4NFLA

Crystal structure of human mitochondrial 5'(3')-deoxyribonucleotidase in complex with the inhibitor npb-t
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
201
structure length
201
Chain Sequence
b'SNAASGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase, mitochondrial
publication title Conformationally constrained nucleoside phosphonic acids - potent inhibitors of human mitochondrial and cytosolic 5'(3')-nucleotidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 69
structure length 201
sequence length 201
ec nomenclature ec 3.1.3.-:
pdb deposition date 2013-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4nflA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4nflA01
3WKEA 2JAUA 3KOOA 4IG4A 2HSZA 2AMYA 3FGOA 3M1YA 2G80A 4XPZA 2WF7A 3ZI4A 4AS3A 5AW6A 4MWOA 1RRCA 2FPWA 1O08A 4FYPA 1YNSA 2YN4A 1WPGA 2B8JA 5AVYA 1QH9A 3VAYA 4HGOA 3SMVA 2VKQA 2FPUA 2IOHA 3NALA 3ZTWA 2GHQA 3NASA 3WK7A 2YJ3A 3U7FB 4HGPA 3FZQA 1L7PA 2YMQA 3SHQA 1RLTA 3EWIA 2PR7A 4ZEXA 3ET5A 4Y3UA 3ZVNA 1XP5A 2HF2A 1NNLA 3N1UA 2YJ5A 1T9ZA 1MH9A 2QYHA 4HYTA 5AIBA 1YV9A 5AVSA 2ZBFA 1RPZA 4YGYA 4GIBA 3ZWDA 3ZWKA 4F72A 4C4TA 2NO5A 1K1EA 4G63A 3UM9A 4CF4A 1ZD3A 3P96A 3W5AA 5AK6A 4EENA 3BWVA 3OCWA 2GFHA 3M9LA 1XVIA 3ESQA 2GO7A 3NUQA 2CFRA 4J03A 3WK6A 4EELA 1RDFA 2FPXA 3U7HB 3I1YA 1SWWA 2PQ0A 1CR6A 2I55A 2I34A 4OFZA 2I33A 1RC8A 5AKGA 1YDFA 4KYTA 4NFLA 4HAIA 1QQ5A 3SKXA 2OYCA 2W4MA 4AS2A 5AM1A 4F71A 5AM2A 2B8EA 5AVQA 2C8KA 4EZEA 2BDEA 3AR9A 1TJ3A 3DV9A 3DNPA 3ZVMA 1RKVA 1Z4OA 3ONNA 1WR8A 4CNQA 3KDPA 2RB5A 5AM5A 1L6RA 2YJ4A 2WFAA 3FM9A 5AK3A 1TJ5A 1ZOLA 5ALMA 5AM0A 1FEZA 1VFPA 2WF8A 5AI5A 5AK4A 3SD7A 3ET4A 5AW5A 5ALKA 1L8LA 3QU4A 3AR8A 4DWOA 1JUDA 3UMBA 3AR4A 1RMTA 3B9RA 4CF3A 3B8EA 5ALIA 2C4NA 2YMLA 1VJRA 3QU9A 4OCZA 4BEVA 3D6JA 4UW9A 5E0OA 3RFUA 4Y2TA 4BBJA 5AW1A 3GYGA 3ZVLA 2OM6A 1TE2A 1SU4A 1ZD5A 3KD3A 4YH1A 3KC2A 5AKXA 2BY4A 2B1QA 3I28A 4NV0A 1L8OA 3KBBA 4NAVA 1RMQA 3WGVA 4UM7A 5AICA 3E84A 1L7MA 2OBBA 5IT4A 4ZEWA 2HDOA 3QUQA 4Y2YA 3L5KA 3QUTA 5AKZA 2JARA 4B6JA 1Z5UA 2WF5A 4G9BA 5AHXA 1X42A 2FPRA 3OCVA 2G06A 3U26A 4YIHA 2IA5A 2IOFA 3L1UA 1U2SA 5AVUA 4Y2JA 3ZU6A 4UMFA 1ZD4A 1IWOA 1Z4KA 3N28A 3WK4A 3WK5A 2YFYA 4BX3A 5IT0A 2B0CA 2YBDA 3QXGA 4UM5A 4MUMA 2P27A 2YMPA 4YCMA 5AW9A 1RQNA 4KX3A 4UAVA 3AR7A 1ZRNA 4KX5A 1QYIA 2HOQA 2G09A 3EF0A 1YJ5A 4DCCA 4QQFA 4YCNA 3PDWA 2G1AA 3PGVA 3R9KA 3NANA 3K1ZA 2R8ZA 3FVVA 1Z4MA 5ALYA 3J7TA 4CE6A 1U7OA 3WK8A 5JJBA 1RMYA 2IOFK 4ZEVA 5ALGA 4UATA 3ESRA 3U13A 3U7EB 4L57A 5ALVA 2CFTA 3ED5A 3FPSA 3QUBA 5AKIA 3L0YA 1N8NA 4YCLA 2WF6A 4BNDB 3B9BA 3OTQA 4RESA 2HI0A 1J8DA 4UMDA 5AESA 3IJ5A 5ALSA 4BX0A 3R4CA 3U19A 3KZXA 2O2XA 5A3RA 3L0BA 5AI6A 5AI8A 2QLTA 1WVIA 2X4DA 1U02A 2P9JA 3OCUA 5ALEA 1T5TA 3R09A 5AI9A 1LTQA 3AR3A 2IYEA 4UARA 1RKUA 1SWVA 1S2OA 5ALHA 2YMMA 2G08A 3S6JA 2FEAA 3UMCA 2Q5EA 2RBKA 3L0CA 2EAUA 2ZOSA 5AKLA 3A1CA 3E81A 4KN8A 3AR5A 2HO4A 3PGLA 4XOUA 1LVHA 1ZRMA 1Z88A 2ODAA 5AW7A 1U2TA 3L8EA 4UAUA 2HX1A 3WGUA 5ALQA 3QU5A 1RLMA 3CZ4A 3QU7A 2RAVA 4C4SA 2HEGA 4Y2SA 4OHFA 1QQ7A 2O9JA 3OCZA 2C8LA 5ALRA 1NF2A 5AW0A 1S8OA 4BYGA 4L6AA 4Y2VA 2AH5A 2P11A 2WHEA 1YS9A 4GXTA 1L7NA 5AW3A 5FP0A 3A1DA 5ALWA 4Y2UA 4AP9A 3W5DA 3OCXA 2DQSA 3L1VA 5AI4A 5AVWA 3OCYA 5ALXA 2C88A 2R8XA 5AKEA 1XPJA 1F5SA 5AM4A 1TJ4A 3BA6A 3E8MA 5ALNA 3U7GA 3L8GA 4QJBA 3WKBA 1RKQA 4YIKA 4DFDA 2B30A 5AKHA 5AVTA 3PCTA 2JAWA 3L7YA 4KNWA 4Y2RA 4Y2XA 3MPOA 4CF5A 1L7OA 4BX2A 3ZX4A 2FDRA 1CQZA 3QUCA 5AW8A 2OA0A 2W43A 5AW2A 3QNMA 4O8CA 5AVVA 3IRUA 2FI1A 2FUEA 2WM8A 1EK2A 1U7PA 2P69A 4XE5A 3OPXA 4BKMA 1ZS9A 2GHTA 2FPSA 4OD0A 4Y2QA 5AK5A 2I6XA 5T41A 5ALTA 4BNDA 5A3SA 3WK9A 1ZD2P 2W11A 4L6CA 1EK1A 5AIAA 5ALZA 2WF9A 1RLOA 2ZG6A 5ALJA 3EPRA 3TLMA 4DW8A 4EX7A 3I6BA 3ZUPA 2ZBGA 2R8EA 4NWIA 3F9RA 3I76A 3W5BA 4EX6A 3A3YA 1Z5GA 4JDPA 1TA0A 3SLRA 4UMEA 2BDUA 3CNHA 4H1WA 4HGNA 1QQ6A 3IB6A 3HLTA 4IFTA 3SKYA 5ALPA 2MSNA 2EARA 3WKDA 4HGRA 1PW5A 1Q92A 2NO4A 3W5CA 3QGMA 2G0AA 2I54A 3L8FA 3NIWA 4JB3A 2PKEA 2ZBDA 5ALLA 2NYVA 4FFDA 2GMWA 1Z4NA 2Q4RA 5A3QA 1Z4LA 3MN1A 2D2VA 4NABA 1Z4QA 1WZCA 2ZXEA 4PNHA 1ZJJA 5IS2A 1Z4IA 2JGAA 3HYCA 3AR6A 4XQ0A 3SF0A 3MMZA 2FUCA 2RARA 1N9KA 5ALUA 4UMVA 1NRWA 3NRJA 3RF6A 2Q4TA 3UMGA 5ALOA 2B1RA 5ALFA 4KNVA 3N5KA 3WKAA 3DDHA 3QYPA 3QX7A 2ZBEA 3N07A 1J97A 2I7DA 1RQLA 2AUTA 2G07A 1VJ5A 3DAOA 5AKKA 4FE3A 3ZW7A 3QU2A 2AGVA 5AW4A 5ALDA 5AVXA 2B82A 1T5SA 1Q91A 4J2TA 4I9GA 3L8HA 2HF7A 1AQ6A 4BEWA 5AVRA 2C9MA 4E88A 5AKJA 1Z4PX 4UASA 3QLEA 2CN1A 4UU0A 2MU1A 2HHLA 2EATA 2CFSA 1Y8AA 2HCFA 2JAOA 3MC1A 2YY6A 3A1EA 5AM3A 1YMQA 1O03A 3N8GA 3ZTYA 3E58A 2R8YA 4I9FA 4C4RA 1KYTA 5AKYA 4UU1A 3EF1A 3NAMA 4EEKA 3AR2A 3FPBA 4HGQA 5AI0A 4Y2PA 2YJ6A 3WKCA 4RETA 5AVZA 3ZX5A 1Z4JA
chains in the Genus database with same CATH superfamily
