1K62A

Crystal structure of the human argininosuccinate lyase q286r mutant
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
450
structure length
450
Chain Sequence
GAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWRSLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPRKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYRHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Argininosuccinate Lyase
publication title Three-dimensional structure of the argininosuccinate lyase frequently complementing allele Q286R.
pubmed doi rcsb
source organism Homo sapiens
total genus 173
structure length 450
sequence length 450
chains with identical sequence B
ec nomenclature ec 4.3.2.1: Argininosuccinate lyase.
pdb deposition date 2001-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF14698 ASL_C2 Argininosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 1k62A03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 1k62A01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 1k62A02
1GKMA 3RRPA 1FUPA 1DCNA 2YIIA 1T6JA 3KDYA 1EB4A 1K62A 4APAA 4V2QA 2RJRA 2PTRA 3QBPA 2J91A 5EYTA 1C3UA 1J3UA 1GKJA 3NZ4A 1TJWA 3BHGA 2FUSA 2O7EA 4FFXA 2NYNA 4MX2A 3CZOA 1W27A 1FUOA 4BAAA 2QGAB 1TJ7A 2HVGA 4EEIA 4FLCA 1U16A 5EYVA 4BABA 4APBA 4ADMA 2QVEA 1XWOA 3NO9A 2PTQA 2VD6A 2O78A 1Q5NA 3KDZA 1TJUA 4CQ5A 2O7DA 1C3CA 1DOFA 2OHYA 5F91A 2PFMA 3OCEA 3R6VA 1TJVA 1U15A 4NLEA 1YISA 5HW2A 1JSWA 1I0AA 2O7FA 3TV2A 4C5SA 4C6GA 4HGVA 3E04A 1RE5A 2O7BA 1KQ7A 2E9FA 2O6YA 3UNVA 4ADLA 1YFMA 3OCFA 2PTSA 2X75A 1YFEA 3R6QA 3GZHA 3R6YA 4C5UA 4C5RA 2RJSA 1FUQA 1HY0A 2NYFA 3GTDA 1GK2A 1B8FA 4EFCA 1VDKA 4NSLA 1GK3A 5D6BA 1K7WA 3C8TA 3RD8A 1T6PA 1FURA 1Y2MA 1AUWA 1HY1A 4V2RA 5F92A
chains in the Genus database with same CATH superfamily
1GKMA 3RRPA 1FUPA 4MUMA 1DCNA 2YIIA 1T6JA 3KDYA 1EB4A 1T9HA 1K62A 4APAA 4V2QA 2RJRA 2PTRA 3F4SA 3QBPA 2J91A 5EYTA 4IQJM 2RCNA 1C3UA 1J3UA 1GKJA 3NZ4A 1TJWA 3BHGA 2FUSA 2O7EA 4FFXA 1HY1A 2NYNA 3F4TA 2JAWA 4MX2A 4L6AA 3CZOA 1W27A 1FUOA 1XL8A 2QGAB 1TJ7A 4BAAA 2HVGA 1Z4LA 4EEIA 4FLCA 1U16A 5EYVA 4BABA 4YIHA 4APBA 4ADMA 2QVEA 2I7DA 4YIKA 2VSFA 1XWOA 3NO9A 2D27A 5M0IA 3U13A 1XMCA 2PTQA 2VD6A 2O78A 4L57A 2FENA 1Q5NA 3KDZA 4WNLA 1TJUA 4NFLA 1U0LA 1IW7D 4CQ5A 2O7DA 1C3CA 1DOFA 2OHYA 5F91A 2PFMA 1Q92A 3U19A 3OCEA 3R6VA 1TJVA 3BWVA 1U15A 4NLEA 1YISA 5HW2A 1JSWA 1I0AA 4L6CA 2O7FA 2JARA 5M0JA 3TV2A 4C5SA 1Q91A 4C6GA 4HGVA 3E04A 2FELA 1MH9A 1RE5A 2O7BA 1Z4JA 1KQ7A 2E9FA 2JAOA 2O6YA 1Z4KA 2YV5A 3UNVA 4ADLA 1XMDA 1YFMA 2VL7A 3OCFA 4E88A 2PTSA 2X75A 1YFEA 3R6QA 3GZHA 3R6YA 1Z4IA 4C5UA 4C5RA 1XL7A 4MWOA 2RJSA 1Z4QA 5H8WA 1FUQA 1HY0A 2NYFA 3GTDA 1GK2A 3CI0K 3CRVA 1XLYA 1B8FA 4A15A 4EFCA 1VDKA 2JAUA 4NSLA 1GK3A 3F4RA 1K7WA 2D28C 3C8TA 5D6BA 3RD8A 1T6PA 1FURA 3CRW1 1Y2MA 1AUWA 1Z4MA 1Z4PX 4V2RA 5F92A
