1K62A

Crystal structure of the human argininosuccinate lyase q286r mutant
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
450
structure length
450
Chain Sequence
GAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWRSLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPRKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYRHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the argininosuccinate lyase frequently complementing allele Q286R.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Argininosuccinate Lyase
total genus 173
structure length 450
sequence length 450
chains with identical sequence B
ec nomenclature ec 4.3.2.1: Argininosuccinate lyase.
pdb deposition date 2001-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF14698 ASL_C2 Argininosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 1k62A03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 1k62A01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 1k62A02
4ADMA 3UNVA 4NLEA 2QGAB 5F92A 2O78A 2E9FA 2RJSA 2PFMA 1K7WA 1U16A 1DOFA 2O7DA 3R6QA 3QBPA 1GKJA 4C5UA 4HGVA 4EFCA 1YISA 2NYNA 1T6JA 1T6PA 3E04A 4FLCA 1FURA 1B8FA 1DCNA 1K62A 2NYFA 1GK3A 1FUPA 4MX2A 2PTRA 5F91A 1AUWA 1TJWA 3R6VA 1GK2A 4EEIA 1YFMA 3TV2A 1KQ7A 4ADLA 1GKMA 4C5RA 4APAA 3KDZA 3BHGA 2O7EA 2VD6A 5HW2A 3RRPA 1C3UA 1HY0A 4V2QA 3CZOA 1TJ7A 3GTDA 1TJVA 4APBA 2OHYA 3KDYA 2HVGA 4BAAA 2X75A 1Q5NA 1J3UA 2YIIA 2PTSA 3OCFA 1FUOA 3RD8A 2O7FA 4C6GA 1TJUA 1VDKA 2O7BA 3OCEA 2FUSA 3NO9A 2RJRA 3NZ4A 1EB4A 1FUQA 1HY1A 3R6YA 5D6BA 1U15A 4C5SA 4V2RA 4FFXA 5EYTA 2PTQA 1YFEA 3C8TA 1XWOA 2J91A 1Y2MA 4NSLA 4BABA 4CQ5A 1RE5A 1W27A 2O6YA 5EYVA 2QVEA 1I0AA 1JSWA 3GZHA 1C3CA
chains in the Genus database with same CATH superfamily
4ADMA 4YIHA 2D28C 3UNVA 4NLEA 2D27A 1T9HA 4NFLA 2QGAB 1XL7A 5F92A 2O78A 2E9FA 2RJSA 2PFMA 2VSFA 1Z4MA 2JARA 1K7WA 1U16A 1DOFA 1IW7D 4L6AA 2O7DA 3R6QA 3QBPA 1GKJA 4C5UA 4HGVA 1Z4LA 4EFCA 1YISA 2FENA 2NYNA 1T6JA 1T6PA 1XL8A 3E04A 4FLCA 1Z4JA 2JAUA 1FURA 1B8FA 1Q91A 1DCNA 1K62A 1MH9A 2NYFA 4MWOA 1GK3A 1FUPA 4MX2A 4L6CA 2PTRA 5F91A 1AUWA 1TJWA 3R6VA 1GK2A 4EEIA 1YFMA 3TV2A 4WNLA 1KQ7A 4ADLA 1GKMA 3CRW1 4C5RA 4APAA 4MUMA 3KDZA 3BHGA 2O7EA 2VD6A 5HW2A 3RRPA 1C3UA 4YIKA 1HY0A 4V2QA 3CZOA 1TJ7A 1U0LA 3GTDA 2VL7A 1TJVA 4APBA 1Z4IA 2OHYA 3KDYA 4E88A 2HVGA 2I7DA 2X75A 3U13A 1Q5NA 4BAAA 2JAOA 1J3UA 2YIIA 3F4RA 2FELA 2PTSA 3CI0K 3U19A 3OCFA 1FUOA 1Z4QA 3RD8A 1Z4KA 2YV5A 2O7FA 2JAWA 4C6GA 1XMCA 5M0IA 1TJUA 1VDKA 2O7BA 3OCEA 3CRVA 2FUSA 3BWVA 3NO9A 2RJRA 3NZ4A 1EB4A 1FUQA 1HY1A 3R6YA 5D6BA 1U15A 4C5SA 3F4TA 1Q92A 2RCNA 4V2RA 4FFXA 5M0JA 4L57A 5EYTA 2PTQA 1YFEA 3C8TA 1XWOA 4IQJM 1XMDA 2J91A 1Y2MA 4NSLA 4BABA 4CQ5A 1RE5A 1W27A 1XLYA 1Z4PX 2O6YA 5EYVA 2QVEA 4A15A 1I0AA 1JSWA 5H8WA 3GZHA 3F4SA 1C3CA
