4NFLA

Crystal structure of human mitochondrial 5'(3')-deoxyribonucleotidase in complex with the inhibitor npb-t
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
201
structure length
201
Chain Sequence
SNAASGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformationally constrained nucleoside phosphonic acids - potent inhibitors of human mitochondrial and cytosolic 5'(3')-nucleotidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 5'(3')-deoxyribonucleotidase, mitochondrial
total genus 69
structure length 201
sequence length 201
ec nomenclature ec 3.1.3.-:
pdb deposition date 2013-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4nflA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4nflA01
2B0CA 4IG4A 2W43A 3KOOA 3BWVA 1U7OA 4BX2A 5AVYA 3DAOA 3L1UA 3WKAA 3AR4A 3ZI4A 5ALZA 3ET4A 4KYTA 4AS3A 1K1EA 3ZWKA 4EX6A 3PGLA 4I9GA 2AH5A 2G80A 5AM3A 2FI1A 1RKUA 4UU1A 2PKEA 1QQ5A 5ALIA 5AW8A 4UATA 1L6RA 4Y3UA 4ZEWA 1RPZA 2BY4A 2G1AA 3B9RA 4Y2JA 5AKHA 2ZBGA 3L8FA 4UM5A 1RLMA 2PR7A 2B1RA 2DQSA 1L7PA 1RMYA 3AR8A 4Y2TA 3SF0A 3EF0A 1RRCA 1AQ6A 2EATA 3QU5A 1JUDA 5AVQA 2WF5A 4C4TA 5ALKA 5AKXA 2HCFA 4HGOA 1L8OA 3KD3A 1EK1A 3KC2A 3FM9A 4UM7A 2FEAA 5AW7A 2HO4A 4XE5A 5AKKA 4KNVA 1NF2A 3I28A 4FFDA 5ALQA 3I76A 4MWOA 3L8EA 4KNWA 2WF9A 2G07A 1Y8AA 1N9KA 3CNHA 1RDFA 4E88A 1WPGA 5ALFA 4H1WA 1SWVA 5AIAA 3E8MA 3I1YA 1J97A 4QJBA 1Z5GA 2G09A 2FPUA 4Y2RA 3W5DA 2I7DA 4CF5A 3QU2A 4BX0A 4ZEVA 3AR6A 1QQ7A 4HGRA 5AVTA 3CZ4A 1Z4NA 3ZVNA 4AP9A 3ET5A 5AVUA 2GHTA 2YMMA 2P69A 5A3QA 4B6JA 3U26A 4G63A 4YCLA 4ZEXA 3FZQA 2JAOA 4C4RA 3ZUPA 1VFPA 4CNQA 3QU9A 2G06A 2YMPA 2EAUA 1O03A 3A3YA 1O08A 1L8LA 1XP5A 1U2TA 2YFYA 3GYGA 4GIBA 5JJBA 3IB6A 2FPWA 3A1EA 5E0OA 4JDPA 2JARA 2NYVA 4QQFA 5ALHA 2B1QA 1CR6A 3QYPA 2WHEA 5AKJA 4UU0A 4OFZA 2AUTA 4G9BA 1Z4LA 1EK2A 4Y2YA 1TA0A 5ALGA 3FPSA 2CFRA 3QGMA 2CFSA 3WK8A 2CN1A 2IA5A 2HX1A 1QQ6A 4EEKA 5AM0A 4NFLA 3EWIA 3QUBA 3A1CA 3U7EB 3I6BA 1L7OA 2IOHA 5AVSA 2EARA 3OCZA 1MH9A 5AVRA 2R8XA 1ZRMA 5AM5A 2YBDA 5ALMA 4BBJA 3AR2A 1S2OA 4BX3A 2OM6A 3L5KA 2ZBEA 4L6AA 3E84A 4Y2XA 2HF7A 3WGUA 3AR9A 1Z4PX 3QUCA 2PQ0A 2IYEA 3BA6A 5AI4A 2VKQA 2C88A 2IOFK 2MU1A 3NALA 5AK5A 1RLTA 1NNLA 1SWWA 3AR3A 5ALVA 2OYCA 3AR7A 4BEWA 3F9RA 3RFUA 1PW5A 3L0BA 3HLTA 3FGOA 3ZWDA 4YH1A 3N28A 5AM4A 1X42A 1RC8A 3QX7A 4L57A 2IOFA 5IT4A 5ALJA 2YJ4A 3SLRA 1J8DA 3ESQA 2BDUA 2RB5A 2OBBA 2B30A 3L0CA 3R09A 3OCYA 3EPRA 5IT0A 2AMYA 3M9LA 1ZD3A 5ALXA 2WF7A 3L1VA 3IJ5A 4PNHA 1Z4JA 4HYTA 4MUMA 1Z5UA 4BNDB 5AW0A 1L7MA 3B9BA 4UMEA 3SKYA 3PDWA 3QU4A 1U02A 3PGVA 3OCWA 4GXTA 3UMGA 4O8CA 5AW5A 1KYTA 5AW2A 2FDRA 3QLEA 1Z4QA 3DNPA 4XOUA 1RMTA 3U13A 3E58A 3SD7A 3WK9A 2G08A 1TJ3A 5AHXA 2Q5EA 3WK7A 1Z4MA 3QUTA 5AK6A 5A3SA 3MMZA 1CQZA 5ALEA 2W4MA 2QLTA 4CF4A 5ALUA 5AKYA 3IRUA 1F5SA 2HDOA 4RETA 3TLMA 3WK4A 3WK5A 3DV9A 2QYHA 2YJ3A 3ZVMA 4YGYA 3QXGA 2B82A 4KX3A 1FEZA 4NAVA 4UMDA 3KZXA 4Y2PA 5AM1A 2JGAA 4DWOA 5ALYA 3ZU6A 2HOQA 4YIHA 5AI9A 1Z88A 5AW9A 3ZTWA 1T9ZA 4BKMA 2WFAA 2ODAA 2GHQA 1YMQA 3N8GA 4UARA 2YJ6A 2YMLA 4HGPA 2WF8A 3ZX5A 2ZXEA 3L8GA 4UAUA 4YIKA 1YNSA 2C9MA 4OHFA 5ALWA 3NANA 4KN8A 3VAYA 5AVVA 2ZOSA 3QU7A 4YCMA 1Z4OA 1S8OA 1VJRA 3K1ZA 4BEVA 4FYPA 1ZJJA 2P9JA 3ESRA 5AM2A 1L7NA 2R8EA 2I6XA 2HEGA 2I34A 3OCVA 1ZD2P 3ONNA 2ZBDA 1RKQA 1RQLA 5AESA 1VJ5A 4NABA 1U7PA 2P11A 1U2SA 5T41A 5AKEA 2YJ5A 5ALDA 4L6CA 2FPXA 4Y2SA 3U7HB 2RAVA 4HGNA 3ZVLA 3R4CA 2I54A 2MSNA 2OA0A 3NAMA 4RESA 4EX7A 3MPOA 3W5AA 3P96A 5AKIA 1RKVA 3QUQA 3SHQA 2ZBFA 1WZCA 3WK6A 3ZX4A 3M1YA 3ZW7A 3U19A 5ALNA 2O9JA 4JB3A 5AIBA 4NWIA 1Q92A 1TE2A 5ALSA 3WKCA 4BNDA 5AICA 5IS2A 2FPRA 2CFTA 3N07A 5ALLA 1QYIA 5AVWA 3ED5A 4YCNA 3OCXA 3L7YA 4UMVA 2R8ZA 3OCUA 4OD0A 3WKDA 2JAWA 3UMBA 3OPXA 2B8EA 5AI8A 3U7FB 1QH9A 2I33A 4BYGA 4HAIA 3R9KA 2C8LA 2WM8A 4EENA 3NRJA 4J03A 1Z4KA 4AS2A 2RBKA 5ALPA 1LVHA 2NO5A 1T5SA 2HF2A 2GO7A 2D2VA 4XPZA 3WKEA 1YDFA 4NV0A 1XVIA 4IFTA 1YS9A 3ZTYA 4HGQA 3W5CA 4OCZA 4Y2VA 4FE3A 5AW3A 1RMQA 5AI6A 3QNMA 2R8YA 3MC1A 1Q91A 3L0YA 2YY6A 3NASA 1TJ5A 5AW6A 2YMQA 5A3RA 5AVXA 5AI0A 3UMCA 1RQNA 3KBBA 2WF6A 3NUQA 4DW8A 1ZD5A 1YJ5A 5AW4A 2GFHA 4I9FA 4XQ0A 3MN1A 1NRWA 3UM9A 2Q4TA 3N1UA 2O2XA 3HYCA 3KDPA 4UW9A 2I55A 1LTQA 2FPSA 3W5BA 1RLOA 4Y2QA 3N5KA 2G0AA 4UAVA 4C4SA 1XPJA 2YN4A 5AVZA 2Q4RA 3B8EA 1ZD4A 2JAUA 2C4NA 5ALRA 3D6JA 1Z4IA 5AK3A 1WR8A 2FUEA 4F71A 3EF1A 3PCTA 3FPBA 2HSZA 3SKXA 2HI0A 3FVVA 3A1DA 4DFDA 5AKGA 1ZS9A 1N8NA 2W11A 1SU4A 4J2TA 5AKLA 3WKBA 2X4DA 4UASA 4EELA 4CE6A 2FUCA 3WGVA 5AI5A 3E81A 2C8KA 3DDHA 1ZRNA 4CF3A 5AKZA 4KX5A 1YV9A 2RARA 2GMWA 3AR5A 2BDEA 3J7TA 4Y2UA 4DCCA 3L8HA 4F72A 5AW1A 2B8JA 1ZOLA 2AGVA 5ALTA 5ALOA 2P27A 1IWOA 5AK4A 1T5TA 2HHLA 1TJ4A 2NO4A 5FP0A 3RF6A 2ZG6A 3U7GA 3SMVA 3NIWA 3OTQA 3S6JA 4EZEA 1WVIA 4UMFA
chains in the Genus database with same CATH superfamily