chains in the Genus database with same CATH topology
1GKMA 3RRPA 1FUPA 1DCNA 2YIIA 1T6JA 3KDYA 1EB4A 1K62A 4APAA 4V2QA 2RJRA 2PTRA 3QBPA 2J91A 5EYTA 1C3UA 1J3UA 1GKJA 3NZ4A 1TJWA 3BHGA 2FUSA 2O7EA 4FFXA 2NYNA 4MX2A 3CZOA 1W27A 1FUOA 4BAAA 2QGAB 1TJ7A 2HVGA 4EEIA 4FLCA 1U16A 5EYVA 4BABA 4APBA 4ADMA 2QVEA 1XWOA 3NO9A 2PTQA 2VD6A 2O78A 1Q5NA 3KDZA 1TJUA 4CQ5A 2O7DA 1C3CA 1DOFA 2OHYA 5F91A 2PFMA 3OCEA 3R6VA 1TJVA 1U15A 4NLEA 1YISA 5HW2A 1JSWA 1I0AA 2O7FA 3TV2A 4C5SA 4C6GA 4HGVA 3E04A 1RE5A 2O7BA 1KQ7A 2E9FA 2O6YA 3UNVA 4ADLA 1YFMA 3OCFA 2PTSA 2X75A 1YFEA 3R6QA 3GZHA 3R6YA 4C5UA 4C5RA 2RJSA 1FUQA 1HY0A 2NYFA 3GTDA 1GK2A 1B8FA 4EFCA 1VDKA 4NSLA 1GK3A 5D6BA 1K7WA 3C8TA 3RD8A 1T6PA 1FURA 1Y2MA 1AUWA 1HY1A 4V2RA 5F92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GKM A;  3RRP A;  1FUP A;  1DCN A;  2YII A;  1T6J A;  3KDY A;  1EB4 A;  1K62 A;  4APA A;  4V2Q A;  2RJR A;  2PTR A;  3QBP A;  2J91 A;  5EYT A;  1C3U A;  1J3U A;  1GKJ A;  3NZ4 A;  1TJW A;  3BHG A;  2FUS A;  2O7E A;  4FFX A;  2NYN A;  4MX2 A;  3CZO A;  1W27 A;  1FUO A;  4BAA A;  2QGA B;  1TJ7 A;  2HVG A;  4EEI A;  4FLC A;  1U16 A;  5EYV A;  4BAB A;  4APB A;  4ADM A;  2QVE A;  1XWO A;  3NO9 A;  2PTQ A;  2VD6 A;  2O78 A;  1Q5N A;  3KDZ A;  1TJU A;  4CQ5 A;  2O7D A;  1C3C A;  1DOF A;  2OHY A;  5F91 A;  2PFM A;  3OCE A;  3R6V A;  1TJV A;  1U15 A;  4NLE A;  1YIS A;  5HW2 A;  1JSW A;  1I0A A;  2O7F A;  3TV2 A;  4C5S A;  4C6G A;  4HGV A;  3E04 A;  1RE5 A;  2O7B A;  1KQ7 A;  2E9F A;  2O6Y A;  3UNV A;  4ADL A;  1YFM A;  3OCF A;  2PTS A;  2X75 A;  1YFE A;  3R6Q A;  3GZH A;  3R6Y A;  4C5U A;  4C5R A;  2RJS A;  1FUQ A;  1HY0 A;  2NYF A;  3GTD A;  1GK2 A;  1B8F A;  4EFC A;  1VDK A;  4NSL A;  1GK3 A;  5D6B A;  1K7W A;  3C8T A;  3RD8 A;  1T6P A;  1FUR A;  1Y2M A;  1AUW A;  1HY1 A;  4V2R A;  5F92 A; 
#chains in the Genus database with same CATH topology
