1K62A

Crystal structure of the human argininosuccinate lyase q286r mutant
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
450
structure length
450
Chain Sequence
GAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWRSLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPRKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYRHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Argininosuccinate Lyase
publication title Three-dimensional structure of the argininosuccinate lyase frequently complementing allele Q286R.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 173
structure length 450
sequence length 450
chains with identical sequence B
ec nomenclature ec 4.3.2.1: Argininosuccinate lyase.
pdb deposition date 2001-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF14698 ASL_C2 Argininosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 1k62A03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 1k62A01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 1k62A02
1I0AA 1DOFA 2J91A 3GTDA 4BAAA 1YFEA 1FURA 3NO9A 2FUSA 4NLEA 1YISA 3RRPA 4EEIA 4NSLA 3BHGA 1HY0A 4ADLA 2O6YA 1GK3A 1K7WA 2X75A 5D6BA 4C5UA 1T6PA 1TJWA 1U16A 4APAA 2O78A 2PTRA 4HGVA 4CQ5A 2PTQA 1YFMA 2VD6A 4C6GA 1TJ7A 2YIIA 4BABA 3R6VA 1KQ7A 3QBPA 1DCNA 1T6JA 1Y2MA 3KDZA 4V2RA 2NYNA 1TJVA 1FUOA 1GKJA 3CZOA 1C3CA 3E04A 3UNVA 3RD8A 2QVEA 4V2QA 4C5RA 3OCEA 1FUPA 3R6YA 1J3UA 1B8FA 4ADMA 2O7DA 2O7EA 5HW2A 5EYVA 3TV2A 1FUQA 1TJUA 1AUWA 1GKMA 4FLCA 1W27A 2PTSA 2RJRA 2O7FA 3C8TA 1EB4A 3OCFA 5F91A 4APBA 3NZ4A 1RE5A 4MX2A 3GZHA 2QGAB 2RJSA 4FFXA 1VDKA 5F92A 2NYFA 4EFCA 1HY1A 1C3UA 1GK2A 1JSWA 1XWOA 2PFMA 2O7BA 2E9FA 1Q5NA 1U15A 2HVGA 3R6QA 5EYTA 3KDYA 1K62A 2OHYA 4C5SA
chains in the Genus database with same CATH superfamily
1I0AA 1DOFA 2J91A 3GTDA 4BAAA 1YFEA 1FURA 1Q91A 1Z4IA 3NO9A 2FUSA 3CI0K 4L6CA 5H8WA 4NLEA 1YISA 3RRPA 4E88A 2JAWA 4L6AA 4EEIA 4NSLA 3BHGA 5M0IA 1HY0A 1Q92A 4ADLA 2O6YA 1GK3A 1Z4QA 4YIHA 2I7DA 2JARA 3U19A 2YV5A 1K7WA 2X75A 5D6BA 1Z4PX 4C5UA 3U13A 2RCNA 4WNLA 1T6PA 1TJWA 1U16A 2FENA 4APAA 4MWOA 2O78A 3CRVA 2PTRA 3F4RA 4HGVA 4NFLA 5M0JA 4CQ5A 2PTQA 1YFMA 2VD6A 4C6GA 1TJ7A 2JAOA 1Z4KA 2YIIA 4BABA 2VSFA 1KQ7A 3QBPA 3R6VA 1DCNA 1T6JA 1Y2MA 3KDZA 4V2RA 2FELA 2NYNA 1TJVA 1FUOA 1GKJA 3CZOA 1C3CA 3E04A 3UNVA 1U0LA 3CRW1 3F4TA 3RD8A 2QVEA 4V2QA 2VL7A 2D27A 4C5RA 3OCEA 1FUPA 4IQJM 3R6YA 1J3UA 1B8FA 4ADMA 2O7DA 2O7EA 5HW2A 5EYVA 3TV2A 1FUQA 1Z4LA 1TJUA 3BWVA 1Z4JA 1AUWA 1GKMA 4FLCA 4A15A 4YIKA 1W27A 2PTSA 2RJRA 2O7FA 3C8TA 2JAUA 1EB4A 3OCFA 1XLYA 5F91A 1XMCA 4APBA 3NZ4A 1RE5A 4MX2A 3GZHA 2QGAB 1IW7D 2RJSA 4L57A 3F4SA 4FFXA 1Z4MA 1VDKA 5F92A 2NYFA 4EFCA 1HY1A 1XL7A 1C3UA 1MH9A 1JSWA 2PFMA 1XWOA 4MUMA 1GK2A 2E9FA 1Q5NA 1U15A 2D28C 2HVGA 2O7BA 1T9HA 3R6QA 5EYTA 1XL8A 3KDYA 1K62A 2OHYA 1XMDA 4C5SA
