4NFLA

Crystal structure of human mitochondrial 5'(3')-deoxyribonucleotidase in complex with the inhibitor npb-t
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
201
structure length
201
Chain Sequence
SNAASGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformationally constrained nucleoside phosphonic acids - potent inhibitors of human mitochondrial and cytosolic 5'(3')-nucleotidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 5'(3')-deoxyribonucleotidase, mitochondrial
total genus 69
structure length 201
sequence length 201
ec nomenclature ec 3.1.3.-:
pdb deposition date 2013-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4nflA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4nflA01
2R8EA 2I55A 4UATA 2PQ0A 1U7PA 3KBBA 2B30A 4EELA 5AVUA 2Q5EA 3R9KA 4NABA 1X42A 4XOUA 3MN1A 1RMTA 3SKYA 3D6JA 2G80A 2B1RA 2I6XA 5AIBA 1VJRA 1LVHA 3GYGA 3QU7A 3QUCA 1N9KA 3ZWKA 3E84A 5AW2A 3A3YA 1SWVA 3R4CA 1TA0A 2ZG6A 3QU9A 3U7HB 2FPUA 2JAOA 1CQZA 2DQSA 5AM2A 3QGMA 3EWIA 2BDEA 3EF0A 2P11A 1Z4JA 1YJ5A 3WKDA 4QJBA 5AW9A 3QU2A 3B9BA 3VAYA 5AI5A 3ZVMA 5AVZA 1S2OA 4KYTA 2C8KA 4GIBA 1IWOA 3N1UA 4UM7A 3KOOA 4KX3A 1L6RA 3ZTYA 2C8LA 3U26A 4BNDA 3K1ZA 3UMCA 5AM5A 4Y2VA 3QNMA 2GMWA 2BDUA 4QQFA 5AW1A 2EAUA 4HGNA 4HGQA 5ALWA 3AR2A 2ODAA 1JUDA 4BX2A 2R8YA 4YCMA 2R8ZA 1QH9A 1F5SA 3OCZA 4UW9A 4C4RA 3L1VA 3FPBA 4L6CA 3U13A 5A3QA 3I28A 1PW5A 1NRWA 4AS2A 2FPWA 3OCVA 2IYEA 4OCZA 4I9FA 1L7MA 5AM4A 5AW5A 4IG4A 1RLOA 3AR3A 1YNSA 3M9LA 5ALRA 5AW3A 1EK2A 5ALJA 2YMMA 2D2VA 4J2TA 1RQLA 1WZCA 3KZXA 4ZEWA 2ZBEA 4HYTA 4CE6A 3I76A 3NUQA 5ALFA 3WK6A 4RESA 3UMGA 5ALDA 4YCLA 2IOFA 3OCYA 3DNPA 5AW4A 3FM9A 1XPJA 3L5KA 4XPZA 4DWOA 1VJ5A 2FDRA 2EARA 3FPSA 1RPZA 1Y8AA 1U2TA 1O08A 5AKGA 5AKJA 2W11A 2G06A 2R8XA 3HYCA 3NAMA 3QUBA 2ZBDA 3E58A 2EATA 3AR5A 3R09A 2W4MA 4F72A 2G09A 2CN1A 3CZ4A 4YIHA 1EK1A 3J7TA 2WF6A 4Y2UA 4ZEVA 3FGOA 1N8NA 3AR9A 2QYHA 1Z88A 4HGOA 4HGRA 5ALSA 2G08A 4UU0A 1ZD2P 4CF5A 3NASA 5AVQA 2ZXEA 3N5KA 1WR8A 5AKHA 3WK7A 1QQ7A 1RKVA 1U7OA 5AVTA 1WVIA 3SKXA 2NO5A 2FPSA 2AMYA 2ZOSA 3WKEA 1ZD4A 3ZI4A 3EF1A 5ALKA 4BYGA 5AKIA 5AK5A 5AKKA 2HCFA 5ALQA 4UM5A 1MH9A 3L7YA 2OBBA 1QYIA 1AQ6A 2YJ6A 2YJ4A 2JARA 3AR4A 3OTQA 3KD3A 5AIAA 3M1YA 2YN4A 4XQ0A 2CFTA 3L8GA 2G1AA 2HHLA 1T5SA 4Y2YA 4BBJA 4DFDA 3U7GA 2HF7A 3ZW7A 3EPRA 4YGYA 2PKEA 4Y2SA 2HX1A 4J03A 4OD0A 1QQ5A 3WKAA 2HDOA 4BX0A 1TJ4A 4Y2TA 4Y2PA 2YMPA 4G9BA 4CF3A 1J97A 4UAVA 3AR7A 3KC2A 5ALUA 2IA5A 4JB3A 2FUCA 3W5BA 1O03A 1Z5GA 4XE5A 4JDPA 3U7FB 1ZD5A 3NIWA 2GO7A 1YDFA 3UMBA 3NANA 3PCTA 1RLTA 1YMQA 1RRCA 4MUMA 1U2SA 5AVYA 3L0CA 2RAVA 2BY4A 3I1YA 2YMLA 1Z4PX 4KN8A 1Z4KA 2C88A 5AK3A 2C4NA 3AR8A 5AVXA 1RLMA 3FZQA 3IB6A 4EX6A 2WF7A 3L0YA 1NF2A 3ESRA 4L57A 3OCWA 1Q91A 1L7OA 3P96A 4Y2JA 3OCXA 3BWVA 2I34A 4C4TA 3BA6A 2PR7A 4FE3A 1RDFA 5ALTA 1U02A 3MMZA 1TJ3A 5T41A 3A1CA 3W5CA 4GXTA 3W5DA 5ALVA 2HOQA 4L6AA 4DCCA 3HLTA 5AESA 3S6JA 4NV0A 2YMQA 1Z4MA 4EEKA 3ZVLA 2HEGA 2FPRA 1RQNA 3U19A 3B9RA 5AM1A 1Z4OA 3A1EA 4E88A 3L0BA 1RMYA 5AI4A 5AI6A 4KNVA 5ALNA 2B0CA 2YBDA 3QXGA 1NNLA 5AKEA 2MSNA 2NYVA 2HO4A 3PGVA 5A3SA 4RETA 2WF5A 2HI0A 1WPGA 3ET5A 3ZVNA 4MWOA 4F71A 3WGVA 2WFAA 4UMFA 3ONNA 1RMQA 5ALLA 4O8CA 3SLRA 4AP9A 5A3RA 3L8HA 3KDPA 3B8EA 4I9GA 4Y2QA 1L8LA 4YCNA 4UASA 4AS3A 5AVWA 3N8GA 4FFDA 2QLTA 5ALXA 2G0AA 2YJ5A 2B8JA 1K1EA 5AVVA 2HSZA 1VFPA 2Q4RA 5AKZA 3SHQA 5AVRA 5AI9A 4Y3UA 4HGPA 4NFLA 1RKUA 2C9MA 3CNHA 3AR6A 4BNDB 5ALHA 5AKLA 4UMVA 4OFZA 4DW8A 3QUQA 4OHFA 2JGAA 3WK8A 5ALMA 4EENA 1L8OA 2B8EA 2FI1A 1Z4NA 1T9ZA 4FYPA 2FUEA 3DDHA 2B1QA 4UARA 2WF9A 3WKCA 3L8EA 4KNWA 1ZD3A 4B6JA 5AK4A 2B82A 5AI0A 2GFHA 2CFSA 3DV9A 4NAVA 1Q92A 3N07A 1SU4A 2WHEA 5ALYA 1Z4LA 1QQ6A 4YIKA 3A1DA 3WGUA 3RFUA 3ZU6A 3L8FA 5AKYA 3SD7A 2GHTA 2VKQA 3ED5A 3QU4A 4H1WA 2ZBGA 2CFRA 4UMDA 3RF6A 3WK5A 5AICA 3L1UA 4BKMA 1YS9A 1ZJJA 2W43A 1TJ5A 2JAUA 2IOFK 3FVVA 2JAWA 4Y2XA 3TLMA 1SWWA 5ALIA 2YY6A 4EZEA 2I33A 4C4SA 3QYPA 4KX5A 1Z4QA 5AM0A 3U7EB 1TE2A 1FEZA 3WKBA 3ZUPA 5ALEA 2P27A 5AI8A 5AM3A 1YV9A 5AW0A 1RC8A 2P69A 3UM9A 4BEVA 2NO4A 4YH1A 4CNQA 3QU5A 4IFTA 3IRUA 5ALPA 2O9JA 5JJBA 2OA0A 3ZX4A 3ESQA 5ALZA 3ZTWA 2AUTA 4ZEXA 4EX7A 5AW8A 3WK9A 4G63A 4Y2RA 2OM6A 2RARA 1CR6A 1ZS9A 2ZBFA 2AGVA 1XP5A 3SMVA 2O2XA 2AH5A 2RB5A 5AW7A 3PDWA 2FPXA 5ALOA 2P9JA 2WF8A 2I54A 5IT4A 3QUTA 1ZRMA 3E81A 3ET4A 3NALA 3OCUA 5FP0A 2OYCA 3W5AA 4CF4A 5AW6A 3QLEA 4UMEA 2X4DA 2YJ3A 2Q4TA 4UU1A 1Z5UA 1LTQA 2FEAA 2G07A 2I7DA 3PGLA 5ALGA 1ZOLA 5IS2A 5IT0A 1RKQA 2GHQA 3N28A 5E0OA 3I6BA 3NRJA 1S8OA 3DAOA 3ZWDA 4PNHA 5AKXA 2HF2A 1L7NA 1XVIA 4NWIA 5AK6A 3WK4A 1ZRNA 3QX7A 4BEWA 1T5TA 2YFYA 5AVSA 3F9RA 5AHXA 3SF0A 1J8DA 2MU1A 2WM8A 3OPXA 2IOHA 3MPOA 4HAIA 3MC1A 1Z4IA 1KYTA 1L7PA 4UAUA 3IJ5A 2RBKA 3ZX5A 3E8MA 4BX3A
chains in the Genus database with same CATH superfamily