chains in the Genus database with same CATH topology
4ADMA 3UNVA 4NLEA 2QGAB 5F92A 2O78A 2E9FA 2RJSA 2PFMA 1K7WA 1U16A 1DOFA 2O7DA 3R6QA 3QBPA 1GKJA 4C5UA 4HGVA 4EFCA 1YISA 2NYNA 1T6JA 1T6PA 3E04A 4FLCA 1FURA 1B8FA 1DCNA 1K62A 2NYFA 1GK3A 1FUPA 4MX2A 2PTRA 5F91A 1AUWA 1TJWA 3R6VA 1GK2A 4EEIA 1YFMA 3TV2A 1KQ7A 4ADLA 1GKMA 4C5RA 4APAA 3KDZA 3BHGA 2O7EA 2VD6A 5HW2A 3RRPA 1C3UA 1HY0A 4V2QA 3CZOA 1TJ7A 3GTDA 1TJVA 4APBA 2OHYA 3KDYA 2HVGA 4BAAA 2X75A 1Q5NA 1J3UA 2YIIA 2PTSA 3OCFA 1FUOA 3RD8A 2O7FA 4C6GA 1TJUA 1VDKA 2O7BA 3OCEA 2FUSA 3NO9A 2RJRA 3NZ4A 1EB4A 1FUQA 1HY1A 3R6YA 5D6BA 1U15A 4C5SA 4V2RA 4FFXA 5EYTA 2PTQA 1YFEA 3C8TA 1XWOA 2J91A 1Y2MA 4NSLA 4BABA 4CQ5A 1RE5A 1W27A 2O6YA 5EYVA 2QVEA 1I0AA 1JSWA 3GZHA 1C3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ADM A;  3UNV A;  4NLE A;  2QGA B;  5F92 A;  2O78 A;  2E9F A;  2RJS A;  2PFM A;  1K7W A;  1U16 A;  1DOF A;  2O7D A;  3R6Q A;  3QBP A;  1GKJ A;  4C5U A;  4HGV A;  4EFC A;  1YIS A;  2NYN A;  1T6J A;  1T6P A;  3E04 A;  4FLC A;  1FUR A;  1B8F A;  1DCN A;  1K62 A;  2NYF A;  1GK3 A;  1FUP A;  4MX2 A;  2PTR A;  5F91 A;  1AUW A;  1TJW A;  3R6V A;  1GK2 A;  4EEI A;  1YFM A;  3TV2 A;  1KQ7 A;  4ADL A;  1GKM A;  4C5R A;  4APA A;  3KDZ A;  3BHG A;  2O7E A;  2VD6 A;  5HW2 A;  3RRP A;  1C3U A;  1HY0 A;  4V2Q A;  3CZO A;  1TJ7 A;  3GTD A;  1TJV A;  4APB A;  2OHY A;  3KDY A;  2HVG A;  4BAA A;  2X75 A;  1Q5N A;  1J3U A;  2YII A;  2PTS A;  3OCF A;  1FUO A;  3RD8 A;  2O7F A;  4C6G A;  1TJU A;  1VDK A;  2O7B A;  3OCE A;  2FUS A;  3NO9 A;  2RJR A;  3NZ4 A;  1EB4 A;  1FUQ A;  1HY1 A;  3R6Y A;  5D6B A;  1U15 A;  4C5S A;  4V2R A;  4FFX A;  5EYT A;  2PTQ A;  1YFE A;  3C8T A;  1XWO A;  2J91 A;  1Y2M A;  4NSL A;  4BAB A;  4CQ5 A;  1RE5 A;  1W27 A;  2O6Y A;  5EYV A;  2QVE A;  1I0A A;  1JSW A;  3GZH A;  1C3C A; 
#chains in the Genus database with same CATH topology
