4NFLA

Crystal structure of human mitochondrial 5'(3')-deoxyribonucleotidase in complex with the inhibitor npb-t
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
201
structure length
201
Chain Sequence
SNAASGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformationally constrained nucleoside phosphonic acids - potent inhibitors of human mitochondrial and cytosolic 5'(3')-nucleotidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 5'(3')-deoxyribonucleotidase, mitochondrial
total genus 69
structure length 201
sequence length 201
ec nomenclature ec 3.1.3.-:
pdb deposition date 2013-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4nflA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4nflA01
2Q4RA 1ZRMA 3NUQA 3QUBA 4PNHA 4FE3A 4UAVA 5AKKA 3WKDA 3ZTWA 3ZUPA 2ZBFA 2I6XA 1ZOLA 2JAUA 3WKBA 3HLTA 4XOUA 3K1ZA 5AVUA 1RDFA 4Y3UA 1L8LA 4KNVA 3MC1A 2R8YA 3BWVA 1RKVA 2HSZA 5AKLA 3ZX5A 3L5KA 2P9JA 3N28A 4RETA 1Z4IA 3WKEA 4BEVA 2QLTA 4XQ0A 2YJ6A 3N1UA 3OTQA 1YV9A 1U2SA 2GHQA 1QQ7A 2HOQA 3AR7A 3R9KA 3WK6A 3RFUA 2CFRA 1PW5A 4BBJA 4MWOA 5ALFA 2HHLA 4KX5A 1L6RA 4ZEWA 4L6AA 2IOHA 4UMDA 1NRWA 3KBBA 4QJBA 1LTQA 3L1VA 1RQLA 1XP5A 3EF1A 3L1UA 3BA6A 4HGQA 4NFLA 5AKEA 5AW9A 4AP9A 4CE6A 1LVHA 2I34A 4C4TA 3S6JA 1WR8A 3L8GA 2QYHA 3A3YA 3AR6A 3QU9A 2EAUA 4O8CA 2FUCA 4IG4A 1N9KA 1RMTA 2YN4A 1S2OA 3B8EA 3AR3A 5AVZA 2RBKA 1T5SA 2B30A 5AK6A 1Z5UA 1ZS9A 3U13A 1L7PA 2DQSA 2YFYA 4UM5A 2IOFK 4EZEA 2G08A 4H1WA 2CFSA 1Z4PX 2HX1A 1JUDA 5AW4A 4Y2YA 4Y2JA 1XPJA 3WGUA 1F5SA 4HGOA 5IT0A 4YIKA 3P96A 2WHEA 2FPUA 4L57A 2BDUA 3J7TA 3KD3A 3U7HB 1AQ6A 4UMVA 1SWVA 3ET5A 3EWIA 4KX3A 1YMQA 3QU2A 5ALJA 1KYTA 5ALQA 2PQ0A 3NAMA 2HEGA 3UM9A 2YY6A 3EPRA 4F72A 2C8LA 1L7NA 1RLOA 1T5TA 3UMCA 2C8KA 5ALHA 2O9JA 4UU0A 3OPXA 4YH1A 1U7OA 4UMEA 5AICA 3U7FB 4E88A 1MH9A 4MUMA 3PCTA 5FP0A 3UMGA 4FYPA 1QYIA 2ZBDA 4CF4A 3NALA 2G1AA 3ED5A 5ALWA 5ALZA 2AUTA 4YIHA 2ZBEA 2GFHA 1ZD2P 1T9ZA 4BKMA 4Y2QA 3ZWKA 3I1YA 5ALPA 1TA0A 1O03A 5AW8A 5IT4A 5AW7A 1Z4MA 1VFPA 5AI5A 2B8EA 5AVYA 4XE5A 3ZW7A 3QNMA 4UATA 3SD7A 4EEKA 1Z5GA 5AM3A 2FPSA 2AH5A 3QU7A 3NIWA 5ALVA 3OCWA 5AVRA 3ESRA 4OFZA 4YCMA 1EK2A 4NAVA 5AM4A 5AW5A 2I54A 1J97A 3KC2A 3U7EB 4UW9A 2JGAA 1Z4NA 1YNSA 1Y8AA 1Z4QA 3SHQA 3WKAA 3MPOA 2OM6A 5AM5A 5AVVA 2MSNA 2YMPA 3FPSA 4OCZA 2WFAA 4NWIA 1L8OA 4HAIA 5ALLA 2OBBA 5AW0A 4JDPA 3SKYA 5ALEA 3OCYA 2IYEA 2WM8A 4YCNA 1EK1A 2G80A 3CNHA 2CN1A 3CZ4A 4UAUA 2P27A 4UASA 4BYGA 3L7YA 5AW1A 4Y2VA 3E81A 1ZD4A 4DW8A 2YMMA 2FDRA 1FEZA 4KYTA 4UARA 3SLRA 4Y2PA 3N8GA 4NV0A 3MN1A 1N8NA 1WVIA 3NRJA 2FPRA 2G07A 5AKYA 4DCCA 5JJBA 1X42A 4DWOA 3OCVA 5AK4A 2FPXA 3DAOA 4OHFA 5AW3A 3OCXA 4AS3A 2IOFA 2W43A 2OYCA 2EARA 5AKIA 3R09A 5A3RA 2D2VA 1ZD5A 2HO4A 2B0CA 1YJ5A 4J03A 4XPZA 4BX0A 3ZVNA 4RESA 2YJ3A 3W5AA 2HF2A 1QQ5A 3ZU6A 1RQNA 1RMYA 3M1YA 4AS2A 5IS2A 4B6JA 5AK5A 1CQZA 4F71A 1CR6A 3I76A 2IA5A 4Y2TA 3QYPA 2PR7A 5ALMA 4I9GA 1Q92A 3L8EA 2ZBGA 3D6JA 4ZEVA 2B1QA 3AR9A 4G63A 4C4SA 5ALOA 3ONNA 3SF0A 4QQFA 5AKGA 5AKZA 5AW2A 2JAOA 5ALXA 4YGYA 3DNPA 1TE2A 4HGRA 2W4MA 3N5KA 5AI0A 1RKUA 2HDOA 3A1EA 3F9RA 5AKJA 1S8OA 5ALSA 3QU5A 5AIBA 2P11A 2ZXEA 2JAWA 4JB3A 2GO7A 5AVWA 2X4DA 3N07A 5ALUA 1SWWA 4J2TA 5AVXA 5AI4A 3ZWDA 2YBDA 2Q4TA 1RKQA 3WK5A 3QGMA 4EX7A 2RB5A 3HYCA 5ALRA 1Z4JA 3A1DA 5AESA 3L0YA 3L8HA 1RPZA 3WK9A 4YCLA 3ET4A 4HYTA 4Y2RA 3QUQA 3L0CA 4BNDB 2Q5EA 2ZG6A 2B8JA 1Q91A 2B82A 2FEAA 3RF6A 1ZJJA 5AVTA 2AGVA 2VKQA 2G0AA 1U7PA 2EATA 3E84A 2ZOSA 5AM0A 4EX6A 3WGVA 5AW6A 3QUCA 2R8XA 3U26A 1QQ6A 3U19A 2RAVA 3KOOA 2JARA 3FVVA 4CF3A 2FI1A 4HGPA 4UMFA 5A3SA 1ZRNA 3NASA 2YMLA 3AR8A 2NO4A 3PGLA 1WPGA 1RC8A 2B1RA 4UM7A 3QUTA 1RLMA 3AR4A 3U7GA 5AM2A 3W5DA 3L8FA 1Z4KA 5ALKA 3FZQA 4BNDA 2NO5A 5AK3A 4KN8A 3OCZA 2I7DA 3IRUA 4UU1A 4BX3A 1U2TA 1Z4OA 2I55A 5AI8A 3IJ5A 1RLTA 4CNQA 4BEWA 2GHTA 5ALTA 2R8ZA 3DDHA 3DV9A 3ZTYA 3GYGA 3A1CA 5ALYA 4ZEXA 3M9LA 2FPWA 3WK7A 2HF7A 3AR5A 3I6BA 4L6CA 1YDFA 5AI6A 3ZVLA 1TJ3A 1TJ5A 2WF9A 3E58A 3PGVA 2G09A 2WF8A 1YS9A 2PKEA 2WF6A 2I33A 4Y2SA 3WK4A 4NABA 3IB6A 2P69A 2BDEA 3W5BA 2YJ5A 4GIBA 3ESQA 5AKXA 5AVSA 4GXTA 3QLEA 5ALDA 2G06A 2HI0A 1QH9A 1J8DA 1SU4A 3MMZA 2RARA 3PDWA 3VAYA 2C88A 3L0BA 3NANA 3SKXA 1WZCA 2CFTA 4I9FA 4C4RA 1Z88A 4IFTA 1VJ5A 2W11A 3R4CA 1RMQA 3QU4A 2NYVA 1Z4LA 4G9BA 2HCFA 1ZD3A 3ZVMA 1K1EA 4EENA 3AR2A 1NF2A 3ZI4A 3QXGA 4FFDA 4OD0A 3KZXA 3OCUA 2C9MA 1TJ4A 3FPBA 5A3QA 3FM9A 1O08A 3WK8A 3EF0A 3FGOA 2OA0A 4CF5A 4BX2A 1L7MA 3B9BA 3TLMA 1VJRA 3W5CA 1RRCA 2YJ4A 5AVQA 3E8MA 4Y2UA 2GMWA 3B9RA 4DFDA 5ALGA 2FUEA 1IWOA 5AKHA 2BY4A 2MU1A 3ZX4A 1U02A 5T41A 2ODAA 3I28A 2R8EA 3WKCA 1NNLA 5ALNA 2O2XA 5E0OA 5AI9A 2WF7A 4Y2XA 1L7OA 2WF5A 2YMQA 4KNWA 3SMVA 2C4NA 2AMYA 3QX7A 5AHXA 3UMBA 4HGNA 3KDPA 1XVIA 5ALIA 4EELA 5AIAA 5AM1A