4ND1A 1NNI1 3RC7A 3I0MA 4DSZA 3DT6A 3OTWA 4IXDA 3F6BX 4UHDA 3TDMA 3A9UA 2XWBF 4EELA 2H17A 5KYGA 1ZCJA 3NYQA 2GB4A 3ORYA 4GQIA 4GG1A 1EFLA 3C7CB 5TEWA 3DDZX 3SF8A 4OL0A 1EYZA 5DYYA 5C5EA 1ZCAA 1AXRA 3MTBA 1XZJA 4H77A 4PZ9A 5BW5A 5JUWA 1JH9A 4S04A 1WTCA 4OHPA 3A28A 1UOPA 1HNZB 4IQFA 2OB1A 5JC1A 1N9KA 2H8KA 3PGA1 2FCAA 3PC2A 1F2TB 1XPUA 1YB4A 4S1PA 1E9BA 2WJVA 1AQLA 3PNKA 2CD9A 3LVQE 4KJXA 1KO7A 5AW2A 2RHLA 2HUNA 1XTVA 3PSAA 1S7GA 1PSDA 1JWLA 2A5DA 2XTJA 3FXAA 3O90A 1CUSA 3TAHA 4M9QA 4AJOA 4E11A 3T9AA 3BDAA 1B26A 1GPDG 1XXLA 2EKDA 4INZA 5DB4A 3MOGA 4EJSC 1ZJZA 1TUEA 1U2QA 3S70A 4N9QA 5AM2A 4JP5A 4DMFA 2JGNA 1U8CB 1VBMA 3L3BA 1PS0A 5FJJA 4NP6A 5SZHB 1JEQA 3ZDBA 3WISA 1OTXA 4MKIA 2J67A 1DXOA 4KRXA 3U4QA 4S1OA 2NZ2A 3BGIA 1NMZA 5EJ9A 5I7OA 3B9BA 2VCHA 2ZE7A 4RE5A 5JG7A 3RTCA 4Z4QA 4XVQA 2GXAA 3OBBA 5I3CA 5KCMA 3GJ0A 1QFMA 3CW9A 2A7XA 2W2OA 2QUIA 2VRNA 3L43A 2L0XA 1TK2A 1XEXA 3K1AA 3D6NB 1BWSA 3FPGA 3IPRA 4U7PB 3ZTYA 1ST2A 1KIFA 1R74A 3C3YA 3G59A 2I4IA 1NATA 5JRDS 2ZS8A 4UDYX 3U7JA 3ZJVA 4PPFA 1SUCA 3E7PA 3TIIA 3K6JA 3THRA 4Y2VA 5JNUA 1G4UR 1HFKA 1FQJA 3GV0A 3REFA 4WRRA 1BQEA 4NESA 3DR5A 1VXOA 3AR2A 5LQDA 1RPTA 3WYBA 2I2WA 3LDAA 3A9CA 3SC2B 5JEDA 2WD9A 2ZYRA 4IICA 1AKYA 1QG0A 4FNAA 4E94A 2HPAA 1U7HA 2BFDA 1QYWA 4K6FA 4I4TA 1GAEO 2FJ0A 1UXGA 3NKLA 5E7MA 4B40A 5EJAA 4BWGA 1I4OA 1O89A 2VDJA 3KT6A 3AUYA 2EDCA 4M7WA 2FN7A 4AM8A 4MROA 4XWYA 1OLOA 3DLBA 2BI8A 2GEKA 5JBNA 1NRWA 5F23A 3HCFA 2ESRA 2XH8A 3DUFA 3EVCA 3GN2A 3DP7A 4PNZA 5EKSA 4C6TA 3KL2A 3WNCA 2CYBA 2FTKE 3EGOA 1LNZA 1YJAA 5FBKA 4A8JC 3M9LA 4PLTA 1HM5A 2PU5A 1GZVA 4UE3S 4MX2A 1ZIPA 4MULA 3G7SA 4PWZA 1O96A 3I1JA 4ZO7A 3RIEA 1Q7CA 5K0SA 4JQSA 2HB6A 4UPVA 5BRJA 4ML3A 1WXEA 2ZI7A 3V4RA 4ZEWA 1EX7A 3P9YA 4JC5A 4ASUD 4N41A 1DX4A 3OKCA 2DZDA 3URMA 1KERA 1K6EA 4WXPA 3BXHA 2J6HA 4ESHA 1Z8NA 1CB0A 1GKLA 1VI5A 2VP6A 2FWIA 4LZAA 4KPFC 1AZLA 4D25A 1GRVA 2P1DA 4XYGA 3Q5EA 4N03A 1SKMA 2FW8A 1O4VA 1V9CA 2GJAA 2AN1A 2X0RA 2J7PD 5BOSB 1KRHA 2EARA 3MXOA 1N5OX 2A9FA 2PPVA 2RHDA 3QE2A 1YFLA 4TXLA 1H23A 2OKCA 3ENQA 2BCGY 4K1LA 1T4CA 1Z38A 3HYCA 2YNMD 3NTXA 7MDHA 1GA4A 3BB3A 3E58A 3EFHA 2RGNC 4D97A 2QP9X 2C5SA 2BTEA 1U0JA 2H1RA 2W4MA 3DHWC 3IP9A 3T95A 2AEFA 4KITB 5JJCA 1J24A 3CZ4A 5DGDA 4YIHA 1U63A 3H42B 3RFFA 3G2OA 4HDCA 4F3NA 3KHSA 4G07A 3I34X 4K05A 4Q93A 3TSCA 2WTAA 1QYCA 1KBZA 1MOZA 1WB6A 2JEYA 3LPCA 2FX3A 2ORWA 4WINA 2PMEA 4DLLA 4NJEB 1M2JA 2FPGB 2N47A 4G9GA 3BRWD 4IKPA 1R15A 2MSKA 3GDOA 3PXGA 4JI8B 1L6IA 4QYIB 3S5JA 1BKSB 2YDYA 5COQA 1MC4A 4AQDA 5CLJA 1JLSA 3KV3O 2JLWA 4BKUA 4JLPA 5EJ5A 3ZH2A 4WOBA 5L9AA 2YWJA 4MJ3A 5KSZA 1VRVA 1XEWY 1Z62A 3CWQA 3R77A 2WFZA 4QYTA 2QNRA 5E2IA 3PGKA 4LJ8A 3UG6A 4NYIQ 4ACAA 3ZI4A 3EF1A 5ICMA 3KBOA 4NEGA 1HZZA 3MXTA 2FUG6 3F90A 4RVSA 5ALQA 3IGFA 1TT5B 3ETNA 2XB6A 2JGJA 4UVDA 5A5VA 2EC5A 1KOGA 1Q95A 4F2PA 5T6BA 2QG9A 5L3QB 1SM4A 2G0TA 2PD6A 3OHPA 4H1HA 4DMGA 1I1QB 3H1PA 3DLTA 1SBCA 1NF3A 4D9BA 1X7XB 2AWOA 2FOIA 2R87A 3KYJB 3T1YB 1F3LA 1GPNA 4EGJA 1FP7A 1FRQA 4EB0A 3KLBA 4HQ0A 1UBLS 2JH3A 5EIWA 4MCJA 3M6AA 1ECBA 1RFLA 3PXCX 3O8DA 4ZJUA 3TJMA 2YFKA 2HX1A 3TLAA 3MCVA 3LWNA 1NM5A 5FR1A 4AX4A 1CVLA 4IQGA 3H1GA 3KHUA 4G9BA 1A4UA 1NASA 2WNIA 2YHUA 3A6JA 3PUJA 1GUBA 3GVCA 3EVBA 1A1SA 3WSVA 3H1FA 2IA5A 2O2IA 1N7JA 5IBCA 3IEPA 2XXAA 4LF9B 1A7JA 1RM3A 3G2PA 1JTFA 1A9RA 4XE5A 1JLLB 4EO7A 4C05A 2ACEA 2CCKA 2VIIA 3K05A 5ADVA 1ZUNB 3AKEA 3A4MA 1L4KA 5B55A 4CN8A 4GECA 4B3CA 2ZDQA 3WSTA 3WLJA 6GPBA 3PXXA 3ZZUA 3BJMA 4DSNA 3TECE 1TRKA 2YASA 3QXJA 1HMPA 4E5SA 5IK2D 5EJGA 4C87A 2AQIA 4B32A 2C97A 1ECJA 3LRPA 3PS9A 4X1IA 1EDBA 1W44A 5AVXA 1EDEA 3FZQA 5FOSA 4OHRA 5IKOA 5JFTA 3L0YA 3I5XA 1V7ZA 3JQ7A 4OF4A 4MHSA 1TA9A 4QJ5A 1DTEA 1RQPA 1Y42X 3GRPA 2FFJA 4I46A 3TLJA 1PJBA 2C03A 1E2LA 1ORIA 1AKQA 1U16A 1AHIA 2X5NA 3D0RA 4FE3A 4O4JA 5DEIA 3SK0A 1B2LA 1US8B 4DC0A 5BOSA 2E48A 5C1IA 1JIKA 3DZGA 3PNOA 3ROZA 3S28A 3E4CA 3C4QA 1YDHA 3ETCA 1RYNA 5D6BA 3KEFA 4WY5A 4EEZA 1E2UA 2DHEA 3T34A 3LO8A 2GYVA 1DRVA 2J9GA 2WTMA 2OC9A 2ZJ5A 3COSA 3I9JA 4IXNA 4RORA 1KO5A 4W82A 4JI1B 3FBWA 3R3WA 3SSAA 3UATA 1WW2A 2G88A 3HSKA 4HZUB 4LDJA 5KYUA 4BB5A 3IOYA 3E7WA 5IHXA 5BSHA 1D0SA 1AQYA 3BZWA 1U8EA 3T38A 4DR1B 3VUEA 1B74A 3AY7A 2PGLA 1A8PA 1VFNA 2GAJA 4NBSA 5HTKA 3S1AA 2O2JA 2PXHA 5B2EA 3GRCA 1TQ4A 1NVXQ 4DSTA 1TYCA 3PHHA 3K9BA 1KR2A 1QP4A 4MITA 4R8MA 1DWUA 1YRWA 1P72A 1Z0FA 1S02A 3CUWA 3CH5A 3MMPA 3RLFA 2NYUA 4V39A 1V95A 1G8FA 3RW9A 2GUWA 2EZTA 1RP1A 1TW2A 1GXSB 2HO4A 3V8RA 4GI3A 5A3SA 2NO6A 4QOJA 2BWJA 3DKPA 3MF4A 2HNBA 2HL6A 3WDMA 1SXJD 5NULA 1LQTA 1ORDA 2G9UA 2QTZA 3C14C 3QE4A 2PRZA 4RDHA 3QWHA 2WJIA 5JCOC 1X3SA 2VLIA 1F2DA 2RKWA 1X1EA 4OB7A 2NYRA 4K86A 1WXGA 1OPRA 1Z6PA 3SSNA 2GVZC 1SOMA 3I52A 4V0MA 1YXMA 3EPJA 4F4UA 3F5MA 2J07A 2XUQA 2I8CA 3UGQA 1XRLA 4V0KA 4TWJA 2K7FA 3N8HA 4NBUA 4EYKA 3NRCA 3R0QA 5KTKA 3UJ3X 1U8XX 2CHUA 4MS3B 1ISJA 2D0OB 4FBGA 1G8KA 2O8BB 5TMEA 4Y3UA 2JFYA 2VBFA 2GBCA 1J20A 2GM4A 2WFMA 3NNSA 3ORRA 3AR6A 1V9LA 2H06A 3AF2A 1KC3A 1UPCA 2HU8A 3LF2A 3RVLA 1O7JA 5JXIA 4EZIA 1RAHA 1U8FO 4KO8A 4KMMA 4OHFA 4UXJA 5JNTA 5MF6A 2JG3A 3R0IA 3DDNA 1XTIA 3OAAA 1IZ0A 2X8LA 3IAXA 3WOHA 2PRSA 3RAFC 1NQ5A 2FR8C 2HT1A 1ANKA 2L18A 1N1MA 221PA 2FI1A 3JATB 4BKRA 3EW9A 2C2ZA 1TZBA 4M99A 4AKIA 1XRMA 3F8WA 4QPZA 5K8VA 5EMMA 4ZVPA 2GS9A 2YZKA 3D8HA 5MFPA 3M33A 3SZGA 4B6JA 4YMGA 1TTQB 3RC3A 3UO8B 