2A94A 2B0CA 4IG4A 4LV8B 2QMQA 4RY9A 3UKJA 3ZWCA 4DNPA 5KC8A 5C52B 5E2AA 3BCSA 4F85A 2XCTB 3ORFA 3OQ6A 3ROEA 1E4EA 3PCRB 4F9EA 3U60B 1TEXA 2IIBA 4I2VA 2G76A 3LQ2A 3RRMA 3K09C 2HBQA 1CZRA 1RYFA 4IXMA 4NONA 3QITA 3LZCA 1UWCA 5TQ2B 4PG7A 2R5FA 1MX5A 4FYXA 2SICE 2GXUA 4BBAA 3OAAD 4GS5A 4ENTA 5E3JA 1ABBA 4TMXA 5L9AA 3KYCB 4J4HA 4Z7OB 5C37A 1JJIA 4L9SA 2ODQA 2YQ4A 3RW9A 1R8JA 2WJPA 3QBJA 4FKMA 1M1XB 2IIVA 2PKEA 4PZDA 4AT1A 3FOZA 3NBXX 1QF6A 1UFVA 4M60A 4PSAA 4AJJA 1E6CA 4L0CA 1BC5A 4U2DA 3R7NA 1YJAA 2IXGA 3VO2A 1M5TA 2MMCA 2PVCA 5DNAA 5JPCA 3BKWA 1CG6A 2AI3A 4R1MA 1MB3A 2A4KA 3HJCA 2VHTA 3MUFA 1CNMA 2I2XB 2BONA 2C2YA 3QXJA 3WLJA 3SC6A 1Y3BE 1M8PA 2QPLA 1EHCA 4M21A 3VAAA 1VPEA 1D8TA 1NXOA 4IRMA 5DV9A 3RRZA 1MV5A 3STYA 3VR4D 4Z54A 1IBKB 2WVAA 1WXEA 3O7MA 3P5BA 2IBTA 1IH8A 2Q50A 2VHQA 2IVFA 4MQ5A 5DT2A 1A5ZA 1GA6A 3DEFA 4L3OA 3BRCA 2HO4A 2HF9A 3O8CA 4UM8B 3PYXA 3AY0A 4TV9A 4D3XA 3KZOA 3TEFA 3ZOKA 1OZGA 1FYXA 1XF1A 4O4IF 4W6ZA 1IY9A 1M1NA 4ND7A 1WABA 1JN0A 3QEMA 4UVIA 3UAVA 4H3KB 4HWGA 3CEJA 2GARA 3KFVA 1VKRA 1CJVC 1F2TB 1M75A 1N9KA 3KV1A 4L9AA 2R86A 4LHEA 4QEKA 4YRDA 1ND5A 5BY2A 3OQVA 3SS8A 1KI9A 4ND4A 2QDKA 1QG6A 4QJBA 1Z5GA 1PZMA 2FRDA 3RYHB 2BV3A 4ESOA 3QVGA 3WOHA 1RVV1 4DV6B 1BDIA 4FB5A 1GZ5A 1ZK3A 3BIFA 4RPKA 4AG3A 3A4VA 4O3FA 5DYNA 3VR2A 2OPBA 2EW1A 3BREA 3WGOA 3NIDB 4CLOB 4DVJA 4QM7A 1TMKA 4E09A 1FJXA 1WP9A 1PFWA 4S1VA 5B53A 5JBNA 3DW3X 1R8QA 1NZJA 1BCRA 1C14A 1GYRA 3NW9A 1WKBA 1VC2A 4MB6A 4OB6A 5I9MA 4QQKA 4Z3OA 2VHVA 3G2QA 4LRYA 2P4QA 2F7SA 1O0CA 5A3QA 1C3JA 1NW9B 3DPUA 4B6JA 5CD1A 3QBTA 2QRJA 1VLMA 1I3LA 2XCIA 3O38A 4X71A 1E2IA 3V6MA 2LTAA 4C6RA 4E7OA 5L6LB 2H1OA 1WMAA 3KWLA 4UHHA 2VJQA 1G5IA 2EZ4A 3JZIA 2FR8A 3QNUA 3QV2A 1CS0B 1O95C 4EY3A 1PD1A 5JYDA 3EQ2A 3WLQA 4BMOB 2G06A 4KPFC 3A4LA 1NSFA 5CEFA 3S1LA 1IN5A 1X7XA 1HFWA 2CL0X 1E9SA 1GCGA 3ZS9A 4K6CA 1U2TA 3WYCA 2ZRLA 1RLJA 3DLCA 3GX1A 1BN7A 2JRLA 2MYPA 4MUBA 3RU3A 3IB6A 1E4VA 3WHLA 1XQ1A 2QX4A 4P2BA 4DLWA 4LF6B 1GUAA 3WGNA 1VGQA 1OLUA 3I9MA 3QLVA 4HHEA 4OFZA 4GW3A 4UD6A 3Q11A 3D5EA 4WESB 2XQVA 3YASA 4BNGA 4B3RB 2J48A 3OPMA 4HL6A 4LA4A 3RGGA 1LY1A 1HDIA 2HNBA 1SVKA 2G6BA 4DL9A 5JPIA 3I01M 4DLUA 3PWSA 1W36C 4R8KA 3X1DA 2IJGX 2JJ2A 3T35A 3TQHA 5HM6A 1XFAA 2AW5A 1YZGA 5HBRA 4PFKA 5JXHA 2JI7A 3LBYA 2NYUA 5ENVA 2HX1A 1OB5A 4B5LA 4MUXA 4HI0E 5KJ1A 3F6YA 2C8VA 2F43B 3PICA 5DBGA 3STWA 1GV1A 3HO1A 1QOPB 2FZKA 4LHVA 4RTRA 1I2BA 2F1KA 2H4JA 5CVJA 1MVLA 2WMYA 2C2BA 3TI9A 3N2KA 5I9TA 1LW6E 1H23A 1PYGA 2G28A 4UEOA 4KREA 2QQEA 3X2SA 4HB2A 5FAKA 1EESA 1CK4A 3BQNB 4XWYA 2NLOA 1OTHA 4ZK2A 4TTIA 4OBBA 2P77A 4MWTA 5DU2A 3DMYA 2YCBA 4F9FA 2CHGA 2WD9A 3DKPA 3SLGA 5BR4A 1MR3F 5H3CA 3UMVA 4ER0A 3VR4H 3KQNA 2UVPA 3C6XA 3EISA 5A0FA 3OQJA 2IH4A 2D5CA 2P65A 2VSYA 4LJ6A 4LZNA 1G55A 3VXKA 2EZTA 2X1MA 1EWKA 1JI3A 3IAFA 3G2JA 4N4AA 1MZPA 4P58A 4BLUA 2Q6VA 1R4AA 3I4CA 3SI7A 2ZATA 4U7DA 2O20A 4JUDX 2BLNA 2RAUA 3DCYA 3EXAA 2PKYX 2YNMC 5EE0A 2VF8A 2DH5A 4LTDA 2EBUA 4TL7A 4P3XA 5JXIA 3N28A 1E94E 4JT4A 2R6ZA 4JBIA 4O4HB 3LO8A 2G7MC 4GGPA 3SQWA 5JS1A 3LRXA 4JKYA 2FPLA 2HYIC 4BVBA 2ZRGA 2OBBA 3AEZA 421PA 5I7WA 3FPAA 1JIJA 5IT0A 4IMPA 1VOTA 4R4JA 2WZCA 4CETA 1W87A 2Z3WA 5BXYA 2WWGA 3D8SA 4DM3A 5TVKA 3E5HA 5K3OA 1EUYA 4J0JA 2F4VB 1X8JA 2ZBRA 3GU3A 4GLJA 1SBIA 4LFAB 3FTEA 1FY2A 1GVNB 1JSLA 1CUYA 1OFIA 2O3RA 4O0LA 2UUAB 5EKTA 1S0UA 2D5AA 3T99A 4H7IA 3IA7A 2P2GA 2X0IA 1Z29A 3R9WA 2VZ8A 4PSDA 1C3CA 5I9IA 1JDBC 4E21A 2WP0A 3A3PA 1KYZA 3IH5A 5KYGA 4IVRA 4G86A 3VSCA 1JA9A 1XCGB 3IQIX 4APBA 1ZOSA 1NASA 3AHFA 4C06A 2NT3A 2BUBA 3WMGA 3SR4A 3NOQA 3D9QX 2DPHA 1NF3A 1ZN2A 3N8KA 3RS9A 3I2HA 5ITWA 1N3IA 4QDZA 4K3UA 1JTEA 2I65A 2OQRA 4P2GA 4P8RA 4B87A 1EZ1A 2C7QA 3PDCA 3BL8A 3J81k 5CG2A 4TKUB 3W6PA 4CIYA 4OIFA 3MCVA 2ZE8A 4AVYA 3ASUA 3RFVA 3CNOA 5ALUA 3M81A 1QPGA 3CH4B 2VHXA 1JTFA 3TLMA 1XXHA 3UFXB 5JNUA 3PKIA 3A3KA 4HPJB 2Z2IA 4DN6A 2OK7A 3QXGA 3KAQA 4KX3A 3H2GA 1ISPA 4G36A 4M9ZA 1E9AA 4S05A 3DEYX 4J1TC 3UHOA 4HAXA 4REOA 2W2XA 3B5EA 3VH1A 5L53A 2ATIA 1TD9A 2FNAA 1JF8A 1KJIA 4C5AA 1IHXA 4G84A 4MYUA 2K7FA 2C5GA 3M1LA 4JI5B 4BKMA 1XI2A 3B1KA 3ZY5A 4F9GA 1QYVA 1EWYA 3C8TA 1G291 2XGGA 4MVJE 1H8ED 2VRCA 3ITKA 4Z3DA 4WCFB 5C5CA 2WF8A 3CZMA 4L5JA 3C45A 4ETNA 3F7NA 3BK1A 2Y77A 4I9UA 2EKZA 2I66A 3HFGA 4PZPA 1W35A 1KGSA 4J0CA 2D3WA 5DISB 3WJ7A 4G0WA 1PJ4A 2A9FA 3QTTA 1NV9A 3N2EA 4JEUA 1UBSB 4HD8A 4L8GA 2GLTA 1KR2A 1XZDA 5EWJA 2OHFA 3UWSA 4EPTA 5GVSA 2I8CA 3O9MA 2A1TR 4MVCA 5EHGA 4FYPA 4IDOA 2H5LA 3KPJA 1MNAA 2IYFA 3D4BA 3R7BA 1JA0A 2XA9A 4CQJA 4CUJA 5CLGA 1XZ8A 1MIHA 2YOHA 1TYAE 1AZWA 3OSUA 5CIWA 5IJZA 4CEIA 3L1KA 1RE1A 3IR6A 4JYPA 1NVUQ 5BVGA 4EI8A 1A71A 4URVR 4LNUA 2X7HA 4KDEA 4NABA 3FWPA 3CF0A 2PJDA 3JYQA 1WJGA 3L7LA 5LB4A 2WIKA 4MS1A 2K6GA 1J2RA 3TW6A 1AB6A 3IUEA 1H05A 3A6EA 3IP8A 1J5XA 4L6CA 1ONOA 1M74A 1Z2EA 4L28A 2NGRA 2VUIB 2YN0A 4PO1A 2H4HA 4DNOA 1JG1A 3ECAA 2YYYA 1F1JA 1R5JA 2IV3A 4FMPA 3CE6A 2B99A 5AKIA 2CVPA 3W6ZA 3DUFB 3GLSA 4IJMA 2O50A 3MTBA 4JA2A 8ADHA 4LJ5A 3FHJA 1OI3A 2FEPA 3LKZA 3IXLA 5A9SB 2WFZA 4UHBA 2C0CA 4JJKA 1NVAA 3K20A 1DKQA 1II8A 1P9RA 1SUCA 1E6LA 2H1VA 3CEAA 3FPJA 1Q92A 3MS7A 4DIKA 5C1DA 4ONEA 4RKRA 2RH9B 2IQ5A 5JJIA 1XL1A 3BX1A 2V3VA 3IILA 1JKJA 1LS1A 1WM1A 1VGVA 2G9QA 1P5ZB 3I2JA 1KFJB 1Q0LA 4ARCA 3L7YA 4PSCA 4QFCA 4OHXA 4V0LA 3W2TA 2R8ZA 3CUKA 4O5OA 1L5KA 4QPDA 3WB0A 1H85A 1VKJA 2Q3DA 