2A 2O7FA 3C8TA 3TV2A 1YFMA 1GK3A 2YIIA 3NZ4A 1K62A 3RRPA 1T6PA 1EB4A 2OHYA 3UNVA 3OCEA 5HW2A 4HGVA 4BAAA 1TJUA 5D6BA 2E9FA 3OCFA 1YISA 4C5RA 3KDYA 1U16A 4C5SA 1I0AA 1GK2A 2PTQA 3R6VA 3KDZA 2RJSA 3NO9A 4V2QA 3BHGA 1HY1A 5F92A 1U15A 3GTDA 3GZHA 4V2RA 1GKJA 1GKMA 1VDKA 1JSWA 1Y2MA 2X75A 4APAA 1J3UA 1DOFA 1XWOA 2O7EA 1FUPA 2O7DA 1K7WA 2O7BA 1FURA 4EEIA 1C3UA 5F91A 1KQ7A 1T6JA 2O78A 2NYNA 4BABA 2VD6A 3CZOA 4C6GA
chains in the Genus database with same CATH superfamily
2QGAB 4WNLA 1IW7D 1DCNA 1TJWA 4BABA 1HY0A 1TJVA 3F4RA 4APBA 1XL8A 1YFEA 1W27A 2RCNA 2PTSA 4E88A 1B8FA 1Z4IA 4FFXA 3E04A 2O6YA 3R6QA 2NYFA 3BWVA 4ADMA 3QBPA 1C3CA 5M0JA 2FELA 3F4TA 1XL7A 4CQ5A 1Z4PX 4A15A 1Q5NA 3CRVA 5H8WA 4YIKA 1Q91A 1Z4LA 2RJRA 4NFLA 4YIHA 2QVEA 2HVGA 5M0IA 1Z4QA 3U13A 5EYTA 2J91A 1FUQA 4FLCA 1Z4JA 4NSLA 1TJ7A 4IQJM 1RE5A 3RD8A 2PFMA 1FUOA 2JAWA 4ADLA 2PTRA 4C5UA 5EYVA 4EFCA 1AUWA 2D27A 3R6YA 2FUSA 4NLEA 4L6CA 4MX2A 2O7FA 3C8TA 3TV2A 1YFMA 3U19A 1GK3A 2YIIA 3NZ4A 1K62A 3RRPA 1T6PA 1EB4A 2OHYA 3UNVA 3OCEA 2I7DA 5HW2A 1U0LA 2JAOA 4HGVA 4BAAA 1TJUA 5D6BA 2E9FA 3OCFA 3CRW1 1Z4MA 1YISA 4C5RA 2JAUA 4L6AA 2FENA 1T9HA 3KDYA 1U16A 2VSFA 4C5SA 1I0AA 1GK2A 2PTQA 3F4SA 2D28C 3R6VA 3KDZA 2RJSA 3NO9A 4V2QA 3BHGA 1HY1A 5F92A 1U15A 4MWOA 4MUMA 2YV5A 3GTDA 3GZHA 4V2RA 1GKJA 1GKMA 1VDKA 1XLYA 1JSWA 1Y2MA 2X75A 4L57A 4APAA 2JARA 1MH9A 1J3UA 1DOFA 1XWOA 3CI0K 2O7EA 1FUPA 1Z4KA 2O7DA 1K7WA 2O7BA 1FURA 2VL7A 1Q92A 4EEIA 1C3UA 5F91A 1KQ7A 1T6JA 2O78A 2NYNA 1XMCA 2VD6A 1XMDA 3CZOA 4C6GA
chains in the Genus database with same CATH topology
2QGAB 1DCNA 1TJWA 1HY0A 1TJVA 4APBA 1YFEA 1W27A 2PTSA 1B8FA 4FFXA 3E04A 2O6YA 3R6QA 2NYFA 4ADMA 3QBPA 1C3CA 4CQ5A 1Q5NA 2RJRA 2QVEA 2HVGA 5EYTA 2J91A 1FUQA 4FLCA 4NSLA 1TJ7A 1RE5A 3RD8A 2PFMA 1FUOA 4ADLA 2PTRA 4C5UA 5EYVA 4EFCA 1AUWA 3R6YA 2FUSA 4NLEA 4MX2A 2O7FA 3C8TA 3TV2A 1YFMA 1GK3A 2YIIA 3NZ4A 1K62A 3RRPA 1T6PA 1EB4A 2OHYA 3UNVA 3OCEA 5HW2A 4HGVA 4BAAA 1TJUA 5D6BA 2E9FA 3OCFA 1YISA 4C5RA 3KDYA 1U16A 4C5SA 1I0AA 1GK2A 2PTQA 3R6VA 3KDZA 