1Q12A 2Y1FA 1NU6A 4KFSA 3DV0A 3HEMA 4PO1A 5BVGA 4N9WA 2I78A 3KKLA 4Z9YA 4DAOA 1FIUA 2JGKA 1HO3A 2IPNA 1BQ4A 5FPYA 4RJJA 1OLSA 4LNUA 4LYFA 1RRCA 3FDJA 3BMOB 1FPMA 4EGQA 5TV2A 1WIWA 2HK7A 4CQMA 4F8EA 4ALKA 1UJ6A 3DT9A 5GZ3A 3L8DA 4UBNA 4NMXB 3PNQA 4MWGA 2JBAA 1R0KA 4AKTA 4KH0A 3DLCA 5KVSA 1CUDA 2FVXA 2W6ID 1IVYA 1GGNA 1ST2A 2XNCA 3I92A 4MUJA 4UXHA 3UOGA 3ROFA 2GD0A 4EKYA 1K5GA 1PGNA 3WK7A 3ZE8A 4DUZB 4TT8A 1LDNA 3OQHA 5CK5A 3J81k 2HIMA 1NXPA 1R4MB 2YZKA 3QV1A 4I3GA 4PSAA 5IUNC 3WIBA 1S89A 1U9ZA 2XI4A 1EWTA 1NLYA 2MSCB 3C3DA 3SJ7A 3NM4A 3GLFB 2I03A 2MR6A 4Q18A 4RSRA 2BFFB 3KM0A 1N7IA 3LKDA 3RC1A 3SC3A 1P74A 4FC6A 2JCSA 1W46A 3SSNA 1K2VN 2BRUC 2X2PA 2H57A 2BFEB 4Q7JB 3WOHA 2A9QA 1H94A 3CSSA 2I3BA 2BP7B 5IANA 2XNHA 4C9BA 2P7IA 4XX1A 4UOZA 3RIGA 4FC7A 4C4TA 4YMSA 721PA 1KNXA 2G83A 1ADBA 3MINA 3O8LA 4L6IA 4YMVA 2NZJA 1YFMA 4WEQA 3I53A 2J30A 4HEHA 1T24A 2PO5A 1RDFA 4EY8A 2JFYA 3INRA 1O96A 3Q9NA 4FYIA 1XCGB 1ELOA 1I2AA 2RC6A 4CLHA 3PNPA 2RH8A 1TDJA 2C2WA 1QRDA 4F4UA 2RGAA 4JUBA 2FA9A 4YQFA 4V0KA 3TQSA 2YWGA 5U4QA 5C7OO 1JDBB 4EI7A 4YRCA 4KPEC 4UM9D 2IXEA 1XNQB 4HDMA 1UZUA 5FLKA 1YI8A 2WI8A 3QPVA 3UVEA 3FWYA 2F1IA 3ASYA 3SG0A 3IX7A 2BLNA 2XD9A 3EXAA 5IAOA 5DKFA 1GYQA 3L1IA 4RPGA 1SHTX 4XYMA 5DNWA 3ZZMA 4UAJA 4CMEC 1C8BA 1NVMB 3HFJA 1PF7E 1X86B 1N5MA 3C2QA 2W2PA 3PPXA 1KSGA 4MQ6A 1KERA 4MKHA 2KYRA 4X93A 2VQFB 1Y9ZA 4GSYA 4LGVA 1KI4A 4TRMA 1ACJA 2DC1A 2F2TA 1FFWA 5J2TA 5T4BA 5JAUA 3TQRA 3QFRA 3NO9A 1Y4UA 5B1IA 4ZO6A 2VKTA 4QX6A 3E0XA 2RHCA 2ZT8A 3N6RA 4OFBA 2RONA 2IXFA 3JQFA 4AY5A 1Q7GA 2Y0PA 4ZZ0A 1ZNQO 4YMIA 3AHJA 3T1QA 3IBYA 1SUPA 3TDMA 2OGTA 2OXRA 1Q0RA 3D3NA 1WDKA 3REFA 4K28A 3FUWA 3LPAA 3SZOA 2JGFA 5H3CA 1Y3IA 1M0WA 1JDTA 1T3GA 5C1OA 5ER9A 1QHIA 1L5HA 3A6JA 1FPQA 3K5IA 1MIHA 4D1YA 4GR5A 5IVKA 5LNK6 4APBA 2X3UA 3KWFA 3L4BA 3B9RA 3TOSA 4RH1A 1O6FA 3WHKA 2XDYA 4DT1B 3UZUA 2HLDA 4AX8A 1PJTA 4MICA 2WWGA 3D6JA 4Q1BA 2HNAA 4RHFA 4EHAA 3U7IA 3H3XA 3IOEA 3QBVA 2CY0A 1PVOA 4M7OA 3STUA 1NV9A 2QTFA 4ALIA 4EGFA 1MHTA 4E5YA 1B8VA 1WZNA 2ADOA 2Z5FA 3D1JA 1TTTA 4PC2A 1AH2A 2BTOA 5SZHB 3KC2A 3T3EA 5A3JA 3BK7A 1NUHA 1THGA 4E22A 3ETNA 2JFZA 4M1SA 2H5EA 4A0RA 1TYCA 2Q7DA 4TKUA 1S1MA 1PG2A 2HK9A 1XZFA 4PYNA 1NVFA 1FSFA 2WIKA 2WA2A 3N7AA 3E84A 1GFZA 1R5BA 4MULA 2R97A 4HAZA 1T1GA 2RHWA 4Y2YA 3C3XA 3HKCB 2DFLA 2OBXA 4BBAA 2WF5A 1QZTA 2FQWA 1Q57A 1A88A 3T38A 1HORA 1X42A 2QMZA 4KKVA 1D4ZA 1AV7A 3VZPA 2C8JA 4R8RA 2IEIA 5IJ9B 4N41A 3D7SA 4P34A 1U90A 2EF0A 3N0RA 1F8FA 4IIYA 3THWB 3DWFA 1LLQA 3ZU6A 5C53B 3MZ0A 4EYEA 5JJLA 2LIVA 1TMOA 2Z8YA 5FLEX 1IWOA 3I6ZA 4OQLA 3L8CA 2RGNC 1UJ2A 3D2LA 2WSSA 1XN4A 4QTTB 4XYBA 4B0OA 4EAQA 3DDNA 2O8BB 5D6BA 4X7PA 4M1EA 4W5WA 2I1VB 1A04A 2P27A 2R00C 1VTKA 2ZUTA 2CL6X 3DOOA 5CG1A 3LKBA 4YAWA 3ZBPA 4ZI7B 2ZK7A 2QRGA 4Q47A 1DT5A 1ZRNA 2UUOA 2ZUCA 4NFSA 3AWDA 4DIFA 1B41A 4ZOLF 1VSTA 2V0NA 3PUVA 4GNKA 3RVMA 4YYEA 4F1WA 4HSEA 3PUWA 2CE7A 2N42A 3GJ8A 4AMBA 1OI4A 1BMFA 1Z22A 3AJRA 2DCMA 4CMBA 5K6RA 2G8NA 1BGXT 4MVWA 3EYWA 4NNPA 3PDCA 5CBPA 3X2FA 3O0TA 2YVKA 2PDAA 3NNDA 2PWYA 3QXJA 2A57A 4MI9A 5KUTA 3F6EX 3HNOA 4KFUA 1HG1A 2AZTA 3QG5A 4EKIA 4QAJA 3KPYA 3GJ4A 2HXGA 3RKSA 5A5GA 2IPAB 1JPNA 4B3SB 2B2CA 1CNMA 3TG8A 2D28C 1MB4A 4EL0A 4U6QA 5C2JB 2C98A 2HEIA 3GMSA 3L0SA 4JT4A 4EVQA 2BR3A 3JQCA 5DISB 2J3JA 1H6DA 3QY9A 4WHMA 2IQIA 3MJRA 3OTQA 3TD6A 2Q5HA 1NVVR 2VJNA 3ZXUB 3U5ZB 2G1PA 2C77A 1Y7IA 2PKCA 3F7OA 4FT4A 1J1IA 4MVJA 3BTUA 3IC5A 4RHUA 3STTA 1YKSA 2NZUG 3R5JA 4DLUA 5H02A 4D4LA 1VPEA 3IKLA 3OH8A 3DMGA 4XQ9A 4DIBA 3DXXA 3T1TA 1RE5A 3K72B 2YDYA 3MB8A 4FFLA 4KLZA 1IZ0A 4YCJA 4Z0PA 3UG7A 2WHQA 1MGOA 3EY4A 3P8ZA 4JLDA 1JFFB 3KJXA 4H16A 4DLLA 2M1ZA 4OGLA 1JHYA 4O2BF 4QWWA 1HYHA 2YJZA 2BH2A 1XKLA 1JKFA 1HDXA 2AOTA 4O33A 4UHFA 1AUVA 1CS0A 3LL4A 5KEIA 1H5NA 1UPAA 3ZGXA 2HPAA 5LLTA 2WFZA 3ZGOA 3ZU5A 2J0EA 1FMJA 2DTXA 3NCHA 3W7AA 1S3GA 1HBJA 1BA2A 3CNQS 3K9GA 3PUXA 4FKMA 4DJTA 5JXWA 4CKCB 1Z2OX 4H6WA 2E82A 5JRJA 2W2NA 4LA4A 3NGLA 3QHQA 4LJ4A 1E3TA 1XE3A 1YOVA 4RAQA 3SICE 4ARCA 2YJTD 4CWAA 3EC1A 3AG6A 3KXKA 2YYAA 5AKLA 3WWPA 1AGRA 1MBZA 4JBWA 3LV8A 2GAAA 5BUSA 1UFOA 3E22B 4Q34A 1OKKA 4ALLA 3TSOA 3JD1A 4OX9B 2Q9BA 3PNLA 3VSAA 3EA4A 1K0FA 1KTVA 1YR3A 1USUA 2CGEA 3IAM1 4KQHA 3HCEA 4QPCA 3L6CA 2JLXA 4EPRA 4TT3A 3QU7A 4IRMA 3AGPA 1H2RS 4HRVA 2H1SA 2HEGA 3EY9A 1KF0A 2BMVA 4NJMB 5C1PA 3TTSA 2GJ8A 1SXIA 4XFJA 1ORHA 3BIXA 1TYZA 2ACVA 2XTJA 5BR4A 3L92A 5F7ZA 3K0FB 4CT5A 3QVVA 4DJ5X 2C8LA 3NKFA 4UPVA 2NQTA 2ESRA 4L95C 2FW9A 4DNXA 2P65A 4ETIA 3DVLA 4DQXA 4WCDA 2QJRA 1K6JA 4BTLA 3BF8A 3DD1A 4Z86A 2AC7A 4HNAB 1LH0A 2P30A 1XEXA 1C8KA 2ZYGA 2BL4A 1T6BY 3GELA 1FFEA 4O0MA 2V7EA 4AP9A 4I8DA 1TB4A 3A1FA 3U1BA 2NO9A 2VHQA 1KC3A 3FNFA 4XR4A 4F5ZA 2H18A 4Q82A 5BO5A 3U16A 1A95A 3FOFC 5ALXA 4H6XA 4YUXA 1EFRD 1H9AA 2WJ3A 4IH1A 5TT0A 3WLLA 3EEOA 1G20B 1TJ4A 3E8MA 4I55B 4URFA 5ALNA 4FCWA 4EHLA 5HJEA 1W49A 4PX9A 4MPPA 2QIOA 3HADA 3VA7A 3A1NA 1OV4A 2W7TA 1YR9A 1X15A 4PINA 5BVHA 1LPBB 3R6WA 1QFYA 4ICIA 4KQ9A 4PYIA 2BMDA 2G36A 3DS8A 4FDUA 5I7OA 1XK6A 4MDEA 1FDWA 4WKBA 1L7OA 3O93A 3HDQA 2FPPA 2W6JA 4S1OA 1R9MA 3LOPA 4LG1A 1CQZA 3K0AA 3SBXA 3UV6A 1D8AA 5BNZA 1WU8A 5EZYB 3CVYA 2XCRB 1J99A 3AFGA 2W6ZA 1TAGA 3VZSA 5A0FA 3TFWA 3JWIA 1U2GC 2DPXA 4OTZA 1BNCA 1GZVA 1QFJA 1VLMA 2FSHA 2VLIA 3BHMA 3WMEA 3ZY2A 1MB2A 2K7FA 5DWQA 2NOAA 1UQTA 4KEAA 1P77A 4Z0NA 4C7OA 2QROA 1ZIPA 3HR7A 