4H08A 3ZZNA 4RDXA 1DDOA 2CNBA 1QTRA 2WU4A 1T8WA 4N5IX 1ADYA 4MYTA 4RPJA 3R3XA 2OHJA 1FP4B 5AI8A 5GMOA 3D7SA 3U7FB 3UWDA 1CUCA 1I9GA 4LNUB 4BYGA 3LPMA 4HAIA 2GZHA 4UHKA 4B3JA 4ABYA 1WSDA 3EAFA 5ALPA 1HLPA 3FGNA 1SKMA 5K45A 1UWLA 2EWWA 1PT7A 4DV2B 3GZJA 2XUIA 3WADA 4N5LA 1QLHA 5HTOA 4AG6A 4EY5A 1GTVA 1N4DA 1JLRA 3R3VA 3I42A 2Z43A 4FP9A 2EX1A 3DEAA 1TKBA 1L8AA 3NWEA 4AKTA 3W5CA 1OPRA 1R4NA 4YUYA 1G6Q1 1PL7A 3BB1A 4UE3S 1YE3A 3MG9A 1P5RA 4L51A 2FF5A 3NM6B 5AH0A 2H4YA 1ZUD1 3H13A 5BQOA 1T1IA 2R8YA 2RAPA 3N0RA 1U81A 2BI8A 1Q91A 3ETGA 4CCWA 3EEFA 4CYMA 3A2KA 3B5IA 3E3OA 3GFFA 1LRJA 2J41A 1TW2A 1XKLA 4G4IA 4X63A 1EFAA 4FEEA 2QPTA 1V2HE 3G82C 4V38A 3OEHA 2YV3A 4U7GA 4YPOA 4EHKA 3EIQA 4P4UA 3IP3A 1NI4B 2VTDA 4I9FA 4PG4A 4Q4DA 4US1R 4Y6PA 1DCMA 4YS6A 1V4VA 4B6PA 4BMPB 4BZZA 1XPUA 1QRAA 4PN3A 4EB0A 2VN8A 1CJBA 2JK0A 4B3SB 5DX8A 4A8PA 4E31A 3PIRA 3V4OA 4B76A 1S8NA 5EFZA 4X8MA 4M1EA 3ZQ6A 1RBYA 3O94A 4XKJA 2I1QA 5KNBD 2IBSA 2WHQA 4J4TA 2PYDA 1U3TA 3BH0A 3IP1A 4HH1A 5JT1A 3IQHX 1XJ0A 2WUFA 1XMSA 3M70A 4LGMA 1FMTA 1Q7BA 1F2UB 2OD9A 4ZVUA 1L5HA 1ZJ4A 2OUKA 4AKHA 4NFYA 2JAUA 1YE5A 2VR1A 3C85A 4M8SA 4BB5A 2QMEA 4RYDA 3KZVA 2Q27A 2ZQYA 2W93A 3UJAA 5TMPA 2CE2X 4M8NE 3QYFA 4KO3S 5BMVA 4UAJA 1B26A 5FTWA 4DM7A 2UYGA 3A1DA 1R6DA 1KO1A 3H1BA 2UUOA 3R5JA 4IF4A 4IWYA 3FN4A 5EINA 2FOLA 3OI7A 1CQPA 1XWIA 4GM4A 4RHXA 1UXIA 1J21A 2IDJA 2GEUA 2ZR0A 5KYYB 2OSBA 3WA7A 5D3QA 2CEAA 3RVLA 5BWMA 4YWJA 1NPDA 3C3EA 2G70A 2MDTA 2FVYA 1Z0IA 3CSUA 3JD2A 2XBLA 3A70A 4XGRA 2PQ6A 2AV6A 2UYYA 3B60A 1D4OA 3FJOA 1DGQA 3LJKA 4BASA 3BL5A 2XGSA 1PV2A 5EFOA 4JOQA 3HN7A 1O8BA 3MBIA 1LWNA 1GAWA 3K32A 3AR5A 2WHXA 2Q5CA 4FN5A 3UQZA 1C3OA 3TL3A 2VDNB 4ZZ1A 2WA2A 2HHHB 4Q05A 4HZUB 3AQIA 3VZBA 3SZOA 3JXEA 2ZITA 1QZZA 5FUWA 3SZLA 5HS4A 3K0CC 3FSGA 4KZPA 4BKOA 4S12A 3MCZA 3NIFB 5DIZA 3DL0A 4IJ6A 3VNAA 1ZIXA 4OFXA 4WZBB 1MBZA 1LS6A 4B1FA 1SY7A 5DGDA 3SMVA 2PMFA 1QH1A 2PMWB 4UKDA 1OQAA 1V8OA 4ZAZA 1UZLA 1WVIA 3BD6A 1I7LA 3G2HA 4Q3DA 4YREA 2GXQA 4FGSA 1QFXA 3EBPA 4BNVA 2X5OA 5AFSA 6YASA 3M6AA 4BCBA 2ODBA 3L1UA 3KOYA 3VU9A 1LDEA 1XMXA 2P9EA 2BSXA 3UF0A 4KL8S 3T12A 1LLDA 2QJWA 4GC9A 1KQFA 4CIAA 1X87A 1GDTA 1RQGA 1E9EA 3KTOA 4HRYA 3K15A 1SD1A 6REQB 1TZJA 1XRJA 3DBHA 3M4XA 1GAXA 3GC6A 3T7IA 1Y9DA 2VAXA 1IN4A 1MORA 3RIHA 1H2HA 2AOUB 1Y4AE 4BPRA 3JQ9C 2DEUA 1L8QA 4BKPA 2FI1A 1AVTA 1RKUA 3OD1A 1VPVA 2R8PA 4UU1A 3TAUA 1S2NA 1QYCA 5KYTA 4KV9A 1Z07A 5A5GA 2O14A 3D3WA 1PHPA 5EHNA 5F2OA 4FQ8A 2I1WA 3W5IA 4WN9A 2XUPA 1MQ8B 3H9JA 2W6CX 3IAAA 4CN8A 1YWGO 5JQWA 4OA5A 1A8UA 3ROXA 1TCUA 3WBBA 4U0KA 1LZKA 4C0LA 1BO6A 5CBPB 1Z8FA 4I14A 1MOZA 3F6BX 3EARA 3JR7A 4INJA 5HGJA 1H4SA 3OETA 1Q6ZA 1W6UA 4G0MA 5F4ZA 4RK7A 1JUDA 3B7GA 3FZNA 3LE8A 3QA3E 1G8YA 1KOJA 1XKQA 5LJIA 4Z99A 3LFHA 1PFQA 2C9BA 3HZZA 4CKEA 2WE7A 1LB1B 3G9XA 4DLYA 4NP6A 5T8KC 2P1DA 3VYVA 2NV6A 5BYKA 5LM3A 3KR2A 3ECCA 1EK1A 2WIJA 3GNSA 4NXMB 3EDCA 1T5DX 3M33A 4CLHA 4NYJR 5AW7A 1QZTA 1UOOA 1KNQA 2ZRHA 5AKKA 5A1TA 1ZI8A 3NGLA 4EJSC 4U9IS 2OGWA 1KZ1A 5IBQA 3H19A 3QHAA 2Q2NA 3JRWA 1CX9B 3NLLA 4TWAA 5TGTA 3IHLA 3QV1A 4M86A 5BRAA 3F5MA 4Q03A 5TPZA 2PUEA 4RD4A 1G7SA 2BHLA 1YI0A 3VZCA 4AWBA 3GN1A 1SK9A 1NLMA 4FPXA 1WTAA 2XVXA 1VRWA 3UWOA 4EW2A 3F4SA 1ZP6A 2Y1LA 2JKYA 4PCLA 1U80A 3HGMA 5KYYA 4JP2A 3UXEA 3C1TA 2H2DA 1KFEB 4WESA 1OAOC 2VC2B 3FMVA 1GNLA 2W71A 2XDWA 1PVDA 1E7QA 1OXSC 2H65A 3NEAA 4Q01A 3QF4B 1U3CA 1XTUA 4MKZA 1PJQA 1Z5ZA 2RKBA 1JSCA 4YJHA 3F5FA 1VCIA 2K87A 4YRFA 2AJCA 4WNAB 2NN3C 5C8YA 2DUJA 1GTL1 1BWPA 1W59A 3RC9A 1LDGA 5CURA 3OLZA 3ET5A 3SSMA 2HREA 5LBIA 5CFOA 1F38A 4ASUA 1XF9A 3G2OA 1NI5A 3MYRA 4NZMA 4TV8B 5TT1A 4FWIB 3U26A 4BVFA 1ZVKA 3ESYA 5JS7A 1PTJC 1AGYA 3BTVA 3V4VB 3FBWA 2JAHA 5JYBA 2IXDA 4PLTA 5LZ2A 5JCOA 1VYVA 2QTVA 3U0VA 1EE9A 2FE4A 2P5TB 3O1LA 5THXA 4AJIA 3QU9A 4DYDA 4PV7A 5DTIA 3H0CA 4DXHA 2INGX 3EB9A 2PO7A 4D8WA 1L8LA 1ZC4A 2AT1A 2X5KO 4RA9A 5JTTA 3LQFA 3VNVA 2LW7A 2J67A 4H7EA 2RG7A 2GD1O 3PGA1 4LHSA 3WGIA 3PJFA 3KUDA 2HD4A 5J1TB 3QYPA 5H8WA 3CW2A 2VWPA 2RGGA 2WHEA 1IG0A 1FTGA 2ZPTX 5G2OA 3RRFA 5KS2A 4BNUA 4NCAA 3WLHA 1ZU4A 2R11A 1UFQA 3ZHTA 2CT8A 1ZXBA 4AF6A 3LUBA 4J90A 3ZW9A 1U2EA 2F1HA 1HE1C 3BFPA 2VOJA 1IDN1 4XW2A 4DIMA 3DLAA 4YRKA 4HCJA 1W34A 2JC3A 3OKFA 5JE8A 2VT6A 5F7XA 4BGEA 3BXHA 2GBIA 1CUIA 1YVDA 2OECA 2QM3A 5C8YB 4IVNA 5AM0A 3VNRA 4Z86A 5AK0A 2MSWA 2WHPB 1KEEA 2NVUB 5EUQB 5DYWA 2YW9A 1O5IA 4X54A 3TXXA 3MMSA 5BUZA 1DV2A 1XXLA 4OXNA 2R3SA 2A5FA 4PAGA 3C3JA 5AVRA 3AHDA 3MWGA 1L7DA 2DC1A 2KBEA 3BMCA 5K3FB 5KUTA 4A7PA 1MO3A 5J2UF 3RE1A 1ENOA 1Z6TA 2AJDA 5G3ZA 2JIOA 3E84A 4ZVVA 3M0EA 4QARA 1TO6A 2VJYA 4KHPB 4ENUA 1Q20A 4BRZA 1FFHA 1G18A 2JK1A 3PDUA 4GKBA 4PIMA 5K1ZA 3GAMA 4AJ1A 1QDEA 1GQQA 4NJMA 4EABA 2PIDA 3W8EA 1DJNA 2JGIA 1WXWA 3OBIA 5K6RA 5IJAA 4NATA 2J9GA 3G3EA 2I8AA 2R2GA 2ZVDA 4LHWA 1X80A 3MXOA 4JUIA 4ZVQA 1EA5A 1CZNA 3AHEA 2PX5A 5FADA 5U4XA 4BX9A 1AMUA 1UDBA 4UNNA 3OZUA 3AMVA 5AVKA 4DR5B 3F7TA 1C8KA 3B6MA 3LL4A 4L4ZA 3QXCA 1SXJB 3VVMA 1C3VA 1ZGAA 1WSBA 4YJ3A 1P18A 2IH2A 1Z6PA 3BSYA 1MN6A 1DFHA 2ZYSA 3PC4A 5KAPA 4WBNA 3NM4A 5IT4A 1I7PA 1CWUA 1T4MA 