2RJSA 3NO9A 4V2QA 3BHGA 1HY1A 5F92A 1U15A 3GTDA 3GZHA 4V2RA 1GKJA 1GKMA 1VDKA 1JSWA 1Y2MA 2X75A 4APAA 1J3UA 1DOFA 1XWOA 2O7EA 1FUPA 2O7DA 1K7WA 2O7BA 1FURA 4EEIA 1C3UA 5F91A 1KQ7A 1T6JA 2O78A 2NYNA 4BABA 2VD6A 3CZOA 4C6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QGA B;  1DCN A;  1TJW A;  1HY0 A;  1TJV A;  4APB A;  1YFE A;  1W27 A;  2PTS A;  1B8F A;  4FFX A;  3E04 A;  2O6Y A;  3R6Q A;  2NYF A;  4ADM A;  3QBP A;  1C3C A;  4CQ5 A;  1Q5N A;  2RJR A;  2QVE A;  2HVG A;  5EYT A;  2J91 A;  1FUQ A;  4FLC A;  4NSL A;  1TJ7 A;  1RE5 A;  3RD8 A;  2PFM A;  1FUO A;  4ADL A;  2PTR A;  4C5U A;  5EYV A;  4EFC A;  1AUW A;  3R6Y A;  2FUS A;  4NLE A;  4MX2 A;  2O7F A;  3C8T A;  3TV2 A;  1YFM A;  1GK3 A;  2YII A;  3NZ4 A;  1K62 A;  3RRP A;  1T6P A;  1EB4 A;  2OHY A;  3UNV A;  3OCE A;  5HW2 A;  4HGV A;  4BAA A;  1TJU A;  5D6B A;  2E9F A;  3OCF A;  1YIS A;  4C5R A;  3KDY A;  1U16 A;  4C5S A;  1I0A A;  1GK2 A;  2PTQ A;  3R6V A;  3KDZ A;  2RJS A;  3NO9 A;  4V2Q A;  3BHG A;  1HY1 A;  5F92 A;  1U15 A;  3GTD A;  3GZH A;  4V2R A;  1GKJ A;  1GKM A;  1VDK A;  1JSW A;  1Y2M A;  2X75 A;  4APA A;  1J3U A;  1DOF A;  1XWO A;  2O7E A;  1FUP A;  2O7D A;  1K7W A;  2O7B A;  1FUR A;  4EEI A;  1C3U A;  5F91 A;  1KQ7 A;  1T6J A;  2O78 A;  2NYN A;  4BAB A;  2VD6 A;  3CZO A;  4C6G A; 
#chains in the Genus database with same CATH topology
 2QGA B;  4WNL A;  1IW7 D;  1DCN A;  1TJW A;  4BAB A;  1HY0 A;  1TJV A;  3F4R A;  4APB A;  1XL8 A;  1YFE A;  1W27 A;  2RCN A;  2PTS A;  4E88 A;  1B8F A;  1Z4I A;  4FFX A;  3E04 A;  2O6Y A;  3R6Q A;  2NYF A;  3BWV A;  4ADM A;  3QBP A;  1C3C A;  5M0J A;  2FEL A;  3F4T A;  1XL7 A;  4CQ5 A;  1Z4P X;  4A15 A;  1Q5N A;  3CRV A;  5H8W A;  4YIK A;  1Q91 A;  1Z4L A;  2RJR A;  4NFL A;  4YIH A;  2QVE A;  2HVG A;  5M0I A;  1Z4Q A;  3U13 A;  5EYT A;  2J91 A;  1FUQ A;  4FLC A;  1Z4J A;  4NSL A;  1TJ7 A;  4IQJ M;  1RE5 A;  3RD8 A;  2PFM A;  1FUO A;  2JAW A;  4ADL A;  2PTR A;  4C5U A;  5EYV A;  4EFC A;  1AUW A;  2D27 A;  3R6Y A;  2FUS A;  4NLE