chains in the Genus database with same CATH superfamily
4WDRA 2DKNA 1FFDA 1PLLA 3FA2A 4H3SA 3PCXA 1Z12A 1RR6A 3MMSA 1Q83A 4GBED 5IXJA 3MNFA 1DBSA 4KI0A 4NYMR 3BTOA 3EG9B 2IQIA 3HSYA 4HEQA 4UKDA 1QFJA 4QBIA 3JQAD 4TTRA 3N0VA 5LKAA 2YJTD 4AN0A 1A7AA 2ZYAA 5EVJA 3TZEA 4IXWA 5DHFA 2NW6A 3FB1A 5THKA 2P2GA 3OZVA 4FXPA 3AXTA 2V6BA 2RG7A 2VHYA 3NIFB 2HA4A 1EAMA 5AUQA 1M76A 1HYQA 2XOKA 2D2FA 4UOQA 4YRGA 2JIPA 1S1MA 1TZMA 1E7SA 1UDAA 2O7SA 1VCOA 1Y3HA 5FL7A 2HSZA 4N76A 1VKZA 2BFFA 5IW8A 2VH2A 4U6NA 1K97A 3B52X 1LBQA 3N28A 3RC7A 5DLDA 4CKEA 5FWYA 1HNZB 4TQ9A 4B7UA 3DZIA 1UM9A 1NDHA 1SK8A 2H4XA 1AKQA 4IQ8A 4WHMA 3F0TA 3OPQA 4ISCA 4Q9LA 2QKYA 2PKXA 5C8ZA 2ST1A 4AKGA 2WA1A 2VRCA 2QQGA 3DLCA 4Z3OA 3WI7A 2E18A 2EL9A 3EIQA 2JJ1D 2VJMB 2XTAA 3FNGA 1DKMA 3LBHA 4LXTA 4UMDA 4YRTA 1I24A 1C8VB 4XUGB 3FBTA 5HIJA 1UEJA 4UREA 4C4YA 4NFLA 1C9DB 3I30X 3KKMA 4OKIA 3X43A 1EG7A 3DC2A 1W85A 4PAOA 5HRCA 5KOHA 1G6KA 1MAWA 4FSHA 1NX9A 2RGWA 4P53A 2VK1A 4HN2A 4QXAA 3QHAA 2QBYB 1SM4A 4E31A 5LQAA 1A9PA 3KU1A 3IXLA 2CLEB 3R3WA 1JEAA 1J9EA 3CGGA 3KE9A 3QU9A 3M0EA 3DLTA 1LY1A 1YT5A 3JATA 1XLWA 2FUCA 4IG4A 5KWVA 2ZREA 1J5PA 1VL5A 4K6HA 4Q5IA 3OJ0A 4AAYA 3BHGA 3BHIA 4FN4A 2WTBA 5K2MA 1OPXA 3B60A 4KBFA 5A5FA 2AG6A 3DHVA 1NVGA 1EFRA 1L5KA 1NAIA 2DUUA 4DFDA 5LNK6 5BMVB 2YR0A 1ND6A 4HEA6 1DELA 2C00A 1PNRA 4Y6GB 3I1IA 5DGCA 2PWAA 4L15A 1C1YA 1SUWA 2BMDA 3N7AA 4R9NA 4R7TA 5DTJA 5JPIA 3RJMA 1AGYA 1QMGA 3NRCA 1O94D 3Q72A 1RRVA 4K8RB 5TEVA 1IN7A 2JRLA 3S2IA 1M8PA 3T54A 2FQYA 2ZTHA 4R2XA 1IN6A 1E96A 1SVUA 3WAKA 1ABEA 1QRTA 1EUDB 1LWOA 2RH4A 3F2IA 1X77A 3N8HA 2CL7X 1NJSA 4MRRA 3KKQA 3A6KA 1EZ4A 2C07A 1DO8A 1YZHA 2WIKA 3NT5A 3RYIA 1HL3A 2B2CA 1QBGA 3E70C 3G1TA 4ZI5A 4AX4A 2J9GA 1KYTA 2PSFA 2PS0A 1UJ2A 1FUUA 3CEAA 1GCAA 5A4FS 4B1FA 1EWKA 1KKLA 2YY6A 3ELYA 1E6UA 2O7RA 3D0RA 3EPRA 4RV4A 5EAIA 5IDYA 1TEZA 5FNVB 4W99A 3RU2A 3W78A 1Z18A 3A36A 4W1SA 1B8NA 1KR2A 2H8GA 4LBZA 4PPNA 5D1NA 4CMAA 2ZT6A 4ALNA 3COJA 3OPXA 2FRVA 2CVHA 3U7FB 3WGMA 2P90A 3QLUA 1QLJA 2I6FA 4AKHA 4MDFA 1A9ZA 1NQXA 2NTEA 3AI7A 1CF9A 3ITNA 4MUGA 4S2EA 2IHZA 3S29A 4DNPA 5BSWA 1RWVA 2CSUA 1Q1ZA 2LGJA 2CHVA 3R7WA 4C78A 5GZ1A 3E9DA 4NMMA 4WNAA 3A4NA 4BVGA 4CQMA 4G0VA 4DEXA 3K2EA 2ZT7A 2E21A 2ATXA 5EZSA 1N5KA 3ESCA 3ZDYB 3GLGE 1ZVMA 5EJ7A 2P9FA 4XQCA 2XITA 3WAGA 2WI8A 1OXVA 3TXXA 1UC9A 1SB9A 1ABFA 2QVZX 1VSVA 3JQDA 4A8TA 3G02A 5D2CA 3E03A 4Z4FA 4OQQA 1ENZA 1DNPA 4LGCA 2F4NA 1AUXA 1TD1A 4W5HA 1S8FA 3T41A 3SX4A 4ZDIA 1S2NA 3G9QA 5IAAA 4MJXA 1N36B 4K88A 1G3QA 5DIFA 5CG1A 4EJSC 1Z4MA 4MUIA 2QM7A 2XEDA 1MOSA 3O73A 2YOGA 4P6VF 3QVKA 3R5HA 5AH0A 5H3LA 4KIUA 4E5KA 1KTIA 3DUFA 2QSJA 1MDBA 1UXHA 1BE8A 2AFRA 4A26A 4CN9A 3BWMA 1VLQA 2WJGA 4M9ZA 2NU8B 4DDTA 4MTCA 4HNUA 1YSCA 2G04A 3QNWA 4Q6WA 5AVRA 4JXKA 4KE8A 1E64A 1JHAA 3UUEA 1EBFA 4GSYA 1E3WA 2YINC 3LLMA 4U2DA 5EIOA 2WE7A 2CFOA 4BV8A 2ZIZA 3E9MA 2ETVA 1FRQA 4RHEA 2OVFA 4EECA 2VK8A 3GWZA 3KFXA 4G23A 4E2XA 1FX0B 3T0GA 5KQGA 3SZMA 2LKDA 2WM2A 3RTEA 1EUCB 3CNEA 1E5TA 4HKTA 4ND1A 2IYPA 4X5OA 3K0CC 5A2QA 5CXUA 2XCSB 4KWTA 4BB5A 5FKJA 3LPNA 1NJ1A 3QKTA 1JJAA 1G0NA 3A27A 1U5CA 4O2AA 5L3RA 1E4VA 4LKOA 4PC3A 5BV7A 4G5XA 2AUNA 3RYCA 1X2BA 2R6AA 4L73A 5J9FA 2D54A 2AZ4A 1XAJA 3UZUA 2Y68A 1Y5IA 2ADFA 4GWLA 2PCJA 3TJMA 4YCNA 2CLIB 3CE6A 1NDQA 1Z7GA 3HKDB 4BQRA 4K8OA 5LP6B 2FWJA 3OJXA 1PJTA 3HDVA 1EGHA 3IP7A 3MT9A 4ZU3A 3W1WA 1EHCA 1LA2A 1ZDMA 1NUSA 4UM9B 2WVJA 4Q3BA 2V4ZA 1N0IA 1ZD4A 2R7AA 3Q2KA 2VT2A 1RW4A 2Y6UA 3PR1A 4U7JA 5FPQA 4YRJA 1OE0A 4HZUA 4F9GA 2OHFA 1XLTA 4C21A 3STHA 4BLOA 1CJBA 4C5AA 1OHHA 2J6BA 3QXJA 1NOJA 1XFAA 2VF2A 5G0VA 3RUPA 1NW8A 1S3GA 3Q7PA 4IV8A 3VHXA 4BKRA 5JJBA 4DC0A 4DWOA 1FQOA 1JEOA 1FTYA 3HYNA 5ERGB 3C4JA 4AS3A 3D64A 2JEYA 1IOWA 5D7BA 4QOIA 1EQUA 2ABWA 1WF3A 3JTEA 4LRUA 5A3RA 4QZVA 2H7VA 4CMJA 2W6OA 1LEHA 4EL5A 2VPQA 2YWCA 3QBTA 4AU1A 1DG1G 1GVNB 2BGTA 1E79D 2WVGA 4J03A 4ABYA 3GZNA 2EP7A 4RESA 5CUQA 5C1DA 2BM1A 4QQ8A 3S1AB 2HRRA 4TKVA 3FR8A 1II8B 3IUQA 1DIBA 2G9ZA 1CQPA 3F6PA 3QPCA 4AS2A 4KE6A 2CDBA 3IDSA 1UXOA 2VJKA 4N5NA 4PGFA 3UYKA 4NNJA 1CQZA 1M1XB 1SK9A 1YOVB 1DCNA 3F97A 3KZKA 2BKUA 4Z2YA 4F71A 1M2OB 1NI3A 2R65A 1XZBA 3U4QB 3JU3A 2GCEA 3D4NA 4I36A 3AOEA 3VVLA 2Y2UA 4X7PA 2WJ3A 4B2LA 3ZGZA 4AI6A 2D1FA 3OFSA 1XD9A 3UA3A 4CEJA 4Q6BA 1JDSA 4PNZA 3VH1A 5BUSA 4F3NA 2HLNA 2HHAA 2J85A 3PC2A 3DSRA 2AR7A 2FWRA 3DDCA 4DE5A 1E7WA 2J3QA 4LF4B 3S8MA 3OQBA 1R6TA 3SI7A 1BZYA 2PXCA 2CDRA 2QTLA 1CUSA 