3ODPA 4RL6A 2QQ0A 1ZUNA 4QQRA 3DVSX 5BSTA 3PIDA 5JS1A 3GLTA 3CO5A 5T5QA 1KBOA 2EKQA 1N0UA 1V6SA 4K0RA 5EL0A 4AJ4A 2A78A 1G3RA 2A4KA 1E1NA 2CWWA 3D4IA 1GR1A 1ESCA 3D5TA 3LC7O 3F1LA 2YC4C 3CE6A 2DLCX 3Q2OA 4RM3A 1DKNA 1ZH6A 4DL9A 4QRIA 3CU5A 3DBIA 4F9FA 2ODQA 3RAPR 3EA0A 4PLCA 3ER6A 5FHQA 2H1VA 4XI9A 3TS1A 2XHZA 1VPDA 5JEDA 5B30A 1AS3A 2YVAA 3K4QA 2UXDB 1RZUA 3R3UA 5FTLA 3Q40A 3GJRA 3N3BC 3G5AA 1XU4A 2X86A 3ZCQA 3VSCA 4FT2A 2HMTA 1CP2A 1N2HA 3NC4A 4OL0A 2KLBA 2I0FA 4FU0A 4Q00A 1GDDA 5EVCA 1FUIA 5HQ3A 4XXHA 5KOJB 2FRDC 2VA8A 2E89A 3ID6C 3MWDB 4HGVA 5G40A 2D1QA 4UNRA 1DJNA 3KPWA 2QIPA 2IV3A 3NV7A 1U1EA 5E4YA 4OU4A 121PA 2HJGA 3GLQA 4JX9A 1PKEA 2EJTA 1V8DA 3T7JA 3LF2A 1VL1A 3A11A 1MW9X 2F3PA 1S3SA 3QWHA 4KQEA 8ADHA 2G70A 3T4EA 3WADA 1MQ8B 3OE4A 1QCCA 4XA8A 3OEYA 5EJIA 5HF8A 1C8LA 1U81A 1Z37A 5HP4A 3L8FA 4R8VA 5KYWB 2NYVA 2FG5A 3CX4A 3AMVA 1EUZA 4A82A 2EKZA 4P3XA 2Q4RA 3RVJA 2I2BA 4ID9A 2ID4A 1VHDA 3PWZA 1JG2A 4GDMA 521PA 1OH7A 3HV2A 4BNFA 2GVNA 4D3YA 4QOJA 1DWQA 2B4TO 1H0KA 1Z83A 2Q5CA 3L4EA 1EDZA 1JQEA 2V7UA 2YWCA 3QKIA 4M3NA 4REOA 5CAEB 4YRMA 5IS2A 2NSLA 5LBIA 3W9YA 3I1JA 2R7NA 4IDEA 1ZWLA 3MT0A 4MJ3A 2QL7A 3OI7A 3R3JA 2J3IA 1CEXA 2JA2A 4LJ5A 3PFKA 4U0KA 5EVJA 4X00A 4RJKA 1A5TA 2ZETA 4DMGA 5M04A 2WAMA 2R11A 3R76A 2CJWB 3T7AA 1HF3A 4ZJYA 1GRNA 5KMGB 3ZIDA 2Q4TA 3THOA 5ALOA 4RHCA 5FRDA 2C4MA 5ALFA 1SCDA 1QYDA 3NGMA 3TL2A 4ZVOA 2XOEA 4PTZA 3IBCA 1DS6A 2O5VA 1IU9A 4O3MA 1TIPA 4F4JA 2NMVA 2PMWB 2FOLA 3HKBA 1HFKA 3Q7RA 1QANA 1PQ4A 2PZMA 3PX2A 3OM1A 5KCZA 3RD5A 1OIWA 1PR2A 3Q5EA 1B3RA 3EVAA 4QUKA 2H8GA 1KVRA 4NJEB 3I5XA 3CKKA 1QPBA 5FJIA 4DA9A 1PLLA 1KMHB 2CUTA 4Q01A 5J63A 1HNZB 4Q4JB 3HBMA 5K0CA 1KZ4A 2XVXA 4HDOB 1HK7A 4FI3F 3S7ZA 1S3FA 1LPNA 5IBRA 5I45A 3K20A 4K6HA 1JHMA 2KI5A 1RRFA 1T4DA 3OZSA 1GUBA 4UU0A 4BFXA 4JYZA 5KS2A 3KWJA 1KJ8A 5KHOC 3EQ2A 1XDGA 3HXLA 1H69A 3LUDA 1NJ8A 3WC4A 2J9FA 1H85A 3CH5A 2PVSA 4XB6B 2QRMA 3A1EA 4LZJA 3W6NA 4HVAA 3U3MA 5CM2Z 2E85A 4G85A 3W2TA 1OYYA 2VHYA 4YV1A 3T1OA 5GAJA 1HLPA 1T9HA 2IS2A 1QRAA 1MAAA 3OZGA 2A0WA 4L9SA 2H16A 4HYYA 4OHOA 1XMPA 2CFOA 3NVDA 3EJWA 4IF4A 3TPCA 4RIGA 3QF7A 1CY4A 5SY9A 4D2IA 1SKQA 3T9EA 2QNBA 2GFIA 3DBRB 3NATA 2R0QC 3HY4A 1NC1A 3BTVA 2QNRA 1AKTA 1IJKA 4M0UA 4NCHA 1LBTA 4RZQA 1HMPA 3ODGA 5LZ2A 2CK3D 2G5GX 3DCNA 2BAGA 4KJZA 2QGAB 4EZIA 5IWAB 3R9XB 2OWDA 3ZHQA 4DPLA 5AW6A 2FXIA 5HZHA 2J9YB 3Q8KA 2COKA 4G0NA 3TIVA 1IXYA 1YCGA 3DJYA 5B7GA 2FN9A 4QFCA 3HYTA 3VV3A 1ODFA 3O1JC 5KTKA 4LJ7A 2H2WA 3TINA 3VPXA 3SZGA 3VR3D 3W8RA 1CDOA 4PZ0A 2LVBA 4AXXA 4HAYA 2ZYDA 2CNOA 3IP3A 2XWPA 3U7FB 4Y7DA 4I9UA 1VJDA 3H1FA 4OQ4A 4AROA 3LIIA 1H4VB 1QYRA 3Q7IA 3RYFA 2J67A 4B45A 3KHKA 6CHYA 4ZZ2A 1P4JA 1U9CA 1MCZA 2ZSUA 4H0NA 4JJ8A 1A9YA 2AG1A 4GYWA 4RY2A 3TMYA 2W22A 2Z2IA 1BG6A 4NVRA 5AVSA 1N3IA 3BZBA 4BO4A 1QKKA 4JNCA 4NBTA 5TC4A 2QRLA 3TNYA 1QO0D 2IELA 1RXYA 4NE9A 2OLKA 4NG4A 2IX3A 3BK1A 3FPFA 3HWX1 1GT6A 3H13A 1L4YA 1SXHA 3K05A 2UU9B 4TV8A 1QGUB 4EJSA 2IH5A 4IV5A 5BR8B 4CF4A 1D3AA 5G53C 5JYCA 1C3UA 3BWVA 3CLUD 4V1CI 1UINA 2INGX 2I66A 4H7DA 4M37A 1QG0A 2PT5A 3BFXA 4PO8A 2G9NA 1XVVA 1NX9A 1CJCA 4HMQA 4FD3A 3R77A 2FJUA 3FTCA 3TXYA 4P1ZA 1E2DA 4D4IA 1N3BA 3CW2A 3WIUA 3Q4GA 4JP8A 1MF7A 3QF4B 1S9DA 4OQEA 2E4YA 3JWJA 4WZBE 3SNHA 2QUZA 1UL1X 1TFUA 2I3DA 3CX3A 3BXEA 3UANA 3I0NA 1S2GA 5T4FA 1LCIA 4V1CB 1G7RA 3ZNPA 1TZJA 1WDLA 1QIIA 1UBSB 1H1LA 2PFKA 1S3IA 5D1NA 1JGTA 4OQXA 2YASA 2A59A 4LQ4A 4BNHA 4TZTA 1YOBA 2W2MA 1ZGGA 5IC5A 3GARA 4JT8A 3K9LA 2ZJOA 4F84A 1BHQ1 1L5QA 4WOKA 2ECQA 1RLUA 4INZA 3O91A 2IZZA 1VSVA 3HRHA 2PSEA 4XWKA 1PE0A 4AX4A 4PZYA 3UF0A 4YP0A 2L82A 5JNUA 1T0UA 3EGCA 1Z26A 1GUZA 4AIRA 1H23A 4KQXA 5IYZF 3T7RA 2R47A 4Q39A 2ATIA 2Q49A 1NOKA 3DDZX 2QG6A 3K5PA 3KPJA 2XW6A 4LSZA 1FS5A 4RMNA 3AFMA 5KX5A 3CXUA 2FFRA 1PVVA 1C2TA 5G1NA 3CKLA 1KJYA 5KYUA 1JIUA 4JJAA 3R0VA 4JLMA 3W5HA 4LZLA 4CQLA 5CG2A 5KI6A 3KLMX 1Z0FA 3VO9A 2QU7A 4ZCIA 1GUYA 3AEKB 1AQUA 3DO6A 5IJXA 2JEZA 3LHFA 3ZHYA 5D6OA 1BEUB 4OYYA 4ZAGA 3HHEA 4Y2TA 2OYRA 2O20A 2RGEA 1GPYA 3BQNB 3EQ6A 3T3HA 3UQZA 2ZJ6A 2BZGA 3MJ4A 3QWIA 4PNZA 4RS4A 4JOCA 3WLNA 4Y6PA 4EKNB 3F73A 2WV9A 5DXFA 2PX4A 2XMSA 5DMXA 2XYRA 1YMUA 2CEAA 3RJ5A 3L43A 2AMFA 1X3LA 4ZAXA 4PC6A 5LOVB 4UNQA 4XSGA 2IYRA 1A8HA 3CCFA 2C5SA 4WAUA 1A8QA 2FPIA 3VNSA 1RMQA 3WGVA 2EHJA 2A9OA 4OREX 2IWHA 2JASA 4Z7NB 1DQNA 3F7TA 1L7MA 1C4KA 5FF9A 5CA0B 4ZEWA 5AKZA 4IKPA 1YB5A 4EATA 4XWWA 5C37A 2ZSEA 4NQZA 2WU8A 5JFGA 3HBNA 4MMYB 4UEOA 4Z8XA 4E5MA 1O0SA 3THYA 5DFAA 5FOXA 4L4RA 1XZCA 3C16C 4EA6A 1KEPA 1OXTA 4I5GA 3MFQA 5C4GB 3F2IA 4MRMA 4HC4A 1MZPA 3ZI0A 1DU4A 1B6SA 2WILA 4CCSA 4UMFA 3HK2A 2EZ8A 1NT4A 1FP4A 1ZD4A 4RV5A 5IH7A 2C7BA 1U2PA 3FETA 4BCBA 2C5FA 2ZXFA 2KMLA 4MUMA 1T8YA 4Q3DA 4R8MA 1Z8FA 4HNQA 3DAYA 3FFBA 3OMXA 1OHHD 2WJAA 3G2IA 1R66A 1RAAA 4ANFA 4B80A 5BSEA 2Z6AA 5FBKA 4BV8A 2AFVA 4GSKA 2G67A 1P1KA 5HKKA 1ABFA 4Z6KA 4KR2A 3UW1A 3ESCA 3NTXA 3T7EA 1ACMA 5DYWA 3KSRA 2QTVA 5F7XA 2JFOA 3H6KA 4J0JA 5J4KA 2EIXA 2DQZA 2C2YA 2ZJZA 3MJFA 3ST7A 2OGSA 3PNKA 3G0DA 2PKQO 5FI3A 4Z4GA 3K1ZA 3X2SA 3HEAA 3WLFA 2R6CA 4D9GA 1U7OA 1T1RA 