chains in the Genus database with same CATH topology
1I0AA 1DOFA 2J91A 3GTDA 4BAAA 1YFEA 1FURA 3NO9A 2FUSA 4NLEA 1YISA 3RRPA 4EEIA 4NSLA 3BHGA 1HY0A 4ADLA 2O6YA 1GK3A 1K7WA 2X75A 5D6BA 4C5UA 1T6PA 1TJWA 1U16A 4APAA 2O78A 2PTRA 4HGVA 4CQ5A 2PTQA 1YFMA 2VD6A 4C6GA 1TJ7A 2YIIA 4BABA 3R6VA 1KQ7A 3QBPA 1DCNA 1T6JA 1Y2MA 3KDZA 4V2RA 2NYNA 1TJVA 1FUOA 1GKJA 3CZOA 1C3CA 3E04A 3UNVA 3RD8A 2QVEA 4V2QA 4C5RA 3OCEA 1FUPA 3R6YA 1J3UA 1B8FA 4ADMA 2O7DA 2O7EA 5HW2A 5EYVA 3TV2A 1FUQA 1TJUA 1AUWA 1GKMA 4FLCA 1W27A 2PTSA 2RJRA 2O7FA 3C8TA 1EB4A 3OCFA 5F91A 4APBA 3NZ4A 1RE5A 4MX2A 3GZHA 2QGAB 2RJSA 4FFXA 1VDKA 5F92A 2NYFA 4EFCA 1HY1A 1C3UA 1GK2A 1JSWA 1XWOA 2PFMA 2O7BA 2E9FA 1Q5NA 1U15A 2HVGA 3R6QA 5EYTA 3KDYA 1K62A 2OHYA 4C5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I0A A;  1DOF A;  2J91 A;  3GTD A;  4BAA A;  1YFE A;  1FUR A;  3NO9 A;  2FUS A;  4NLE A;  1YIS A;  3RRP A;  4EEI A;  4NSL A;  3BHG A;  1HY0 A;  4ADL A;  2O6Y A;  1GK3 A;  1K7W A;  2X75 A;  5D6B A;  4C5U A;  1T6P A;  1TJW A;  1U16 A;  4APA A;  2O78 A;  2PTR A;  4HGV A;  4CQ5 A;  2PTQ A;  1YFM A;  2VD6 A;  4C6G A;  1TJ7 A;  2YII A;  4BAB A;  3R6V A;  1KQ7 A;  3QBP A;  1DCN A;  1T6J A;  1Y2M A;  3KDZ A;  4V2R A;  2NYN A;  1TJV A;  1FUO A;  1GKJ A;  3CZO A;  1C3C A;  3E04 A;  3UNV A;  3RD8 A;  2QVE A;  4V2Q A;  4C5R A;  3OCE A;  1FUP A;  3R6Y A;  1J3U A;  1B8F A;  4ADM A;  2O7D A;  2O7E A;  5HW2 A;  5EYV A;  3TV2 A;  1FUQ A;  1TJU A;  1AUW A;  1GKM A;  4FLC A;  1W27 A;  2PTS A;  2RJR A;  2O7F A;  3C8T A;  1EB4 A;  3OCF A;  5F91 A;  4APB A;  3NZ4 A;  1RE5 A;  4MX2 A;  3GZH A;  2QGA B;  2RJS A;  4FFX A;  1VDK A;  5F92 A;  2NYF A;  4EFC A;  1HY1 A;  1C3U A;  1GK2 A;  1JSW A;  1XWO A;  2PFM A;  2O7B A;  2E9F A;  1Q5N A;  1U15 A;  2HVG A;  3R6Q A;  5EYT A;  3KDY A;  1K62 A;  2OHY A;  4C5S A; 
#chains in the Genus database with same CATH topology