3W5IA 2WG2A 2YFQA 3E9CA 2V6JA 3GRUA 2QGZA 4JA2A 1LBEA 3DNPA 1KA9H 2P9QA 1JIIA 1P5FA 2EV9A 2NVUA 1RKUA 3F4BA 4C1BA 1W9MA 4CIXA 3QMVA 2GAJA 1YZYA 4LSMA 3AM5A 4ZQIA 5EXXA 2J9XB 1XZHA 4QGBA 3NGXA 1T3ZA 3VAZA 1RD4A 4HNTA 1IU9A 1KO8A 1KBOA 1GPDG 2DWOA 1FXWF 1XRRA 2A0UA 2XJ9A 3MWGA 1XRQA 5HCNA 1ZD8A 3GXBA 3U4QA 4ZHQA 3QMMA 3AFIA 2H7XA 4D79A 4RPGA 3ZNQA 2AOTB 1KH2A 3NQ41 4EX7A 3C1AA 4ZYXA 1ZU4A 4K28A 1LX7A 4QDXA 1XPUA 4OGKA 3RAGA 1QONA 3N39C 3H0EA 2DRIA 4JNCA 4ONEA 4JLNA 3R3JA 1K2WA 3ZIDA 1QTNA 3T1OA 1R3UA 1P74A 5LYJF 2ORYA 1LNQA 2OENG 3OPMA 4DSNA 3AIMA 2GJ4A 2C4HA 2R6ZA 3IV6A 3KL4A 4MCHA 4DJDC 1QB8A 2Q2VA 2ZB2A 4Q3AA 4F4HA 4ENRA 2B8JA 2B82A 3E53A 4PSKA 4OQ4A 4FD3A 2O8DB 3BWEA 3D9QX 1KMIY 3Q10A 2UUPA 2VKQA 3FDZB 2CVOA 3IHTA 4TLLB 1OZAA 1NQVA 2QX7A 2Y71A 4J4HA 2ZS9A 3GEEA 5COAA 5IJXA 5CDTA 4BUCA 1TO6A 1YFEA 3O8DA 3RRYA 2Z4SA 2YXDA 1X1CA 3PG5A 5F9MA 5JC1A 5LLDA 3UY4A 3EPLA 1F0PA 2VT7A 3AVYA 4R98A 4GMXA 3A0RB 2NO4A 1Z6YA 4FYKA 5C32A 1RIIA 3OEHA 2WINI 1C4XA 2D59A 5FPPA 1UBMS 1E2BA 4IIJA 1SRRA 5CMLA 1E63A 3UPTA 1IVYA 4IHJB 4AUNA 1R8SA 1W0KD 5IM4A 1BMTA 2C31A 3BK7A 2HRBA 2BGKA 2PKCA 3F71A 1E2HA 3NEAA 4U5XA 4AZSA 1IM5A 3LUKA 1O87A 1T2NA 4GLLA 1JZTA 4GZ3A 5SV2A 3ADOA 2VZ0A 3FPJA 3WVNA 3M6AA 2LDBA 2QL7A 2AUMA 3K1YA 3AP3A 3T7SA 2CGEA 3TCNA 5EHIA 2FSVA 3ZY6A 8AT1A 3H9EO 5IN5A 5KYUA 2PUBA 4QEDA 3NIGB 2VWGA 3WQSB 2O8EB 1OTYA 2I55A 5EMJA 5AI8A 1QC5A 2I3GA 5SY4A 5DTEA 3SKVA 4OQEA 3DVRX 3GLHA 3N2YA 4MWGA 4DSZA 3M6FA 1Z7EA 1GNTA 2FN3A 4NEQA 2AOVA 1CUBA 1ATZA 4PLHA 5CHEA 2XNCA 3LWDA 2JLAA 3FWPA 3O4FA 4OHBA 5L95A 4UCQA 3UK0A 4I5DA 5CVCA 3AFNA 4D4KA 2UUAB 4DYVA 2BBTA 4KYVA 4CT5A 4YMLA 1NP7A 3JYQA 1HFKA 4P3NA 1YC5A 5AI6A 1W2WB 2J5XA 3L43A 3WFZA 3MWDB 2IS6A 3EUFA 4HZIA 3OQHA 4OMFG 2JJMA 5BYBA 2IITA 4K3UA 1PWHA 3TZKA 1E1YA 2ZUDA 5DSTA 1E8MA 5FLXA 1Q7BA 1TUGA 4NV3A 5M04A 1FVFA 1DWPA 2WV7A 2X58A 3QLTA 1ZXBA 5GJVC 1ZNXA 4CTKA 1J5EB 1P4HA 1K8QA 3H5WA 4B7CA 1T2EA 4BN5A 2RHWA 1LCIA 2PWYA 4MWEA 4M9QA 4PYMA 4FZ5A 4UUMA 5B7NA 3IRVA 3WO1A 3IIIA 3QLEA 4U2CA 2PMBA 2Q3EA 2QRQA 4TYMA 3BAZA 3WADA 1Q0LA 4LG1A 4O5OA 4TRNA 2H2FA 3T3GA 4QBKA 1JFSA 3P2IA 5I7AA 1BDHA 2O8BB 3T0FA 2PT9A 1P5RA 4ZO9A 1LLQA 2VUUA 3NAGA 4GH5A 4XSHA 1B43A 1C1HA 3S4YA 2WYHA 3IR5A 3AVOA 4KAFA 3TL3A 4D4JA 4RHCA 2JFFA 1QQAA 2OZEA 1EXNA 3ACBA 3WJ1A 1CXZA 2YIVX 4R4JA 3R4CA 2GUGA 5SZJA 4IV5A 2PMDA 4TXLA 1IY2A 4OBXA 2VYQA 3FAZA 2PGJA 3AESA 3ZDQA 1CNMA 1GZUA 2AC2A 4INZA 4YAEA 3PC6A 5EHNA 5F51A 4PPYA 2BBOA 2OCIA 5E95A 4G5FA 3AUFA 3F46A 2RHRA 2A0XA 3R3UA 2FHSA 4YRDA 4BLQA 3A9UA 4LFAB 4NJEA 3OZEA 5IRCD 4J0HA 4A36A 1GUBA 2VJLA 3UMVA 3WGZA 3IO5A 1FSZA 2WT4A 2O4CA 1RJEA 4Q9AA 1A5BB 1VJRA 3PFHA 5FRDA 4TVBA 2X76A 5AVQA 2ZCUA 2FPGB 3BCRA 2OBMA 1GWNA 5JCOC 2GHRA 4KE9A 1OBFO 2XBMA 1BKDR 3ZEIA 1IWOA 2BY4A 5FO1A 1I2CA 1NVAA 2JF0A 1EP3B 3H2HA 5J58A 3UAOA 2VHCA 2HU8A 4KIFA 1OQAA 1X7YB 1NU6A 1U80A 4AZ0B 3SXPA 1NBWB 1TQ6A 3AG5A 2ET6A 3U7JA 4MW1A 1Z68A 4UOEA 1WDKA 3DZDA 3TLGB 1U0NA 1P0CA 3JZMA 3RPEA 1X92A 4CMGA 5AD1A 1OH5A 3W6UA 3T61A 2YVLA 1X13A 2BKAA 2FZVA 3I6QA 4BGDA 3CWQA 2O19A 1Y6GA 3HXLA 1RKXA 4K87A 4C0LA 1LI5A 1U8FO 2CVQA 4V0LA 3CZRA 5C7LO 4G36A 5K1ZA 1VHJA 2QAJA 4ECAA 4DR7B 4WFKA 2J09A 1MQ9A 1D2CA 4KFTA 5KOIA 3NHPA 5D1HA 1WW3A 3O2SB 3Q88A 4L75A 4D8XA 1Q0TA 1UFKA 3BGDA 2R60A 2CY0A 4B43A 1JHDA 1NKTA 4WBSA 3SZUA 1MV8A 4IXTA 4DC9A 2BR5A 2JDID 4GOOD 2NV0A 4OP3A 4YNBA 1V35A 1UOOA 1VE7A 1O95D 1EX9A 4ML3A 1MB0A 3L9XA 1IZ8A 1XEFA 2O2JA 3NCTA 3OIVA 3PQ3A 4KFUA 1YE8A 3W6PA 5IM4F 4HAWA 1HTWA 1U7DA 3SS9X 5EMKA 5HUJA 4EKEA 1BOOA 3EMKA 1P1CA 4FJ1A 4CV2A 3LNTA 5FADA 1RKVA 2CXTA 3HJTA 3VNBA 4IGAA 1Q0RA 2CHGA 5A0TA 1PDWA 1ETUA 3RVKA 2W2MA 3CONA 1H3NA 3SZ3A 1ADYA 3C87A 1GZ6A 3CIFA 4XQ0A 2YJ6A 1RJFA 5EVCA 1QG6A 1S2DA 1DRJA 2HQOA 3RFUA 4MWOA 1G64A 4Q4CA 4HDAA 3DA8A 4MZDA 4C2UA 2BEJA 2W8ZA 1I94B 3TOZA 1ZJZA 1N2ZA 4TOIA 3GEGA 1UMKA 4QJBA 4ITVA 1F14A 3IEKA 3EF1A 2ZRDA 3GGDA 3N2NA 3VR6H 2BFDA 5ESRA 5KWJA 1NRXA 3WMXA 4C43A 3HBAA 5K3OA 3GHHA 5LFAA 1PW7A 2YUIA 4B9AA 2HA2A 1LVHA 2PDAA 5CM8B 1ISSA 2IYNA 4A4DA 4ENTA 1JH9A 3KVNA 3MWEA 1KWKA 2DY0A 3GNLA 2E0IA 1XN4A 1RWMA 2YZ2A 1KHHA 1AB6A 5L7YA 3TAXA 1DEXA 5AOBA 4YJ3A 5D3MB 3SBXA 1JPVA 4AURA 2PZLA 1IFXA 1ZD1A 3KOMA 5I7VA 1I5OA 1RYEA 1JJFA 2CNBA 2JZCA 2DFVA 3DT6A 5JVDB 4OUKX 4QUJA 1OUMA 1SQ5A 4E07A 2AJBA 1T5SA 3LDHA 1HDEA 3Q1LA 1GTJ1 4EI9A 2C54A 2G67A 4GMKA 1G5HA 1ZS9A 4KWEA 4F5WA 2P30A 1NMSA 3AUKA 4BC1A 1R15A 3GFRA 5D8DA 4DM3A 5E3JA 5KJCA 1G55A 1YE5A 3EMVA 4LAFA 2JGKA 2RONA 2X77A 1P3JA 2FTKE 2I1VB 3KJEA 4IFEA 4QGFA 5B6IA 3GLFB 4M4SA 2MR5A 2DHEA 3DF7A 3K05A 2XYQA 4IMJB 