2QNIA 2AQ8A 2QR5A 3OPVA 5EWMA 1RMYA 2JFVA 2W6NA 3OJ0A 2OV2A 5HTKA 4CM3A 1JEOA 3VMMA 4JOSA 4L3OA 4P33A 4TKVB 3D0KA 4DM3A 5B1EA 4L57A 2OFFA 3W1EA 4WV3A 3GGPA 3VH4A 1B3BA 5LUBA 2KM1A 5GZ6A 4E31A 2OFXA 1FYXA 3BAFA 3C6YA 3QMVA 3TBFA 3TXAA 5B7QA 1U4SA 1O6CA 1TU4A 1WMSA 3MB5A 4K1LA 3SM3A 4BNDB 4EYQA 4OQPA 8ABPA 3M6IA 5H70A 1J90A 3WWZA 1I5RA 5C8DA 3HKEB 2NXEA 2XMCA 3JVVA 4N65A 3JVUA 2X0DA 2XRMA 2IBMA 1LX6A 1L5WA 2PYIA 2Y1CA 4NNOA 1G1MA 4MVXA 4J76A 2WDZA 2PV7A 4HPXB 1U3VA 3SYRA 3ZZTA 3U19A 3ZHRA 1WP4A 4IIFA 1COZA 5J5VA 5BQOA 5T6BA 1YE8A 2DTDA 3Q6NA 4TPKA 4JBHA 2VNHA 5CHEA 4HEQA 5JZMA 4JEUA 4YR9A 1W88B 5FDFA 2NU7B 3D0QA 5DEOA 4WKOA 3MIZA 4DGSA 1JDNA 3CZAA 3BGSA 3IUEA 3IUBA 2C2KA 3MT9A 1YKFA 3DTYA 4LY9A 1PJ3A 2GPTA 4ILEA 4Q9IA 4A4DA 3BXOA 3BJRA 3P2OA 2NTYC 1QF7A 2WBLC 3LW8A 4AG5A 2R7KA 1U3UA 2W6OA 5HM6A 1L2TA 4KR7A 2ZRJA 3OTIA 2YMMA 1QGZA 2HLPA 2J3QA 1DJPA 2COUA 3CRQA 3H8SA 3JVEA 4BO6A 1QTIA 2A5FA 3C4QA 4LFCB 2ZOSA 2OCDA 3COPA 4KQGA 1NU8A 2IZ7A 4I4TA 2BW0A 4JUAA 3CLSD 2ZPAA 2IU3A 2R5NA 4P32A 5ANRB 1H42A 2W0SA 2WWWA 3PGLA 4HVTA 1UK8A 3QVWA 4BNVA 4C20A 5FBVB 5IVDA 3HYNA 1NY6A 1Z5NA 5CX1A 2QRVA 3BF7A 1UEJA 4ZCQA 3TW8B 3ETEA 1G8JA 3EFOA 3H4IA 1KO4A 5FEMA 3FN4A 1Y6GA 4TGLA 3S1AB 4L8GA 3CJTA 3VTZA 2WUWE 1I2MA 5C0OE 3O8NA 3G68A 1CUSA 1ATZA 1Z12A 1YR6A 1W4ZA 2FHSA 1G0OA 4JEIA 5I5GA 5CDYA 3D6UA 1QQ7A 5HQJA 1SN7A 1UZAA 4K7JA 3ZWOA 1PR6A 2WSMA 1NI3A 1ZH4A 1PO7A 2CVPA 4KWHA 3KOXA 1QH1A 1XRLA 4MDYA 2C2GA 3KAQA 3CSDA 5DGCA 5AT1A 4D74A 3WAJA 2P9EA 3DKKA 1YU9A 1AKQA 3EG9B 4PAGA 1EBUA 4XQCA 5FPKA 2ZVPX 3C74A 4HL6A 2R8RA 4X1YB 4BQNA 4IH4A 5HOQA 2CHQA 2OCIA 4MZDA 3KYCB 4LMPA 1JYSA 2DR2A 4GG1A 1HZZA 4ZIRA 4R98A 3KK0A 1EVQA 1QCYA 4GBGA 4HN9A 5IM5A 3ND8A 5YASA 4B9EA 4I0WB 4HRAA 4YDRA 3U40A 3DE3X 1WXGA 4H7FA 4PSUA 1JFVA 1E2PA 1VYUA 2H4YA 5EOVA 4QYSA 2DULA 1J1ZA 3LBIA 1KKUA 5LA6B 1VBNA 4RMJA 2IEGA 3WYCA 5KNBH 1SBYA 4RFSA 5J23A 2ZKIA 1NJFA 4RTPA 1EU1A 3L7YA 4RIHA 4Q3BA 2DFNA 4U02A 2GILA 3CUUA 4N82A 3ZX4A 1JBEA 2P5TB 3HY3A 3RHSA 1A72A 4L16A 1RADA 2Q6LA 4M8KA 4PS1A 3TVTA 4DLAA 4DYDA 4A10A 3OOSA 1ZH8A 3JATA 2V7BA 1DUVG 3GLHB 3IOYA 4IO0A 5TF4A 1TM2A 5LXTB 2Z2ZA 4FMBB 5EP1A 2Y0EA 1OVGA 1K3TA 3WDSA 4IUCS 2ZRCA 1QK3A 4BEJA 4QEKA 3LC0A 4IM7A 1RSZA 2HHAA 1IL0A 4C3UA 2ZRHA 5DWVA 1L3BA 4CEIA 1XKXA 4EGAA 4Y2QA 2DYKA 3GEMA 3OE5A 5AK5A 5T41A 1WY5A 3ZWCA 1HOTA 1XQ6A 2XQGA 4GRAA 1CP3A 1I30A 1DJQA 1GQRA 2A7QA 2WF9A 3SQMA 1DCNA 5IXJA 4LWZA 3LD9A 3AVYA 5LC1A 4ZD6A 4WRRA 3A0UA 3CC8A 4G4IA 4GUDA 3SOPA 4A0GA 3FUUA 2PS0A 3I76A 3DV0B 3C1UA 2OCYC 1QLWA 2XGGA 1AZLA 3KFXA 2IV7A 3SLRA 3AOEC 3SR4A 1XG5A 2RKWA 2Y6UA 3CH7A 1KJQA 1OLSB 2IXAA 4LNUB 4DMHA 4AJJA 1YQUA 3F4KA 4ZKDA 4CQMB 1X8LA 3GRZA 1O57A 1ODCA 1K27A 2H4HA 2X22A 3KELA 4MQLA 2DP4E 1K06A 1SUSA 2GAFA 4W4TA 1ZMRA 2FR0A 4PLPA 4ROSA 5FOSA 2YZNA 3ANYB 4KQJA 4LDQA 5EXPA 3VPFA 4UTVA 4PF1A 2AC2A 4NZYA 3RODA 2NG1A 2BGUA 1BX3A 5TEWA 4DG8A 1HY3A 1DKUA 1MO2A 5EHGA 5KQSA 1MX5A 3OJFA 2MOKA 2J3DA 1RBMA 4GEKA 5EPOA 1R7RA 3TTVA 1P0PA 3MWEA 4HPWA 4CPDA 3I9FA 4JU9A 3A9WA 5UKDA 3DUWA 4P84A 5EGNA 1Z63A 2C3OA 5CDFE 1ESMA 2EFGA 5MN5A 4RULA 3PL5A 1CUXA 3HVJA 2ZIVB 5KSPA 2ZXEA 3T1NA 3U80A 4IHAA 4YMGA 1M5RA 2H5IA 4UQOA 1KPIA 2E3JA 3H5OA 3MINB 3OWOA 3V8NA 4UZEA 3VU8A 3KETA 2PUCA 3G7NA 2KHZA 1PWEA 3CSUA 1RI5A 3N2EA 1RC1A 3CCBA 1WXEA 1ZI8A 4IXDA 1VL0A 4O4IB 4LC0A 5D3QA 2JKVA 3SZUA 4D8UA 4EFKA 3M83A 2PKQP 1XTSA 1O96B 4MWEA 4NEHB 4TKLA 5GGYA 3NRJA 4LXTA 3EHEA 1NIJA 3OTOB 3SI7A 4DQLA 1BHO1 3BIFA 4C08A 3T5BA 1RHUA 1XK7A 2BEKA 5GVRA 1K6IA 4HDMB 1KO1A 3RHFA 4JI3B 4EUSA 4UCWA 3N5KA 1CHNA 1X7XA 2QD3A 1ABEA 1YGYA 3DDHA 4X92A 3LUHA 3QX7A 2YVUA 3PNOA 1NVXQ 2CVFA 1F6WA 1WMBA 2JGNA 2I7DA 4UUOA 4B9AA 1RQLA 2I4MA 1E8MA 2BMJA 1JJIA 3CN9A 2HPZA 1UBTS 3DAOA 2VRWA 4FE3A 3SZMA 5I9IA 1GCAA 2EHDA 1P4RA 1FTQA 1SNYA 3QU2A 4RC9A 5DLPA 1REQA 1HDOA 3BB4A 3MXTA 1BDIA 1PD0A 5J2TB 3EMVA 5JJCA 4QBGB 5MGNA 3LMKA 4GOMD 3RS4A 3UW3A 2XLCA 3IV9A 3JQEA 5CLFA 2HUNA 3DMDA 4ZAVA 3KWMA 1JKMA 4PHCA 3ZCUA 1YB6A 5KB3A 1NQUA 2AG6A 2O06A 1IY2A 1M33A 2HBYA 4A36A 3HJTA 4R1OA 4C4OA 1XDDA 2Y0BA 3URMA 4EJ0A 2BMFA 2QUKA 1ADCA 3AINA 2ATVA 3M6XA 3VR5H 3RV3A 1WWKA 1FFSA 1YRAA 3G7UA 1S7GA 1L5HB 4Q48A 1L1FA 2W48A 3MTIA 3ZTYA 1WUKS 3WQBA 4DMUB 2WK1A 5CCXA 1IXSB 4XLZA 2A3RA 5FOWA 5K8UA 4B3DA 1YMVA 3EEQA 1UFRA 2X0FA 1HZJA 1KK2A 1R6UA 2KSQA 5I3CA 5JNTA 2VNJA 3X43A 4DS3A 1Q0LA 4L4SA 2PMBA 5KNCD 1MAHA 1WV1A 2XRZA 1QRTA 1E62A 1KEEA 5FUMA 2D2XA 5DCWA 5G02A 2JD1A 4X7MA 4EZBA 1YF3A 4WJLA 4JP5A 3AERA 2ZRPA 4F11A 2V65A 3F7MA 4ER7A 3EVNA 3GNQA 2CD9A 4TKUB 3D1LA 5EJ5A 1T13A 2HSZA 3FGOA 5H83A 5KTMA 1BE0A 3EISA 2OHHA 3GJXC 4RZIA 5H3LA 2ETXA 2AFIE 3BQ9A 2DAPA 2Q27A 2XQFA 2QX6A 2B1JA 3T5PA 4L0MA 5H7XA 2B8JA 1ITZA 4JXXA 1EVJA 1TKCA 4UFNA 5EIBD 1Q0HA 3SMVA 2ZIAA 1XMIA 3GVPA 2WJZB 3IHLA 1MD9A 2JFHA 3GFBA 5C1DA 4NI5A 4G36A 1P9RA 4HAWA 3NAZA 3WE7A 5L7WA 2CYAA 1NLMA 2ZB4A 3K30A 3LDFA 3A9RA 2YWDA 1I2DA 4D9NA 1IXZA 1AXRA 2WTNA 2IEAA 1S2IA 3ZVNA 1W76A 4H1VA 2CMHA 5IFKA 4AP6A 2VJDA 1M1NA 2V7XA 5JAPA 2GX6A 2QM0A 2FMIA 1KQGA 2HF8A 1MVLA 1KO7A 2IZ1A 4TRJA 3A9CA 