1QFJA 2C4KA 3AWIA 4X3CA 3HG7A 1SUSA 2CVZA 2FJUA 2E9FA 4M0MA 1Z7BA 4IQJM 4RV5A 3RTGA 3EPRA 1E9BA 2QTFA 5DSZA 3JYPA 1WQ3A 3CX7A 3LWZA 4O08A 2E5WA 2ID4A 3A6JA 4GPTA 1MAUA 5ALXA 5EJ2A 1JIQA 4BWVA 4C89A 1V16B 2IC5A 4HYTA 3VZSA 4BE7B 5E4YA 1NIJA 5EJGA 3SQDA 3EZGA 4WFJA 1GT6A 2FQXA 1ODFA 1G5PA 1X7WB 2AR7A 2Q2QA 1OI4A 1HK7A 1ZSNA 1ONNA 1SXJC 4DA7A 1HETA 5K3AA 2O1SA 3KT0A 4TWZA 2PMEA 3SKYA 3KKPA 4MWZA 3QOFA 5L95A 2QZPA 2W6QA 3LYHA 3ND6A 3LCRA 3EPPA 3ENQA 3VR0A 4AZ3B 4HUJA 5HA5A 2J9RA 4CKZA 2PH7A 2XZTA 2OCXA 2HJ9A 4HN2A 4CIDA 2JLBA 4RV4A 3LD9A 4DMLA 2QMOA 3PE4A 2PMDA 5B7GA 2GGSA 3T9AA 4XOUA 5A4AA 4I4CA 4M9CA 1FE8A 2ROQA 3PFWO 1Q95A 4I36A 4COKA 4WLEA 3HU3A 2P2ZA 2AXEA 2HA0A 1DI0A 2JCVA 1DX4A 4JUFA 4QICA 1JE0A 2OQ2A 4NFSA 4DCSA 3QUTA 1WUJS 5A3SA 1JX6A 3IPRA 3HL0A 5JC8A 3A2MA 2P6MA 2XEDA 3KQSA 3RSHA 4ZEMA 2VTBA 1YACA 4TS1A 5SICE 4RMGA 2J3DA 2FKAA 5BSUA 2O3TA 5EMJA 2R79A 1TYCA 2IS2A 2B82A 1TUBB 1F3LA 5FNVF 1B00A 2NO1A 4KQFA 2WICA 4ZVOA 4EHAA 4KR2A 2ZT5A 4FNAA 3QVTA 5FOSA 5EPOA 2QXTA 5JWRA 4L0MA 1UMDB 2UUBB 2VPZA 2FMTA 5BSVA 5C5IA 2YMLA 3GG9A 4HGPA 4ZT4A 1U0SY 4RANA 4CM9A 4HZUA 3TPZA 5JAZA 3PHGA 3BGDA 1DU4A 1OWPA 3PDJA 1SXJD 3T6KA 1OFTA 4O1HA 3NAGA 1HX7A 2DFNA 2OXCA 1W30A 3SZGA 3GUCA 4FHFA 4DKXA 3VSDA 3VX3A 2EVWX 3D7NA 4JP8A 4B8WA 4CN9A 5KC9A 2H5IA 4E4RA 4DJ5X 1RADA 1RXYA 1QZXA 1VGRA 1ZJJA 2ZSHA 3FHCB 1T1SA 1V3UA 1WL8A 4GR9A 3DNFA 2XAAA 2BI7A 4ZDWA 2IPXA 4HNAA 4CZ2A 1LX7A 1Z39A 2QJRA 4D9GA 4NK5A 4R7TA 2JJ1D 2EJWA 3OX4A 3CI0K 3K92A 2CDBA 4DEYA 1CIJA 4IZHA 2Z09A 4EFNA 3HWX1 3TR6A 2PGDA 2YNMA 3IBFA 3RD8A 1RCUA 4HWTA 4F6CA 5HKOA 3V5NA 1RC1A 4G2NA 3TDKA 5BUCA 4B74A 2E82A 2EQ5A 6GPBA 1JHAA 3KPWA 1ZCFA 4ZOEA 2W8BA 3Q6MA 2IPLA 3DD5A 1B4DA 4GKVA 2ZWOA 5CXXA 1RKVA 1BKSB 2R1TB 3R24A 4C4AA 3GCGA 1Z9BA 4IQGA 5C8DA 4C3ZA 1AKWA 1P3JA 3NH6A 2IYVA 3HEAA 2NSJA 1UH5A 3OFNA 1GCAA 4YRLA 3W34A 4AF7A 3MUEA 1CQXA 4C6TA 1XOIA 3PVCA 5K9ZA 2MMGA 4Q9HA 4PCUA 1QE3A 5DASA 3UWMA 2V7XA 1QGDA 2GD2A 1TC2A 5I7OA 5P21A 1TT7A 1NQOA 3LKDA 4EG6A 4GL2A 5B1YA 3F7MA 4DGSA 4DXDA 2JD1A 2G83A 2ZJ8A 1F17A 2B5VA 4F6RB 2PG3A 3OCXA 3N8IA 2C0QA 2WWXA 1P2DA 2A9VA 4UMVA 1FVOA 3LT0A 3LVFO 1QRTA 4DR4B 2GPTA 3GRKA 3L01A 3PUHA 2ZJYA 2WTNA 2BCEA 4GZ5A 2WWTA 3A9TA 5CFPA 5I9NA 3N2GA 2GH1A 3IPYA 2NTYC 4P7FA 3V1LA 3QEOA 3VYUB 1I14A 1MJGM 2QN3A 1I2AA 3PC2A 4EENA 3PD7A 4GOMD 4NV1A 2ST1A 4TYYA 3GLGA 2WYOA 1PG2A 1T13A 2VEDA 3NHPA 5A4KA 2XZLA 4UCQA 4AJ4A 5KDDA 3F4TA 4IOMA 3UPUA 1GYPA 4D9KA 1QK3A 5CVEA 3MT0A 2AXNA 1B23P 1XNJA 3LUDA 5DMHA 4KVZA 3UC9A 5HIMA 1XKTA 3AVOA 4BIMA 2GPNA 2QNIA 1LUAA 4IR7A 3ZTYA 5C35A 1NKSA 1E63A 2A1TS 2Z1MA 4Y2VA 3DD1A 2R6JA 1V95A 1X7HA 4KDFA 4LTNA 3WMFA 1KO7A 3IAM6 1H4TA 5EWLB 4GYYA 1X6VA 5BR7A 1C3LA 1Z0SA 4NESA 1HE4A 2H2WA 5HRUA 2ZB7A 5B2ZA 4F5YA 4GDFA 4KG7A 1K6MA 3RTEA 1V3QE 2VXOA 2XKBA 1NUAA 4L2IA 4YO7A 3INRA 4Y6QA 3OO1A 4EGJA 5AOVA 2OKGA 1LV7A 3M4ZA 3SY8A 2F62A 1SVOA 4BO8A 3LTEA 1GLGA 4RS3A 1DNPA 5DTRA 3GLQA 3LKVA 1ZD5A 3BXXA 3INGA 3BD8A 2PLNA 2GESA 3GFSA 4TQGA 3SQOA 4I4LA 4HZIA 4LZLA 4XQ0A 3SYRA 4EI2A 2X9LA 3CQ9A 2D0PB 4RKWA 4YUWA 3R7WA 4PZCA 2J5BA 1WOMA 4D8YA 3TZEA 4G5OA 1HRDA 1ZG3A 3GLTA 3G0CA 1E9RA 4BNYA 1T8YA 2FDCA 4Q4HA 3STUA 3K1AB 1F8GA 3VSBA 5TPWA 3W5BA 1E64A 2KWIA 1AXRA 3FPCA 3KR0A 4PC7A 1L4UA 2QTGA 3LY8A 4AMVA 4PGGA 4YJGA 3EG5A 4C01A 4MIOA 3CBGA 4UEJA 4E11A 4EF6A 4EPRA 5CFMA 5FWYB 2ZBUA 1WVGA 5C7YA 4CR7A 1PFYA 1TTHA 5D3KA 4K6HA 3GARA 4EKIA 2WSBA 2DPLA 4G1MB 3I0ZA 3N0TA 2FSSA 4Y1EA 1A9XA 1KYWA 1T4BA 3CISA 2V0NA 3P2EA 4H4EA 4L22A 1FFEA 4UTXA 3RCBA 3WNZA 5LZ9A 4FE4A 5FTKA 1V37A 3AFHA 4E08A 2IIQA 3ZQ4A 1PJCA 4AN0A 3NHJA 1OGYA 1D0VA 1W5SA 3H9BA 1QO9A 1E62A 1JDBB 1RQXA 2H0AA 1NNUA 1OFUX 1YC5A 1QGAA 2JFZA 3DZIA 3LZDA 4ZCSA 4FI3C 4MEAA 3ICVA 2PQMA 3ADBA 4EEXA 3ZHOA 2FK7A 4URXR 1OBFO 5BRJA 1STOA 2C3PA 4LS3A 1YRYE 1YA4A 1XPRA 1KEEB 2WHPA 2ZYIA 3D8NA 1ZYUA 2V97A 3D2BA 4AJHA 4B84A 3OM9A 2WILA 3DAHA 3GJQA 1DQZA 2X1LA 3FCXA 4N40A 3WLPA 1E89A 1JBQA 3D81A 4HWPA 4MVJA 4RGQA 4TVKA 3V1KA 1ECBA 2GYWA 1Z5OA 4NEHB 3RI3A 1Q1NA 5I9BA 3HLYA 1NWHA 3IEXA 1XZQA 4J6FA 1LV8A 2FHSA 2XADA 1V71A 3INTA 1P17A 4YV7A 2XGMA 1TJ7A 3ELYA 1IWOA 1FRNA 1HZJA 3O1IC 5ETJA 1WVMA 3WGZA 1TJ4A 2QTCA 3CE9A 3KAPA 4CQMD 1P2BA 1ELOA 2AD5A 1FK8A 3KKEA 3DMPA 2PZMA 4CCYB 1VDKA 1JXQA 2DCUA 1HDYA 2GJ8A 3NNDA 3O9VA 1O6BA 4JQCA 2MHCA 4N8SA 4O2AB 1P1IA 4RGYA 1THMA 2NTJA 4QYTA 3FDJA 4S24A 1CE8B 3PJDA 3FZYA 4UMFA 4ZCLA 1SZCA 2AMVA 4MRMA 5LU9A 3BWVA 1Y3CE 4MO2A 4Z7QB 5DNCA 1GPDG 1RZUA 1Y1TA 3WKAA 2BH9A 4DQ0A 2IS1A 2F1IA 4YTEA 3NYIA 4XASA 5EJ7A 3S8EA 1EXDA 4ZC8A 3I6ZA 1IPFA 1WMFA 1K97A 2L19A 2Q9CA 2X3FA 3LSTA 4J91A 5JZBA 3Q5DA 3EVGA 1CY6A 4WKBA 2C2WA 2HA6A 2P35A 4DA0A 3O2QB 4HVAA 2AQHA 2QN6A 5EQJB 2C96A 5K3CA 3LLCA 3PR1A 2WA1A 5BORA 3O2JA 3BMXA 4GOJA 5KJCA 1FX0B 3HNPA 4JLKA 4TSFA 4GM1A 1Z47A 2PU5A 1SBCA 3B9RA 5IK2A 1RPZA 2GCIA 4I55B 2ZBGA 3BIXA 1UINA 2DWUA 3LECA 5IYZA 3R0VA 1N7IA 2QVZX 3HDTA 4FUQA 4V0SA 4XX1A 1ZXXA 5J5AA 4KPYA 4RHUA 2Q9AA 5HVNA 3V2IA 1ONBA 3GGDA 3HNRA 1S7CA 2I2BA 2J3IA 2JBHA 3FKSD 3K9LA 4EY4A 5L7YA 1AX9A 2V3WA 4R01A 1N2OA 2ZJFA 4QAJA 