5AW4A 4MVJM 1R8XA 4OHPA 2PUHA 3L82B 1SVSA 5DHAA 1XDBA 2WZQA 3G7UA 4M87A 4LC0A 1A96A 1OLUA 2H00A 1PIWA 5F9FA 4O0MA 4MRSA 4EG8A 4PRZA 4V3BA 3VPXA 2ECPA 5EXPA 1T3LA 2E4XA 2C4UA 4K0RA 5CD9A 3ET5A 2J48A 2SCUA 4QBFA 5DGDA 3O94A 1LQUA 2PQ0A 1FB5A 3LBFA 4W8GA 2J9ZB 2IE8A 4RL4A 3RD5A 1NJ6A 3JQ7B 4MWBA 1FLVA 4H60A 5CX1B 5T4BA 5JBNA 1MC8A 1CRQA 1TYCA 4V0NA 1XNRB 3QY0A 5K0LA 4FQ7A 2O9JA 4BRZA 4PC7A 3IVMA 3T7AA 4EPTA 2CXNA 1E92A 4H0NA 4RORA 2GM4A 4RYLA 3S70A 5BNFA 1E3TA 2D5IA 1HY1A 4OF4A 1W47A 4OYLA 3LKDA 3LHDA 1TMYA 1XEWY 3DFIA 5ENZA 1JTVA 4OM7A 2W22A 2FZCA 1YF3A 4ITUA 3C8DA 3LUDA 4MQEA 2CMHA 2PBRA 4YALA 2I3BA 3LA8A 5EJ8A 1P2TA 5FWDA 3CMCO 5I8ZA 4D9NA 2Q5CA 2I7TA 5CX4A 2FMIA 4LVUA 5JAZA 3RS4A 2O0HA 3RV3A 2CCKA 3NO9A 3ZHUA 1U04A 4WFJA 4B4OA 5B2EA 5IPFA 3UK2A 3OO0A 2I2DA 3ZIAA 3I1YA 2REBA 3RS2A 2F4VB 1LPOA 2XVMA 3IVRA 2QRGA 3RVNA 1U0SY 4OGGA 3V2UA 2IHKA 2IY8A 3EXIA 3GEHA 3UJHA 3QVTA 1BFKA 1F2UB 5JISA 4I50F 1RM5A 3BJZA 2BI4A 1VHTA 2I2FA 3AERA 4XWGA 3NJ4A 5EL0A 2CK3D 1QOQB 2AOUA 4J7AA 4LDPA 3COPA 3CRQA 2PWZA 3CPHA 4YJKA 5KINB 1TJ7A 1PZNA 3BM5A 1XD2A 2G17A 2PSDA 1NOKA 4PCVA 3SMQA 4YX9A 1AS0A 1Y1LA 1N2BA 2FX2A 2HCBA 4D2IA 5HFNA 1CR0A 3OCWA 3TSCA 5KVAA 4YAKA 4G26A 4HR7A 2PL5A 3Q2OA 1N2SA 2CB0A 2GK3A 4M7RA 4MUAA 4U2BA 4O4IF 1QRRA 1EK2A 3TBKA 1GRQA 4DLZA 4QTYA 2I54A 5KUTA 3GJ3A 4NE9A 4JUBA 1T6XA 1NMEA 1XZIA 3BHMA 1XR3A 3IPYA 1ZX1A 1Y8AA 2VR1A 2V8OA 4J1TA 3IH5A 3H8VA 1U5BA 3KQTA 4GL2A 4TS1A 1XVTA 5LL6P 3NEJA 3KUXA 2NU7A 2GK7A 1UADA 5EQJB 3T9BA 1NF3A 3KJNA 2C5SA 4MK4A 3ZD8A 5TGTA 1ZUD1 2DKFA 1X7XA 1C1DA 2WFAA 2X41A 3VDQA 3U60B 1LI4A 1M2EA 5B7GA 4CIYA 3L49A 3MLAA 2RHTA 1XO1A 3AT1A 1RTKA 3JZFA 3T6KA 2OBBA 2YY5A 4O4HB 3RADC 3OE7A 4ZI7F 3IVGA 5KNCH 4HP8A 3D3NA 4PO8A 3RUHA 3LZDA 1ITZA 4AWXA 3PD7A 4Z1MD 4LPKA 2PNJA 1VKNA 4HXGA 3IE1A 1J00A 2QROA 2IWRA 2IKQA 2OB1A 4M49A 5K3DA 4FE7A 4IDBA 3RHTA 1U81A 2X8AA 4G0UA 4K9PA 3VNVA 4ZZ3A 3BAFA 4Q05A 5HW2A 4BDTA 1L7RA 2QQFA 4CT4B 4D4LA 1I1HA 1N8NA 3WGQA 1A3CA 1H1LB 2FPRA 1BVHA 1P8JA 4RPHA 2O54A 2D1SA 2OWDA 1T4CA 3OEEA 2ZBQA 3OCVA 4E21A 2YRWA 1VSUA 4OHFA 3OTWA 4IOLA 4ALMA 5LDDC 3L6RA 3RK4A 1NUUA 3N70A 2Y0DA 3BD8A 4ZOLB 4AMBA 1QO9A 4KHZA 4YRNA 2VK4A 1E58A 3SJ7A 1CEXA 1WXWA 3IHKA 4N3BA 4C0QC 3BF7A 4Q9KA 1YJ5A 1C9NA 4HRAA 2REQB 1PJ4A 3KHTA 3UJ6A 1B0UA 1YA4A 5D5HA 1KQ7A 3DZCA 5DN6A 1UJNA 2VJYA 3T8YA 1FS6A 3ECSA 3ORSA 5FOSA 2ID4A 2DUNA 2RKWA 4YDRA 3ZHZA 3ZIAD 4F21A 3ZDAA 1GSHA 4OH1A 1NWHA 3RVRA 4WT7A 3Q3EA 3RCBA 3UGTA 4AG5A 3UA4A 3KYCA 1AX9A 1GZ5A 3WC4A 1HDOA 1Q2UA 3UBMA 4AZTA 5IDWA 4HDQB 2JCGA 1XQYA 2VUSA 5KAMA 4AJIA 1XQVA 2VBIA 4G37A 2OFXA 1SQGA 1VLLA 2NO6A 3UJ9A 2W6PA 1KFJB 2FCAA 5FUWA 2C2GA 5TE9A 3DVSX 2ZBGA 3D6JA 3OZIA 2BUCA 3LSYA 3GDWA 4X1YA 4LF7B 3NWEA 4I1PA 2B7BA 1IRXA 1XWOA 3AI1A 4QU9A 1M1YB 5I9TA 5HS4A 5AKZA 2ZBUA 4MHTA 1HZZA 4MWDA 2JAOA 3NZEA 3O1JC 3U62A 4KR0A 3TOSA 5JAIA 3IKVA 4R9UC 5CBKA 1AHPA 4R6XA 3V46A 3EAGA 3RRZA 2BGUA 3LYHA 3D5EA 3AQIA 3FRHA 3N5KA 2IUFA 1V16A 3ANLA 4ZAXA 2NIPA 1R9MA 3H84A 3T12A 4ZREA 5TB5A 3VJMA 2V1XA 2ZUCA 3BMQA 2WZCA 4LBVA 1YS6A 4WOCA 3TW6A 3S7ZA 1U3UA 2B7CA 2GO7A 4ZKEA 1X8XA 4XX0B 1RXVA 2GBFA 2HRDA 2Z6QA 3NGMA 3N07A 4WZBB 1P4RA 3PP8A 3PXXA 5F35A 1KK0A 2IYSA 1IBRA 2Q0XA 3JQAA 4F3YA 1JLSA 3IDOA 5ISMA 5LBIA 1KEVA 1U2PA 3C3EA 1LK7A 5BP7A 2CJYA 3QKIA 4MW2A 2HDHA 3DZJA 3D8SA 3EXHC 4D3YA 1MJNA 4CETA 4Y7DA 4J75A 3Q8MA 3AB3A 5HR5A 2ZE8A 3V4FA 3QWBA 2A6PA 2VXBA 2ON6A 2VA8A 3L0CA 5DNYB 4J76A 1A1VA 1KRWA 5BY2A 3EG5A 1N5LA 4I4TA 1TC2A 1KP3A 2PUJA 3LUCA 5G0UA 4C89A 3FCSB 2H5JA 2GN2A 1IXKA 4N0QA 1R8JA 4P2BA 3RF6A 5AVJA 2I6UA 1KFEB 4KBYA 4F56A 3LIIA 1H4TA 3DCJA 1ETHA 5L51A 4P81A 2LRHA 3R44A 3AEYA 5K8UA 3AVPA 4KI7A 1F20A 3NBQA 2I8LA 1QGYA 1DC8A 5D3KA 4HG2A 5FHRA 3OQVA 4L4YA 2P65A 1LQ2A 2R1VA 3FVVA 4HNSA 3KVVA 3NTVA 3NETA 5EP1A 1YKSA 1H22A 1OLXA 2B1RA 4UE2A 4UM7A 1GKIA 3CVOA 1ENPA 1QXSA 5HWSA 2FK7A 3DEYX 4KLNA 4R8RA 3LGAA 1JEDA 1CWUA 2QRVA 3GWGA 4EFLA 4EJSA 5LQJA 2R85A 4BLVA 1ZWLA 2RGCA 4I4TB 4DV2B 3W6OA 2J08A 3OT1B 3OWXA 3OPYI 1FZTA 2G25A 1GGKA 1QCYA 2RAPA 3FD8A 3OIUA 3TFOA 1TFUA 2JFYA 2OZLB 4XWAA 2XVXA 1I0AA 2QQ5A 3D7NA 2GAAA 3JYOA 3MT8A 4XGIA 1XJCA 5F33A 1EGAA 3CV3A 5H9VA 1YBHA 3R9WA 3AL3A 2X1HA 1L4GA 4CNQA 1AO3A 3DW3X 3PRJA 1K0UA 3CEHA 2F9MA 4YJGB 1SOAA 4R54A 3W8RA 3U44A 1MZPA 3OD5A 2A7QA 1KDRA 4YUXA 5JMOA 2FG6C 1TJYA 4F2GA 2B9VA 5KJ1A 4DCOA 4NBSA 3VNSA 1R16A 2FQWA 3FHLA 3JV7A 3FZYA 4LA4A 2ZR9A 3WQRA 1Y34E 4L6CA 3D54D 3L8DA 1K06A 2B5WA 4JUFA 1OJ7A 1DQZA 2VRNA 2QSYA 2PFGA 1V9SA 2B1IA 5KYTA 4LF9B 4KKXB 1YS9A 4NYIQ 3E3NA 3DBHA 3I05A 4NZ9A 1M2NA 3WE7A 4N6NA 3F5DA 4J0QA 