3FTNA 4A8PA 2GFHA 2B1GA 3H17A 3NYWA 4WK4B 4UOEA 4MQFA 4LMAA 1Z4LA 4ZYUA 4FFRA 2EKPA 1LC3A 3H2KA 5CFZA 2WMDA 4YVFA 2CJXA 5ARCA 2Q3MA 5JSUA 4L8LA 3ZE8A 3RSZA 4IF4A 2BM0A 2PIAA 3GVPA 4U8HA 4KQIA 3STHA 4XGNA 4GKVA 1QUEA 3AVWA 1SJ9A 1I0AA 4ES6A 4A23A 1MOQA 4O2RA 1AQJA 4OQFA 2JFFA 2WSBA 1CQIA 3BA1A 4OYLA 4B8WA 2A0YA 2DHRA 3AHHA 4BRSA 2VP9A 4ZYLA 4KSCA 3LT2A 3S99A 3SJUA 2A9QA 1HYHA 1PHPA 4TMVA 2C07A 4J90A 1Z34A 1AMOA 2JL1A 2ZRPA 1QHSA 1MH1A 5DHRA 2JAWA 1R4ZA 2QXYA 3W9BA 4PANA 1WJGA 2G7MC 3OA2A 4RGVA 4LE1A 16PKA 1DIOB 3LSYA 1JR3A 2CW5A 3DXFA 3MAJA 5DGCA 1RJFA 1JIQA 2Q5HA 4HXYA 2QMUA 1E18A 4ARBA 1Z4QA 5IVPA 2GN1A 4E12A 1FEZA 2FNAA 1UBRS 1EUCB 3JQDA 4IDAA 4UU7A 3AVXA 1C3CA 4MDHA 1XQXA 3COPA 2HWUA 4I3FA 4KQ9A 4ODIA 5TMPA 1VCHA 4XXHA 2EKZA 2P69A 5L3ZA 4IINA 4JJEA 4K88A 1KY4A 2ALJA 2NO4A 2VK2A 4MQ6A 3ZGYA 1QKKA 4MPRA 5BN1A 4CKCA 4FE7A 1KDTA 3ITKA 4J7CA 3UJPA 3PLRA 5A4AA 5ALPA 3QE3A 2P4SA 5JJBA 4UVHA 4JP8A 5L51A 4JX9A 4GYJA 5HKKD 4W7IA 1QFYA 5CT4A 1OHHD 3ZTWA 3L7NA 4TYQA 4ZEXA 1GGMA 5FI1B 2QQ0A 3PTLA 2EFCB 4LN1A 1AURA 3HU2A 2PD3A 4DR7B 1WXFA 2YVQA 2AJTA 3MTIA 1USGA 4BBPA 1J5XA 1OZFA 2C61A 3H9JA 3R3HA 4NCBA 1BGXT 1OXMA 2VJLA 2XRZA 3FE2A 4PSDA 3S27A 1E79A 1KZ4A 2J1LA 4G0NA 1B3BA 3KUUA 3RROA 5B57C 1OU0A 4JHLA 4MJXA 4UXIA 3ROKA 3VJMA 2A0XA 4E09A 2O8BA 1I3LA 1LPPA 1KEEA 3KVOA 1SRQA 2RK3A 3RC1A 1JX6A 1LLFA 3OFSA 1GKYA 2AXEA 2H52A 4H08A 2JKZA 3NU1A 4JEIA 1XRSB 5FBLB 3RFVA 2QE6A 3ILXA 3HA5A 4H1TA 1J00A 1EKXA 1S2LA 2FEAA 1I1OA 4RZSA 5EHIA 2VDNB 3PIRA 5GAJA 5C37A 3KYIB 1RS0A 3IMKA 6Q21A 2WHRA 5FWXA 3EOBI 3DXZA 5L4SA 1G17A 1W94A 3C7AA 3O4GA 3ZU5A 3P9RA 3UB4A 4UM9D 5TJHA 2PTSA 3AVUA 1G5PA 3CUVA 2B98A 3UJDA 3ZWDA 1WV1A 3WRWA 2FFHA 2ZUWA 1X1BA 4TVKA 3VDQA 4AIRA 1B15A 3LKDA 2WIDA 1MO2A 1Y5LA 2IIPA 3EVEA 3NM6B 4GYYA 3QEMA 5AVSA 1YULA 1STOA 2GHRA 1KS2A 3FHOA 4JLVA 2CLMB 3CVUA 1JA0A 1JJBA 1VYVA 2C5EA 4OH1A 3HDHA 3L8ZA 4NDZA 3KB2A 3IKLA 1FZQA 1T3ZA 2G5TA 5EP4A 3WFIA 3ZIUA 4ETMA 1AKMA 3V9PA 3EB9A 3ICEA 4F2HA 3IQIX 1RWBA 3I2KA 5LP6B 1SBQA 1J25A 2SKCA 2E5WA 2RAUA 3PI6A 5TX7A 3AF1A 2GZRA 4FHDA 2NN3C 4OREX 1F20A 1WMDA 3O95A 4INOA 3N39C 3CNLA 3DL4A 4UATA 3R7DA 1O5OA 3GELA 5BYBA 3T3HA 2Q49A 1DAOA 2R1UA 3R3YA 1DZIA 1J1ZA 2OO3A 1SBYA 4B34A 3D2AA 1EUQA 2ZSEA 4PW0A 3VC1A 3WQBA 5KQPA 3JVVA 3KQNA 3MN1A 1RAEA 1RMTA 1WBJB 3KWMA 3Q3VA 3SKYA 4B80A 4P4NA 1E1QD 3UYKA 1NWHA 2N75A 1XZLA 1L5KA 1SELA 1NYTA 3JPYA 3JQGA 3K5PA 3THSA 3KXPA 5L4LA 3WZMA 4IVNA 1N0HA 1GAQA 2RC6A 4B82A 9MHTA 2Q9UA 2PZGA 4Y6RA 2AKEA 1FX0A 3E84A 4M21A 4ZDKA 4IJWA 4XW2A 5DBEX 1LTHR 1PAUA 1U81A 2IK8A 4LXQA 1DBIA 4D0LB 5T64A 2X22A 3NIGB 2P4UA 4R0VA 1OVMA 4TROA 2PFGA 1MP0A 2I2CA 1T34A 3U7HB 1D2AA 2OZLB 3CF4G 5CLHA 3PXDA 2EQAA 3LLVA 4NZ9A 3PICA 1UWVA 3TPFA 3ROFA 1L5NA 5IZ4A 4MR9B 1DOAA 2WHXA 2O59A 4ENTA 3WMFA 2JBHA 1OZGA 1YS7A 1DFIA 5D2CA 5EA2A 2F62A 4MPJA 1SUDA 1XDDA 2IXEA 1KDVA 4AG5A 3ERCA 3KYDA 2J3JA 3WKDA 1TYEB 2M6SA 2ZR8A 4DV3B 3K0SA 4MVXA 1J6UA 1PJSA 1QJCA 4LE0A 4YMUA 3UW1A 1ZR4A 2VL7A 3DVQX 3VAYA 1NUQA 2TS1A 2M1XA 2FEMA 4O5AA 3K09A 3L6DA 4IMPA 4K6HA 4OA5A 1YRLA 3QHPA 5FUXA 3UJCA 2QDKA 5LN1A 2GOYA 4NYJR 3ZD9A 4LS3A 4UNPA 2C8LA 3MAAC 3AF6A 1G59A 3C48A 1JHQA 2JW5A 3ASVA 1BEUB 1OGIA 1II0A 2DJIA 2EDAA 2OENG 3GO4A 1IPFA 2GMWA 3KELA 3D8NA 3BQ9A 3QNMA 4MVJM 4D81A 5JYEA 1Z0KA 3EG9A 1LDBA 4MYSA 2HBYA 1ZAYA 1LBTA 2Z4RA 2QRVA 2WVAA 2QTMA 5HILA 3ETJA 1HY1A 4GI1A 4JL6A 3X1MA 4YUYA 3BTOA 5AP9A 6NULA 1JDNA 5GOTA 1YU6A 3FHJA 1IY1A 3HY4A 4FMCB 4MUXA 3KZ1E 1TM5E 4QO8A 4YR9A 5BR7A 4QE3A 2RBGA 1Z36A 3NC4A 4MWGA 4C14A 2C7PA 2HEIA 3WE7A 2IFTA 2PAFA 5JJLA 1B73A 5FWXB 4TZTA 1R5JA 2DFVA 4GR9A 3CIOA 3K9HA 3DT9A 4X1OA 1ZM2A 2WKSA 3ZLUA 1TZJA 1ZO8A 2HMSA 2P30A 3P0IA 4TV8B 4BU1A 3EC2A 1BFDA 2OGTA 4LDAA 5FT9A 2IGTA 5BMVB 8LDHA 4D02A 3OMLA 1QV6A 1NG9A 2F90A 2W71A 4KLNA 4UCFA 4B2PA 3B1YA 1K4MA 3QHAA 2C94A 3DEJA 1W29A 3O47A 3WHKA 1VE6A 5ILQA 4ZCRA 2ABWA 2E1RA 2JJMA 2C4UA 3K94A 3WK6A 2UZAA 3FI0A 3UMRA 3Q9UA 4CMAA 4AO7A 4F60A 2GAIA 2ATCA 5JC8A 4RSRA 1KY3A 1SKAA 2JZCA 1CWUA 3C4JA 4DWOA 5K8TA 3Q15C 1FFAA 1VSVA 4YYEA 4AC9A 3AFMA 4QREA 4QYWA 4I08A 3KLNA 3KM0A 2JDIA 4IBOA 4ENUA 2RHHA 2NACA 2FLWA 3P27A 5EI5A 1H2EA 3AFIA 1OT3A 4NLLA 4NU5A 4LQCA 1POWA 1ZUIA 1YONA 3JQGB 3OQ6A 3AR5A 3N8KA 3NHYA 4Z5XA 1ZA2A 4BX8A 4NC9A 3NP7A 1USWA 2Z9CA 2O4UX 3IPXA 1YBFA 1SBTA 1QVZA 3WGHA 2VAMA 1I4DD 4C3UA 4I8DA 3KJGA 3RABA 2J3EA 1R8SA 4P83A 1C8BA 5ALSA 3BMOA 3JSXA 4E5PA 1GIAA 1PS8A 4IDPA 1ADBA 3RRJA 4WNAA 1K7EB 2YC2C 4H16A 2UYCA 3HKBA 2HIGA 3PU6A 3QIVA 5DV9A 2BMEA 5HWSA 1LQUA 3HNOA 3KTAA 2H3HA 4A5SA 3SKXA 2NO5A 2QZ4A 4ZVMA 4Q4JB 1YZHA 2BM1A 4DR4B 3CF2A 1RCUA 3OY2A 4LJSA 4ECEA 3S81A 4U2CA 4ALJA 1D4FA 2FEOA 3UHFA 3JQCA 1I6MA 1XT6A 4H7IA 2F55A 1FUQA 4K46A 2XUZA 2JI8A 4NNOA 2ZUBA 4QYSA 1R50A 4Q9JA 4QTYA 2H11A 2YFQA 1VOTA 5JPDA 2O57A 3QV1A 3K8YA 1VLJA 3BK2A 3C5HA 3RYFA 4MB2A 2PTQA 1DADA 4LNUB 3VV3A 3H6HA 4EB8A 3DONA 1Y9DA 3PT9A 5T67A 2AI3A 4AW9A 2VH5R 5HUHA 4YXWD 2HHLA 4LV5B 4W7HA 2Q3CA 3HCRA 1Q0UA 1U15A 1XIVA 2QS9A 3FOFC 4R5HA 2V6FA 4OA8A 1U0FA 1A9XA 1ZFNA 4J0GA 1Q5PA 4Z9AA 1C80A 4HAZA 3ZY3A 3C41J 