3EF0A 1ZPDA 5JY6A 1CUHA 2AD1A 3A1SA 1I3CA 2V3CC 2W2PA 2XDAA 2Y2UA 1EJ6A 4W5WA 1U8AA 3HACA 2IYWA 5ICMA 1JMKC 4UTNA 2JIDA 1PQWA 4EFCA 3UPDA 1GFIA 2FK8A 1MB4A 5T4FA 1JWAB 3X1YA 1ITZA 2RGNC 4ZYXA 2ZIGA 2AK3A 5KAMA 2DJ5A 1XELA 3LA8A 4REMA 4ZO9A 5F35A 4NMWA 4NENA 1E3MA 2V96A 3CXUA 4IYRA 4FDMA 3BBLA 2G5TA 1NVGA 1G2OA 1UJ5A 3B8HA 3LC7O 3RVOA 4AMGA 4BFZA 4IXNA 4OJMX 5H4GA 4CMIA 1TCBA 3LPCA 4CLDA 5JXWA 1P29A 3W5VA 4TT3A 3AONB 3HABA 5BUSA 5LQMA 1RDFA 2BM8A 5ALFA 5HW2A 2F9MA 4LHXA 1QNLA 1ZUHA 4DZZA 1EUQA 4PTLA 4J7CA 5HMMA 1P91A 2XGOA 2ZYWX 3DW1X 1VJDA 1WCV1 2G09A 3HY6A 2HV8A 1C9YA 2CVHA 3HP1A 3EDYA 1P1RA 3HSKA 1A9SA 5CVVA 3QIVA 3MGAA 1JJAA 3MJHA 3T1VA 3VPHA 4H4CA 5EJ9A 2C7PA 3E3AA 3V7UA 5IKMA 1K5GA 3DBLA 4HYEA 1JT9A 3AR6A 3VVLA 3GLGB 1WCXA 1XTSA 2C99A 3V9PA 1EQUA 4YHBA 3LXXA 1NC3A 1WB9A 4L4XA 2AOUA 3TTWA 3HJHA 5JS8A 4BQQA 4PAQA 1ZHHA 3ZVNA 1N1EA 4RJLA 1RZ3A 3BS4A 4MKIA 5TX7A 1RQ2A 3VC3A 2H52A 4EOGA 2G9ZA 2GRJA 3EVTA 3RGWS 4DQUA 4E03A 5HQ3A 4A23A 5BVHB 2JFGA 1TYZA 3KP1A 4ZYVA 5EWMB 2N1MA 1FQKA 3R7AA 3FZQA 3G8YA 2FLKA 1Y81A 3EGXA 5I7RA 1NKTA 3ACCA 2OLKA 2I6FA 2HEIA 3EIXA 4G5YA 2XR1A 1V45E 4OQPA 5TARA 4ZV4A 2O8VA 2P40A 4LZOA 4YYZA 4JI0B 4Y6LA 3P8ZA 4FS8A 1PK9A 1T0PA 4INPA 2PV0A 4U0JA 5F7ZA 5GOTA 4DCJA 1BDHA 3TD6A 2JCBA 4FYWA 3IHWA 1PGQA 2IZ0A 3GFBA 3OQHA 1P3DA 1PUJA 4JODA 1JAXA 3LDUA 4MRVA 3GRPA 4H6XA 1F4VA 2R6HA 1YR2A 4QOGA 1FW8A 5DGCA 4B3XA 3K05A 2P9QA 4EKDA 3LLMA 3WLFA 1IU9A 4PZUA 3D4PA 2FXVA 4A2CA 3HBMA 3VNBA 4BV3A 3HXTA 1Z0AA 1EHIA 1Y34E 2IHZA 3G1UA 3WMWA 1Z33A 3N5CA 2YDXA 4UZSA 1PGOA 4YDHB 2P9CA 2A4MA 2WMOB 4DG8A 4US2R 2D54A 4MI3A 5LLSA 1MFZA 5JNRA 2FUG1 2QV0A 4DR6B 3WGQA 2EKBA 1QQ6A 4RENA 3RUIA 3ZV4A 4XCVA 3MPUA 3ZHUA 3ZZ0A 4G1EB 3O26A 4XM2A 4ME6A 2A0WA 1KDRA 4IHKA 3UAWA 1V8PA 3LYUA 4OGGA 4R2KA 4ZOCA 5DW0A 1DINA 1CUJA 4JVSB 1D03A 3DTVA 2PDAA 4KWCA 3ZH2A 3ZWMA 4E5KA 2VJPA 1VRCA 1Q15A 1Z28A 2VJDA 3II6X 4QULA 1XCPA 3P52A 4FYIA 5EIOA 4D5EA 5IWAB 1PUXA 4X1OA 3AVVA 3JD1A 4PY2A 4UPDA 1MDFA 2GILA 4IZ6A 5BV8A 1Y3DE 1DIBA 3Q9SA 2DLDA 1JHQA 5FA8A 1L4BA 3QE4A 1KJQA 3PFGA 1NVVR 2EOAA 3UICA 1BFUA 1AHHA 1X3SA 2HA5A 2HJHA 3AO0B 2BIFA 3GQBB 4MNTA 1EFTA 4E1VA 1D4AA 2YWDA 4ZOLF 1R64A 3OURA 5GONB 1FVXA 2V7GA 2XYHA 4XUDA 3ZEAA 2C97A 2VK1A 3L0BA 1WQ1R 2GK6A 4YJDA 3ZXUB 4BTVA 4F0JA 3BSSA 1VL1A 1X42A 4E3WA 3M6UA 3VDNB 4YMGA 1CZLA 1Q14A 2CK3A 3R9IA 3D7RA 2PSEA 1GL9B 1GD1O 1O2DA 2F59A 3BIOA 2Q1UA 3IT0A 1V4BA 3DHWC 3RTCA 3CZ9A 1A7JA 2ZIFA 4E1AA 1VTKA 4MV1A 5ADWA 3DZDA 1NYRA 4MAFA 2DZDA 1EVQA 1TOAA 3QVWA 1MAHA 2Q3HA 4KLZA 4V03A 3R9XA 4ML3A 5EZYF 5GZ1A 3V1MA 4KFCA 2ZTLA 3HFSA 3A32A 1Y33E 4XPIB 4Z0TA 4EPXA 2HKIA 2G63A 1NVKA 3ZOZA 1CJUC 1RFLA 1HMYA 4RWZA 4JROA 1ULUA 4BLRA 1EXMA 1FMLA 3MERA 4B4UA 3E9NA 1C1HA 1U02A 4GXTA 4U7TB 5IAEA 5HZMA 1N5OX 3L0ZA 4ND1A 2J0UB 2ZJ2A 4HNQA 4CMAA 3OJ0A 4YR9A 4JIMA 2E2WA 3NO9A 2XWPA 3MYYA 4C29A 4MZXA 1Z4QA 4JI4B 1FNNA 4DMCA 1SQFA 1UC9A 2GO1A 4HMQA 1IEWA 5D7BA 5ILGA 2IHVA 3SD7A 3WK9A 4DPLA 5ICCA 3WWPA 4QELA 4YRZA 5F98A 2J6CA 3AVPA 2P9HA 3FLEA 4KLRA 5BYJA 2GCPA 4Q7KA 2XV1A 1HY1A 1N6RA 2Q49A 4YJ2F 5T67A 1ZCZA 4LOIA 2G71A 1M2JA 2QLTA 2R6AA 3GDWA 2NUPB 1EVYA 2QVBA 2AFHA 2VH2A 3CR8A 4MXDA 1G6KA 3IERA 4RHTA 5KQSA 1L4MA 3A04A 3BE5A 1JLHA 1V9LA 1G1AA 4NYMQ 1J1UA 1KQ3A 4YRBA 4JJGA 2ODNA 4J4BA 1TMOA 4PONA 3GEEA 2OVBA 3FOCA 3NI2A 2JEOA 3EDMA 1N1DA 1OXVA 3HRIA 2FQYA 4HEA6 1EGMB 1QIKA 3CUUA 3ZU6A 5CCEA 2R4TA 1PLKA 2GFIA 2WW8A 3R9XB 1NNSA 1X1EA 4ABTA 3V7FA 4AY3A 2ODAA 2VIIA 3N7UA 3P1JA 3FG9A 3RU7A 3U7RA 4JBWA 3N8GA 1KY2A 1S02A 2NP7A 2BTQA 2YJ6A 3MINB 3KAKA 2I71A 1J09A 2ATVA 2UYOA 5KOYA 1EIZA 1Q11A 2BGKA 3MRSA 4ZOLB 1M2VB 4K2AA 3IE0A 4G8JA 4ZYLA 3EVDA 1RRKA 4IIXA 3VAYA 5JJKA 4HXEB 1VLHA 3HCBA 1NONA 5CNIA 4GMXA 2AC2A 3MWFA 4EG7A 3JQ9A 4OH1A 1XZEA 3EXFA 5TSDA 4MJ3A 4BEVA 1GG5A 3CT4A 2PANA 3IIJA 2B4YA 3WP0A 6ABPA 2A5JA 2JA2A 1M10A 1A3CA 3KQWA 4G1BA 4H2DA 5IJ9A 3CNNA 3LUCA 4DIBA 4TZKA 3ONNA 1ZSVA 2DWOA 2JFFA 4YFYA 3DONA 2LV8A 3I4LA 1KAOA 4IY1A 4OMUA 4F46A 2J09A 1ESMA 2XYVA 3P9CA 3NFRA 1PT6A 2CXUA 3D1VA 3H2IA 4K9SA 1QHNA 4YUAA 1OH6A 4H1VA 1QP7A 1U15A 5A5FA 1HDGO 1UAYA 1CUWA 1L5SA 2G5PA 4MMYB 4DLLA 3E15A 4HXFB 4G26A 3HCWA 1AQUA 2CL6X 4IDDA 3AHHA 3RAGA 2UZ0A 3H4TA 2CUKA 5JR3A 3OE4A 4LJSA 5HCNA 5BSTA 4EX7A 1I1HA 3OLXA 1FJGB 2Z1NA 2X42A 4G9EA 2J5XA 2A78A 4H31A 4H7KA 4WZAB 2WLSA 5KKNB 3B82A 1MF7A 4JEIA 4JHLA 2QLLA 3HY4A 1H2BA 2XA1A 2TS1A 3D2LA 1X2BA 1O6GA 3H3JA 4KPEC 1WZCA 4B45A 1JIUA 1USIA 3C7AA 2Q3CA 1HYQA 4IHJB 4B83A 4PPQA 5LLDA 2GUWA 5TE9A 4ARZA 2DY0A 3AFOA 4BP8A 3WKCA 3EN0A 2EL9A 3LKBA 4JYZA 2OO3A 3I01A 3K0BA 4CL8A 4DWJA 1QSGA 4RCZA 4FLFA 3VTAA 4GDMA 4EM6A 2HCRA 2QX9A 3I9LA 4L85A 5BQXA 1Z15A 3Q3HA 1J07A 1LI4A 1CY0A 4Y9DA 3JRXA 3V7YA 2ZTVA 1A9YA 1IAVA 4OD0A 4Z1MD 3NOXA 4X20B 3RTAA 3V6LA 4AK9A 1PJ8A 1Q3HA 8LDHA 4W4TA 4DPKA 2I33A 1U1CA 1B2RA 3EHDA 3WZ2A 1J2JA 3NRJA 3W9SA 3GP8A 2MYTA 4BDTA 4RYLA 1MOSA 4AS2A 3RK1A 5ERYA 4PQGA 1F3OA 2FDXA 3JATB 4WY2A 1J2TA 1XV5A 2FGKA 3JWJA 4LVUA 4OQQA 2JHPA 3N39C 3G23A 1AN9A 1YZHA 1DHRA 1N5MA 1CY7A 2NV2B 1WUHS 3L4SO 3NCTA 2KBFA 5JU6A 2V7VA 4OKIA 