 4ADM A;  4YIH A;  2D28 C;  3UNV A;  4NLE A;  2D27 A;  1T9H A;  4NFL A;  2QGA B;  1XL7 A;  5F92 A;  2O78 A;  2E9F A;  2RJS A;  2PFM A;  2VSF A;  1Z4M A;  2JAR A;  1K7W A;  1U16 A;  1DOF A;  1IW7 D;  4L6A A;  2O7D A;  3R6Q A;  3QBP A;  1GKJ A;  4C5U A;  4HGV A;  1Z4L A;  4EFC A;  1YIS A;  2FEN A;  2NYN A;  1T6J A;  1T6P A;  1XL8 A;  3E04 A;  4FLC A;  1Z4J A;  2JAU A;  1FUR A;  1B8F A;  1Q91 A;  1DCN A;  1K62 A;  1MH9 A;  2NYF A;  4MWO A;  1GK3 A;  1FUP A;  4MX2 A;  4L6C A;  2PTR A;  5F91 A;  1AUW A;  1TJW A;  3R6V A;  1GK2 A;  4EEI A;  1YFM A;  3TV2 A;  4WNL A;  1KQ7 A;  4ADL A;  1GKM A;  3CRW 1;  4C5R A;  4APA A;  4MUM A;  3KDZ A;  3BHG A;  2O7E A;  2VD6 A;  5HW2 A;  3RRP A;  1C3U A;  4YIK A;  1HY0 A;  4V2Q A;  3CZO A;  1TJ7 A;  1U0L A;  3GTD A;  2VL7 A;  1TJV A;  4APB A;  1Z4I A;  2OHY A;  3KDY A;  4E88 A;  2HVG A;  2I7D A;  2X75 A;  3U13 A;  1Q5N A;  4BAA A;  2JAO A;  1J3U A;  2YII A;  3F4R A;  2FEL A;  2PTS A;  3CI0 K;  3U19 A;  3OCF A;  1FUO A;  1Z4Q A;  3RD8 A;  1Z4K A;  2YV5 A;  2O7F A;  2JAW A;  4C6G A;  1XMC A;  5M0I A;  1TJU A;  1VDK A;  2O7B A;  3OCE A;  3CRV A;  2FUS A;  3BWV A;  3NO9 A;  2RJR A;  3NZ4 A;  1EB4 A;  1FUQ A;  1HY1 A;  3R6Y A;  5D6B A;  1U15 A;  4C5S A;  3F4T A;  1Q92 A;  2RCN A;  4V2R A;  4FFX A;  5M0J A;  4L57 A;  5EYT A;  2PTQ A;  1YFE A;  3C8T A;  1XWO A;  4IQJ M;  1XMD A;  2J91 A;  1Y2M A;  4NSL A;  4BAB A;  4CQ5 A;  1RE5 A;  1W27 A;  1XLY A;  1Z4P X;  2O6Y A;  5EYV A;  2QVE A;  4A15 A;  1I0A A;  1JSW A;  5H8W A;  3GZH A;  3F4S A;  1C3C A; 
#chains in the Genus database with same CATH homology
 4ADM A;  3UNV A;  4NLE A;  2QGA B;  5F92 A;  2O78 A;  2E9F A;  2RJS A;  2PFM A;  1K7W A;  1U16 A;  1DOF A;  2O7D A;  3R6Q A;  3QBP A;  1GKJ A;  4C5U A;  4HGV A;  4EFC A;  1YIS A;  2NYN A;  1T6J A;  1T6P A;  3E04 A;  4FLC A;  1FUR A;  1B8F A;  1DCN A;  1K62 A;  2NYF A;  1GK3 A;  1FUP A;  4MX2 A;  2PTR A;  5F91 A;  1AUW A;  1TJW A;  3R6V A;  1GK2 A;  4EEI A;  1YFM A;  3TV2 A;  1KQ7 A;  4ADL A;  1GKM A;  4C5R A;  4APA A;  3KDZ A;  3BHG A;  2O7E A;  2VD6 A;  5HW2 A;  3RRP A;  1C3U A;  1HY0 A;  4V2Q A;  3CZO A;  1TJ7 A;  3GTD A;  1TJV A;  4APB A;  2OHY A;  3KDY A;  2HVG A;  4BAA A;  2X75 A;  1Q5N A;  1J3U A;  2YII A;  2PTS A;  3OCF A;  1FUO A;  3RD8 A;  2O7F A;  4C6G A;  1TJU A;  1VDK A;  2O7B A;  3OCE A;  2FUS A;  3NO9 A;  2RJR A;  3NZ4 A;  1EB4 A;  1FUQ A;  1HY1 A;  3R6Y A;  5D6B A;  1U15 A;  4C5S A;  4V2R A;  4FFX A;  5EYT A;  2PTQ A;  1YFE A;  3C8T A;  1XWO A;  2J91 A;  1Y2M A;  4NSL A;  4BAB A;  4CQ5 A;  1RE5 A;  1W27 A;  2O6Y A;  5EYV A;  2QVE A;  1I0A A;  1JSW A;  3GZH A;  1C3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...