5M3BA 16PKA 3C6QA 4UOZA 1BXRA 2XMDA 1SCKA 2PMWB 2ZBVA 3DMYA 2QW1A 5HQTA 4DR1B 1D09A 1QFZA 1Z0AA 2Y67A 1L5WA 4GKAA 2EKBA 2O8EA 3H5OA 3EQZA 4ID9A 3VTAA 4DBLC 3AMVA 4WRRA 4CKEB 2WZBA 2ZUBA 1I3MA 2FUG6 3Q5GA 4JLUA 4KJZA 5GOZA 4HWOA 3P20A 2DQ4A 4Q7EA 5CA1A 2YDXA 2WTNA 4N82A 5L3ZA 1UP6A 2V3VA 2ZRFA 2JLXA 1AGXA 3TWOA 3LP6A 1PT6A 4FCTA 3TZQA 3WYBA 1T1RA 4CTNA 3Q6NA 1FBTA 3TEFA 1DOZA 1DAIA 2DZDA 3ZNPA 3ROPA 2B0JA 1JXAA 4LYAA 4YRRA 1DDOA 3FR7A 2Y99A 3IAFA 4G6ZA 1CUAA 3DL4A 2ZIAA 3JVUA 2C8JA 3NANA 4C3ZA 4H7JA 1JA9A 1ZNZA 2DCUA 1V0JA 2B1GA 1PS8A 3G8DA 3M4XA 2J0UB 4OXYA 4QBGB 5H9WA 2FWAA 1YZKA 2BBWA 1WMBA 2Y1XA 4S35A 3V9AA 1QF7A 4IFTA 5I7RA 3S5UA 2PUEA 3DHNA 1EJBA 5CTAA 3HYSA 3F3KA 4BIIA 3QENA 2IEDA 1U99A 2XTNA 2C2KA 4CM6A 3ANYB 3TQFA 4JLAA 3CX8A 4MXDA 1QTRA 1PFGA 3QXGA 2BP7A 2BSXA 2FZLA 1YZFA 4G01B 2UZ1A 1UK9A 4TUYA 5FULA 4EHLA 3KX2A 4BNGA 4H7EA 1ZSVA 4OAOA 4JYAB 1J20A 2V3CC 4YACA 1NNUA 1Y82A 4K46A 1E1CB 1B00A 3H2KA 1T4CB 4QQKA 4PZDA 5FTLA 3C5HA 3OQPA 1MO2A 3ULKA 2VT6A 5AJUA 1R5OA 1GNPA 2JFHA 2P41A 8ABPA 1U7UA 8LDHA 5K03A 1KOGA 5HF5A 2QDKA 4FFSA 5ICGA 3ZN2A 3PEUA 2FUEA 3LECA 2MU1A 2ZSAA 2XMRA 4E1BA 5H70A 4WOBA 3CF4A 1ZIDA 5CFPA 1KYXA 3O1LA 4Q3KA 1MABB 2WUDA 3U9TA 1VMIA 1LLCA 1UMCA 4RHUA 5AW8A 3T9DA 3S40A 3NTOA 1IH8A 1Z5VA 3HJNA 2BKXA 3B2EA 2VVTA 2YYYA 5K5EA 3TD6A 1Z45A 4N0MA 2LCIA 1VPTA 2JGFA 3CEJA 4PLGA 4DCVA 2YMQA 4G65A 1YS4A 4HH3C 4R05A 5EWJA 2FH5B 3D7MA 1ZONA 2H11A 5FQNA 4RSGA 4DKXA 1PL8A 3FOEC 4ZOBA 3L4JA 1NN3A 4B46A 2J3KA 4INPA 2BD0A 4JI6B 2RFLA 5ESDA 2QM3A 4BFUA 4NC9A 4PNHA 3D5TA 3T1VA 4A0HA 2PKQO 4CLEA 3KUCA 4UBMA 2QJFA 1SXQA 2JLVA 4BGUA 4EZIA 2VDUE 4DPLA 1TXGA 4LCBA 3FN4A 4IPTA 1UOEA 3LRXA 4L51A 1EBBA 1BCSA 1XZPA 1N5MA 2B25A 2GASA 1U9ZA 2GDZA 2XA1A 3DQZA 3ITDA 4KSYA 4LJSA 3FGNA 4YT4A 5AHRA 4OYRA 5A6SA 2B98A 4NBNA 3KE8A 4DJAA 2HBZA 3V8EA 3L7IA 2G72A 2MSCB 1ZH4A 2QVXX 4TXHA 3I9LA 3VAAA 5JCXA 3M83A 1VHWA 9ATCA 3TKYA 2CJWA 3AF2A 3AV3A 5E2AA 2HPVA 4M1OA 3WV4A 1T91A 3HA5A 2PV7A 1Y42X 1HT0A 3GBPA 3KUUA 4J6EA 2QORA 1XN1A 3GRPA 3OC6A 4L4UA 3PWZA 4TUYF 3B48A 4A0GA 1H85A 2HJHA 3DO8A 3OTQA 4G85A 4REQA 2IIPA 3TLEA 3AR7A 3KTFA 4MOWA 3QYAA 1DTWA 2FWNA 1NYLA 2BTQB 2Z57A 4YMTA 1UIMA 4IXMA 3ONEA 4JBHA 2QN3A 5C5EA 3F4SA 3DZHA 3GGCA 3R5TA 3SQMA 2W83A 3L1VA 4RQBA 1MC4A 1U7HA 2NU8A 1KI6A 1EXWA 3L18A 4ZANA 1M0EA 4DLXA 1Z08A 1DS6A 3MGAA 1CB7A 5LDGA 2IV7A 4YTEA 4X61A 5JJKA 1Y89A 621PA 1W85B 3TNDA 4DMFA 1NIJA 5BT8A 2R25B 3B3FA 4G5OA 1TZJA 3CVJA 2HU5A 2JFZA 5CVEA 3AP2A 1T6NA 2FLKA 3C3KA 1FP4B 2JIOA 5CVUA 4FT2A 4MEAA 4ZK2A 1UKVY 5F4ZA 2WRZA 4EK9A 3PGA1 5MHTA 4QRIA 2MYPA 2G28A 3PUHA 5FOWA 2BTQA 1GQRA 2MMGA 3JW8A 3NS7A 2GPBA 3E15A 1JAXA 1NV9A 2B2XA 3K0BA 4LDJA 4FR2A 2YFYA 1L8XA 5EJ9A 1FP1D 2DU8A 1VMAA 4IRUB 3UMJA 5TARA 4WUVA 3OPYB 2A2ZA 4TXJA 2OGZA 3B82A 1J2EA 4L8GA 1RXIA 2FR8A 2MINA 2VSNA 2PWBA 4ZOCA 4KV7A 4HRXA 5IAGA 4KQGA 2FF5A 1C50A 2WTMA 3H65A 1RZRA 1SIWA 3RVOA 3OVMA 3BXOA 4LHXA 3TUZC 5A9TA 2WBLC 3P96A 2WHEA 4CMEC 4FQ8A 4ZT4A 3DLAA 4QDJA 5KS2A 3IFSA 1NE2A 2PRKA 4OLFA 4OP1A 1DWUA 3OQIB 1HE8B 4X1KA 1JJIA 4BLTA 3EGDB 3U7HB 1AQ6A 2PQ2A 2XCIA 2ZB8A 4OI2A 5F23A 5FWNA 8OHMA 2CCJA 3R0XA 1F6WA 3CT4A 2A0YA 2VF5X 1VIYA 3U80A 1LC0A 3VNUA 1KY5A 2KBEA 3ODGA 3ZK9A 4UHEA 1H9BA 2H16A 4KL8S 1ZJYA 5FV7A 2HB6A 3RFCA 4RSRA 2DLCX 1KOLA 4XIYA 1OI4A 2ZI6A 4DLNA 1A2OA 4BECA 2JIZD 3VKFA 1XDGA 1X1RA 4PWZA 4Z0NA 4LFCB 2YTZA 4JB0A 4TZKA 3MTEA 1AURA 4OQXA 3UWMA 5TV2A 4UBLA 4YCSA 5COBA 5AICA 5BR1A 3TQIA 3IEIA 4YJHA 4A73A 2VHEA 1C3JA 2NADA 1E0KA 3KB6A 1JKJB 4P3YA 3UMGA 2F3QA 3IJRA 4FYPA 3NV9A 1FP2A 2V9PA 3RT9A 4F04A 4M8LA 3JVDA 4GWGA 3ENQA 3QBDA 3KL2A 3NP9A 3N8IA 3RG2A 1CJVC 1THZA 2HMVA 1B8PA 1OBCA 1C3LA 1GV0A 2PD3A 2AG5A 1T1JA 4FLFA 3MCAA 4GDMA 1T5BA 4Z0TA 4BRUA 1M2VA 4GT1A 4F85A 2YHBA 3M1LA 4DIOA 1E79A 2VC2B 2ISCA 3HKDA 1P4GA 2AD5A 3CF6R 2O6LA 3G79A 4CLDA 3AM1A 4Z9YA 4MIOA 1KZ4A 1U0HC 2JC3A 3JS5A 3SYMA 4BWVA 2NN3C 3SEAA 5JH7B 3DE7X 2X1VA 4MX8A 3V1UA 5L53A 3FJYA 5DNEA 4FOPA 4JMPA 4PC2A 3WFIA 4FDVA 3PV0A 3QF4B 2I71A 1RZ3A 2BFBB 5AP9A 1ADFA 2EYUA 3DT8A 4EBBA 1Z7BA 1RHMA 2G1UA 2PAAA 3E6AA 4BU0A 2QP4A 2VHXA 3H0CA 4XQEA 4C2BA 5GOTA 3H9JA 1Z5GA 1VIMA 3S5JA 3LS2A 1ECGA 3B85A 1SJ9A 2I03A 4ISBA 5D3ZA 4UTVA 1JSXA 3PQ5A 1P0QA 3E4CA 3AVQA 1EDDA 1LSSA 1ZN2A 1QDUA 1T0UA 3HDGA 2OMKA 2PH7A 3P0IA 4L9WA 4W5WA 3W3ZB 4RXUA 1NBHA 2FPIA 1YUMA 2E4ZA 3AB7A 3HM2A 5FI0B 3HC7A 3ASVA 3PYXA 1B74A 1QC5B 2Q6LA 3AFMA 2ZSUA 3NT2A 4I6GA 4OMUA 1ZJ6A 3Q0TA 2WY2D 3KJIA 3URKA 2R4QA 2HRZA 4NG5A 3U7EB 3G9XA 2JGAA 4EWLA 1QO7A 4ABTA 2FG7C 4M21A 2ATEA 4CM8A 1TX4B 4FI3F 4C7XA 3HFSA 1E6KA 4PSDA 