1VRCA 4TSFD 5IAJA 3VR6A 2ZR0A 4BVEA 5LP6F 5KWSA 4NJOA 5ICSA 1D2MA 1LRLA 2VHVA 5KQMA 1NW4A 3VDMA 3U60B 1W0CA 4IMJB 4OHKA 1F6DA 4L72A 5JT1A 5B58T 3EEBA 1JU4A 1X15A 4OJKA 2AXQA 4LFCB 3H2GA 3UY4A 1LDYA 3EQ6A 4J9UE 4BWVA 1PYOA 1CV2A 4E51A 1PBTA 2VH2A 2JC3A 4UDNA 1Z39A 5BR1A 1K8YB 1RJWA 4PSCA 1LSJA 1ZD5A 4TL7A 2GKSA 3D6MA 1MABA 2QRUA 1ZPDA 4R7TA 2Q0SA 2HM7A 3PQFA 4YBRA 3OQPA 5C0OE 1GUFA 1RLTA 2W5UA 1XJWA 2OXEA 1V6AA 2R1TA 3QITA 2V6JA 5CB4F 1N5LA 3PC8A 3ANXA 4K2AA 4W6ZA 1JQLB 4ZVUA 3UMSA 5A6SB 4S3MA 4XJTA 4B46A 3P19A 3CLSD 4GD3Q 2C4NA 4PC6A 2H5EA 3QY9A 5IJ0A 2VXBA 4KE7A 2V3CC 3HA2A 4EL0A 1FTQA 2BVNA 3I72A 1EVIA 1DE0A 1SUFA 3BWVA 4NPCA 4RO0A 3F6CA 2R5FA 1NXQA 2ANBA 1A5TA 1J99A 4NOLA 1Y8ZA 1HZJA 4KE6A 3IIJA 1JSWA 1EFRD 1NUHA 1WX1A 3JQAD 3QM1A 4BQPA 5A2GA 1Y8QB 2SECE 2X15A 1W4LA 3QENA 4I5FA 1W96A 1KO8A 2ZKLA 3VR3D 1JZQA 2WHPA 3F8SA 4OUDB 5AESA 3ADBA 2WB2A 2CVFA 3RS4A 2C3YA 3MCUA 3N2GA 1KEVA 3ZXIA 4MOWA 4EPWA 2C4HA 1KY5A 1R6VA 4RC9A 5F3RA 5H3HA 4TLLB 5IP5A 1JEJA 3JW8A 3B7PA 3O9ZA 2QYOA 2HEGA 2IHKA 3GLHE 3VV2A 1ZVVA 2J7PA 3ZWAA 2PUFA 4DIFA 1B6SA 2GX6A 3CC8A 1P7ZA 5AYVA 3QQPA 3FNBA 3A1EA 3IQGX 3UOWA 1LI4A 3QI2A 5BNWA 4B3RB 4L02A 2DKOA 2JLBA 1QGUA 4DJAA 2Z1DA 4GL4A 2OFPA 3V33A 2A5LA 5CDTA 2I71A 1EIZA 1RJGA 5ALNA 3UT5B 4BZXA 4WECA 3IFSA 5JPIA 4ZQEA 2BEVA 4FR0A 1G3QA 2NUTB 5HG0A 1ESDA 2WUVA 3AW9A 3EXG1 3FYUC 1GNRA 4LI0A 2WF5A 5JDCC 1XU7A 5B4TA 3TH5A 2R44A 4KFUA 1C9DB 1EP2B 1GRRA 1MDBA 4HUQB 4OHYA 1OYVA 1N1DA 1ZNXA 2MDTA 3FHCB 1KQNA 4WADA 2BJVA 2H1IA 4RD2A 5DBGA 5LZ8A 4DSUA 3L79A 10MHA 1E0SA 2ZVJA 5ALLA 2ZU0C 1J09A 3L5OA 5D51S 5F51A 1DIGA 2QW0X 1LJUA 3SHQA 4ED9A 4W1RA 1DHTA 2N0SA 3DO5A 3J7AC 3B3GA 1KVUA 4Y2QA 3CMMA 3GRFA 4YQZA 2VDVE 1MT0A 3AHCA 2NSJA 5CJJA 1KQPA 1BKYA 1GFZA 1VKJA 1Z8DA 5CLIA 4Z99A 2A4KA 2HO5A 2WT9A 5CAEB 2WHYA 4AECA 2BE9A 4UPEA 1Z0ZA 3IT0A 3GFGA 2WE8A 3KAJA 5KTRA 1OA0A 5KYWA 4P53A 4FCTA 3NAGA 4RKFA 5CD9A 2JEOA 2C9MA 3KPJA 1QUFA 3AB7A 5JSQA 2H5IA 1X86B 3NUZA 4FONA 4Y9UA 4YPFA 2HT6A 3N7TA 3I62A 1G2PA 2ORYA 2Y1CA 3QXHA 3CRNA 2H9YA 2NVBA 1ISGA 2ZLBA 4RTJA 3Q9LA 3CZMA 3LYLA 2H2FA 2G17A 4LTNA 1K88A 4TZKA 4KLAA 2FPIA 4PGAA 4XI9A 1NBMD 4CKBB 1E6KA 2FUEA 3MHPA 3RIHA 2GZ1A 1GRNA 2J5BA 3EFEA 2AC4A 4MPDA 1T8SA 4DL9A 2B36A 1GAWA 3NT2A 1SU8A 5E3HA 3DHEA 5AJTA 2NQTA 3O2NA 1W46A 2DFKB 1F6BA 4ND8B 3M5CA 1Y3AA 1NVUQ 3QKWA 5UKDA 2CFSA 4CF6A 1NBAA 1T29A 3P8ZA 1CNFA 2AXNA 2ZBRA 4AUKA 3KYCB 5JAHA 3CX6A 3H16A 3OIWA 4LJ4A 3TZBA 3ELDA 1JHYA 1GO2A 3EQ8A 3NEJA 1YI0A 4C7MA 5FWNA 3TWOA 4RFSA 3AKZA 1D8TA 1HPLA 4TLCA 3UYLA 4ZARA 1SEVA 3ED5A 4YCJA 1YFJA 4FTWA 2PSSA 4R01A 2AFIA 4HDMA 2QR3A 1NHGA 2V3WA 1HORA 2DPXA 2YOHA 3EXIA 3G2HA 3NDJA 4P35A 2DQYA 4C01A 4IDHA 4JJ8A 5IRCD 2C5FA 5F5XA 1ZXBA 4KAJA 3WA7A 5LA6F 4BO6A 4XQGA 1PEKE 4X8LA 4ZO9A 2IDKA 3HTXA 2HA2A 3CUTA 5E95A 4DLTA 1YUBA 4AZ3A 2ZCJA 4BV8A 1LBQA 2ASVA 2WI8A 4X1KB 3A27A 1OKKD 5CYPA 4Y2XA 4B3GA 4KXVA 3WC4A 2FEXA 4IM7A 3WHIA 3OCJA 2JATA 5H8WA 3MRXA 3DAPA 2CLFB 2ZYHA 2GN2A 2DBQA 1N7HA 3AO0B 1GV0A 3KOUA 3USCS 3THXB 5AM0A 1WUKS 1MORA 5CM8B 1D2CA 2EHDA 3KB1A 1ADGA 3Q12A 4A2WA 5BV8A 2Q1YA 3P2KA 3RVOA 2P27A 3D4BA 1C3UA 4WFJA 1TYZA 4IYJA 3BH7A 3GT7A 1NBMA 1D7OA 3CHYA 3MQ4A 5SYMA 2YXEA 3E7XA 1N8KA 1YOVA 2PV7A 3FVQA 4HFMA 2GYUA 4EG5A 2OT3B 5FKJA 1TF2A 2BTOA 3H4VA 4BO9A 4JELA 2V5VA 2NUTA 4ADMA 2NNWB 1EGHA 4X3OA 1K6XA 3DXYA 4MW0A 1WHTA 4IDGA 3S2YA 9LDBA 4PXAA 4BBZA 1E4EB 2HU7A 4V24A 5CNJA 4C0AC 5DDIP 3GPDG 1T1JA 2O8CA 2I6TA 2N1MA 2H4WA 2W83A 3KZVA 2K6GA 3FMIA 3IKMB 4HDNA 9ABPA 1TQHA 5IZCC 3ZCVA 1V8OA 4JX8A 2VG8A 4B4DA 4EX7A 3F73A 1DC4A 3OZSA 2ZM5A 1OA1A 1M8JA 3PNSA 2HVGA 3FOWA 3FB4A 4G63A 3H13A 1Y7IA 2OM6A 4I5DA 3UGKA 4C88A 1Q0SA 3OJOA 3STTA 1JG2A 1WIWA 3WWEA 1HO3A 2RB5A 3PA6A 3I6MA 2IEIA 2FPXA 3IBTA 3IO5A 4MW1A 4F9TA 5LJLA 1OZAA 2I54A 1NXWA 5IBQA 3ASUA 2YKGA 4IS2A 1PFYA 2Z8ZA 5CH8A 2PIDA 3GZ4A 4M49A 3RBZA 5AW6A 3RRFA 4BFZA 3PXUA 4P31A 4DQLA 5DN9A 3SNHA 4DYVA 4EFMA 4BO5A 3SBDA 4JYCA 5A2QA 2FSPA 2PX4A 4CRWB 3MRTA 1DPFA 3N74A 2ANCA 3FN4A 2GASA 4YCAA 2HQBA 3PUIA 4CM8A 3W90A 3OZTA 3QXXA 1ZOLA 1J33A 1GNTA 2C9YA 4NFHA 5KNBH 3ACDA 5I47A 4G0MA 1QKIA 2J0UA 1JQ5A 1E5XA 4LDPA 1D2GA 3W4KA 2Q9AA 4O4LF 1Z63A 2ZRNA 5EP1A 2D0DA 5CA0A 3WY9A 4D0RA 1K7YA 4U3JB 1CQJB 1G20B 1OV6A 1COZA 2R66A 2UVPB 4PO8A 4WOPA 4Y9DA 1OBOA 2EZ9A 4DN6A 2EYUA 4MDEA 1PGNA 1AZWA 3IAUA 5BMOA 4RZHA 2W98A 3EIWA 3MPOA 2QTFA 3MC1A 3IXMA 3RNLA 1LKZA 1PSWA 3GEPA 3CI0K 1YZLA 2OWEA 3P26A 3PR3A 4H7FA 4NVRA 4J1TA 4OLAA 4BTVA 3OIDA 1PNQA 4I55F 1DINA 1MDFA 5DE3A 5K8JB 3CW2A 1ZVQA 3FUUA 3P9QA 1XZQA 3EXFA 4J0HA 3RGGA 4YRIA 1NOKA 3GMTA 1MPXA 3PCXA 4L5JA 1TTHA 2O3QA 2UUOA 3DCYA 3I30X 2RMKA 5KQRA 2ZJ3A 1V35A 4A27A 3UGJA 2BGNA 1FFBA 2WAOA 1U0GA 3CNBA 5FBRB 1FS6A 1EB8A 3CYFA 3D5TA 1NX6A 4PYRA 1VJRA 3LQQA 2IS1A 4L4XA 1WSDA 2JRCA 3IA2A 1K5HA 3EQ7A 3EZXA 1BMDA 1DIRA 4CIWA 2P91A 4PPYA 1NL3A 1X39A 2X23A 3T0IA 1L4EA 3TIFA 3CBQA 3S29A 3OE1A 3WGLA 1T1IA 1UT5A 4QUJA 2HR1A 2O7RA 2VPQA 1N25A 4WWHA 4GOJA 1N7GA 1LWNA 2XF8A 4CKWB 3BSFA 2G4LA 3G1WA 1V41E 2VRCA 1QR2A 3QPAA 4MRMA 4PRZA 4N7MA 2MCFA 1CY0A 3KKQA 3T4PA 