A;  4L6C A;  4MX2 A;  2O7F A;  3C8T A;  3TV2 A;  1YFM A;  3U19 A;  1GK3 A;  2YII A;  3NZ4 A;  1K62 A;  3RRP A;  1T6P A;  1EB4 A;  2OHY A;  3UNV A;  3OCE A;  2I7D A;  5HW2 A;  1U0L A;  2JAO A;  4HGV A;  4BAA A;  1TJU A;  5D6B A;  2E9F A;  3OCF A;  3CRW 1;  1Z4M A;  1YIS A;  4C5R A;  2JAU A;  4L6A A;  2FEN A;  1T9H A;  3KDY A;  1U16 A;  2VSF A;  4C5S A;  1I0A A;  1GK2 A;  2PTQ A;  3F4S A;  2D28 C;  3R6V A;  3KDZ A;  2RJS A;  3NO9 A;  4V2Q A;  3BHG A;  1HY1 A;  5F92 A;  1U15 A;  4MWO A;  4MUM A;  2YV5 A;  3GTD A;  3GZH A;  4V2R A;  1GKJ A;  1GKM A;  1VDK A;  1XLY A;  1JSW A;  1Y2M A;  2X75 A;  4L57 A;  4APA A;  2JAR A;  1MH9 A;  1J3U A;  1DOF A;  1XWO A;  3CI0 K;  2O7E A;  1FUP A;  1Z4K A;  2O7D A;  1K7W A;  2O7B A;  1FUR A;  2VL7 A;  1Q92 A;  4EEI A;  1C3U A;  5F91 A;  1KQ7 A;  1T6J A;  2O78 A;  2NYN A;  1XMC A;  2VD6 A;  1XMD A;  3CZO A;  4C6G A; 
#chains in the Genus database with same CATH homology
 2QGA B;  1DCN A;  1TJW A;  1HY0 A;  1TJV A;  4APB A;  1YFE A;  1W27 A;  2PTS A;  1B8F A;  4FFX A;  3E04 A;  2O6Y A;  3R6Q A;  2NYF A;  4ADM A;  3QBP A;  1C3C A;  4CQ5 A;  1Q5N A;  2RJR A;  2QVE A;  2HVG A;  5EYT A;  2J91 A;  1FUQ A;  4FLC A;  4NSL A;  1TJ7 A;  1RE5 A;  3RD8 A;  2PFM A;  1FUO A;  4ADL A;  2PTR A;  4C5U A;  5EYV A;  4EFC A;  1AUW A;  3R6Y A;  2FUS A;  4NLE A;  4MX2 A;  2O7F A;  3C8T A;  3TV2 A;  1YFM A;  1GK3 A;  2YII A;  3NZ4 A;  1K62 A;  3RRP A;  1T6P A;  1EB4 A;  2OHY A;  3UNV A;  3OCE A;  5HW2 A;  4HGV A;  4BAA A;  1TJU A;  5D6B A;  2E9F A;  3OCF A;  1YIS A;  4C5R A;  3KDY A;  1U16 A;  4C5S A;  1I0A A;  1GK2 A;  2PTQ A;  3R6V A;  3KDZ A;  2RJS A;  3NO9 A;  4V2Q A;  3BHG A;  1HY1 A;  5F92 A;  1U15 A;  3GTD A;  3GZH A;  4V2R A;  1GKJ A;  1GKM A;  1VDK A;  1JSW A;  1Y2M A;  2X75 A;  4APA A;  1J3U A;  1DOF A;  1XWO A;  2O7E A;  1FUP A;  2O7D A;  1K7W A;  2O7B A;  1FUR A;  4EEI A;  1C3U A;  5F91 A;  1KQ7 A;  1T6J A;  2O78 A;  2NYN A;  4BAB A;  2VD6 A;  3CZO A;  4C6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...