2YW2A 1PZHA 5AUOB 1H66A 3K8OE 1Q3TA 4GICA 1BNCA 3PD1A 4IJMA 4QLAA 2NACA 2DFKB 4X7RA 3AUXA 5AVVA 4DZTA 2HRCA 1IZYA 2OXTA 1QG0A 2IHBA 4G4SO 4OY3A 5K3SA 2QS9A 4PX2A 2WQ7A 3OP4A 1LX6A 1Y3FE 4NICA 1T5OA 1L4KA 3LCRA 3I4LA 2JFGA 5G1NA 4O2AB 3HJCA 4TPKA 3HMQA 4DARA 4CEIB 4CM9A 1K5HA 3UV6A 3KQUA 5ILGA 2RG1A 3ZCSA 3T7KA 1XKLA 4DQUA 4B3MB 1HQYE 2V7XA 3MCTA 1A50B 2Q4OA 2X4GA 3DCYA 4H0CA 1KDVA 4ZYLA 1ID1A 5JECA 5UKDA 4PAQA 4TZ6A 3FHCB 5KDDA 1HLFA 3ZHOA 1JI3A 3GJYA 5P21A 3H16A 4D0NA 3GRZA 4OVKA 1XRJA 2VAVA 3A32A 4ZXFA 1WP9A 1P72A 4H6VA 4P8RA 2O20A 3FPAA 3UVEA 4LVOA 4AMVA 3MQFA 5TGDA 2C8VA 1EDBA 1I30A 3AINA 1FSPA 2ZUWA 4FCWA 1G6Q1 3GP5A 3TW8A 2N42A 1T8SA 2ZRKA 3UENA 3I2YX 1XZAA 3IVXA 4QYWA 3A6ZA 5DBGA 5HDBB 4IIYA 3BJRA 5FBLB 2HBYA 2EARA 3NHWA 1AMUA 4WD3A 4TMFA 3PJFA 5KQPA 2EP8A 2NP7A 1YQQA 2OHXA 2C4VA 3D6AA 1RYHA 1JECA 4GQIA 3ZVNA 1DV2A 1J90A 3T5DA 1OA1A 2PFSA 5IC4A 1PDVA 4J7CA 4ER3A 5ITSA 1J2JA 3ZEAA 1JDVA 2EFDB 1UINA 2OM2A 4RE6A 3UK7A 1QFXA 1TQHA 3CRVA 4GP6A 1CIVA 1PR6A 1TZKA 1OI2A 1NR5A 1BD3A 2EU8A 2QE7D 1GG9A 4M0DA 5ECDA 1FVXA 3FETA 1EWTA 3C39A 1JG7A 2I2CA 1KH3A 2QUKA 2YV3A 3E23A 4OOFA 3FSEA 2CFCA 4JDUA 2AC7A 3H1FA 3I76A 1KS9A 3MJDA 3W7AA 2DERA 3ZWNA 1WA5A 2IIQA 2Y6VA 3P1JA 1HMYA 4KVAA 2PWPA 4N7MA 1D2HA 3U6BA 3PFIA 2NSDA 3K0FB 4RHXA 3EAQA 2XLCA 4TV9A 3UPUA 2B1QA 3AHHA 1A5TA 2ILVA 3BTUA 3KJGA 4J07A 3TVDA 4UPEA 5B3JC 5F7XA 3UAZA 3UHJA 1I4TD 1X74A 3OJFA 4MS1B 1SQ0A 3KS9A 4N9WA 4NONA 2I4RA 5HE9A 1K3TA 1VOTA 4BQNA 4BTLA 5SY9A 1H0SA 1V7CA 3NORA 4OQNA 1P2BA 2NUPB 4BJ1A 3WFJA 1OA0A 2C9BA 2NUTA 3GLGA 1NF9A 1Q0SA 1X7DA 2ZITA 3VV3A 1KU6A 2CNLA 2HU2A 1H5UA 4GEKA 3F9RA 4QOEA 2OMEA 1NUHA 2WIFA 4FS3A 4OHVA 5BQ5A 4RADA 3SC6A 1A4UA 1NVFA 3HJBA 3UF0A 5LQKA 3CSUA 5F21A 2GXSA 1SZCA 1Q21A 3EH1A 2X4DA 4FW9A 4TKUB 2DBYA 1LXCA 4A6XA 4NMWA 1EHIA 2ZUVA 4MHSA 3F73A 2WJVA 3GLFE 2C5FA 3MG9A 3E4DA 1N32B 1W88A 2M6RA 2XE7A 1VE9A 4ZI2A 2GR9A 3QX8A 2W2LA 5K45A 3CTMA 4RZUA 3U7QB 3A1DA 3N2EA 1IHOA 3DVQX 3RROA 2RHLA 4KOAA 4E2FA 2CL0X 2AI3A 1ESCA 2EZ4A 2GVNA 3QUQA 5CVDA 3RJZA 1N6KA 1JVSA 2O8CB 1Z6GA 3ZZTA 3E3AA 5HPYB 5I9SA 2A0WA 5BW8A 5JXWA 5LP1A 1H0HA 2DTEA 4M22A 4HTFA 3SU8A 2BZGA 2GN9A 2JHPA 3G0HA 2QVLA 2WJIA 5LU9A 4AY4A 4MKIA 2MYNA 5F3RA 1RQXA 2A5LA 2ZOSA 3U17A 4YAUA 4DA4A 3ZD7A 1QKIA 2DTDA 4TYQA 3FPFA 1QQ6A 1SUCA 3E2IA 4PCLA 4X71A 4D8YA 4YV2A 1SIUA 1CLEA 2NYUA 3MCUA 4AF8A 2YMLA 4D4MA 5BV8A 2PS1A 3U5ZB 3O92A 1EA5A 3LGSA 4NFSA 1RABA 5H7XA 5G0SA 5DM60 2AN1A 3IGFA 1Q7GA 4MR7B 1PFKA 1H1LA 5GV7A 4DLTA 3DW1X 3HJHA 2VYFA 1HOXA 3EVZA 1Z17A 4NX2A 3DXYA 3T7DA 3W5DA 1EB9A 4YUYA 4X45A 3W05A 3K70B 4I1OA 1TM7E 5HEKA 5E6UA 3LO8A 4DY6A 1D07A 3RSSA 1E6CA 1IM2A 3DD1A 4A0SA 1K27A 2FX5A 1U9IC 4WX2B 1WWKA 1XZGA 1OV4A 3W4KA 3OM8A 2RGNA 1RRGA 3L6BA 3T3OA 4KEAA 4WFQA 4YLYA 5FUQA 5K99A 3I52A 3VYVA 3G8CA 1M2HA 3JRWA 5KOJB 1XJQA 4Q1VA 1PFYA 4JP3A 4UHBA 3W8DA 3E1KA 1NN0A 5IT9A 4B3CA 4A1FA 1R66A 4ZEXA 3Q9SA 1O9HA 4LF5B 3KK0A 2WTAA 3VC3A 4X24A 1J25A 1TO1E 3IVCA 1WJGA 4TN1A 4JCOA 1VZ3A 2HR1A 1F4VA 3P26A 2WKWA 4X8MA 4GWKA 4PVCA 4OLAA 5CYPA 4TWJA 3Q8LA 1V6CA 2IPLA 2QJRA 2WU3A 3RAJA 1OZHA 3Q9UA 5HBGA 2O2EA 2QR5A 3C6YA 4FDUA 3AJ8A 3A9SA 4H31A 4MUFA 2DUJA 2AVDA 1Z56C 1I01A 4GUDA 4A15A 2AJCA 5BSFA 4RO0A 1H6CA 5C8YB 1P44A 1YFKA 2NNLD 2G9UA 3D8HA 5BUZA 1WCV1 4BO1A 5EMHA 3ZZUA 1A9QA 1BU8A 1RPJA 2OQIA 3HVRA 2D28C 1OAOA 5JE8A 5K3FA 2YWEA 1CZLA 2QG4A 1ISFA 4PLYA 4E0BA 2ARKA 3R7WB 5DBEX 5ABPA 4CG2A 1OIXA 1FUPA 1DL5A 4EG6A 4KIGA 3PXGA 1VSQA 1GY8A 1SU4A 2VBFA 2RARA 4LBYA 4D8UA 2FWBA 3OM1A 1ZM4A 3LUJA 3PWTA 3QPUA 4G56A 4S04A 1DIGA 2MSWA 2NSLA 2W2NA 3HE3A 4V0SA 5A71A 1EDEA 1GGNA 4BKOA 4HDCA 1XU9A 1XYYA 2YRFA 1VB5A 3D2CA 2AS0A 1WF6A 2IK8A 1W34A 2GZ3A 1GLGA 1ZN9A 1PVVA 2B2NA 1NVUQ 2ZPAA 3UKOA 1OVMA 3HNPA 5JSFA 5BN5B 4E14A 1CULC 1M6VA 1S9HA 2VJNA 3DLIA 4NPCA 4RY0A 5I9IA 1VMEA 2WJYA 4JROA 1WCIB 1ADCA 4D4IA 3E7DA 2PL3A 4IKEA 2PLNA 5IU6A 1T4DA 1X94A 1M3SA 3BRWA 3E8XA 2VZ9A 3P52A 2OGWA 4QKQA 4P1ZA 5B58C 4W5RA 1WKVA 1HSOA 1J1IA 5CCBA 2IS2A 5DVZA 4N7JA 4JYZA 1YRHA 3I5XA 3G8YA 4CEHB 2X8LA 2KM1A 3FM9A 1R0YA 3U37A 1P0PA 2HADA 2MMCA 2PNFA 3GEBA 5JAQA 1YOVA 3IBFA 5BRNA 1I1QB 3IMCA 4TL7A 5LA6B 3B9BA 5B1EA 2ZWAA 1ZM3A 1WXQA 5CG2A 3ZE7A 2PGXA 3N0WA 5ESXA 1IMOA 3TDMA 4DGSA 2UVPA 3HFRA 1UEXC 4RA9B 4Y30A 4ZJZA 2VPPA 4G89A 1E59A 2H4JA 1TF5A 2HPHA 3CT6A 2J59A 1U02A 4ZEMA 1YB2A 2V7UA 4HDMB 3ETLA 3RS0A 3VZQA 2A1IA 2L17A 5T41A 3HV2A 1A9YA 4YJ2F 3MUOA 2WSIA 1A27A 5INTA 4ND2A 3ZXXA 4DDKA 3H4MA 1YJCA 1GYQA 3GF4A 2NXJA 2YASA 2PXXA 2CCGA 2OD9A 1G2IA 2WB4A 4S1OA 3IMGA 2ECQA 2FUNB 2E4UA 4I14A 4IIDA 4Q48A 1BHO1 2XSZD 