3TFQA 5CG2A 4W1QA 4M1SA 4D0GA 4DABA 3IA7A 1JHRA 1PJZA 1ZY2A 3GGGA 4AY3A 3DVAB 5LIRA 2E7ZA 2WWFA 1YJ5A 4K9KA 1KIAA 4M8LA 2I4MA 3FGZA 3FYSA 4P3NA 5AOVA 5HS6A 2W7TA 2REQB 2Y1GA 3R6WA 3C6XA 2DU8A 1D1SA 4MP6A 2TYSB 1QFJA 3UKOA 4BRZA 1EJBA 4ZCTA 2YXBA 1S2OA 5H0IA 3IV7A 2UUAB 2I99A 2ZXUA 1SCKA 4HDNB 1LPAB 1SKBA 1JF8A 1NF9A 1PUIA 1J2YA 2A5JA 2ZT6A 4X62B 1SBNE 3SYTA 3UPUA 3KOOA 4A5OA 3T7IA 4Z4CA 1NY6A 3HDYA 3HCAA 3T5DA 2IYLD 2ZJ8A 4PBRA 2FGKA 2WUEA 2PNJA 5HQJA 3H6KA 1P4JA 3ZZNA 3NUGA 1VDMA 1WPXA 3A6FA 1UJ6A 1HE3A 5HIIA 4HGNA 3ABSB 4N3NA 4HR7A 5AJWA 4B76A 4TKMA 3HVUA 4D4KA 2P7HA 1P75A 2VNAA 1C1XB 1KK0A 3IR6A 3OIVA 4MK4A 1THZA 3CS3A 1T3TA 5MDHA 5J4YA 2I2XB 3OCZA 3IAM6 4I66A 4HRYA 3VYTB 1FURA 1V9SA 1E79D 1L8AA 3ID6C 5GGXA 4EVIA 3AXSA 3FPBA 4MLCA 4EGAA 2Q8PA 3I04A 1YFEA 3IS3A 2O3RA 3AYZB 3PD0A 5M3BA 1MAUA 1UCFA 1ZIXA 1UPFA 1AUVA 4W4TA 5DYNA 4YUVA 3D4NA 3RU3A 2FYTA 3ZQJA 4LFAB 4IQ0A 4RIFA 2ZAYA 3K5IA 4R6WA 5ALRA 5E6UA 3T4EA 4IJQA 5J2UA 3FCEA 1TJNA 5ELMA 5CA0B 3QXSA 1P31A 2F64A 4FOPA 3O8OA 1TUBB 2NXEA 3V2HA 4IKEA 4RS4A 2K7ZA 2BKAA 4UE2A 3ZVRA 3OBIA 3ACCA 1KR5A 2BEWA 3HWWA 2EJUA 4Q19A 5JSYA 5J2TB 3TKYA 1CUEA 4FFBB 2CJWB 4BQSA 3FMPB 3ZOZA 4JBHA 3H11A 3BAFA 4QHYA 1BE6A 1JFFA 3AFNA 1RPAA 4MS4B 4ZO8A 4YRKA 3HNPA 5P8WA 1T2AA 2YHIB 1CNEA 1SUIA 1J7KA 3G6KA 1QYRA 3ISJA 1IJFA 3RT9A 1E0JA 1E1RA 4C0HA 4DMRA 2EZ8A 2R751 3DLIA 4QFDA 1OROA 2VK8A 2X8JA 4FFNA 1PR3A 1I9CA 3MINA 1R0WA 3UT6A 1QCCA 3P0EA 3JAWB 3A1VA 3FDXA 1LNQA 4G8BA 5KSOA 2DUJA 3TW8B 4FZ3A 1W4AA 2YS7A 4R3NA 1ISFA 3EJ6A 3IBCA 4X20A 2CN1A 4U9UA 4E33A 1JPVA 4XPIA 3RVJA 1M2OB 1NIPA 4MWBA 4AKTA 4HX9A 3VU1A 4YJ2A 3RYHB 3OT1A 4X7BA 4BFYA 1JIXA 3RYTC 3VNVA 1XEWX 2PZLA 3EAGA 3IJPA 3R0JA 4J1SA 2IQIA 3U4CA 1S2DA 5LQMA 1GHTA 2OCYC 4FNGA 1FXUA 4DQ0A 3SHVA 2ZIGA 3IPAA 1CZRA 1BVUA 3KFVA 3D3JA 3MTGA 3S2EA 3ZYCA 1E9EA 4CV3A 3SHTA 1L1FA 5IBPA 1IH8A 1F2UB 2X5JO 4IL5A 1W5AA 2Z56A 2VZLA 3T35A 1HG0A 4KBGA 1SXJE 3KFXA 4LOAA 1DQPA 4M0MA 2ZVPX 4PXYA 1U3WA 3X2SA 4CM9D 4F96A 3PC7A 1WP9A 3EVZA 3HZOA 1BCRA 5DNVA 1PQPA 1PL8A 5GJBA 1DC8A 1OLUA 4G4SO 4XM1A 4CMCA 2GJ4A 4IG9A 3DV0B 1G6Q1 1UBKS 2FSSA 2QYTA 3PQCA 4HRVA 4P7FA 4DA0A 4YRNA 2X5XA 5SZIA 1BFKA 1KSFX 1UMBA 4HDSA 4LWQA 4WKOA 3RYCB 4EGFA 3ILHA 4YJGA 3CCCA 1ULTA 4Y18A 3UUGA 1I2MA 3NDBB 2RONA 2YIMA 1NXOA 1V26A 4LJKA 4I6JA 4M9CA 4YK7A 4B7XA 4B6EA 1F3OA 5KYYA 5L7WA 2YV1A 2Z5LA 5A9RA 1CHDA 3JRNA 3VR5D 3NBFA 1G16A 1QQ5A 2BH9A 1R4MB 1OY1A 1QHIA 2BZ0A 3BOSA 3BL6A 3OZVA 5A1JA 3A11A 3GJZA 4CF3A 2YV2A 3A1NA 4KAAA 5TDHA 1UFRA 4EUFA 3KC2A 1CT9A 4RE6A 4JB3A 2HSGA 3ZNOA 4XIGS 3MFYA 4L9AA 1MAVA 4Q05A 5K0NA 5LLDA 1J22A 3AWDA 3D43A 3ESDA 4ZDIA 1KU6A 1XCGB 1OXVA 1UZLA 4R9VA 4BYMA 3AEZA 4UTPA 1A9QA 5AH0A 1Z0DA 1A9PA 1J4AA 3E22B 1W6RA 4FGUA 5A0VA 1G20E 3NTOA 1EUDB 3FLEA 4IKOA 4ZYZA 2RAVA 4HMOA 2YMLA 4QULA 1CJTC 4UHHA 3LWZA 4TUYB 4J4TA 4TTPA 1ELOA 5AK3A 1DG3A 2RCYA 1S8AA 2ODPA 3NXSA 3ZHOA 4X00A 3ZKWA 3CCFA 1N3LA 1OH8A 1A71A 2ZSHA 1YL7A 3G2IA 2XSZD 3C5CA 4EF4A 3GFRA 1VE1A 2Z8YA 2C7RA 4QUIA 1JLRA 2DKNA 1G7RA 3LX8A 5EG5A 4Z2YA 3L01A 3H8SA 4FFBA 3NBZC 3QJGA 2CYAA 2A3NA 5CK5A 1Z6ZA 4FGJA 1AHNA 4TVBA 5T4HA 4REQA 1Q21A 4GXTA 4POOA 2QSZA 1ONBA 3PHGA 4KIUA 4QQNA 1WUJS 1CUYA 1JSLA 5JXJA 2UU9B 4M55A 3HLTA 4Q9LA 2ACKA 3OZIA 5JYCA 2HC9A 3ILYA 3STWA 1UANA 3W8RA 1DDOA 3ZJUA 4IV5A 1B0AA 2R3SA 1TL7C 2F9FA 3LGAA 1YFKA 5EUCA 4AUNA 4KYVA 2IYTA 4Y1EA 2VPIA 4N6NA 2PL3A 2XJ4A 3ONVA 3OQBA 3C3JA 1TKAA 4HB2A 3RNOA 2FX2A 3F71A 4G09A 5ECGC 3TW8A 3HA3A 4C0WA 4JCOA 3RC9A 1DDGA 4BNDA 1UEXC 3WMWA 1XTJA 2RSLA 1GFIA 4NE9A 1JQAA 4MV3A 5BWCA 1SAYA 1V1RB 1IATA 1U8AA 1NW7A 4Q4HA 1HKHA 5D3MB 1BA2A 2V7UA 2BHSA 4LSMA 1ONNA 4MV6A 2P3LA 2PKYX 5HFJA 4BGUA 4X92A 1KOJA 3BD7A 1JDBC 5KSYA 2P3OA 3D2CA 1WBDA 3B53X 4MEJA 5H59A 3PFNA 2PV0A 2GPYA 3HNRA 4QBGB 5DJ5A 4D3ZA 1QH8A 2NM0A 4DG8A 4MCHA 4Q37A 5EZYA 1KSHA 4A2CA 1RYZA 1ZMOA 4IUDS 2EL7A 3VKUA 2CDCA 2I4NA 3G8DA 3FWHA 2FMXA 1OWNA 1R7RA 3EZYA 3L1JA 4HWSA 4RA6A 4YDHB 1F0NA 2CLOB 4A0QA 1IPHA 4TS1A 1DO2A 3AEYA 4XVCA 2BE7A 4MQEA 1T9GR 2JKYA 1E8MA 2WPNA 2YJZA 4BO2A 5K99A 5K6RA 1P9RA 2PH3A 2G5CA 4K3VA 4L75A 5AUNB 2P2YA 4JI4B 2B92A 4YHHB 4II3A 4AQ7A 1H2XA 1NU6A 5HM8A 1PS9A 1J0AA 3VO1A 2NTNA 2HSZA 2ODBA 1K8ZB 2WZBA 3BERA 3H0CA 2Q3DA 4E2ZA 2DQZA 3UV6A 1B1CA 5MHTA 3RS3A 1N6HA 4IY1A 3PRJA 1CZKA 5DLDA 1CY7A 1G19A 4NXNB 3DWEX 4YV0A 3TL6A 5AKLA 5CFQA 2I1WA 4OFZA 4YFYA 2P2ZA 3CY6A 1MJ5A 2R4UA 2JGAA 3DZCA 4CUJA 2D5LA 1R12A 2JIZD 3CGGA 4EHJA 2HW8A 1XTBA 1H6DA 2PJDA 4G1CA 3D1JA 3EA5A 1TM4E 3FOAA 1R0SA 4RAQA 4QOEA 2B8EA 4HQRA 4BNYA 4ZWNA 2BR4A 2ADFA 2P9FA 1DFGA 2XTZA 4C06A 4IOMA 4CDMA 4UFOA 2RK6A 3L9WA 3EARA 3R7FA 2VJCA 2WF9A 1GCOA 1F12A 2E6KA 3CUUA 4FS3A 2O23A 4N0MA 2E37A 1A27A 2H57A 2ZTUA 2VZ9A 4NZNA 1E58A 4WOJA 3GJQA 2PLRA 3DV9A 4PAMA 1B0ZA 1RHJA 1LFDB 1P17A 5H81A 4J3NA 3ZV5A 5HJEA 3KWLA 2XDWA 4LCJA 1NI5A 3LYAA 3O73A 4TUYA 4Q7QA 4PC1A 1DTWB 4ROSA 1ZN7A 4AAYA 5GM2A 4XSHA 4BE4A 3N05A 3IIMA 1CR0A 1YZTA 4HNAB 4W5NA 3EZ7A 4JLKA 1GLVA 4X60A 4ZZ3A 3JTEA 1EZZA 2GJ9A 4OJMX 3LUJA 2ECPA 4UUPA 3CUYA 4WH0A 1SPBS 4YJDA 5ADUS 4AZVA 5HRAA 5EPOA 