 1GKM A;  3RRP A;  1FUP A;  4MUM A;  1DCN A;  2YII A;  1T6J A;  3KDY A;  1EB4 A;  1T9H A;  1K62 A;  4APA A;  4V2Q A;  2RJR A;  2PTR A;  3F4S A;  3QBP A;  2J91 A;  5EYT A;  4IQJ M;  2RCN A;  1C3U A;  1J3U A;  1GKJ A;  3NZ4 A;  1TJW A;  3BHG A;  2FUS A;  2O7E A;  4FFX A;  1HY1 A;  2NYN A;  3F4T A;  2JAW A;  4MX2 A;  4L6A A;  3CZO A;  1W27 A;  1FUO A;  1XL8 A;  2QGA B;  1TJ7 A;  4BAA A;  2HVG A;  1Z4L A;  4EEI A;  4FLC A;  1U16 A;  5EYV A;  4BAB A;  4YIH A;  4APB A;  4ADM A;  2QVE A;  2I7D A;  4YIK A;  2VSF A;  1XWO A;  3NO9 A;  2D27 A;  5M0I A;  3U13 A;  1XMC A;  2PTQ A;  2VD6 A;  2O78 A;  4L57 A;  2FEN A;  1Q5N A;  3KDZ A;  4WNL A;  1TJU A;  4NFL A;  1U0L A;  1IW7 D;  4CQ5 A;  2O7D A;  1C3C A;  1DOF A;  2OHY A;  5F91 A;  2PFM A;  1Q92 A;  3U19 A;  3OCE A;  3R6V A;  1TJV A;  3BWV A;  1U15 A;  4NLE A;  1YIS A;  5HW2 A;  1JSW A;  1I0A A;  4L6C A;  2O7F A;  2JAR A;  5M0J A;  3TV2 A;  4C5S A;  1Q91 A;  4C6G A;  4HGV A;  3E04 A;  2FEL A;  1MH9 A;  1RE5 A;  2O7B A;  1Z4J A;  1KQ7 A;  2E9F A;  2JAO A;  2O6Y A;  1Z4K A;  2YV5 A;  3UNV A;  4ADL A;  1XMD A;  1YFM A;  2VL7 A;  3OCF A;  4E88 A;  2PTS A;  2X75 A;  1YFE A;  3R6Q A;  3GZH A;  3R6Y A;  1Z4I A;  4C5U A;  4C5R A;  1XL7 A;  4MWO A;  2RJS A;  1Z4Q A;  5H8W A;  1FUQ A;  1HY0 A;  2NYF A;  3GTD A;  1GK2 A;  3CI0 K;  3CRV A;  1XLY A;  1B8F A;  4A15 A;  4EFC A;  1VDK A;  2JAU A;  4NSL A;  1GK3 A;  3F4R A;  1K7W A;  2D28 C;  3C8T A;  5D6B A;  3RD8 A;  1T6P A;  1FUR A;  3CRW 1;  1Y2M A;  1AUW A;  1Z4M A;  1Z4P X;  4V2R A;  5F92 A; 
#chains in the Genus database with same CATH homology
 1GKM A;  3RRP A;  1FUP A;  1DCN A;  2YII A;  1T6J A;  3KDY A;  1EB4 A;  1K62 A;  4APA A;  4V2Q A;  2RJR A;  2PTR A;  3QBP A;  2J91 A;  5EYT A;  1C3U A;  1J3U A;  1GKJ A;  3NZ4 A;  1TJW A;  3BHG A;  2FUS A;  2O7E A;  4FFX A;  2NYN A;  4MX2 A;  3CZO A;  1W27 A;  1FUO A;  4BAA A;  2QGA B;  1TJ7 A;  2HVG A;  4EEI A;  4FLC A;  1U16 A;  5EYV A;  4BAB A;  4APB A;  4ADM A;  2QVE A;  1XWO A;  3NO9 A;  2PTQ A;  2VD6 A;  2O78 A;  1Q5N A;  3KDZ A;  1TJU A;  4CQ5 A;  2O7D A;  1C3C A;  1DOF A;  2OHY A;  5F91 A;  2PFM A;  3OCE A;  3R6V A;  1TJV A;  1U15 A;  4NLE A;  1YIS A;  5HW2 A;  1JSW A;  1I0A A;  2O7F A;  3TV2 A;  4C5S A;  4C6G A;  4HGV A;  3E04 A;  1RE5 A;  2O7B A;  1KQ7 A;  2E9F A;  2O6Y A;  3UNV A;  4ADL A;  1YFM A;  3OCF A;  2PTS A;  2X75 A;  1YFE A;  3R6Q A;  3GZH A;  3R6Y A;  4C5U A;  4C5R A;  2RJS A;  1FUQ A;  1HY0 A;  2NYF A;  3GTD A;  1GK2 A;  1B8F A;  4EFC A;  1VDK A;  4NSL A;  1GK3 A;  5D6B A;  1K7W A;  3C8T A;  3RD8 A;  1T6P A;  1FUR A;  1Y2M A;  1AUW A;  1HY1 A;  4V2R A;  5F92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...