4BZWA 1VLJA 3M6VA 2P4EA 2Z0MA 1A7AA 5EEGA 3SNKA 4E30A 1IY8A 3JQEA 3GPDG 4PZYA 4ZVKA 2AN9A 2JBWA 3RYTC 1TRKA 3F5SA 4O2LA 3W04A 5E1MA 4RTLA 2ZULA 4YHHB 4K28A 4R0NA 5CT9A 1KQ7A 4I6GA 5ERXA 4A8JB 1G5TA 1N75A 1KE2A 2GAAA 3NASA 5HOEA 1B8VA 4BU0A 2E1PA 2V59A 5SYMA 2O8CB 2CWWA 2QTNA 2G36A 2GEVA 2J33A 3NAQA 1AUPA 4G23A 3RVRA 3STHA 3TAHA 3A9SA 3CUEF 3LBHA 3NUQA 4ZVMA 3QELA 1SXJE 2QRLA 1MABB 1WXQA 4I1VA 1QHGA 1TF2A 3FF4A 2NOAA 4QTXA 3LLVA 3WYGA 1U0TA 1SC1A 2UZ3A 4LPSA 3WZMA 2CJXA 3JAMA 3UBTA 4C0SA 4ARSA 1H9CA 3MK31 5DX1A 3EZ2A 3OA2A 2XRMA 1CIPA 1UM9A 2QI9F 1NATA 1P7WA 2W22A 4Z1MA 4RTPA 1U11A 1K5HA 2QF7A 3CONA 3ED1A 1S5PA 1FRFS 1G8AA 1G6HA 1Y63A 1JHUA 1R0XA 3G88A 3L49A 3SSAA 3AOEC 2AA3A 4DJJA 5AK3A 2PBLA 1JHYA 4F71A 4ZMRA 3IVGA 4DDVA 1IBRA 1ZAKA 1M1YB 2JHGA 1XIVA 5A5DA 4EHLA 1U2PA 3FPBA 2HSZA 3S28A 3DBIA 1JLMA 1U6KA 3FWNA 3ENNA 3EIFA 1XTVA 3PT5A 3RUAA 3ZDZB 2OGUA 3ZHBA 1TL7C 1W36B 5IYZB 3D0QA 2GWHA 1FU7A 1K6JA 1E9VA 2OORA 5KCMA 3CR7A 1EM8A 1YK0A 2ADFA 2REOA 2ZGVA 3CEPB 1BQ3A 1C7RA 3DF9A 3LP6A 3TZ6A 1LDMA 4B75A 4BL5A 4G5HA 4EHDA 2CVFA 4GVXA 3Q7IA 2B36A 1W44A 5B7NA 2FUCA 3MTDA 1S01A 2ZUVA 1TADA 4X64B 4JGGA 3UK6A 4GPZA 3H1FA 4BAGA 5E9JA 1KIMA 2PGAA 2PFSA 4C7VA 3H05A 2R8OA 4G3XA 4KRXA 4X97A 1ICEA 3OT4A 1KRHA 3BCUA 3D43A 4IIBA 2IGTA 1N3YA 4N01A 5E4JA 2P27A 4JLJA 4CMEA 1W8DA 5JO9A 3EWNA 1KMMA 4KYVA 3G9TA 2Y0BA 5AWFC 4ZGBA 4GX2A 4P82A 1LFDB 2JCXA 5CX1A 3IAHA 4EYEA 5M2QA 1XWOA 4C2TA 4TXMA 1PU2A 4E5DA 1WE2A 2X19A 3S8MA 4HFJA 4S1WA 5BNWA 2C77A 2O7QA 2Q3FA 1T5IA 5F73A 4JI6B 1LA2A 2GM3A 3HUUA 3K73O 3NR2A 5TJHA 2BFDA 3ZYZA 5AD1A 4FCVA 4M36A 2BEVB 3PI7A 2FPGB 4ADLA 4N12A 1AUQA 4B31A 4HR7A 1NC1A 1RBQA 2XBUA 4L2IB 4MW2A 1PFGA 4EHHA 1UOQA 3PGKA 2VF5X 1FSFA 1URPA 2C92A 1TO1E 1DSSG 2GZMA 3ZE0B 2Q0QA 1W4AA 4F8JA 4JYAB 3BRWA 1KR5A 2FUNB 1YSCA 3GEDA 4DLRA 1ZGZA 4HWSA 3SE7A 1WD5A 1MOPA 3H83A 1BKYA 3AVWA 1YFEA 1F8UA 4IDHA 5REQB 3WL5A 4J1NA 4R81A 5FPQA 4NEGA 4U1RA 1NXQA 3AQ4A 3O2SB 3VU1A 4MQLA 1GTRA 1M7BA 3JX9A 2WYHA 5CK4A 4QPPA 2OPHA 4MRRA 3TTTA 3NJRA 5K51A 1SKUA 1YZNA 1N7HA 1D7AA 1M6NA 3I9V1 5IVPA 3A6PC 5A9TA 2IDZA 3CLUD 1ZH0A 1A04A 2EGHA 5C1OA 4XQGA 1AQ6A 2FQQA 2DRIA 4AIRA 1KRXA 3O1HB 3ZK7A 1T35A 2HPVA 1WP4A 2PLFA 1JMVA 4S1NA 3SSOA 5FWYA 5LA6A 2A35A 2G1UA 5KMGB 3PTLA 3IDFA 1U31A 4JBNA 4C4TA 1GPMA 4AO8A 3EK2A 1NYTA 2IHBA 2R5NA 4XRRA 1P62B 4W7IA 4RL4A 3O2NA 3G2KA 3A6KA 1B1AA 5E6RB 1FUYB 1Q0HA 2Z8XA 4C7OB 1HOXA 2AB0A 4P4SA 2JFXA 1R5BA 4UM7A 3B6EA 4C6HA 4XE5A 3OFVA 2SNIE 5I3ZA 3I28A 3PQ3A 4OAOA 1G66A 2PV7A 1KXZA 3I34X 4FKBA 1TCVA 4ZWNA 4EYOA 3RVSA 4NI5A 1EM8B 2GBFA 2HR1A 4B33A 3TX6A 3R1IA 4GI7A 2XA2A 4FWBA 4HVTA 3U4DA 4H1WA 1T3HA 1MJHA 1L7XA 2BZSA 2GLXA 4MVJF 4PF1A 5AHRA 2Y05A 3OEHD 1SD2A 4LXYA 1X92A 3HA7A 4MROA 1B0UA 3VHRA 1P72A 1SUDA 2EHDA 3DUWA 5IK2D 2X0KA 1N8SA 3TLCA 3VPCA 2XDQB 1FUQA 4FDUA 5EE9A 1JFVA 4CF5A 4LRQA 1FSPA 3JWIA 1FTYA 4QUHA 5HSGA 1OT3A 4LX8A 4YNBA 1EAMA 5AQEA 4NZPA 3TDMA 1FF9A 4WOJA 4NMHA 4MB0A 1E5QA 3RBZA 1ZEMA 3CZ4A 1HKHA 4JZYA 3W1WA 2PZ8A 1SCUB 3A4IA 4YUZA 2VBIA 4ZKDA 4L8FA 2AG8A 4YRRA 4AP9A 3T4XA 4IQ0A 2VHYA 4TM7A 1UK9A 1QGZA 3GRAA 5G0WA 5DHUA 2XHZA 1DADA 2J32A 3WRXC 1GCOA 1KH2A 1ULBA 4DV4B 1CVLA 4O3MA 4ZEXA 3KHSA 1GZHB 3JVIA 3IVMA 4MUYA 1PP4A 4URWR 4RIEA 3C2QA 3C7TA 3OJLA 3VSAA 4K6MA 1TMGE 1YBHA 5DHRA 2VHJA 3D3JA 2CNNA 3TX2A 3UHPA 2BL4A 4DWWA 5LKRA 2YC4C 1YUMA 1K8ZB 1W6RA 2ZJ7A 4XM1A 2OB2A 1MC1A 4WN3A 5JV5A 1S3IA 1BHO1 1G21B 2XUGA 3BD7A 3LDHA 2ARKA 2YTZA 1G3RA 3CBQA 3GYGA 4GIBA 1C2YA 2QN8A 4WLOA 3S99A 3TRFA 3ZUGA 1Q0RA 2Q45A 4MS3A 3TQRA 1NX9A 1OXTA 2XCQA 4G5RA 2IVZA 2DB3A 2JI4A 2OHOA 1V7PC 1YC2A 1LDBA 3S2YA 3VFDA 3A26A 4BTLA 2HWKA 4G9BA 5HKKA 3AG5A 4IHAA 3G8AA 3GH3A 3VR3D 4FNMA 1EK2A 3U40A 2OYRA 2IH5A 1YCFA 3FNEA 1GXSA 5IABA 3W05A 3ETDA 4U2FA 5CVTA 1E2QA 1USUA 4I19A 3OMXA 3NBQA 2B4QA 4HMOA 2WTUA 2EKPA 2BFEB 1A8QA 3HA5A 4MVJI 1N78A 5KNCD 1ABEA 1XCBA 3IDSA 5CP8A 2IUFA 1J0CA 3EWIA 4M55A 4DIEA 3UB4A 1F0NA 4WRRA 2Y0EA 3IAEA 1ZH4A 3PQ2A 2JEYA 4RVUA 1NBME 1U0EA 2NXNA 3C6QA 4CTNA 3SXUA 1NVXQ 5JCJD 2F43A 1U2ZA 1X1TA 2JFOA 1M6VA 4F9TA 2AHRA 2ONYA 2XMCA 3LVBA 4ND8A 1DAGA 5HIAA 3MD9A 2FX5A 4QQRA 4U6QA 2FRDC 2WINI 5FFNA 4M4SA 4E5VA 4L8VA 3DC7A 4PVDA 4L6AA 2PMBA 4UAGA 3BHIA 2VOEA 4X66B 1FU8A 3T38A 3TW8B 2BZGA 2ZQ5A 3P2OA 2QD2A 4ZTBA 5EZYB 3GDGA 3MEQA 3QUSA 4RJ2A 1X74A 4Q3NA 4R51A 4A36A 2EJTA 3JTEA 4KXMA 1HL7A 4NZOA 3TMAA 2W2LD 4D3FA 3OTGA 5I5EA 1CZKA 4KWTA 4HQLA 3T95A 2VYND 1K6EA 3RM3A 3T7SA 4FMCF 2HBYA 4I4TA 4DQDA 1OUMA 3I30X 4HTFB 4LF4B 2CBZA 1D5CA 4ZPJA 3INYA 4OHVA 2IP2A 2DU8A 3R0JA 3T94A 1O95A 2BHTA 3DF7A 3BVPA 5IUJC 1BQ4A 5AM4A 4JBXA 3QY0A 3V4PB 5JXGA 3DMGA 3M5CA 1FUUA 4L57A 1C9DB 1DWPA 3HB5X 3LVQE 1AO0A 4R1LA 1HDCA 2BGWA 4KH0A 1ODKA 4UM9D 3ERCA 4RZ2A 5CDFA 4ACBA 4IQ4A 2IU4A 5CLQA 4O5AA 4MP8A 3ICCA 1AQIA 1F5NA 1GRQA 2ORED 4LK2A 4PPFA 3ORHA 4JQZA 1CT9A 1G3UA 2JH9A 4XIYA 3T8YA 5K6AC 1DQSA 2CFOA 3S5UA 3B1VA 4ITRC 4DUZB 5DXAA 1GLNA 4YRGA 3PFIA 2IY9A 3AKCA 4JN6B 1WU7A 2CJWA 4HDAA 1ZY2A 5EIBC 3EZ9A 3FIUA 3GJ0A 3M9XA 3TVDA 4DMMA 3A3OA 4YXWA 1PKXA 2XOXA 5NLLA 5K0NA 1ENYA 1WPQA 