1T0IA 3VSEA 1WPQA 5EIHA 5G4LA 3EMKA 3ZDZB 1I2AA 3CIFA 1WUYA 4JODA 3RWMB 1P45A 2OE2A 2P9EA 3AMVA 2OD7A 3LSTA 4REQB 2B9VA 3BQNB 4FMPA 1DEAA 3RQIA 1DQSA 3UJAA 5CT5A 3ZDFA 4D8WA 3Q7RA 2ZFUA 4A6EA 2D2EA 5FEUA 3E04A 4MUJA 2M1ZA 4YAIA 3RADC 4YEDA 1U3TA 3ICWA 2I33A 1EGVB 3GMDA 2GKGA 3RAGA 3RS0A 1EFRA 4TYNA 3CZPA 4OQYA 1Z35A 2VUHB 5D84A 2XGSA 4LDNA 1IQPA 4MQLA 1FUPA 1CF2O 5G02A 5J3JA 5JU6A 2Q7XA 4FDUA 2TMGA 1BXRA 3JQ9C 4QTTB 2D8AA 3IJRA 2HD4A 4XUCA 2H65A 1PR2A 2P5TB 4TM7A 5AXDA 5BQPA 3AIIA 4B8ZA 5CXUA 1YV9A 1HMYA 1FB5A 4ARCA 4MWTA 3INYA 2DERA 3CPEA 3NORA 1YC5A 3I6YA 3LUHA 1E4VA 4YRDA 2XCRB 4RKRA 5JCXA 4ZICA 1YR6A 2H9AA 2D5BA 4MR7B 2BFEA 5LKRA 1JTEA 5IS2A 3R9XA 4L7VA 3SYLA 1E3SA 1M0SA 1ZCFA 2X42A 3MJSA 1BHJA 3DPIA 3BFJA 4F4FA 5JNLA 3BMNB 3DBLA 1GPBA 1XD8A 3EYAA 5ANRB 3ZXXA 1N2CB 4DE5A 1M72A 5BV2P 4RTPA 2CD7A 4RY2A 2D5CA 3O4FA 4ITRC 2ZWOA 3QW2A 3WK9A 5KJFA 4D9NA 4M8KA 2Z2IA 4UNIA 1JQJC 3RRYA 1Z2PX 1KPHA 1QORA 3B9PA 3K0KA 3Q1KA 1IBKB 4KUHA 1MMFB 3QZUA 1U3CA 4IVPA 4P82A 3F9CA 1HYEA 4WGGA 3QTLA 5FUBA 2XCSB 1FJXA 2W2LD 4HOYA 1ZRMA 2LRHA 3OCEA 4WKNA 2HJGA 5IT9A 3HUUA 3NWJA 3VSDA 3PDUA 5CDYA 3LD9A 4B48A 3A36A 1OSNA 1KJQA 2ZI4A 3M9XA 3QLEA 2X4DA 4UMEA 1JHOA 3GEDA 4Q3OA 1CPYA 3CLRD 1VSUA 1CFJA 1VYUA 2D06A 2VUUA 4U2EA 4WN9A 5EQJB 3VR2D 4ER7A 5B6IA 1O9HA 4FT2A 1FYEA 2LVBA 2WTBA 3EPKA 4LUCA 1Z6GA 3HN7A 4ZOLB 1JEYA 3OU7A 3IX7A 4JR2A 5ADWA 1NRXA 2FG5A 4L7QA 3ASYA 4WVLA 1BH6A 5ICGA 3DAOA 2RJNA 2EHJA 2A1TR 3PL1A 4J91A 4M7RA 2XEXA 3AESB 2FSVA 4Y1RB 1C1YA 1C7ZA 2UUBB 1CR1A 3FTFA 1L4MA 3TI9A 4IO1A 5J2UF 4RGQA 3RUDA 2HRQA 2WOOA 4ARIA 2HBZA 3H9EO 2L19A 3Q11A 1DCKA 1FK8A 1W9MA 1L5MA 1XP8A 1GL3A 1QONA 2QN2A 4IDQA 4YV7A 1UAYA 4NU8X 1IUOA 5SZKB 2E85A 1W36D 1FP6A 3V3TA 3ZC3A 4D43A 1L4BA 1DTWA 1N1EA 2BF4A 2AN4A 2LE0A 5FTNA 4TQAA 4G1BA 3GLTA 1KF0A 3KLMX 3QOFA 4GT1A 4HXGA 4JZKA 4MDYA 4WQMA 4C7XA 3ZX5A 1U0RA 3F96A 1CE8B 3H2HA 4DM7A 2H2GA 1VMIA 4MV8A 1BEZA 3WWCA 1EZ1A 1EVQA 3RVKA 2ZPTX 2WVJA 1FPMA 4MKZA 1QK4A 4G8DA 4UHEA 2HWXA 5ED0A 2GEFA 1KRWA 1SB9A 2ONKA 3IC5A 4EUEA 1A04A 4WUTA 2WD7B 5B7QA 1ETHA 3QMPA 4JD5A 5CIWA 4QARA 3CVYA 4PG6A 3IR5A 2QI9F 3DA8A 3TQTA 1DUVG 3HP4A 5LSAA 1B6GA 2X7HA 3NVMB 1EFPB 2H1WA 2QI9C 2YXNA 4BO0A 4GZ5A 1X7DA 4NDNE 1T15A 3A06A 3U9LA 4MVJF 3RUAA 4RWZA 4ZCQA 1YZGA 1OIVA 1EWTA 1XNJA 2WUGA 2DOKA 3R4CA 3GR6A 5CX4A 3RU2A 2BUCA 2ILTA 2OMKA 2V4MA 3FPKA 3KEQA 3LBNA 1R6BX 4ALMA 5G0VA 2AJCA 4N40A 2WC1A 4BUZA 4COOA 4QKQA 5CIYA 4DYHA 1QHYA 4PBTA 4URZR 2IIVA 5ISMA 1G0NA 1XKTA 3PFBA 4LVUA 4P5PA 5JS1A 5IYZB 1JFVA 1F8FA 2F7SA 4R2MA 3EXG2 4JUDX 1KVTA 4WZ6A 4MQ4A 4PYMA 5H70A 3RIYA 3SX4A 1D2HA 3DTNA 1CUZA 1EA5A 1DXHA 1LV7A 1N2XA 3B7WA 3QU2A 4NCKA 2GR9A 3H8VA 3WYEA 5BMVF 3ZVMA 3LLMA 3V5NA 3OJXA 2WEKA 4NYIR 5KTOA 1XTKA 1U0HC 2ATVA 2QAGB 3ZNPA 1QMGA 2QV7A 3G9TA 3RPEA 1QP7A 1ONSA 3ENNA 5B1SA 1BDBA 4TS3A 4IH1A 4F93B 4P2GA 1EXDA 1OF1A 4PICA 4CDGA 1P9NA 4XAQA 5FA8A 2B1JA 3LX5A 5JLJA 4IRUB 4ARZA 3T1HB 1E1CB 5BP7A 1M1YE 1JLLA 2D62A 3LKBA 4AI6A 1E7YA 3VNRA 2ZAOA 5BURA 3H9CA 2EAUA 4YPOA 2B5VA 7ABPA 1DP4A 1OYYA 5IARA 2PUCA 1PBNA 4EYEA 2D1YA 1ISMA 2YN0A 4E46A 2QG6A 2J46A 2FW9A 4GSLA 4M53A 3P0RA 2R8ZA 4W5RA 3L1KA 1R4AA 1YDEA 3QVVA 1P2FA 2QXTA 1SCJA 1K9VF 3K0FB 5FYDA 1DMSA 1XDZA 1XTTA 3SC6A 1RP7A 1YTLA 2SBTA 3M4XA 2WR8A 1IY2A 3NGLA 4NXMB 2MJLA 1J06A 4RZQA 3W8EA 2JLUA 5KHOC 4MUFA 5FOXA 1OI7A 4QGSA 1TEZA 3KNZA 5CFRA 2F1OA 4EP1A 1D6MA 4H7KA 4HWRA 1F06A 2CXHA 5FOUA 4ZIRA 1TDJA 4RZIA 4DCJA 1K98A 4JP2A 2ZYSA 1SEPA 4URHA 5CBPB 1R6UA 3CX7A 1DX6A 3AEUB 1BFUA 4FZVA 4IMRA 4PQFA 3H9QA 4HNGA 4XCQA 4FK8A 3TTYA 4B35A 3NDIA 3AERB 5G2OA 1QGYA 3QWFA 4G2NA 4QBTA 3QVSA 4ETNA 2YWRA 1E2FA 3ME5A 3AY6A 4TQUS 1EFKA 2ZANA 1NVVR 2DECA 2I03A 4BLQA 1LF5A 4AO6A 1XSEA 4BNGA 3WYNA 5K09A 1H4SA 5TT0A 1BHSA 1GCAA 2I65A 3QBTA 1YK0A 4RK6A 4EK9A 2RGYA 1NMXA 3HVRA 2J9FA 3CX3A 4NCJA 1GD1O 4OFXA 5JMTA 3C6KA 1F17A 3E9EA 4IJUA 1CE8A 1FJHA 1R8JA 1ZMBA 3NYIA 2W48A 2A33A 3FPSA 4P4UA 5LZ5A 1RHUA 4Z4FA 1SA0A 1CUGA 3LLCA 4TXNA 3SLGA 1XV5A 3LX6A 4WIAA 1AOXA 1TA4A 4R9NA 1M2GA 1P0PA 2NO1A 1XMOB 3UWDA 1L7AA 4H6VA 4ER6A 3CX4A 4KWIA 4CLOA 3SAJA 1E6MA 1K3FA 4YRBA 2K4MA 1T13A 4N5MA 4BPRA 1LV8A 1ZN8A 4TWZA 3IKTA 1KI6A 1EFPA 3FBTA 121PA 1J56A 3P45A 4MW5A 2NU8B 4FHZA 1M6VB 1RZRD 5DTIA 4HGRA 4TV9B 4LPKA 1ZD2P 2ORED 4Q4AB 4YBZA 1TU0A 2CCJA 3PV0A 3EPHA 3ZD6A 4ZOLF 4FEYA 3SM9A 3USES 1YRHA 1MGOA 3N5CA 5DK4A 3IJEB 5F98A 2EIXA 3WK7A 4QDUA 5HHTA 3B6IA 4C7BA 3ETDA 4O2LA 3V1LA 5IK2A 1YNOA 1AB6A 2BELA 2A9JA 4PCAA 5TVKA 4QYMA 3KQPA 2AHOA 1F0KA 3BT7A 4BFUA 3TGWA 1KYZA 3TRHA 2QAGC 4L8VA 2QORA 3MB8A 4LXTA 3PYXA 3WKEA 5C7OO 2HLPA 1CF9A 1PNOA 1LDEA 4GX5A 1BD3A 1E9CA 2HGZA 4J0IA 2GZAA 5J5VA 4B9AA 1DJOA 5ED4A 1N6OA 5HZHA 2R6FA 3DGEC 5F33A 5H1YA 2RE8A 1C9YA 4DA8A 2Z3ZA 2Q3JA 3PEUA 4EKYA 1FJGB 5KCZA 1O57A 5TMBA 4R1TA 1QB7A 2WMYA 3L7OA 4DFDA 3L7BA 3FCUB 1EGQA 2OG1A 2YYSA 2YWBA 2ZYWX 5GV7A 2QN9A 4REMA 2FG6C 3ZE1B 3LIIA 2EFJA 4GZ6A 4EJMA 5JZOA 3LNTA 5LYJA 1LS1A 2JI9A 1Q7GA 3ENWA 1W5BA 2PLFA 4IMIB 3NI2A 3NPMA 4O4HF 3VDXA 1I36A 3UANA 1C30B 3KAQA 5TE9A 1FMCA 1QIKA 2EGUA 1VA5A 2NU7B 