3OCCA 5FORA 2CZQA 1LJLA 2PWAA 5JYEA 3CEHA 1AQYA 5FR1A 5CXXA 3ZDDA 2XA1A 2IY8A 4EPWA 1JI3A 3GLGB 4G63A 3MELA 3JYHA 3UK7A 5HPYB 5DNVA 5CEFA 4QOHA 1XVIA 5LQJA 4L4ZA 4Y98A 1Y4AE 2QT0A 1BN7A 2CE2X 3FUVA 4A03A 5CBPB 3GEBA 1Z17A 3KO8A 4E1AA 5L3SA 5LB4A 4GXRA 4MVJI 3UC9A 1RQRA 1CR6A 1OXVA 2CMDA 1T10A 1Q1NA 2YUIA 3PC2A 1KZ9A 2NV6A 3MWKA 4TLEA 5CLLA 2IU4A 5H3HA 3DHYA 5BOVA 5F7OA 4KR3A 1FXUA 1UJMA 5JD3A 3BERA 3F4LA 3FSGD 4HP8A 1PL0A 3DW1X 4FE4A 4XDHA 5I4IA 4YHHB 1RZVA 5E9AA 2EEPA 4JV5B 1OI7A 1EP1B 1U8XX 2ZYHA 4DF3A 4KTVE 4GR4A 3PFNA 2F90A 3MLEA 3DV9A 3KYIB 4W6QA 5CLHA 1OH5A 3KL2A 3MQ4A 1OHHA 1HSZA 1P4HA 2BEJA 1RKVA 4S2UA 3ZD8A 4YAGA 4IQGA 2FUG1 5HJ2A 1NI5A 3JQ9A 1JA9A 1VL2A 2ZVJA 4JUIA 1TUBA 1P81A 2HA4A 4NYJR 4RA9B 2AR0A 1WR8A 3N53A 2WZQA 2W8BA 4I2NA 1CUVA 1F9AA 4ZCLA 2BFOA 1OX5A 1T2NA 2Y05A 3VNVA 1PJ4A 1KQPA 1JLHA 2WFAA 5AK3A 1GN9A 4TM7A 1VFPA 1NC3A 2AOTB 3B13B 2OEPA 3BCSA 1AKMA 1CS0B 3NTRA 3WLMA 4LXUA 1Z3IX 3UKDA 2EWVA 2HJSA 3CISA 4QELA 3B3GA 1L8LA 5J4HA 3AR8A 3KZ1E 1MAVA 2V7QA 3I8XA 3LFUA 3USES 5IF9A 4FCVA 5JPDA 4TL8A 1I2BA 3PNBA 4YPOA 3PHLA 3FYSA 1CQWA 1GZ4A 1OU4A 1UDBA 1YOVB 4U2EA 4XOIA 2PH7A 3NJRA 1V26A 4YJHA 4HNTA 4RENA 4EI2A 1XNJA 1WXDA 4F1JA 1FNSA 2CNDA 4BLSA 3R4VA 4K1XA 2I2XB 1M54A 3IKMB 3RFUA 1LLFA 1PQYA 1KSHA 1ZRHA 4L4YA 4XIYA 3WA6A 2G63A 5DF1A 3QOXA 2H4ZA 3IUQA 4R2XA 3QWBA 4YH1A 5FTWA 1ZC3A 1DVRA 2GZRA 4NPAA 4E3ZA 2CF6A 2OAGA 4CYMA 1IJEA 4MB6A 5JBIA 1RWPA 4FN4A 5C5DA 1WUIS 1N7HA 5B2EA 4MKGA 1ZKMA 1H65A 1HURA 2GBFA 4IJWA 2NTNA 3LP6A 4ZCTA 5CA1F 4FYVA 4XGRA 4BKPA 1FFXA 1FFBA 1DL5A 3EGOA 1NDQA 2HDWA 1T8SA 3M4ZA 1PJ2A 2NSJA 4H27A 1M1YA 1P2UA 3TKAA 2HDHA 1RJDA 3FIUA 1SZCA 2FSUA 1EM6A 2XKAA 2Y77A 1CF9A 1Z6XA 2PZAA 2QMHA 4GKAA 4DREA 2DT8A 1SK8A 3MW8A 5CU7A 2B3TA 1QTRA 2RK4A 5K0GA 3OTHA 1ICIA 4LXYA 1XEXB 1PGJA 2IA5A 3RB8A 4RDCA 4WKPA 3ZHBA 4FHFA 4DNPA 4BVAA 5D3MA 3RVPA 3KT0A 4G5SA 2QSUA 2ZAOA 3TVYA 1IRIA 3N28A 3HGTA 2ZWMA 5IT0A 4KGXA 4EEZA 5EE0A 5BUCA 1FRQA 1F7UA 4Q1AA 1I80A 3A2NA 3PI6A 4G8BA 3RGGA 4ZP1A 1SU7A 1SD1A 2BI4A 3ZS9A 2Z8YM 2UUBB 2OCAA 4LF6B 1QOPB 1JSLA 3U81A 2O7QA 5BNFA 3SS9X 3ENZA 4O4JA 2C3UA 2OECA 3DMTC 5D85A 2H51A 2O2YA 3FGPA 3HDVA 1GPJA 1FCJA 1ZKDA 2J41A 3WMRA 5BVHB 3ROPA 2OV3A 1FDSA 1STOA 2Q5JA 2Y76A 3QPAA 4TWZA 1QHSA 1QK4A 3TL3A 1DRWA 3QXCA 4FS8A 5FH9A 4U3JB 3V2IA 4QHYA 1XTTA 2G1AA 3K0AB 1A7UA 3DZDA 5IKEA 2OC4A 4JQYA 5EHZA 5CH8A 3NP9A 2QMYA 2WKQA 3GEEA 3A1VA 4IDPA 5IZCC 1H5QA 3H2KA 3ZBTA 1SCJA 4YLYA 5BT8A 3DT6A 1UJ4A 4WXYB 1DQPA 1CVLA 1JR4A 2VR1A 3ZWXA 4C7OB 4AN4A 1UCFA 3R3SA 1ZUNB 1FYVA 1LC3A 2HLHA 3ZQJA 1UWKA 1Z8DA 1ML3A 4EBFA 1BWQA 2QAGC 3EUWA 1HPLA 3K2EA 1U8EA 1CRZA 4LECA 3E61A 1BCRA 2GFQA 4AMZA 4FHZA 1DSSG 4QG3A 2BGNA 3MWGA 2DPGA 2P6RA 3VR1A 1P4AA 1Z3CA 1KXZA 1XQ9A 4QVIA 1YI1A 3CF4G 4OXYA 3SXUA 2IPOA 3COJA 2FLVA 1SB9A 4QGBA 4LF8B 4OBBA 2P68A 4RV4A 1E9FA 1H93A 2CBGA 2VP0A 4M49A 5A3RA 5K4HA 1T9AA 2VRNA 2WT8A 3O2QB 1JQJC 2QLTA 2NZYA 2O6LA 3AB8A 4MVCA 3F6CA 1EUYA 3ANNA 5HQ3B 3EH1A 1KHHA 4FZRA 4BNXA 2F43A 1VYVA 1Z0DA 2XE7A 2I8LA 3BRWA 3CJQA 3D6MA 3KJIA 2VC2B 2XJ4A 4ZQFA 5B3KA 1BRMA 2I7CA 3AF5A 4AI6A 4OBWA 4PWYA 1M67A 1WW2A 2CXRA 1PEYA 2JI6A 3NHPA 3G9ZA 1ST3A 2WHPA 5ALHA 2Z9BA 4CIYA 2GXUA 4RDIA 1LJUA 1HL3A 3V8BA 5E4FA 1IUPA 2W2XA 5C1IA 2QJFA 3PR1A 1TIBA 5EGSA 1W35A 1DAFA 1DTWA 4OMFG 2YNMC 4KGDA 2RGXA 1KMNA 1Q3TA 4WLEA 1ZK0A 2DHRA 3EMKA 4I6EA 3T3OA 1Q6YA 2VPYA 2RC5A 2WTXA 2ZUFA 4BMXA 4XJXA 4C2TA 1EM8A 1B2RA 5JZVA 5BURA 5HVNA 5JE8A 2JANA 1IONA 2H7YA 3VZQA 2JF0A 1XA3A 1JVBA 4CL0A 4L15A 5JQGA 1E6CA 4V0QA 1CEYA 3UK0A 4I99A 2GPWA 5HTOA 4J07A 4XDGA 2NT3A 4E1VA 1YQTA 3SC2A 3PEEA 3C4JA 5ARDA 2X13A 1BA3A 2PK3A 2ZWAA 1WMDA 4X1IA 4NKRA 4JCCA 1ISIA 3WYDA 3KX2A 3MT8A 4FYWA 3RRJA 3OD5A 3GAFA 1YB7A 3NNNA 1NUTA 1XCOA 1B0UA 2VF5X 2WQZA 4DVJA 3ZWNA 5EJ6A 1SU6A 3F1KA 1KARA 3O26A 3DGFC 4FX2A 1UR5A 4RKWA 3UJCA 4IIUA 3LK6A 1W9MA 2WM2A 1VDZA 3GNLA 5CP8A 3UJHA 4DV3B 2ZRQA 1OBOA 3L8GA 2MYNA 1N7GA 3T0IA 4DNFA 2C5EA 3LO8A 3MAJA 4HDQB 1WUYA 9MHTA 4P80A 1T3TA 5EE1A 2DBZA 3QHAA 3OX1A 1UODA 1M2VA 1DAOA 2EKDA 4RX1A 2AL7A 5HF6A 2ZSBA 1PEDA 2JIBA 3AI3A 6ADHA 2ET6A 1CY0A 4IF6A 3WAKA 1TECE 3FCYA 3GLVA 3K8YA 1V8FA 3W5VA 4ZZ1A 3P2IA 5ERXA 1JLLA 2JDID 1E9RA 1M1UA 2PGLA 2VTKA 5AW2A 3HLKA 1JFSA 2FN8A 3IRUA 1E9AA 1EH5A 4F56A 4JI8B 1GGJA 2XRFA 3NTQA 1U7ZA 3V2UA 2J9FB 1ZD1A 3JTMA 3EBOA 4UM9B 3A9SA 3M5PA 4YO7A 1G8GA 3D5QA 1UF9A 5AHWA 1XLUA 3VC7A 2R1VB 5H82A 4QNMA 4FOTA 3ZDYB 5L6MB 2GHTA 2AVDA 3FF4A 2GCEA 3V1KA 3VTKA 4RV9A 2XCSB 1E20A 1RQGA 1T1SA 1BS9A 4LPSA 1DG9A 1UBGA 3TIIA 1EK1A 3O7MA 1O94D 1VMDA 2JK1A 3VXKA 1G21B 2GM3A 4DC1A 2O8DA 1RLOA 1MJ5A 2I6UA 1J9EA 4WFKA 5FCDA 4LF9B 2NU8A 3EJ6A 3WRXC 2Z57A 4GPBA 1GO2A 4EB8A 4ALMA 1QR2A 1Z5GA 5EPEA 3TFOA 5FD8A 3IQZA 2AOUA 2VDVE 1JDPA 2IPMA 2AD1A 2GTIA 4KZPA 4CV3A 4DC9A 4OG2A 4ZOCA 4H7IA 4LWOA 4QARA 2EG9A 3BGVA 2ONKA 4MHTA 4KAAA 3I39X 3UAXA 2VTDA 2PKXA 1NE2A 3HLTA 2IIPA 2I3ZA 2R6R1 2Z3ZA 4GWLA 1SHJA 1J0DA 3FSJX 4QT4A 3X2EA 4DM4A 1KZ1A 3OLYA 3C1TA 1LD3A 3R7WA 3WNZA 3A05A 1HT2E 3D8RA 2A0XA 3RYFB 1XCMA 3DPUA 3ZEIA 3U6KA 1QE3A 4R54A 1GZDA 2O2JA 