 1I0A A;  1DOF A;  2J91 A;  3GTD A;  4BAA A;  1YFE A;  1FUR A;  1Q91 A;  1Z4I A;  3NO9 A;  2FUS A;  3CI0 K;  4L6C A;  5H8W A;  4NLE A;  1YIS A;  3RRP A;  4E88 A;  2JAW A;  4L6A A;  4EEI A;  4NSL A;  3BHG A;  5M0I A;  1HY0 A;  1Q92 A;  4ADL A;  2O6Y A;  1GK3 A;  1Z4Q A;  4YIH A;  2I7D A;  2JAR A;  3U19 A;  2YV5 A;  1K7W A;  2X75 A;  5D6B A;  1Z4P X;  4C5U A;  3U13 A;  2RCN A;  4WNL A;  1T6P A;  1TJW A;  1U16 A;  2FEN A;  4APA A;  4MWO A;  2O78 A;  3CRV A;  2PTR A;  3F4R A;  4HGV A;  4NFL A;  5M0J A;  4CQ5 A;  2PTQ A;  1YFM A;  2VD6 A;  4C6G A;  1TJ7 A;  2JAO A;  1Z4K A;  2YII A;  4BAB A;  2VSF A;  1KQ7 A;  3QBP A;  3R6V A;  1DCN A;  1T6J A;  1Y2M A;  3KDZ A;  4V2R A;  2FEL A;  2NYN A;  1TJV A;  1FUO A;  1GKJ A;  3CZO A;  1C3C A;  3E04 A;  3UNV A;  1U0L A;  3CRW 1;  3F4T A;  3RD8 A;  2QVE A;  4V2Q A;  2VL7 A;  2D27 A;  4C5R A;  3OCE A;  1FUP A;  4IQJ M;  3R6Y A;  1J3U A;  1B8F A;  4ADM A;  2O7D A;  2O7E A;  5HW2 A;  5EYV A;  3TV2 A;  1FUQ A;  1Z4L A;  1TJU A;  3BWV A;  1Z4J A;  1AUW A;  1GKM A;  4FLC A;  4A15 A;  4YIK A;  1W27 A;  2PTS A;  2RJR A;  2O7F A;  3C8T A;  2JAU A;  1EB4 A;  3OCF A;  1XLY A;  5F91 A;  1XMC A;  4APB A;  3NZ4 A;  1RE5 A;  4MX2 A;  3GZH A;  2QGA B;  1IW7 D;  2RJS A;  4L57 A;  3F4S A;  4FFX A;  1Z4M A;  1VDK A;  5F92 A;  2NYF A;  4EFC A;  1HY1 A;  1XL7 A;  1C3U A;  1MH9 A;  1JSW A;  2PFM A;  1XWO A;  4MUM A;  1GK2 A;  2E9F A;  1Q5N A;  1U15 A;  2D28 C;  2HVG A;  2O7B A;  1T9H A;  3R6Q A;  5EYT A;  1XL8 A;  3KDY A;  1K62 A;  2OHY A;  1XMD A;  4C5S A; 
#chains in the Genus database with same CATH homology
 1I0A A;  1DOF A;  2J91 A;  3GTD A;  4BAA A;  1YFE A;  1FUR A;  3NO9 A;  2FUS A;  4NLE A;  1YIS A;  3RRP A;  4EEI A;  4NSL A;  3BHG A;  1HY0 A;  4ADL A;  2O6Y A;  1GK3 A;  1K7W A;  2X75 A;  5D6B A;  4C5U A;  1T6P A;  1TJW A;  1U16 A;  4APA A;  2O78 A;  2PTR A;  4HGV A;  4CQ5 A;  2PTQ A;  1YFM A;  2VD6 A;  4C6G A;  1TJ7 A;  2YII A;  4BAB A;  3R6V A;  1KQ7 A;  3QBP A;  1DCN A;  1T6J A;  1Y2M A;  3KDZ A;  4V2R A;  2NYN A;  1TJV A;  1FUO A;  1GKJ A;  3CZO A;  1C3C A;  3E04 A;  3UNV A;  3RD8 A;  2QVE A;  4V2Q A;  4C5R A;  3OCE A;  1FUP A;  3R6Y A;  1J3U A;  1B8F A;  4ADM A;  2O7D A;  2O7E A;  5HW2 A;  5EYV A;  3TV2 A;  1FUQ A;  1TJU A;  1AUW A;  1GKM A;  4FLC A;  1W27 A;  2PTS A;  2RJR A;  2O7F A;  3C8T A;  1EB4 A;  3OCF A;  5F91 A;  4APB A;  3NZ4 A;  1RE5 A;  4MX2 A;  3GZH A;  2QGA B;  2RJS A;  4FFX A;  1VDK A;  5F92 A;  2NYF A;  4EFC A;  1HY1 A;  1C3U A;  1GK2 A;  1JSW A;  1XWO A;  2PFM A;  2O7B A;  2E9F A;  1Q5N A;  1U15 A;  2HVG A;  3R6Q A;  5EYT A;  3KDY A;  1K62 A;  2OHY A;  4C5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...