4WLNA 4WN9A 3WRXA 4NR0A 1ZNYA 1N7JA 1TKCA 1BS1A 1K7FB 1XTIA 2GUWA 1EVYA 3PNKA 2PGIA 4O0LA 4XX0A 1GTRA 5AM1A 4D9KA 1E9DA 1ZCFA 4KE7A 5AXAA 4DSTA 4ZTZB 2QLMA 3F9CA 2F43B 3K32A 1EJ0A 2J32A 1Q17A 2JGEA 2R48A 3ONVA 2DH6A 3P2JA 4LW8A 5A6VA 1TU4A 4G2TA 1OROA 3D2BA 3L4BA 3K1AB 4C0KA 4TMXA 3HLTA 2ZE5A 2P1RA 3NHUA 1KO4A 2CEAA 1XTTA 4M8SA 4Q21A 1L5MA 1PEYA 3EXHA 5JUWA 2C77A 3KZCA 2EZ9A 4MQEB 4Y3UA 1TLTA 3MZ0A 3DG9A 1Z2AA 3NOXA 1Q0HA 1HYBA 3SJUA 1QRUA 2O05A 3DKVA 3KB1A 4V0KA 2YVUA 3UFBA 3EBPA 3I39X 4RVGA 3N2ZB 1V8FA 2HD4A 5AYVA 1SU8A 1EVIA 3GLTA 4RA6A 4WV3A 2WSLA 4QYTA 4RK1A 2A4MA 2DEUA 3ZE9A 1FLDA 3ANXA 4HQKA 4BEVA 2JNWA 3HZHA 1C9YA 2G76A 3KNZA 5JNUA 4JHXA 5EIBD 3OEED 1YHYA 5EIWA 4TS9A 2HDWA 1JIQA 2VBCA 2DUMA 2QAGA 3T9FA 4II7A 3EVGA 4A1OA 2PAFA 4B5KA 4ZN6A 1XGKA 2BH2A 1RC1A 4NI5A 2I80A 3D2LA 4NJMB 2C04A 4L6AA 2IOHA 3ROFA 3L7KA 2JVJA 4U7GA 2HA6A 3VI3B 4EF4A 5C1OA 4EUEA 1GAQA 4ZOEA 1QANA 3ZE2B 4BE7B 1W96A 2GJSA 3NGLA 4PYLA 5K0FA 1YZVA 2C7BA 3GRRA 1H94A 3U3ZA 1ZVKA 3OY7A 5TMBA 1KJ9A 2PM8A 2A5GA 2GYUA 2QRUA 1X14A 3AR6A 3GFPA 3KM0A 4H3HB 4LSGA 4U02A 5DGTA 1V9CA 5A1JA 3H19A 1Q19A 3FNQA 1E89A 1FMJA 4WNYA 3PC4A 1ZOPA 2CNKA 3H4VA 3CSDA 1KY2A 2OXIA 3PFBA 4TKLA 3R7AA 5K8IA 1Z5UA 1MORA 2WTXA 2QMYA 4FSDA 4UM5A 2VYCA 1HFWA 4MKGA 4MYRA 2XGJA 2AFIB 4K3VA 5KTTA 4BXOB 2X0IA 2DFLA 3KAKA 2CLKB 2NTVA 4KREA 3I83A 3JSXA 2C94A 3CZPA 1VL1A 4II2A 4AMUA 3WHLA 2C98A 4KO1S 1SKBA 4YS6A 2H65A 1FRFS 2H08A 5CEJA 4R0VA 4DMGA 1U6KA 2EGHA 3R41A 2ZJAA 2QSZA 4BLRA 4JI4B 4J49A 1ZH0A 5AJXA 1KDTA 2QW8A 5E4YA 4ZVVA 1SG9A 2DULA 4XIGS 3T0IA 4EB3A 4EPWA 4GPEA 1DRUA 2ZEJA 3EPPA 1FXUA 2EZUA 1YVPA 4UFOA 2FMTA 4BPBA 1FFAA 2HNAA 3PFCA 3OZGA 4IY1A 1SVOA 5CLLA 3TPFA 1IN8A 3IA7A 4D46A 3BXFA 3DLPX 3T4EA 4NAHA 1VJ0A 2W6JA 5CYOA 3JY6A 4I3HA 2BGLA 2P35A 3AJ9A 5B12A 1COZA 4N1AA 4QVKA 5FEUA 1FURA 1U7OA 1VJGA 3ELDA 1CRZA 1X9HA 4JXZA 2Y1OA 3QWFA 4ND7A 2XUHA 4MS1A 3OE1A 3EUEA 3F8TA 1TUBA 1OVGA 5T4EA 4B6GA 1G41A 1YIAA 2FEOA 2PL1A 4DCNA 3RSFA 1U4OA 2XYHA 4I66A 4QPZA 4LE1A 1J33A 5TQVA 3DTVB 3K30A 4PCUA 1G66A 4YIHA 1EP2B 1SBNE 1UKCA 4CMIB 4LY9A 4RPIA 2QT0A 5J5AA 1F4PA 2XQVA 4MV9A 1Y3BE 4HLNA 4ZVNA 2C99A 1UXIA 4EGSA 1XKQA 2YQ5A 2GHIA 1SOVA 5EE1A 3WB2A 5HZGA 2A7XA 1PR1A 3WLEA 1UEIA 1YB4A 1P6UA 2ZYWX 3GROA 3A7EA 5JD4A 1V25A 2PA0A 2BM9A 1SH7A 1NIPA 1WVMA 1RADA 2GESA 1QYVA 2P4HX 1N3YA 4FHFA 5BSMA 3VPDA 4FHZA 1DTWB 2O23A 3DFUA 4ZTUB 4I2NA 2H3HA 2IVZA 1W2HA 2IP4A 3F7OA 1ZIPA 1ZLYA 1IB6A 1F1JA 2HK6A 1OZFA 5CT5A 1U7ZA 3DYIA 1Z0FA 5E9AA 4A7PA 2BVNA 1Z5ZA 4BTVA 4RKWA 1MGPA 3LG2A 2P62A 1E5LA 4XKJA 1PR4A 4M3NA 3HKCA 5E4FA 4HTFB 3UXEA 5CGZA 4JLKA 1M8GA 2WK1A 3RRPA 5TQ0B 2FWMX 5DU2A 4EZBA 2A9FA 4N40A 1VG1A 4GQBA 2XQGA 1GIAA 1XTVA 3L1HA 1QE5A 4MDHA 2Y9MB 4OAPA 5JDIC 4MQMA 5DI3B 1NKVA 4EJFA 4LRWA 3M6LA 2NXCA 1Q2XA 1CRLA 3H11A 4V1CA 3LCJA 4HT3B 4TWBA 4R0MA 3QF4A 5AMXA 4GGPA 1E94E 2I1QA 2PZGA 3QG5A 4HQLA 3UMMA 2WFLA 5DSXA 2K2WA 3D6MA 1QQBA 4BO0A 2D2IA 1ODTC 3GUYA 1KFKB 3AHCA 2WHXA 3BMCA 3U9SA 5K6AA 3H42B 2WDZA 4ZCTA 1XKTA 3THYA 5L8VA 2WILA 4K9KA 2DECA 5K20A 2JI4A 4Y2HA 1L7BA 3WIDA 5CA0B 3A4VA 1Z2PX 2AWNA 2XUJA 3KOYA 4YJ2A 3OCYA 1WXEA 4P4TA 5A1TA 3T1HB 1GPBA 3IR6A 4E5DA 3FGZA 1FZQA 3TB6A 1SQ6A 4Z4QA 1G8MA 4HAYA 3WLRA 4E70A 1GAJA 3CZMA 2B7LA 2G80A 4UZSA 3ELWA 1NVBA 5HJ2A 4I5FA 3T3DA 2CYAA 2W2XA 3DE4X 3I6ZA 3L7DA 4D81A 5HVNA 5KOJA 2P27A 2HCJB 5A7GA 3L7YA 4BYGA 5JLJA 4OHWA 4B74A 1IEWA 1YQTA 3SLRA 5K51A 4Y2PA 3IAHA 5DLYA 5BPHA 3N8GA 5EP4A 3QBPA 4KIWA 2V97A 2WUFA 1OLSA 3BB3A 1IUKA 1Q1AA 2G07A 2BFAA 4J29A 4ZVQA 2H4YA 1G7CA 4PVDA 4RV5A 4HLCA 1ZUNA 3IA2A 5LKRA 3O2NA 5ILOA 3ZBTA 4ZGWA 4W4TA 4PIVA 3CRW1 5DNDA 2YXLA 5CFRA 1E9CA 1SBIA 3FYCA 3LNCA 3R6TA 1AN0A 4D42A 3SIPA 3THWB 2VDQB 3I5AA 3RTAA 4XPZA 1UFVA 2FUG1 2AI2A 2HIMA 3ZBQA 1JALA 3T5GA 4UBOA 2WM9B 4U2FA 5FWXB 1YRWA 4JV5B 5BORA 2XMPA 4BNLA 4J8PA 3C1OA 4YJ3F 2EKZA 2ZSHA 3VSDA 4M83A 1KQNA 3NAZA 1N2CA 5SYNA 2J0SA 2H1LA 2I2WA 3VDRA 2OGUA 1UBRS 4AZ3B 1H9CA 4B8YA 1GZSA 4XTRA 1SOUA 1ML4A 4BVAA 3P7MA 5GZ3A 1S7GA 2XQJA 1UZUA 1P80A 4M0FA 1BHQ1 3LOQA 5F2OA 2XB2A 4UVEA 1OYYA 2DPMA 1WZNA 4BNWA 1W6RA 1R0WA 3U4CA 2BMWA 4ZRNA 1FP7A 4NPHA 5GVRA 4UNNA 3GT3A 5J5CA 5JWHA 4LX0A 3RS5A 5ARDA 4Q00A 3FBWA 1JW9B 2DSNA 1UPTA 3I73A 2J6CA 3GELA 1MX3A 3IODA 5JO0A 2Y3IA 2P5TB 2PKQP 2RI0A 4XIFA 3T06B 1JDNA 3ZQUA 4EJ6A 5C18A 4NL4H 1C80A 1LGYA 1EUQA 4OL9A 3V7NA 3H87A 2QN7A 4GG1A 2J7PD 3HLYA 2P4SA 2JANA 2VATA 3FWNA 4IDGA 5LUAA 4YRPA 1KWGA 4CM8B 3VO8A 3HR8A 3EEQA 4G25A 4A8JB 3ZWDA 4XYEA 2AJLI 1E8NA 3X1DA 4EVQA 3BPSA 3VM6A 3C8MA 4EW6A 1EFDN 2O6HA 3C6KA 5K9ZA 3LP5A 2CLHB 2NTNA 2TSYB 