4RXMA 2GK4A 3PEWA 3WL5A 1DJQA 2IX9A 3ZW9A 4PSUA 1RI2A 2HA0A 3GGOA 2W42A 2BISA 1GUAA 3MQ2A 4OSOA 1I94B 1E3TA 2NSYA 3EGWA 4RY9A 1XZMA 4I5IA 4BP3A 1V4VA 2XWQA 4N0DA 4DSOA 4Q1VA 2J5XA 1QZUA 1YTUA 4EEIA 4LOHA 4JUIA 1FRZA 1YMQA 2A9VA 2I9PA 1XKLA 4ZJYA 2YBEA 3GGCA 4MS1A 2IS4A 5CBPA 5ENZA 4NZMA 5B3JC 1Z4PX 4OM8A 1D0VA 4YDRA 2PT7A 4G25A 5B3JA 3GOQA 3O8CA 2L82A 1N2IA 3GCDA 3K16A 2ZYIA 4A8TA 1PTJA 5KYKA 3I37X 1OILA 3QI7A 4QOHA 3WV5A 5HUJA 1R0CA 3LCVB 3GRVA 1Z07A 3G82C 3VYSB 4HLCA 4MXDA 3GRAA 4NBTA 2C2XA 1A8SA 4L57A 1D5CA 1SZDA 4URFA 4Y2JA 4QTUB 3V55A 4AJPA 3O26A 1RWMA 2I34A 4A6XA 3THOA 4PZUA 4DJJA 1CJCA 2PXAA 2V03A 2PA3A 3KVVA 4FSDA 5DT9A 3RIMA 1QF9A 4D45A 4F5WA 1N2JA 4L76A 3CEMA 2PUJA 3IVMA 3H5IA 2F3SA 2WYIA 4AJJA 5TGTA 4US1R 5DYWA 2Y1KA 1DDIA 3MNFA 4LF4B 4C7OB 1FUIA 4L6AA 2X4GA 3L7MA 5IBRA 4DCCA 3JQ8A 3IPCA 2H1FA 4MRVA 4E1BA 3F4KA 4KC0A 1ZKMA 1WWKA 1APBA 1XQWA 4BMNA 1Z4MA 1SD2A 3FF4A 4AKSA 3H5LA 5E1BA 4WVFA 1QTRA 4CR7A 4NNJA 1O97D 2GF9A 3ZU2A 1ENYA 5JMWA 4LWPA 3KG2A 4RD4A 3A26A 1HRDA 1SK8A 2F8TA 3ND5A 1T4CB 4XQ9A 3TTVA 4AMGA 3T9DA 4XGIA 1BJTA 1XWIA 2PMFA 5AI6A 2AEEA 4MV4A 4KNVA 5DCYA 5HF8A 3VGPA 1KNQA 4A0RA 3L4BA 4Q4CA 2YWXA 3GCZA 1SPXA 4ZANA 4NRDA 1FXWF 1SN7A 2XRYA 3PGVA 2Y1FA 1XF1A 3WZ2A 1J5PA 1IEVA 2OYSA 4DPMA 2CNWD 4JP1A 4QAQA 1GTG1 4DLKA 1GSIA 4F72A 2JD1A 2Y68A 3CR3C 3JQ9A 5TLSA 3Q72A 4RD6A 1TEHA 2WFAA 2O2HA 1PLKA 1LI7A 2I8AA 2QN6A 1TUGA 4JFAA 2OV6A 4O8CA 3RRNA 1TVEA 2C9BA 2WU4A 4DCPA 3MWKA 2W0MA 2QTGA 4C04A 5JFGA 5JY6A 4P7KA 3RHSA 3OH8A 2Q8NA 1VE7A 3V00A 2XMGA 2J5QA 2G0AA 1J8FA 1QQTA 4HUJA 4C0SA 3S44A 2IQ5A 4R1NA 1Y6FA 1NNSA 2ZZMA 2HRRA 2Q4RA 1P3Y1 1KE1A 2COKA 3HBNA 4BCDA 1MO6A 2I7VA 2RIPA 3UC5A 3UA3A 1T5HX 4XVHA 2A9RA 4OM7A 2H7XA 4KOEC 1EM6A 4ME6A 3GNTA 3A1WA 4W5QA 4WXEA 1T43A 3WQQA 4CTOA 3ZEAA 3TQRA 3TOSA 2J33A 1ZWKA 2FHSA 3A0RB 1JYSA 1HTTA 3EISA 4FZ5A 4MGEA 3PCRB 1X7XA 4C1BA 1JG7A 4JR0A 5KQLA 1TMOA 1C30A 4PZ0A 3PA8A 1SKYE 3GIWA 1GUDA 3E6AA 4TM8A 3VMFA 4DLPA 1AUWA 1LC0A 2BC9A 2BH2A 5JEEA 4QGFA 1TCVA 3F3YA 3RYIA 1PW7A 1M2KA 1RAGA 2FY8A 2GXSA 3M6XA 5CFPA 1ZJWA 1YMUA 3PF8A 3W04A 1GT91 4E08A 4UOZA 5LCXA 1JJ7A 3I39X 4DUGD 1F8XA 1OAOC 3CR8A 3P7MA 5IFKA 2BP7B 3RV4A 2OP0A 1TJPB 2C3OA 2ZYAA 3U44A 2QJWA 2EF0A 2H6EA 2G25A 1VECA 3WGUA 2ZB3A 2Q2VA 2YQ4A 5TV2A 1II8A 2P67A 3FUVA 3R76A 1PL6A 3OFVA 4GGOA 4M1YA 4I36A 3U3XA 4L95C 1X0VA 2WP8J 5JSZA 3ZEIA 3GT0A 1ADYA 3RT1A 3VI3B 1IQ0A 4EMSA 2WPDD 1ZK3A 2Q4BA 1YU9A 2VNJA 4MAMA 4DLXA 1CLEA 1C7FA 1E2PA 1L7EA 1Y4ZA 4ROTA 4DDKA 3DE2X 1FUEA 4NJMA 4ALNA 2RH5A 4C0LA 1FNCA 5H9WA 3KTOA 4RQTA 2D7CA 2CSXA 4X7RA 5LWQA 3MJTA 3QXCA 3QVXA 5AJXA 1V5IA 2BEJA 2JVIA 1MENA 1ZJJA 2W43A 2XDQB 5K0EA 5TGZA 4TYPA 2A88A 2VRCD 1NRJB 2EKBA 2MYUA 4YJ3B 1W88A 2XOXA 2XQGA 4X3CA 1VDKA 1SWWA 2AG6A 3U7QB 3V48A 1FP1D 2YY6A 1NVBA 2RHBA 2TRSB 4Y9TA 1U2PA 3VZPA 1S1MA 1JJAA 3I3SR 2PBFA 3Q7TA 1TF7A 2OCGA 1QR6A 3N2ZB 2ZAMA 3P2MA 4IUBS 4QU5A 3K30A 5B6PA 1ZVKA 1U7XA 2G77B 2I4OA 2POQX 1WF6A 5FPSA 2J5RA 2G63A 3GEIA 4MCAA 5ERXA 1PVVA 1NVTA 4OK3A 5A9SA 4EPVA 3T5AA 4RY8A 4RTKA 3JYNA 5BUZA 1RC8A 3UB2A 1DUSA 2QMOA 1XG5A 3WADA 4A6PA 3R3SA 3A4VA 1O6ZA 1HLGA 4FOLA 3M4YA 3RUCA 3TRDA 3WOVA 3Q8LA 1IEQA 1WS6A 1QLHA 5JW6A 2YWFA 1L1QA 3WAGA 1YVDA 1MJGA 2ODTX 3GCWA 1Y8RA 4A1OA 3IVGA 2JVJA 2BJHA 2JJYA 3A6ZA 4FOSA 2FPMA 5DOZA 4U2KA 4CT5A 1I3MA 2R2AA 3HBJA 2OOSA 5IZCA 3RUFA 3VHXA 4KB5A 2F1IA 4MGHA 5E7QA 2J9YB 2MOKA 3P9KA 4R71A 5BVGB 3TL2A 4Q1EA 4AG3A 1KYIA 1HUQA 2FJUA 4RK5A 4XZ3A 2UZ4A 3ELWA 1YA6A 2YL2A 4B7UA 3FCOA 4R7GA 4RFLA 4F12A 1ZH4A 3OICA 5EVCA 4I3HA 4HB3A 3JQBA 2CVPA 2PMKA 4KVZA 1RPJA 3KL4A 3NHKA 5I5GA 1YIOA 5TEVA 5HMLA 1I01A 1D6SA 5KEIA 1WDLA 4OJYA 5YASA 1UUFA 2GT1A 3IQFA 2CJPA 4TKUA 4Q9KA 5IT4A 2DM6A 1A7AA 3F0TA 3KE9A 4D4IA 3NIDB 2RDMA 1DU4A 2XXAB 5DOVA 5KKCA 2DKFA 3VNSA 2YJ3A 3F6RA 4PGHA 2RFLA 1M2VB 3H2IA 1SXPA 2XZOA 1U6KA 4OXRA 2G9QA 2Y0CA 4QPJC 2G1UA 3VPXA 3QWAA 4YCBA 1RC0A 1TKRA 1NV9A 5DSTA 3A4TA 3KP1A 4PAQA 1HETA 4PS1A 3LTNC 3K9FC 1NXXA 8ABPA 4BNFA 1QOZA 2BKUA 4B74A 3D8TA 2QV0A 1DLIA 2I0FA 4DDWA 4RGBA 4TMKA 1Z15A 1XVIA 5AK6A 3UW3A 2AJDA 2WINI 2NAFA 4J4HA 5I7VA 1XFAA 1VHDA 3C87A 3SE7A 3SEAA 8ADHA 4LQDA 4KKVA 4JR1A 2D5IA 4QQKA 1VZ2A 2MU1A 5CB8A 3KU4A 1ND5A 4HN2A 1XRNA 1QF6A 4YRSA 3IESA 1E1RD 4FP9A 3E7FA 3V8BA 1XHFA 3DJYA 5M7EA 1H3EA 4RELA 3LHDA 5EIBD 3RJMA 3STUA 2BGKA 3ZCPA 5C1DA 4V3BA 4NI5A 1XHLA 2R9VA 3BAZA 3UC9A 1VC2A 5HRUA 3FYHA 3S2FA 5K3FA 1EQ2A 4J0QA 4NMWA 2QTVB 5AT1A 2Q5EA 1SQSA 4NABA 1U4SA 2G9VA 5KYUB 3U1TA 2PZJA 3P5SA 4PR3A 3D8BA 4CLDA 2J0SA 4OJQA 3OZDA 1FS5A 4PQYA 1E3WA 5IUKC 1T2VA 4MVJP 4BV2A 2BKXA 3O8NA 5BN4A 1PQYA 1W88B 1OXUA 2EQ5A 2FR0A 3KTAB 4TMXA 3BSSA 3OPNA 1GA1A 1WY7A 4WSOA 3LRTA 3TTUA 4R1SA 3H0KA 2AD5A 3GFFA 2O2YA 3L40A 3T7TA 2JJ2A 2AWNA 2J9RA 1ZH0A 2GD0A 4C4XA 3O8RA 2DTEA 2BUAA 1W1IA 1NURA 1YH3A 4ZAVA 1N6KA 3AI7A 3DBIA 1GT6A 5EMHA 4DIUA 4HDKA 4YDQA 2B4TO 4J3FA 3GLFB 4QSHA 2IHNA 4DA7A 1KEZA 3LC2O 4NAHA 3NTRA 3OMWA 4CW7A 4A36A 4PZEA 4YAOA 3H84A 2PWBA 1BIFA 3CKMA 4F4IA 4LGYA 3UFBA 3L7DA 3PKZA 4G2TA 4R7ZA 2H2HA 4H35A 3U3RA 2F43A 3LPLA 3P1JA 4MQMA 3QKRA 1H1TA 