4XVQA 4BTVA 2O0KA 4DKXA 3WXBA 2XTMA 1FJGB 2PANA 2AYYA 2V5AA 3DAFA 3C7CB 2ZBDA 2PNJA 4INJA 5KNCA 5DNYB 2ZJFA 1TO6A 2LBPA 3PQEA 1L7EA 1QFSA 2I2AA 5CB0A 1ZN7A 3FNGA 1QJ4A 4CIBA 2F64A 5CUQA 4X97A 1JTEA 4JZKA 2D59A 2VF8A 1AGYA 2SCUA 3N0XA 4NABA 4E21A 4E7PA 2AHOA 1YQWA 1T3ZA 2E0IA 2JJ1A 3KQQA 4TV8B 3VDMA 2J5RA 4ZU3A 1YR1A 1KYQA 2C3YA 3ABRB 1CE8A 2BONA 1N25A 1G38A 5KSZA 3TIXB 2DR3A 4ADLA 1M5UA 2AJBA 1MO6A 1WDWB 2OC9A 2XOXA 4UHDA 4DYVA 1UAYA 1DB3A 3E9CA 4B3TB 3JD4A 2W2VA 3E7WA 3Q3VA 1WRBA 3NHKA 1NDUA 1OU0A 1JDBC 1LV8A 3BD8A 4BO1A 1DV2A 1FX1A 3H05A 4DCNA 4DCJA 1AY0A 2G88A 4A16A 2WVGA 1DJOA 2PLAA 4QQKA 5DBFA 2PZGA 4ER6A 1BDHA 5ED4A 3MMSA 4A2PA 4A15A 2ZRKA 3RG2A 1H1LB 3V55A 2H7XA 1XJ5A 3MGCA 3KOZA 5CB8A 1Y8QA 3SOZA 2Z9DA 5DYIA 2PGJA 2V6JA 2X9VA 3F4SA 1QDLB 2CMKA 1JHZA 4L02A 3AUTA 1E63A 2CL0X 3LLCA 2F1HA 4C0XA 1EXMA 1G3QA 2WAXA 2Z2YA 3KVOA 4GE0A 4LTMA 4B32A 3GDHA 5CTJA 1CU1A 1YDEA 1PLKA 3G1UA 3H3FA 4OGFA 2WJPA 2VPQA 3I9V6 3U4GA 2VDMB 1AGXA 2GBCA 2ZS8A 1VB3A 5EIOA 1OASA 2PVCA 4N49A 5KHAA 3C3WA 3IIKA 4CMKA 4NJOA 3PDHA 2X8AA 4B5KA 5JSZA 1VKOA 3ONWA 4WDQA 3PQ6A 2VNKA 5SY6A 4HAOA 2Q0HA 1BKDR 2Q6TA 1R74A 5KX5B 2I4NA 2I67A 2X4GA 5KYUB 1K7WA 2EGGA 1UWVA 1FLAA 1V7CA 3JSXA 4O0LA 4CQLB 3BE4A 4YBRA 5B3JC 2AV6A 1MRNA 2FQYA 2RHOA 1T5IA 1WSBA 2AFHA 3CBGA 4CLEA 1QHYA 3OF5A 1NWHA 2B4RO 2PQ6A 3TEJA 3CTMA 4L4UA 4RTKA 1D0IA 3S2ZA 4QYWA 2AUNA 3GP8A 1EI9A 2FSSA 3FPBA 1YHYA 3B2NA 3GN2A 3G2HA 3OLVA 3ZLTA 1B1AA 5IM4A 2E48A 1W1UA 1F48A 2FSGA 4LTNA 1ZCZA 3D8BA 5F76A 1F38A 2WMNB 3NKVA 1ZVJA 2FPIB 5G3YA 4DTCA 3LE8A 4Q0MA 1ISJA 3LHKA 3KOYA 3SEAA 1W1IA 5EIAA 2VH5R 4EYSA 4ZALA 1A9RA 1IZ9A 4TS3A 1TM7E 5HDQA 2JLZA 1X1DA 1TTQB 2D5AA 3EXG2 3QV2A 4RD2A 3UYKA 4U2GA 4EY7A 1KEKA 1SCBA 3NDBB 2YN4A 5HMLA 4OF4A 3THYB 1QH9A 3OZIA 2HGSA 1MA0A 1PBNA 5FA5A 4EUHA 4KKXB 5DSXA 1QSGA 1VE6A 1U1GA 4LHYA 2XB4A 1TMGE 2GBLC 4LV6A 4MRMB 5CXQA 2VJOA 1Q5PA 1P1JA 1F4PA 2ZJ2A 4IGIA 1L7PA 3UK1A 2ZCJA 3R5FA 3PX3A 5FNVA 1ML4A 2QM3A 3G2KA 3ZHVA 1FP4B 2AR9A 1Q7TA 4BFYA 3IIMA 4IINA 3G1WA 3A9TA 5JS2A 3TRDA 4AXBA 1VP3A 2FY8A 3NEPX 4WNCA 3IGFA 1SHZA 2TMKA 3E82A 2FWBA 4HZGA 3RJMA 3DVAA 1FFHA 4NXMB 3LC2O 1VCIA 1D7AA 1NM5A 1YIDA 2ZBFA 4MYRA 4G24A 3RIXA 1W0KA 5ULLA 3VFDA 4J0IA 1Z7GA 1DPFA 3CO0S 3HU5A 4R1MA 4ENRA 5BW5A 1ZICA 3G3EA 2QTVB 3AL2A 1PT8A 3UB3A 5KYTA 1CZNA 3W7BA 4MUIA 4E2FA 2ECOA 4EENA 2EKLA 1TQ4A 1PK7A 3HSYA 1P18A 4WLVA 5FV4A 3GNSA 2GO7A 2ZJYA 3OBBA 1PV4A 3KTDA 4U7PB 3HPRA 1HFWA 2Q29A 2EL7A 4M1TA 4UHKA 4LHWA 1JG1A 4J0CA 4L5CA 1KEZA 4FFSA 4LE0A 1C7IA 3U4IA 2XCLA 4OSPA 3BK2A 5C31A 4D9MA 3CGWA 1ATIA 2QTRA 3UWKA 1NVAA 3DXFA 1OUMA 5JVDA 2J31A 3TZEA 3LU1A 2R84A 2VRCD 3V7UA 3RVNA 4E08A 1AK2A 1RVDA 3EGEA 4JT9A 4KFTA 4ND5A 4U5XA 3ZNNA 4BVEA 4FDVA 1C0LA 3VH3A 1VE5A 3LYAA 4JNKA 5TGDA 2Y0DA 2IHZA 5FWYA 1WXIA 4K2HA 1TJ3A 2QKYA 3ZVMA 3F5SA 4MCIA 1LQUA 1OLUA 2EGHA 4RADA 5IBPA 3B5IA 3CW9A 4C07A 4LMRA 5BWNA 4GO1A 4BLVA 1FUKA 5CVUA 4H1TA 1VC2A 1GG8A 4P86A 4LK3A 5K0ZA 2RB5A 4R68A 2C3PA 1OLOA 2AEMA 2P0AA 2ZQZA 4UCFA 5JCOA 4YUZA 5HRAA 5DYGA 3DM5A 1D9XA 3WISA 1AC5A 2GAOA 1HQYE 4YMWA 5FPTA 1CFZA 1NYRA 1EESA 1B73A 1E2QA 2HQOA 2O4CA 3RU7A 3MF4A 2X75A 1ZY2A 3BORA 4BNMA 5JCJA 5LQRA 2BI7A 2C0PA 2EX0A 3VR6H 4GZ6A 2JRCA 4BY9E 3A2LA 1DBSA 4CF3A 4ZO8A 1P73A 5ALIA 4IX1A 1EWRA 2YMLA 2JIMA 2X58A 3QU9A 3WVNA 3G1TA 2WAYA 4I4TB 4R1LA 3WDKA 3UGQA 1DUSA 2YY5A 1SU4A 4JGGA 4HVCA 2ZE8A 4GLBA 1AQIA 4GWGA 3TLKA 2VQDA 1S8NA 1FS4A 3LOQA 5FL7D 5CX1B 1ECJA 2QRVB 3CVOA 3P2JA 1HNWB 3RK4A 4PQYA 1VI6A 3EFOB 4M86A 4JFRA 3DOHA 1E3JA 1O95C 3OQPA 3OZCA 3ND7A 2HCTA 1W5AA 2C92A 2ORVA 4ARBA 5HQTA 1A8UA 1XZDA 2A9JA 4NAVA 1KAHA 4Z7QB 1OXMA 4RXMA 1QH8A 3U4QA 5LP6C 1TEZA 4Y6RA 1GZHB 3AI1A 2VTEA 1UXJA 3E15A 3PZBA 2ZIXA 3PD7A 2F17A 2HDOA 5AJYA 2WIFA 2D0PB 4D3DA 3VKWA 3F8SA 1GCGA 3FLAA 2YHIA 5JSHA 1PD1A 4BVLA 5HDBB 3ZGVA 2GJAA 1CC1S 3JQBA 1QH1B 1LDGA 1LSSA 2ORED 5B1HA 3UWMA 1XPOA 1VBFA 3MLAA 5IAJA 4F91B 3OJOA 1J8VA 1SQFA 3P9CA 2H59A 1CUUA 3NYQA 4MLZA 5BWBA 621PA 5CDSA 1C4WA 1ENZA 1HL7A 3E2MA 3KUDA 4YJ3F 4CL8A 3TUIC 1XL1A 5KTOA 1HY0A 3WK5A 1IHPA 1R0LA 1W0JD 3IVCA 2P2ZA 2ZUEA 5CB4A 2YV5A 4UM5A 4ZIRB 3OU2A 3MJSA 2QMQA 1SCUA 1ZQ9A 4X66B 4EP1A 2VNAA 1PFUA 3ZHZA 1UMCA 1DAGA 5TSDA 1DTEA 1LXCA 4HH0A 3SR3A 4AM8A 4JH0A 1T9BA 1PEKE 2WKWA 4IZOA 1ZLYA 1PZFA 1PGQA 2GZ1A 2XQIA 3BDIA 3D8TA 1W48A 4HQOA 4HS9A 4RFSB 2R9VA 4RSHA 2C2OA 1EFPA 3AO0B 3PQ3A 4TV9F 5K8VA 4C14A 3TF5A 5FPPA 1GA6A 1J8YF 4LWPA 2QMOA 2BKLA 3V4PB 5A5VA 2X0EA 4GF5A 3FZNA 3IE1A 4ZRDA 1XDUA 3R9KA 3GMTA 1CJMA 2R8ZA 1W25A 2AI1A 3O8BA 1YC5A 3CE9A 4P36A 4ZU6X 1YIOA 3WK8A 3E7XA 4C88A 1VZ3A 3UA4A 1MU0A 3P9PA 3GFVA 3QEAZ 2WPDD 4I5IA 5ICMA 5BNTA 1EXVA 3LHDA 5JDIA 2BN4A 4XB1A 5D7BA 5D1HA 3EZXA 1JQ3A 2WIBA 1CY7A 5IAKA 4CEIB 1CJTC 4OFWA 1UFVA 4YAIA 1NN0A 4I2VA 3CLRC 4ZYLA 5CCEA 2GPNA 4BYMA 5IU6A 4AS1A 4Q4LA 3SVTA 3DTNA 1YS4A 2GT1A 1E2GA 1Y5NA 3EOBI 2B78A 3A8TA 3OO1A 1A8SA 1HA3A 2PN1A 5A2QA 5FQOA 4UTXA 1NURA 1R1DA 1KZ6A 2FW6A 2RGCA 3R4CA 1LBHA 3WNCA 1TUGA 1N4AA 2VXYA 3T7TA 4FNGA 4UZFA 2VAWA 2YZGA 3OCJA 1QE0A 3EVGA 1GKLA 4YCDA 1O87A 4WKNA 2VXCA 2DFDA 