3GA0A 1GZVA 2RFLA 3MQ2A 3QLEA 4X45A 1N36B 3E0QA 2BF4A 1ULZA 1OTXA 1WW8A 1ZNWA 2XOEA 4OOEA 3D8UA 2CZCA 4O02B 4XLTA 4CEJB 3E58A 3BF7A 3P9XA 2HGSA 3X1KA 4YCSA 4ZK6A 4QUBA 4DLAA 1KTVA 4IIVA 4WADA 4EAAA 3V3TA 3DXFA 1DEKA 1LLCA 2N3ZA 1I7QB 1DEAA 1UPUA 4D4MA 2JKVA 2ZWPA 4PPYA 2X4GA 3L7CA 1E1YA 4RHCA 3AI1A 4ALLA 1U2GA 3WK5A 1H6CA 3U49A 4MHSA 4L5IA 2GPJA 2A9RA 1LQTA 1BU8A 1I4LD 2F8LA 3ENZA 2VZEA 3ITDA 3KTAA 4HYQA 4KFRA 4M87A 1XRSB 2BSAA 5FA5A 1IHOA 4TWJA 1PBTA 4DWOA 1PHRA 2HOQA 3C98A 3L8DA 1V1RA 4NK4A 3PNQA 3FDXA 1VKHA 1Y0BA 1XTIA 2UZIR 1T9GR 2R4QA 4OHKA 4KQGA 2FU5C 2QAIA 3TSOA 2R6FA 4UARA 1H94A 2BHSA 3CGGA 4H0CA 1NXXA 1HEIA 1F6BA 1BW9B 5JZOA 3L8GA 4G0UA 1LX6A 4LZWA 5HFAA 3EODA 2WP8J 3KOZA 4QVIA 1LQUA 2DLCX 1R00A 3KCQA 2UAGA 1L1QA 4P83A 1Y9AA 2CXXA 3DGFC 5SV2A 3WYAA 5K3SA 1DRJA 1YZUA 1Z4OA 4Z51A 1ZNYA 4MGYR 1QIMA 1INLA 1W46A 1YRLA 2KX7A 4PLFA 3T5TA 1VA5A 3PTZA 1I8TA 4KEAA 3VJKA 3TB4A 2IU6A 3ZKAA 5FBLB 4G0VA 4Q00A 2X6QA 5AJXA 1R3DA 1J00A 1OX4B 3SHVA 2GJKA 3F74A 3I0MA 1QBKC 4KLCA 4C3VA 1D5WA 4NCIA 1JSXA 4K6GA 2L69A 3LGAA 5ITZB 3Q98A 4R5HA 4B0OA 3OWHA 3CLKA 2QQFA 5F7JA 1N5RA 1R6BX 1X1RA 3E9CA 5AKEA 1RAHA 5M5BA 1UBTS 4BPBA 4Y2SA 1WB5A 2UYCA 4WV3A 1BXRA 4JIGA 5A1JA 4O2BA 3CSSA 3QQPA 4KQXA 3BMQB 3O6VA 3REQB 3VC7A 3ZIAA 4ENQA 1CUDA 4FQ7A 1YQWA 3R7FA 5JZSA 3K2EA 5KINB 3P96A 4E70A 1V5EA 3B6JA 2NNLD 1Y5LA 3WP1B 5H16A 1C7ZA 3CG0A 3LT2A 3TCXB 2ZU0C 3RFTA 1QV9A 4CG1A 3CLRD 5EE1A 1RAAA 4N7RA 3N8HA 3TIIA 3BB4A 1IZ8A 1RQRA 4MQMA 4TSRA 2R751 1O58A 3IUPA 3PNVA 3LP5A 1HSOA 2PJUA 3QOYA 4MIKA 1NX6A 3TOSA 3LQ4A 2CLOB 3AOGA 3I23A 3PLNA 3L7NA 3TW0A 4TL9A 2AMJA 5HIJA 1ZH8A 4MZDA 2W70A 3A10A 5FNVA 2FPRA 4TN1A 4B3BA 2F4NA 4KI7A 2WYIA 2PRZA 3VKUA 1C4KA 2ZIVB 3WWCA 2FN8A 3LTNC 5EJAA 1ZMOA 1M2FA 1U3DA 2POQX 3ZCPA 5KWIA 3TG2A 1N0UA 3SYLA 3AERB 4KQ2A 4IEIA 3COSA 3PIIA 1UQTA 2GKSA 1J5PA 1GAEO 5I9SA 5K0CA 1T0BA 4MCAA 3IS3A 4DR3B 3QVKA 3Q3JB 1DB3A 5JSYA 2Q3BA 1T6NA 2X9GA 4NNPA 4I6EA 5D00A 3U0BA 2C8LA 3R0IA 2EDCA 2ONKA 4KQEA 4TLLB 2X2EA 4M76B 5BVHA 4LV6A 1BHJA 4ZVNA 4L78A 5KQMA 4FS3A 1VM6A 2CYBA 2IBMA 2KPOA 3VR1A 5DJ5A 4E5UA 2A92A 1QTQA 2ADOA 1TB4A 1YR3A 1XEWX 3I5UA 5CVUA 2CXTA 3AY7A 3C6ZA 1Z6ZA 4IICA 2HZ7A 2VRNA 2R4UA 4GVPA 4ZVPA 2Q46A 2IEDA 1CY2A 2W98A 1BRMA 1O97D 3CGWA 3H2SA 3L04A 3BIWA 3OP1A 1JG3A 4H15A 2PGIA 3JU3A 4OKSA 4KSBA 4IL5A 4CFZA 3X1MA 2D5BA 2HDHA 3L5OA 5AI6A 1MRNA 3RHFA 2AFIB 5K09A 4B7AA 1P1FA 3SJCA 4E15A 3MTEA 2C5AA 5B7QA 4CIBA 3GJXC 2XKKA 1ZZGA 3OA0A 4BJ6A 1SRQA 3BFVA 2Z2ZA 3BKXA 4JJ8A 5IEBA 3ROQA 4BUZA 3H75A 4PHCA 4X94A 1IOVA 1BNCA 1L3BA 3IOMA 4D9CA 1GPKA 4DDTA 4ZN6A 2DR3A 1PL6A 1ZISA 3AETA 5FUYA 3BK2A 2XUKA 1XGKA 2CLFB 4RHYA 1Q1EA 2A88A 2EV9A 2E4UA 3N87A 4QBFA 4ZTZB 2QL7A 4YBRA 3O4HA 2YJGA 4R98A 5CGZA 3DZHA 4CDNA 1BW9A 1K7FB 3V2UA 4RPIA 2Q7XA 4RX1A 4EKEA 2BKAA 4EI7A 1IVNA 2Q2WA 2BMFA 4G01B 4CGYA 1P1BA 2Y1FA 4Q4JB 3PC8A 5C7LO 5J4VA 1MT0A 1FU4A 1S1MA 2WVGA 2QTVB 1LTQA 3DZFA 3QI2A 4HAZA 4L0QA 4RD1A 4YJGB 5D3ZA 3ZDXB 2C04A 1I1NA 4DCVA 1TJUA 2GF9A 5DFAA 2SKCA 13PKA 3GZ4A 5FKJA 3ADPA 1EINA 1WZUA 3C87A 5CT8A 4YUVA 5TPWB 3WI7A 5JSQA 1PJTA 3EFBA 4FTWA 3GA7A 1FFSA 3K9NA 2NADA 2R8RA 1M0EA 5JRZA 3HBLA 3QEKA 1CF4A 4PPNA 4X8OA 3WE7A 4M7WA 5ALRA 4CHGA 1E7YA 5L40A 3R7DA 4PAWA 1K4KA 2M9MA 1ZK2A 4PZAA 3VOBA 3IOCA 3OP4A 1GA1A 4D4GA 1JAIA 1K89A 1AT1A 3D6MA 4JBYA 4DUGA 5KWJA 1DWUA 1G8HA 4M37A 3BIJA 3AL3A 3H5IA 3U9TA 4DCNA 1R15A 4P84A 4A0HA 3OIFA 3VR5H 4Z2AA 3WBFA 2QRMA 4LWQA 5TGZA 3L0IB 4CI0B 4CT0A 4D8VA 4DFDA 3GFRA 2VPIA 3ZI0A 4KR7A 1FSGA 5JYCA 2W11A 2A0UA 4KGXA 2ERCA 4POAA 3RAJA 4DBLE 2W6MA 1HRKA 1Z36A 3GUYA 3QLTA 4EW1A 3BDAA 2BFWA 1TVKB 4GMDA 2V0GA 4M6WB 4U3JB 3W8NA 1Y6FA 1FC0A 3EGEA 3LW7A 1ZRNA 4OB8A 5GPBA 1H0SA 3HI6A 4G5XA 4MKFA 5DN6A 3TFWA 4AROA 4CF3A 3EZXA 1CPYA 4EMBA 3AVXA 2D1QA 1GFZA 2AE2A 3SZRA 2GCOB 3HXMA 7AT1A 1GEEA 3D5TA 2H9YA 1O97C 2VDRB 3JQQA 1FNCA 4MHOA 3AIMA 3MB8A 5K0FA 3H1TA 1I01A 5FL7D 3C3XA 1I7NA 1YD7A 2POCA 2C9OA 3PE3A 2XQGA 2DM6A 4LWZA 5F3DA 2B8JA 1ZOLA 2CF5A 5ALOA 2P78A 5AK4A 3JQ8B 4OQFA 4V1CA 1T9CA 3DBOB 3PXUA 3RV3A 2CMGA 5KI6A 1ZRHA 3MJSA 3LDFA 3PF9A 4CKCB 5E3IA 4YN3A 4FEYA 5T3YA 1YJBA 4EA6A 1JKIA 1Q3TA 3PXXA 4MRSA 1HDOA 3DUFA 1A69A 3HV2A 2D4AA 1XMVA 5BW8A 5FTJA 4BKQA 9LDTA 1EGQA 3F6RA 3M3HA 1FP7A 4JLMA 4AJ2A 2V1UA 2QR3A 1R9GA 1E3WA 3KJFA 2JGEA 3DAOA 3KXLA 2HNKA 4YMSA 3F3SA 3HR4A 2IGBA 3CN7A 5GVRA 1Z7WA 2JANA 3RRNA 4YAOA 3Q3IA 4LHYA 3DM9B 1XDDA 1U8CB 1NW3A 3O4VA 2AH5A 3H0KA 4O1IA 1KP2A 2FXIA 1RAEA 2CNDA 3VPSA 5GJVC 4BO6A 2JAPA 2R1TA 1QK4A 1U8UA 4YMTA 5FBWB 2XLBA 4REQB 1XDGA 3WRVA 5L4NA 2DR2A 1QTIA 4Q4LA 1U0RA 2IEGA 3ZDRA 2ZRJA 2D13A 5LMCA 4TXJA 3ZWNA 4TUYF 4ISCA 2ENWA 3QPVA 1E1QA 1WWKA 3FGPA 4X7PA 3QLUC 4JR0A 1M2EA 3JQBC 4LZAA 3J80A 4CMGA 2QDXA 3GVHA 4NULA 2IUYA 5F5NA 2QMHA 1DAFA 3EIWA 1EFPB 1W5TA 3ULKA 4DR7B 1JYEA 3AFIA 4MV6A 2PT6A 2J4CA 1NRJB 4R41A 1KKMA 1L7PA 1KBQA 3G7UA 4CCYA 1KVUA 1SUWA 3PP8A 4UEWA 5IASA 3BZWA 3FX2A 4MARA 3SM3A 4B3CA 5C1IA 3EMBA 3FAKA 2PWZA 3QU5A 5DI3A 2DQKA 1N0IA 1TX4B 3QNWA 1RYHA 3NTOA 3ER6A 1Q16A 3R77A 4AZSA 3L8CA 4CQLB 1V2GA 3BGSA 1SOMA 5LZ8A 1QCZA 