2FFQA 2H29A 2D2IA 5JI2E 3U40A 2AYYA 1GKIA 4X54A 2N46A 4A0FA 4AJLA 4YRZA 1CYEA 4FBLA 2C8JA 4EITA 1Z0JA 3E3AA 3BH6A 1D4ZA 1G8AA 3OZUA 1QB8A 2IYQA 3BCHA 1WKCA 4MCIA 1FJ2A 2XB9A 4RIEA 1CXZA 3OZAA 3E35A 5ADHA 5K2OA 1W4RA 2BUBA 3TL3A 3EIEA 2J3KA 1SHZA 3VVBA 2PE5A 4L8WB 2Q6TA 1A9YA 4FIDA 5CR9A 2RHGB 4HGQA 2VHCA 1ZX1A 2W2NA 4ZZ0A 2H16A 1CCWA 4ID3A 1L2TA 4FCWA 5GGYA 4EB6B 3MTEA 2BHTA 4FMDF 2Y2UA 2VTBA 1PQWA 2Y92A 2CLSA 2PGXA 4FDAA 5CP8A 4AFNA 1DBRA 5JAQA 4ZOQI 2BD0A 1BE0A 5DKFA 2Z83A 3EWNA 4QUKA 3TGLA 3D2BA 1ZN9A 2VWPA 2A5YB 2ZITA 2ZSAA 4DDMA 1IUPA 1ZQ9A 3DP9A 4FFPA 1C7IA 3IOBA 5A4FS 5A3QA 5BWMA 4B3MB 4M2LA 4F6RB 2P4HX 5JBQA 4QTZA 3JYPA 4MX8A 4UAGA 4O3MA 2O07A 4IRMA 2CF5A 3R3VA 2XIJA 2QBYA 1Y6ZA 4LSWA 4DNOA 5KOHA 2PZMA 3AR3A 1CUJA 1PEYA 4TMZA 2H07A 4G36A 4FU0A 3T7AA 4H7DA 4RV4A 1W4ZA 2TMDA 3P20A 5KNBA 1Y8QA 2WK1A 3ABRB 2DY0A 3ILVA 1YCGA 4NZZA 3WNQA 5F1OA 5F3DA 4E6PA 2XZLA 1XZ8A 1Y6QA 1L7DA 1PZEA 4KFSA 4LZPA 3T3IA 2D0PB 1AKEA 1KH2A 3IODA 1FUKA 2G04A 2AW3A 5GADl 1GQ2A 2IPMA 4URYR 1DEHA 1HQDA 3LY7A 5IXYA 2CL7X 4Q02A 3LFUA 4L1KA 4XTCS 4IPTA 5DWQA 4CLRB 4QDTA 4WOKA 1VJ5A 1NDQA 2FDRA 2DG2A 2PQ6A 3V4LA 2H5JA 5AKJA 2QTNA 2ZUSA 1QGUB 5D01A 1PNRA 4TXHA 4TZ6A 3D6TB 1GNVA 2B4KA 3L46A 4WXYB 4DCVA 3DBRA 4DUPA 3TD9A 4LF6B 1Y6JA 1A9SA 4C29A 3KXLA 1RR6A 4GMHA 2YCBA 4AJKA 4CMIA 1MOPA 3ABZA 4EOGA 1BJKA 2C95A 2TMKA 5HF6A 5IVDA 1PK7A 3EF3A 2YVUA 1D3AA 4WLFA 2PXXA 3A1UA 1EK1A 3TSOA 5KPDA 1JQKA 2P4QA 1G291 3ROEA 5HQ3B 1UL1X 1XTPA 3BXEA 3FGOA 4GMFA 3AR9A 2X0NA 2ZROA 3Q88A 3QKIA 4PU0A 1Y63A 1YWGO 1H8EA 3W9UA 5AVQA 2QUAA 3G9ZA 2GWRA 4PC7A 3W5UA 4MVJG 4HDKB 4F97A 4EECA 3NTUA 4O08A 2ZWPA 4DJEC 1H6AA 1G8JA 1WVMA 1S9DA 1XZCA 2PX0A 1YR1A 3LNCA 4X45A 2CV0A 3IR7A 2FPSA 4X91A 2AMYA 2YHAA 4DJFC 1SUWA 3LYUA 3W8FA 4MKHA 2D7JA 3GLGA 4LRTB 1V71A 4QXRA 4E3WA 5I9IA 4I8XA 1T26A 4UJ3A 4LRWA 3ANLA 2PSDA 2XODA 1TJ7A 1L5RA 3DEHA 1IM2A 2VATA 3T9FA 3OT4A 2ZRGA 5C8ZA 2GVDC 3CWZA 3K0EA 3BTVA 3OOSA 4ZO4A 3E5RA 1JKFA 2FVXA 1ABFA 1UODA 4F7WA 2W6ZA 3GP3A 3QEOA 5BNIA 4P34A 3OZXA 2ZDHA 5BUQA 4EVSA 1XDWA 2PH1A 2ZJ0A 4LJLA 4B4WA 4V1CA 3NOQA 4EI9A 2P0EA 3F97A 5E0KB 3RJ9A 2QRZA 2G71A 1G60A 2XUGA 3KR2A 3VM6A 2VZ8A 2P6UA 2QLMA 4HDAA 3VYRB 5CLFA 2GRAA 1INLA 2V0NA 4XR4A 2P4EA 1OX5A 1BNCA 4NULA 3GH1A 4PWYA 3C6YA 4BGIA 2WTUA 3I9MA 2HZBA 1DCTA 3Q7QA 1E3JA 1JWAB 3HU5A 3E23A 1HXHA 3C85A 1BDJA 3EGEA 3LQKA 3MJRA 4Q3LA 4WZAB 1WW3A 1RXWA 2ZWVA 2WIBA 4O25A 1GQYA 2C00A 1PQ4A 1QG4A 1DKRA 2QVXX 3BK7A 4K26A 5HEKA 3R7WB 2WRZA 3P4UA 3WP1B 2Q6KA 5DTEA 3A2KA 4BPBA 5FFFA 1JG3A 3HL4A 1U4OA 2J3MA 1GZ7A 1QBGA 2NXNA 1WHSA 1CUXA 1O97C 4NPAA 4TKVB 4WCVA 4A0GA 1K7FB 5KNLA 1QH1B 2ACWA 3ZV6A 3EZGA 3NANA 4QOSA 5K3AA 4EHBA 5K8UA 3JQFC 5K2MA 5LA6B 1NAIA 3KOWA 1G3UA 4CBVA 5KWJA 3QA9A 4DS3A 3OX2A 3HKEB 2IL1A 4HWTA 1HL7A 5CVCA 4HNHA 3O0DA 1EP3B 3RRPA 1SB8A 2C88A 2ZRCA 3BE8A 4F0JA 1M5UA 1ZCZA 5G4KB 3VPDA 1PK8A 5CVEA 1RHQA 3GDGA 1IN4A 3CF0A 4G81A 4GLLA 4D92A 4B4OA 2WF7A 3LOQA 3R0XA 3IURA 4B1FA 1FRNA 2TSYB 1P80A 1D7AA 3PR1A 4TV8A 5EC8A 3BA6A 4CMEC 4Q39A 4G1FA 4QQ8A 4LJYA 4GBMA 3RG8A 1JSCA 2E21A 3RTEA 3D6UA 3COYA 1M34E 1ODFA 3GUCA 5GM1A 3ZIAD 5I48A 4B44A 2Y0EA 3W5CA 4AX8A 1BSVA 5IX8A 4FDMA 1JE1A 3UGTA 3PGJA 5SY6A 3ES9A 3M8KA 5DBHX 3V6MA 4DG5A 3CLTC 4NV0A 2VF2A 1YOVB 1LPBB 3A31A 1SC9A 1DBWA 1NN0A 3UHJA 1BX3A 2O6LA 4J7AA 1JR2A 4MEAA 3OCFA 5I9LA 2AFHA 3CF4A 3BBPA 3W6PA 2QM7A 1XL0A 2OCAA 3ZWWA 2MIIA 2WMOB 1CY8A 3NHFA 1JW9B 1T5BA 1T8RA 2OAQ1 1V2GA 4IIDA 3I9V6 1TMYA 2BR5A 3B6KA 5J4LA 4L07A 1F7VA 3CZ9A 2YIDA 4XWTA 4RH0A 2WQ7A 1SZCA 3B7GA 1QIJA 3EIOA 4P80A 1W48A 4TKZA 4FCCA 2WSIA 5BO5A 3R6GA 4Q4DA 1CDEA 1NXSA 2FP4B 1OUMA 2GM9A 1EEXB 3MB5A 3P4YA 5C3UA 1M1YA 3CR7A 4KQ6A 2GCEA 4I2NA 1QNFA 4M1MA 2FN3A 4RETA 3RVRA 2HLNA 4B0OA 2OXCA 2RD2A 2X6QA 4NONA 3R44A 4F71A 4B85A 1TCCA 2ZRHA 3W2TA 1TADA 4BX9A 1FFXB 4MGZR 2BKLA 4POAA 3SLRA 1EHIA 3WHLA 5JJ5A 5A9SB 1G9TA 2VCYA 4BZPA 4XKJA 4BVFA 2Y67A 1U1DA 3B8EA 4LZWA 2Z95A 2LD4A 1P8JA 3HKBB 5K51A 4QEDA 1UBMS 1JR6A 1VPLA 3VR0A 3NHZA 2C2KA 3N8GA 4F3CA 4YYZA 4ZCMA 2FZGA 1Y3HA 2FRVA 2WE7A 3AGQA 1DC5A 1SHJA 1F14A 4H3KB 1OWMA 3ZJ4A 3EAQA 4FR5A 1KP9A 2IYNA 2IUYA 2XKAA 4NFLA 3EJWA 2ERCA 4GVPA 4L4UA 4AJEA 3Q10A 3CNEA 5HKLA 5I01A 1FTYA 3PPXA 3HCNA 3IT2A 1U7ZA 2IZ7A 2PGAA 2RGBA 4NFYA 1PGOA 4FYYA 2DHQA 4DV4B 4Z9FA 1XN4A 1NF8A 4O4JF 4XGKA 3LUDA 1C1DB 1JAHA 1L4YA 1XQVA 5B2ZA 3VRHA 4DRYA 1W1UA 5J40A 1WXQA 4BAGA 2JBWA 1UBJS 3K4QA 2H9IA 4U3JA 3KPVA 3AV0B 4EENA 4LXYA 2QDXA 3LF1A 5DHTA 3R7WA 3UAYA 1RBYA 2BFAA 1T9ZA 2OM2A 2PEYA 2GQ0A 3ISTA 3O83A 3ADKA 2VP0A 4DCMA 1U3DA 1IDN1 4CM4A 2IZ5A 3TNLA 2ZBPA 4TKVA 1C7JA 2JFZA 3L8EA 3HB0A 2PZAA 2ZIAA 3B6ZA 1RWXA 3CRW1 2VNKA 1Y7LA 3M1LA 4GOND 4QAJA 5FL3A 5LA6A 1HBJA 2YDXA 4AXBA 4EPXA 1BS1A 1ZJ4A 3WGYA 4NEHB 4Z4GA 3DSRA 2G70A 3IXQA 1SVUA 4U7WA 1AGXA 1MNQA 1P2SA 4ACBA 1JBQA 2R6GA 2PO7A 3COWA 3TTTA 4LX8A 3SZMA 2FZCA 2JHFA 2CFRA 2WJYA 3HV2A 2D27A 3BMQA 4I19A 2IWHA 2C3UA 5C80A 2VPWA 1JDVA 2GPBA 2G5GX 4LYJA 1Z6QA 3O9VA 5HNKA 2EX1A 4KQMA 1HWYA 4XUDA 1GM5A 2XYRA 4NOKA 3IE2A 4CQJA 3L7LA 5A6SA 3GLVA 3HDTA 1TI7A 3EFBA 3AVQA