2HSJA 3LCCA 4C0QC 3PEUA 3S28A 1NGSA 3C85A 1G8MA 4HWGA 1JNXX 1G291 2FSVC 2QHXA 3KQPA 2YHBA 1VE9A 2ZSJA 4XIGS 4Z9FA 5A9RA 1TL7C 4TRRA 2Q0SA 2W2OA 5TGTA 3I9MA 3FNIA 2ZIEA 3KU1A 3R09A 5L7YA 1C9NA 2WU4A 2XB9A 4ZQGA 4GZ3A 5IUJC 1EAYA 1S2OA 1YQ9A 4DSNA 4NDNE 1P1FA 3S6JA 5A4MS 2ZB8A 4XWTA 3GP5A 3V9PA 1DPGA 1Y5MA 1RHRA 3HXQA 4U7JA 3OHSX 3KSAC 1GDHA 1UIRA 1RS0A 4B7CA 2OV1A 1Y1TA 3F5QA 3LKVA 2Q3EA 3UA3A 4RYDA 1PZNA 1OREA 1ZJ5A 5HX7A 1O94A 3U9SA 4N4AA 5JISA 2HX1A 3ND6A 2YZ2A 2CW5A 3CH6A 4B75A 2Y99A 4UREA 1POXA 2P4HX 2RAVA 4MQ4A 4R2IA 2PXCA 5E4TA 3QVSA 1N57A 5JH7F 2GJ4A 2NQ8A 3FOBA 1WOYA 3KJNA 4OKNA 2FXVA 3PQDA 1PVDA 1JB1A 4NBSA 3FUTA 4YJGA 4BYGA 1XEAA 2YN0A 4LCBA 4IXWA 1PZEA 1ID1A 2IZ0A 3B3JA 4GVPA 1R0WA 1YS9A 4YRJA 4RGYA 3QJYA 1L7NA 1WXHA 3PCXA 4O5OA 1G98A 1MFZA 2F6RA 1V3VA 1PTJA 4Y2UA 2IH2A 3ZR4B 1CQJA 3W34A 1JHXA 1X7XB 2DQSA 1JR3D 1UBOS 3M1IA 3M6AA 4H4DA 4PWZA 2GPSA 1SKYB 4G26A 2EJUA 2NO7A 3HZRA 4EQ6A 1JS1X 3V32A 5DLYA 5AKEA 2R8XA 1U3GA 1ONNA 5TIIA 2I6QA 3KSMA 3U4AA 1P6QA 3DWIA 2OHVA 5JDCC 1E59A 1WNFA 3BSSA 4OHCA 2HJVA 3I04A 1REQB 3U0BA 1L7DA 1OAKA 1NSTA 5E7JA 4OQZA 1C7RA 4ENVA 5BN1A 3LUFA 4C0SA 5F2NA 3LYHA 4BPBA 1MJGA 2XWBF 1BHJA 4FYXA 3ROXA 3GLFE 1EUQA 4QXPA 3ANXA 4IJUA 2VEDA 1M2NA 1P0QA 2DLNA 4K03A 3O73A 2VRBA 3PFGA 1X38A 3QUCA 4LQCA 5AW8A 5KWIA 4BZQA 4R5HA 2X23A 4D3FA 5KNDD 2GZDA 4C6RA 1WBDA 1GTSA 3LUCA 3PDJA 2HN9A 5EP3A 3E03A 4ZYUA 1AKUA 4PCLA 3HCFA 1PEAA 4WZAA 2I9KA 2D2FA 1CUWA 5AQ1A 1THMA 3OFKA 3RAGA 2QZZA 4EY4A 5AUQA 4B8ZA 4X44A 1SVSA 2QVBA 2UUCB 1GGEA 5E2AA 1XVLA 3N2GA 1XZHA 3PXUA 1IDN1 4HXYA 4EH1A 4EG5A 5JUWA 5KU7A 1RYBA 2OHFA 4L07A 3S27A 3F8WA 3GB9A 4D43A 1JWAB 3U17A 1KEEB 3S2SA 3MTDA 1NBAA 4JX8A 3KYBA 4A0SA 2PD4A 2ZG6A 2H8KA 5ALJA 1E79A 5GONF 2XB2A 1U2RA 2CLFB 1H0RA 2QRNA 4CM7A 3TMAA 3IOCA 2AMJA 3OE7D 2H1OA 2GCIA 2REXB 4RK5A 2LGJA 3ZV5A 2WQ6A 2ZFUA 1XPRA 1T0PA 1UMDA 1T1IA 5IF3A 1UWLA 5JWRA 1KXJA 4ZPJA 4K0KB 3FPJA 2FJ0A 4MTCA 4J1TC 2P3QA 1MXHA 4LRUA 4M0MA 2YRXA 1W4LA 3TH5A 3GCDA 4D8XA 5KWJA 1W94A 3FCCA 1G5TA 3QPDA 4CM1A 2XR1A 2AZ4A 3OIYA 1G42A 1M1XB 2PXAA 4YECA 4YHBA 2OLEA 2W00A 3DYBA 5E38A 5DPMA 4EO7A 4W9NC 4XLTA 1AIPA 1C1HA 2PLFA 3R8CA 2ZUVA 1JF8A 4NATA 2HD4A 1WCXA 4DSAA 1OYVA 4EYOA 1E3MA 2IHYA 3CEAA 3NBUA 2IHNA 2Q6OA 1A76A 5COAA 4P3KA 4INAA 1N6PA 5CH5A 3TE7A 5ALLA 3BWCA 4ILKA 4Q3KA 3QUSA 2CDRA 3U1TA 4D92A 1WHTA 5WRFA 1M1NB 3I09A 3WRWA 2OBLA 3KAJA 4CUJA 2VPZA 4NS4A 4Z0TA 4CU5A 2XX3A 2F3SA 1R12A 1AB6A 3JD0A 4K26A 3OIGA 3HNPA 1BXKA 1G5FA 1WUJS 5EA2A 2CSUA 1OIXA 2OQ2A 4CCWA 4XWAA 2AE2A 1C0KA 2HQSA 4B3RB 1MX9A 2WTBA 4ZYVA 2B9EA 3BMCB 2PVPA 4DR7B 4J91A 4EY5A 1GGKA 2XUDA 3SX4A 2XTAA 2ZUBA 3F5DA 2R4UA 4XQ0A 4YXFA 2JGEA 2XWSA 1FXSA 1FQOA 4PANA 4R1TA 1BH2A 2WP0A 3IAXA 1JWLA 5L3SB 1HYQA 1F17A 2PZLA 3KZVA 5JXJA 3ICCA 2K6GA 2ZUSA 5H16A 1NXSA 3Q41A 3U49A 5GVSA 2FPKA 2AA3A 5LQNA 1ZGCA 5HKBA 1FSZA 1DFIA 2QDXA 4N3NA 4X54A 5JALA 3OX2A 5M34A 2WWRA 3ZZNA 1E4VA 3H7IA 3DMHA 4X71A 2FK8A 4MUGA 1XRQA 4PSKA 2Q50A 3V7WA 2QVGA 3BM5A 2P1ZA 1PNVA 4H6VA 2H4FA 2WZCA 3CPSA 5TMPA 4F3TA 3HO1A 2F59A 4FQ7A 3MAAC 2OPBA 3OFNA 2AGVA 1K63A 4EUNA 4LNHA 4QUJA 3PTZA 2RK3A 1RACA 1TUBB 3TAXA 4OBEA 1SURA 3RVKA 1HNNA 2H0RA 2XF2A 1B0ZA 4UE3S 4MYHA 2VHVA 1KZHA 3VNQA 4BEWA 2V9ZA 3KQMA 4OI0A 3RSFA 4L9WA 4UC0A 2FFAA 4FHEA 2Q6IA 2QP9X 2CXUA 4E88A 2JCVA 4U9HS 1QX3A 1N5DA 3AESA 4ZTBA 3R3XA 2Q7OE 2P6UA 4GD3Q 2M9MA 1NZDA 3N74A 1YZHA 4PYQA 5CYPA 5FHRA 4ZOLA 1C9EA 1WVGA 4F5YA 3C6BA 2YV1A 1A96A 4RMGA 1F14A 2Y9MB 2IDKA 2QUJA 2HCFA 3PQ2A 4Q19A 3W0LB 4EI9A 3DEHA 3EODA 2C96A 1TKRA 2GZSA 4FZ3A 2E1PA 2GEDA 5CLIA 3QX3A 1OSNA 3B48A 2Z6QA 4YJHB 1DIGA 5FFMA 1QVVA 4UZSA 1AT1A 1DC3A 1JEJA 2VAVA 3HVIA 2FOIA 3PXXA 5EFZA 3WRYC 3Q8MA 1N2OA 1PK9A 2H1RA 4BMYA 2LZ0A 4BNUA 4MCAA 4BKRA 1Z0KA 5K3BA 1C3VA 2PG3A 1N33B 1UJCA 5EZQA 4XJVA 1GGVA 1RAHA 4E6EA 3PGA1 3HFGA 5KYNA 4M53A 3HCRA 4FHCA 4MNTA 1VGVA 1V7PC 4WH0A 4QVKA 1FVHA 3A7EA 3HNRA 3D6NB 1EFLA 1GL9B 3IMCA 4OA5A 3TCNA 3KPUA 5JPIA 4IR7A 4LVNA 3DNFA 5CEJA 2V1UA 3F3SA 3WKEA 4P31A 3PLAE 5B36A 3KVVA 4AURA 2E2WA 1V3QE 3BB1A 5JS8A 4J16C 1VMAA 1U9IA 1XAIA 2EEZA 4AS3A 1FFXB 5IUKC 1HKHA 2Y93A 3SIXA 1NP6A 1OROA 2A33A 2OCGA 4OLAA 3GRKA 1M1YB 2XY4A 3LPNA 5IFLA 4MX2A 1F4LA 4JKIA 1IN4A 2A9KA 1I4WA 3W8NA 4OK5A 4EHNA 3WIOA 3SYKA 1P62B 5JFTA 4Q3CA 3HCWA 2HNBA 1LZKA 1D6SA 5D3MB 1NVBA 3P4YA 4JLWA 3ZDBA 2YWJA 5ILOA 1WG8A 5D87A 1NL3A 2VJAA 5BWOA 2XA2A 1DBQA 4IRXA 3ET5A 2D4HA 2R6JA 3IT1A 4ZVNA 2FMXA 2ZSFA 1CDEA 2KX7A 3BWYA 2A5LA 2JI8A 3N1UA 5LDDC 2RBEA 1C7QA 1SCNE 3KSBC 2ZSAA 4XGIA 4JP2A 4BFSA 4N8DA 1T0HB 4IS3A 5FL7A 3T99A 5JI3E 1VRCA 3ZDAA 3DO8A 3ELDA 4KO2S 4O4JB 4OGGA 4US1R 5ELMA 3STYA 3PEWA 2IODA 3RBXA 1RPZA 5KTPA 4YGYA 3ZWDA 3TLGA 3IVAA 1CDZA 2NO5A 2IP4A 3TRFA 3UM9A 4DUGA 3FBGA 1D1PA 2IT1A 4X8MA 1XJ0A 1EX9A 3OCWA 2GFHA 4AQ7A 3JAWA 5DEIA 4A0HA 1P2GA 5F5LA 4AZTA 2GI4A 2GEVA 4WOCA 1IN5A 1TEVA 2REOA 3W2IA 1YAHA 5TPZD 9LDTA 1GFSA 5IPFA 1VB5A 1HV8A 4JI2B 4M76B 3W5JA 4E5VA 3ASUA 1O8CA 3GO4A 2OD9A 3MCUA 5TQJA 5H9VA 3QE2A 2IF2A 3CB2A 4HAIA 4XEHA 3R6VA 4HDRA 3G8DA 3SSAA 3OQNA 3E1SA 4G41A 1KO8A 4EJMA 