2F8TA 3T9FA 4S3MA 1OE0A 1UXOA 1Z6AA 2W6PA 2P6UA 5IXJA 4FMDF 1ECFA 1KK2A 1W4BA 2Q9BA 4GXRA 4Q18A 1JECA 2FN7A 1A2QA 3OHPA 2ZBPA 4O4IA 4DUPA 3EA5A 2B21A 1NF2A 4FFBA 3K7EA 1JQAA 4IS2A 1TF7A 3I76A 4Y9SA 5G53C 1J9EA 1Q7GA 4MWOA 2QTRA 1BA2A 1M83A 1T2NA 1I6MA 3A9UA 2W00A 3BJZA 4KPUA 4GMFA 4X61A 5DXJA 5H3LA 1OD6A 3FVWA 3M3PA 5A71A 4I1IA 4U2EA 3QE2A 1ISIA 1A9RA 1TLFA 5F78A 4A0GA 4CM3A 4D99A 4OQLA 3COYA 1IOZA 5DULA 4D46A 4F21A 2NMVA 3DKKA 1P61B 1DBVO 3FRIA 3GNTA 5JCPA 4IPTA 3U3OA 5HTKA 4EUEA 2D5LA 2NVWA 3BWEA 1K7WA 1S2MA 1RE0A 4PSKA 4RKEA 4QNNA 4A8TA 3ITEA 1A96A 2DPXA 1U16A 3LXMA 2FJ0A 4K86A 4ZEVA 3RTDA 3DVRX 3CJQA 2P5SA 1JB1A 2GCEA 2W2OA 1FB5A 1GZUA 1YHYA 4P38A 1JAZA 1Z6GA 5J2TA 2JJMA 4FX2A 3VM6A 1IL0A 1YZ3A 4A8JA 5ILOA 2NIPA 5LQKA 1J42A 1GPBA 4R1OA 3B48A 2I4MA 4OX9B 5F64A 4CDRA 2HRQA 1ZKDA 4RGVA 2AOTA 2J87A 2DT5A 1RHUA 4A8JC 2JAOA 4LY6A 1OYVA 3UUGA 4OBEA 4YACA 4HT3B 2NXEA 4PO9A 1HDXA 3Q4GA 5CFRA 1DIRA 2ID7A 1TF5A 3EUEA 2CCKA 3ILVA 2FH5B 3WYFA 2NPIA 3UH1A 4ALMA 1BEEA 2HJGA 4FJ0A 1D4FA 1TJVA 2C2HA 2WAMA 1SZDA 2E4ZA 2O8BB 2CUNA 2CBXA 4ZAFA 3A1EA 3Q2OA 5E0OA 5JFOA 1N33B 2JARA 1ZN7A 1VJ0A 3A9VA 4KVAA 3K30A 3TIXB 3DT9A 4MHTA 1OASA 3DKRA 1NT4A 3WQSB 1HSZA 3EZYA 1FFXA 1QANA 1BHQ1 5ALGA 2XNDA 4M0EA 3CPEA 2ZR9A 1F4LA 3H1EA 3JWPA 4URFA 2ZSAA 2V5AA 4MCIA 4KB5A 5CPFA 3WLAA 3RVKA 4UUNA 3F9IA 4LRWA 4NDAA 3T1NA 5BWNA 1GNPA 1WDKA 2J0EA 2GPYA 1EJ2A 5HKBA 2O7SA 4OMDA 2QT0A 1DLIA 3W5JA 3FUVA 2YZGA 4KGDA 1V6AA 1M1UA 2REXB 2WIDA 4QU9A 1EK5A 3U7EB 5HPYB 1KEUA 4ENSA 2QOEA 2QVGA 3QKTA 4RPLA 3WRYC 3ODPA 2ZYGA 1ZCJA 4YT8A 2FE1A 2CLDX 4FILA 4CV0A 4DSOA 1MXHA 1XDZA 4EFDA 5A9RA 3M2PA 1YDHA 4QATA 2W48A 3NVKI 1FYEA 3C74A 4XM0A 4WZ6A 1ZJZA 2C4TA 3E9MA 3IQZA 4KIWA 4CM8A 3AKZA 2XDQA 1NVEA 3D4IA 2DWQA 2QX7A 4MQEB 3ZQKA 1NBEA 3AEQA 2IYPA 2BKLA 3ADOA 1U7UA 1LSSA 4DMGA 5TQJA 2HVGA 1T9AA 2FWJA 2IW3A 2WVHA 4II7A 1PX0A 3GGJA 5IVDA 3WGUA 1I5RA 1XYYA 1YS4A 3OH8A 1F9EA 3OAAA 3FPGA 1C0KA 4PIVA 4XQ9A 2IX3A 5CCXA 1JHMA 3KLBA 4NCXA 4XEHA 2JIRA 2OP1A 3J7AC 2IOFK 1LPPA 1XN1A 2CLKB 3NALA 3MT8A 4E2YA 3K0FA 4UJ5A 5ALVA 4MMZB 1MO4A 3AR7A 4MEBA 3AJ9A 1C81A 4BEWA 3TOZA 4GLFA 3KLNA 1EMDA 1RWMA 3AYZB 3BGVA 1KWGA 4DB4A 1OC4A 1UEJA 1U94A 3TQIA 3FKQA 1D2HA 1E1KA 1YT5A 3D4OA 3FGOA 5BNZA 1ULSA 4JEMA 5IHXA 2WQZA 2P79A 4PRKA 3NV9A 4U2GA 2ERXA 3F8TA 4YDRA 3SVLA 3ESQA 1BA3A 1SXGA 2QRPA 4KO8A 1IONA 3WIOA 3NC1C 4CKBB 4M1TA 2Q62A 4X6XA 4YALA 2ZR7A 3VH3A 3R09A 3LYAA 1MAVA 3I83A 3F67A 1C9EA 1FQWA 2IT1A 2WF7A 2ZRQA 3L1VA 4RKYA 1PL0A 1M76A 4UFOA 2JGDA 5G0SA 1Z26A 2EBFX 5JXJA 3ZK8A 3IUJA 4M9RA 4I3GA 1LF0A 4MWSA 4EMSA 4UMEA 3KETA 5JD4A 1K98A 1KI7A 5FUVA 4EQ6A 3NUZA 2EX4A 2O54A 1V1MB 4RHEA 5KKAA 1YVEI 1HQCA 3JVDA 2Q6OA 3TGPA 1EK0A 2R62A 1X13A 3GZNB 4RLQA 1XZGA 1P0PA 1XVAA 2QTBA 1N0WA 2BF7A 3EXEB 4FR5A 3T7DA 4G0ZA 3DYVA 4EYKA 2GPAA 5E0KB 1QS0A 1MGPA 4QXQA 4B71A 1VP3A 2PXHA 1U8FO 2YASA 3PSHA 2DBRA 5CT6A 1RRGA 5AJYA 3GLGE 1JQ5A 1WDWB 3BJMA 2H1LA 3OE1A 2AK2A 1TYDE 4R8SA 3GHYA 5G02A 1P4AA 4OU5A 1IK4A 3TTUA 4C20A 3ORRA 3QA9A 2GRUA 2ETVA 2NYRA 1XLTA 4NHEA 4AURA 3H17A 2JGNA 5BWCA 3FLMA 1PFUA 4YP7A 3WL7A 1YCGA 3E7DA 1ZNXA 3OPQA 4QRHA 3THYA 3D6AA 4HRAA 4F97A 1JHRA 3HA2A 3P9KA 5KU7A 5ALYA 1HY3A 1LJLA 3ZTWA 1PV1A 2XD4A 3LCCA 2JJQA 4I55F 5AO9A 4ARIA 1HFEL 5G40A 1A7KA 1JQDA 4ZAGA 1J20A 2PSFA 2QUAA 3EVEA 3AKEA 3P7MA 4FDAA 3UBMA 1PNTA 4HFNA 1OKKD 1DO2A 1NQXA 2I8LA 2K2QB 3QLVC 1ESZA 1NMSA 3AEUB 4ER7A 3CUTA 3NDJA 2VI5A 3GVPA 4C2BA 4NZNA 2GKOA 4I7EA 2IU0A 4R83A 1N34B 1A4RA 3LRTA 5BSGA 1Y1KE 5EKUA 2JVJA 1YR8A 2VF7A 2GHRA 2Q1YA 1NUQA 3UO8B 4D4IA 1DTSA 1C7EA 2AFHE 1JLKA 4RTJA 5LL6P 4P4TA 2EIHA 1QJCA 2VDVE 3FAZA 4HRXA 3T34A 4LMBA 2XT9A 4BFTA 1DPFA 1VI5A 3O91A 1AD2A 1NMXA 1Z0KA 2CLCX 2EF1A 2Y1GA 3RRBA 1NPTO 4E3ZA 1VE1A 4HN4B 4J0QA 2P9YA 1LRKA 1GPYA 3LBNA 2AZTA 3ONFA 4DLZA 1UXHA 5L8VA 1LCIA 5BN3B 4QFDA 4HSGA 4QSMA 4MVJG 3G0DA 3EIHA 4OP2A 4IDQA 4RZHA 2W6OA 4NH0A 4TTVA 2FPXA 4ZARA 1J23A 1QVVA 3EYAA 2EL7A 5DYIA 4UOZA 4ZOAA 4G89A 4CG0A 4JKOA 4NOJA 2I54A 2O1XA 3LG2A 4N1AA 5IKPA 1GGEA 1PJZA 3LH5A 1HEUA 4OEHA 1QR2A 2XWQA 2ZCVA 2OSVA 2XVYA 3MPOA 4FOTA 1P9LA 1ZVJA 2HWWA 3A25A 3GWGA 3LMKA 4OHUA 1WZIA 3QUQA 2QU7A 2AWNA 3HUFA 4MYDA 4ALKA 3PF8A 5MFZA 1P4SA 1PQ4A 3FBTA 2R7LA 3NBFA 4W1RA 1ND6A 4ZO8A 3ENKA 1FUIA 1NBHA 4D4HA 1K92A 2W90A 4QAQA 3WK6A 3NYRA 4O4HA 3ROGA 4X6YA 3ZX4A 1R6TA 4QU0A 4TV9F 1IG3A 2ATCA 4Q48A 1BEUB 1TE2A 3AL0C 1NL3A 2C9ZA 1VL6A 2OV8A 3P0FA 2BZ0A 1N6KA 5IS2A 4B09A 3KV3O 3KALA 2WFMA 3ZPXA 1B6RA 3TKAA 1U1FA 3GOQA 1M2HA 3EPHA 4DQXA 4BC0A 2WZQA 2LBPA 2OGTA 3R5HA 4P22A 5IAKA 3RS3A 3WTCA 5K0GA 2Y76A 3TSYA 5E95A 5FWDA 3GJ6A 2YZNA 1EKXA 2FAXA 2EQBA 2OBMA 1OPXA 4XYEA 1B1CA 4OHRA 1IM5A 2JCYA 4B32A 4NAUA 1FFBA 3F46A 4F60A 3NJ4A 5B7PA 2YRXA 1BEZA 3ZDDA 3LFTA 2XCOA 4LXGA 5TIIA 1I4DD 3KB1A 3P9RA 3HVKA 1U0BB 5EUBA 4AS1A 4Z4GA 1BX1A 3OPVA 3JQ8A 4V1CB 3GLFB 1TM2A 2XBMA 1SOAA 1LPBB 3RFXA 4OY3A 5WRFA 1C7IA 3C8ZA 5FHQA 2IYOA 4MLDA 5GY7A 1T9DA 1P4HA 1WHTA 1YJQA 1GFWA 2D2VA 4RJIA 4XPZA 2PAAA 3S1SA 2FPOA 3TRHA 4FCWA 4GF5A 2QTWB 2ACKA 1TKCA 4IH9A 2ZRBA 3KKLA 3UJNA 1JKMA 1W0KA