3VYVA 3OZTA 1RM0A 1ONOA 4RL4A 3EFHA 1C29B 3HMKA 2BUBA 1BCRB 2QK4A 4JJKA 3A28A 1OT3A 2IQ5A 1A98A 3AKYA 3WMFA 1SBIA 5ESWA 1JIVA 4EEXA 1KIMA 1Q19A 2OHJA 1A9TA 4G9GA 4IUBS 5BMVA 3SXUB 1AD2A 5D5QA 2QY9A 3AUXA 1RM5A 2CUZA 1TRKA 3AHFA 3OQVA 3PE3A 4N54A 3UNXA 3AVWA 1PFQA 5A5DA 3FCAA 1NNEA 5EKXA 2VTVA 1MNQA 5ALMA 3TQIA 4JP3A 2IHVA 1G20E 4K9OA 1F0PA 3WOVA 5K2OA 1WZEA 4OB6A 1XEFA 2BF7A 2ETVA 4G1MB 1CZHA 3K6SA 2F43B 5FQNA 5BSGA 3DLTA 3X3HA 1K89A 4HG2A 4KUEA 4F2GA 2YR0A 1JILA 3QU4A 1NA5A 4G86A 4IWXA 1W19A 3L18A 5F77A 4PY2A 1GL3A 1EXDA 2IE0A 2IBTA 4DMCA 1YBMA 4Q12A 1RMTA 4V2IA 4LEIA 2WHPB 2RHLA 4EWLA 3BSWA 2I62A 2WYIA 4NYJQ 3H5RA 2Q6KA 1IOVA 1EZ1A 3W8EA 4WEOA 4ZI2A 3W2GA 3X1XA 5F21A 1A1VA 1D2EA 1GKUB 1E1QD 2MDTA 1ZK2A 5IDVA 3VC2A 4C7BA 2UZIR 1H2AS 4ZTZB 1KI7A 2BTEA 2C84A 1M2OA 1YULA 4IQ8A 2RCNA 1QG2A 1QO9A 4QBTA 1XMSA 5IMSA 5K5EA 4BE7B 4H18A 3I1IA 3G88A 1N2BA 4RDXA 2XMPA 3H17A 3KTAA 3E3OA 3VBCA 5K3EA 5KJ6A 1X1TA 4RVDA 3VDXA 4OI1A 4L9RA 4RNCA 1RZRA 4IWNA 5DBIA 5DO9A 1VJ1A 4ZAWA 1VKRA 2GN8A 3JQQA 2H54A 3BRCA 2AE1A 5JQGB 3RTCA 3HO8A 4BU1A 1GITA 5AJVB 4CN9A 1Y7HA 4QLBA 2VG8A 2W6PA 3JARA 4G67A 4HH3C 3T34A 1EJ2A 4CKWA 3SC2B 2Q28A 3OCVA 4J9VA 1WTCA 1CY6A 3U26A 1Y4DE 4X1IB 3T3PB 1H2EA 3P9IA 4FZ5A 4ZDIA 2W93A 1EDDA 3AH8A 5C32A 4CLRA 1V1MB 3E05A 2AW5A 4NDAA 4LGYA 3TGPA 2AN3A 4JT2A 3ZEAA 2Q4DA 4CTJA 5K4AA 4B43A 4IHQA 3V4OA 1K7YA 2UXBB 3Q7QA 4A0QA 3I2YX 4MV5A 2RHRA 1JRLA 1VLHA 4XQGA 1A27A 4ZO4A 1N9GA 5JXIA 4YCMA 3MJTA 3PR3A 1I0ZA 1OZ0A 3WG9A 4BNKA 1AM4D 4KX3A 1IPHA 1UM9A 1UT5A 1G7TA 1Z2CA 3GV0A 1FDIA 1E5VA 3WJ2A 5IHXA 5FWDA 4HD8A 4B40A 4KWIA 2ZBRA 1M2VB 4PZEA 4UKDA 4ZI7F 3MCVA 4E46A 3BMNA 4MITA 3VKGA 4AF6A 1VZ2A 1SXJC 4IJVA 1ADYA 3I72A 5JR3A 4WXRA 1YH3A 4U0JA 4E2ZA 5EYPA 3VUFA 5J58A 2PSDA 2PQMA 2XAAA 1JLLB 2J6HA 4JXJA 4OQMA 3SDBA 3ZS8A 4RPHA 4FDMA 3T4PA 2C82A 4Q4AA 3UH1A 4RD4A 1QUFA 2B94A 2VF7A 1H1TA 3OM9A 1DRJA 1DEHA 3JQRA 1RXWA 1JL3A 1LK5A 5F2EA 3IP1A 2HGZA 1TF2A 4KQ2A 4WLOA 2P2NA 3R20A 4LDPA 2CFTA 1AE1A 4BKUA 4QOFA 4N48A 4ER0A 4BNYA 3P5SA 2SKDA 3G9QA 1VE1A 4I4LA 2Z98A 1CQIA 4JFAA 4YK7A 4AZSA 3IDFA 2A1TS 3CM0A 1GADO 1XQ1A 1OFGA 2ENWA 1Q20A 1QIJA 1Z0IA 3H1GA 3IXQA 3NBYC 2YOHA 3NHRA 3AUSA 1NLFA 2K87A 5T4HA 4UDYX 2GLTA 4BBPA 1B26A 3A3KA 2B36A 5D51S 3ZE9A 4A91A 1XGKA 2NU8B 4BX0A 1DGQA 4CF6A 4Q9HA 1KQ3A 2VNIA 3UXHA 3FPHA 1OJLA 4IJ6A 4CLDA 5AI6A 3ZQKA 4WA7A 4G01B 1U7XA 3ZQ4A 1X9IA 1C3OA 1K5PA 3E5MA 3H4VA 3ICWA 1WVIA 3ZY6A 1XDSA 2X4DA 2WOJA 1B00A 2X6RA 1VRWA 2P9JA 1UFKA 3OCUA 4RK1A 5ALEA 4ERNA 3FUXA 2ZR7A 1OXSC 1SCIA 3LXUX 3TQFA 5AI9A 2FCAA 2G72A 1QKJA 3AR3A 3LWNA 2M1XA 4HEA6 2R68A 4ES6A 1VIMA 4KN9S 3COVA 4WWHA 3R7WB 4GPAA 3H86A 3IPRA 2BHLA 1ECBA 4PLWA 3ILVA 4UTRA 1DQZA 1KI8A 4B87A 2FUNB 2WD7A 4F21A 1R37A 3HJRA 3AR5A 1JR2A 1UBCA 5HIKA 4UE6A 5CNIA 2YYZA 1FLDA 3G5UA 1E8NA 3QU5A 3RNLA 2B92A 4A8PA 2SCUB 3ZD7A 4HZUB 1FQKA 5EE9A 1RLJA 3BE5A 1P2VA 2WWHA 3KYDA 2CFIA 3H83A 4YRBA 3JQ8A 4R7ZA 1O77A 1CE8B 3DE7X 1KMCA 1WCYA 1YT5A 2O9JA 4FBLA 3UKOA 3P0IA 3VYUB 4JMPA 2X40A 3KOMA 4MR8A 4CTMA 2XH8A 3ZIAD 1DC5A 5C35A 5J4YA 1P5JA 3MHPA 2PBZA 4MRAA 1S8OA 1J2UA 1ZO8A 3KLPX 3MMNA 4TUYA 3O2NA 5IC6A 2XT9A 3T9DA 4XH9B 2VUTA 3A4IA 3AXSA 3FCOA 1QCZA 1ECGA 4YS6A 4IOKA 3NVAA 4G8JA 4IICA 4O8ZA 4RF4A 4D9BA 3CUYA 4EUEA 5AW3A 5DOZA 1G8HA 3G0OA 2FQXA 5KO2A 3DAGA 1C0IA 1VJ0A 2QW8A 4HCJA 4EHKA 4MLDA 4I6JA 2HU2A 1QC5B 2DUWA 1EEXB 3UUWA 3O7WA 3M8KA 3KUXA 3P52A 3K9NA 2RGYA 2C88A 1OPRA 2JAPA 1GKIA 3JCZA 3ZXYA 4B79A 5CXUA 2HT1A 1GKKA 2Y1WA 2O1EA 4ACAA 3P97A 1Y8QB 3T15A 1BE6A 4B33A 5I9LA 1UC9A 4U2CA 4N8SA 3QXHA 4K6GA 3D4BA 1R8XA 3H5VA 3G13A 3L41A 4J3NA 5ADWA 1TYBE 2Q4BA 1AOXA 4D46A 1EJ0A 4I55F 2JLAA 4UHBA 1G5HA 1ZGAA 3L1JA 2V45A 4CM9A 2FEMA 2A1TR 1VJTA 4CF5A 2Z0MA 3H4TA 3JQFC 1G2QA 1WVMA 2FR8C 2P9BA 1PR0A 1DQSA 2QTLA 4HFRA 3NR2A 5DP2A 5JSZB 2REQB 5AJWA 1SVNA 3UATA 1J49A 1F1JA 5K3FA 4G0WA 3H9BA 1TKBA 1V48A 3GFQA 2POQX 5EZYF 2OHGA 3HB1A 3O84A 4WY5A 4ZREA 4QO7A 2WR8A 3K9HA 1C80A 2O2CA 4O3FA 4IHKA 4X61A 5DT2A 1J2RA 3RSGA 3GW8A 2AFHB 3AILA 4B2PA 3UBTA 4YJKA 4WY8A 1ZNYA 4L50A 3SY8A 4LGCA 2IYWA 1KOJA 1RWWA 2AI3A 2X1VA 3M5WA 4N3AA 3WK9A 2OFPA 2WYOA 3Q2KA 4JC4A 1M7BA 3VYWA 3VKHA 4UTOA 4HRXA 2W2KA 4F4DA 5REQA 4P58A 3V4FA 1KYWA 1VPLA 2OCBA 1SULA 3IE0A 4K40A 2QUIA 3HI4A 4YQYA 3TLBA 3RUAA 3A3YA 4Z1MA 3B51X 3OIVA 2RH9B 2XDWA 1FQJA 4NK4A 2IUTA 1R0YA 4X64B 2OT3B 4XDZA 4EAAA 1ZHFA 2W4IA 4LDRA 4CMJA 4FGWA 1DOZA 2CMFA 3IAS1 3T9CA 1FK8A 1YKGA 3L82B 4WCFC 1ZJZA 1J2JA 4IFTA 3SKYA 4EYGA 1JAHA 3DZGA 2VP3A 16PKA 2YWEA 3Q1LA 1MOSA 2O3JA 4WMLA 4X8OA 3JASA 4HQNA 2DGDA 2NAFA 2NO4A 3IEIA 4OVKA 2RI1A 5B7PA 3AIOA 3VTFA 1N1EA 2FMHA 2IYYA 3G23A 3ITNA 3H97A 4Z9XA 4LVUA 1KDVA 1MTZA 1WCIB 1O54A 2EBHX 3N2KB 4HO1X 3MTQA 2CLMB 3UQYS 2ZYUX 1MDFA 2GMWA 3Q15C 2M6KA 2MTBA 1E7RA 1N92A 1EE1A 2HMAA 4IIGA 1IXRC 1XZLA 4OHXA 1ORIA 3C8HA 1C14A 4RM2A 5BP7A 4V0ME 4CUZA 4N0EA 1E1CA 1N75A 2A1UA 4BXOA 3JRWA 3R2JA 4BLOA 3WLRA 1VKJA 1A8PA 1RXUA 3VR4A 1Z4IA 4WBNA 1KIAA 3KCQA 5BQ5A 2QN9A 3UBMA 1OLXB 2WM3A 4JLOA 5DM70 1F20A 1AX9A 5JSQA 3SR0A 1J7JA 4FHGA 3A6HA 5NULA 1JJAA 1H0SA