2XDQB 4IBOA 2EG9A 4X20A 3R9IA 3T94A 5F7OA 5FNVF 5CURA 5KJFA 4QFMA 5IM5A 1MLDA 2ADOA 2FY8A 3U4AA 2J1LA 2Z6AA 3C7TA 3VVCA 3L0DA 3EPKA 2HK7A 5FCDA 3QLUC 2B34A 1UWKA 4LJKA 2VO1A 1LRJA 3AHGA 1X1BA 3MSXA 2OC9A 4OBEA 3VR4D 2CJWB 3Q2IA 4RK5A 1E5XA 1SAYA 3QEOA 1R6AA 2MSKA 4FINA 1F2VA 4X63A 4E51A 1IN5A 1GTZA 4Q9HA 2JIQA 3DEKA 4YR9A 2XRYA 2WWWA 4ZOQI 1EWYA 3ICVA 1X70A 1OWMA 1AQYA 3JQBC 4L6IA 3E9ZA 1UWLA 3NDIA 4OB7A 3IERA 3H9UA 4Y6RA 5FI3A 1H8HD 5CFMA 2SKCA 1RWBA 4IIFA 3OMXA 1K6MA 1P1BA 1RU3A 1XCPA 4R8KA 3T5CA 1EXVA 1FTQA 2COEA 1NXWA 2BEVA 3MOGA 1RLMA 4L28A 4FMDF 3I5UA 4NDAA 3OCEA 1AH2A 4GGOA 2AHRA 5LP6C 1E7YA 3PE4A 3Q7TA 1R88A 5U4XA 4RIGA 4W5NA 3LJKA 4UTPA 2RH9B 1KK1A 4II3A 2JVKA 3R77A 4RQAA 5LCXA 1Z74A 1RZVA 2HCTA 3W9YA 2WAYA 3GFVA 4J0IA 3VU3A 3PHIA 2QVBA 3FH0A 1QWSA 1R2QA 4NESA 3I2IA 4JSTA 1T43A 3HVHA 3ASUA 2I78A 2VPZA 1XEWX 3BGSA 2VZEA 4GOMD 4NBVA 2W0MA 3JX9A 4W8OA 4ZTBA 5DWQA 2Z43A 2R00A 3QPVA 3VPAA 1OWNA 1G3MA 2B4AA 3C48A 4F60A 1BEZA 5GM2A 4GOLD 2JCBA 2OR3A 5CU7A 2GWHA 1MIOB 3QFSA 1J0EA 5PNTA 3NC4A 4EQ6B 4PG7A 5CIWA 1UAYA 2FX3A 5TMEA 2WF8A 1JQAA 4QHYA 3QW2A 1WDMA 2HRQA 2X7XA 1NBIA 1X39A 1VXRA 1MVOA 3ND7A 4LYYA 2WF6A 1U9JA 1J0AA 3Q1KA 3R0ZA 4PV7A 4RZ3A 3OQ1A 2GRUA 2GZHA 4GUAA 2W2KB 5EERA 3FYSA 3DAPA 1JU3A 3GGSA 3Q7IA 4NABA 5JFOA 2C9OA 3GEIA 1OFVA 3OKPA 5C1PA 1DQRA 1I2ZA 3L7NA 5TXGA 2BDEA 2FFHA 2GN8A 2QZJA 1JKMA 5EXDA 5K0CA 2HXYA 1Y6RA 4M0PA 4W9MC 3PSAA 3ESQA 4ESHA 3NV7A 5ALDA 4P9NA 1V11A 1KGSA 5AJYA 2B8TA 5CRIA 3R3YA 2WTEA 2CXOA 1QK4A 3MMZA 1T6ZA 3LFHA 1VLHA 4ALKA 3D8RA 1DC4A 3QHPA 4G1FA 3HKBB 3WBFA 4D92A 3BCUA 3GLHE 2X0RA 3HNRA 3SKXA 4LHVA 2BLLA 3EIXA 1HSZA 4JKOA 3AETB 4Y0AA 1J06A 5CH5A 1SXPA 2ZR8A 2XWPA 2JIMA 2W11A 2WIGA 4V0RA 1IB0A 4UEJA 1S0UA 1NT2A 1ZNWA 3GT4A 4LHSA 1KSGA 4AKTA 3NYIA 2Z8ZA 4ZT7A 1VRCA 3T7IA 4P4UA 3RRJA 2L18A 4OREX 3ZVMA 3QK7A 4ARCA 1TUEA 4K2AA 4TMTA 4XB2A 2YCLA 4XGQA 2IQ5A 2P3LA 5LUBA 5C52B 3H0KA 3R5SA 3FYUB 3L5OA 2WU4A 3OX4A 3NBMA 4FHEA 121PA 4S24A 3KJFA 3TDNA 2A3RA 2OKGA 1QRAA 1JF8A 3S55A 1IAVA 3O9VA 1PQYA 1O54A 1U0GA 2WWHA 4QDKA 4KAAA 4MINA 4V2UA 1Z39A 1ZNQO 4FFRA 3BSFA 1U3FA 3KP1A 1E98A 3OJOA 1PYDA 4JIGA 3FWZA 5L9AA 4LOHA 3P4YA 4A10A 5GVSA 2XCQA 4NNPA 4B7ZA 1MO3A 1YXMA 2BRUC 2M6KA 4W63A 3KTAB 2MINB 2P2NA 3H17A 4QUBA 4G0OA 4HUQA 4ZDWA 2F64A 2QTMA 5CT6A 2I8CA 4K5QA 2QM8A 5J2TF 3RIXA 2ERCA 1E69A 1P18A 5JSZA 1VLJA 2WMNB 3A7DA 4YJDA 3MTIA 2G5CA 3IAM1 3ZCRA 3HS3A 3BMOB 3LBIA 2ODQA 3K9HA 4DR6B 3A05A 3LQRA 4PX5A 1J0XO 1OYWA 1ZMTA 3PGMA 3WB1A 3WJ7A 1SBZA 2PYIA 3VBCA 1VI6A 2INGX 2ZJ3A 3VYRB 3Q3CA 4DZZA 1TW3A 1O0CA 4E5NA 3ERCA 4AKIA 5FIUA 3E8SA 2WF7A 4C0JA 1A9XB 5ULLA 2IEIA 2GAOA 4KPGA 4LDQA 2P7HA 1FU4A 3KDPA 4KQWA 5IAJA 4TXMA 4MX2A 1J8VA 3B89A 3IDAA 4YAJA 3AUTA 3H6KA 2CNWD 1JU4A 5H02A 4B17A 5KWIA 2FZ4A 2RSLA 2V74B 4FE3A 4UAVA 1L5NA 4DQVA 4N65A 3E9EA 1U2DC 4O2BB 2D4HA 4CU5A 4JVSB 3LD9A 1I2DA 3C8UA 1DO2A 1T4MA 2WKPA 1QHGA 3UB3A 2AQIA 3JARB 5B3KA 1KIFA 1NGSA 1T9BA 4ND6A 1U8EA 5M5BA 1TUIA 1EP9A 1NLMA 2AW3A 2Y9PB 2ZJ6A 3FMVA 4IS2A 4KLZA 2A92A 4BMNA 4BQQA 4X60A 4GSKA 4YMVA 2AEFA 3S8YA 5DV9A 3SE7A 4IKOA 4YC7A 4MUBA 4X6XA 2GFIA 1PGOA 3T4UA 2R1ZA 3O4GA 5BQPA 3SQNA 3DKIA 3GUVA 3RHSA 5JPCA 5L3SB 3BKXA 1XU7A 1ECCA 5B64A 1FA9A 1CETA 2H0QA 1DBWA 5GONB 4ANFA 5HKOA 1KEKA 3K8ZA 3CWZA 3V7FA 1D04A 2XWJI 3G17A 3BC1A 3LC0A 3ACDA 4FLMA 2ZYRA 5F2NA 3C2QA 4NZYA 1UBCA 3W5UA 4NU0A 2OILA 4MRVA 4UJ3A 4CWAA 1E9BA 2ODEA 1XWFA 4ITRC 1HI9A 4BBJA 3RFVA 3UC9A 4X20B 1XEAA 4HWGA 1QIIA 3DPIA 3O91A 4LKRA 5COQA 5BSUA 3LAWA 1WSWA 4BMPB 1GZDA 3T9EA 3I53A 4TLMB 2ERYA 3ESYA 1SU6A 1LPMA 1K88A 3CA8A 3L41A 2O1WA 4HPJB 4JLJA 4BP3A 5LNK1 5E9WA 4RAQA 1M8JA 4FN5A 4E7OA 4N41A 1P4JA 1SCAA 2QTGA 4MMYB 1T24A 3V80A 2ZK7A 1PHPA 3VSBA 4I1YA 5BYJA 5KYWB 1WV1A 3HBLA 3KT3A 1FYDA 1X1EA 1DWQA 2VTVA 3M33A 3THSA 3G2HA 1CEQA 1P7CA 3AYXB 1EDOA 4TTVA 4WBXC 3KQNA 2I2AA 1IUNA 2QRMA 1EUYA 2JAQA 3E3MA 4UNIA 3L0ZA 1YH3A 1RQRA 1ZIXA 2O2DA 2XRMA 2D1QA 2RB4A 4J3JA 1N9KA 4R31A 5FXMA 3ZH9B 4A5OA 2GF9A 2RBKA 1XCJA 1T1IA 4DDHA 3C97A 3FNBA 2CZGA 1KP9A 2W9XA 4QPCA 4ZVLA 4ZMRA 2PGDA 4UULA 5JAPA 1OREA 1RYBA 2HT1A 1QQTA 2ZB3A 2ZRIA 3JQEA 5KSZA 2ZS8A 2XADA 3P0EA 4H1WA 4AY2A 1JIVA 4MIYA 1T0IA 3AY3A 4XUEA 5EWMA 1JUDA 4IDCA 3EODA 4P0TA 2WMYA 4N39A 4RD1A 4LGYA 3ISVA 2Q5JA 4B4VA 2VHWA 5F1KA 1FDWA 4S1PA 5DM2A 5B3AA 1JQ5A 3WQBA 2NUTB 2H1HA 4MW7A 2FOIA 4G5GA 5BMOA 1FQWA 5CA0F 2DFTA 4KCGA 1ZICA 5FWXA 2WAMA 4KFRA 5B36A 2P5YA 3BN3A 4ZQGA 2QENA 1VMDA 2OY0A 3TQQA 1U1EA 5J5VA 3AIKA 4P0PB 2VYVA 1A8QA 3P2KA 5HKKD 1PGJA 1KEEB 2XECA 3B5JA 4UEOA 2DT8A 1XRNA 3F74A 1KRHA 1MHPA 2YS6A 1IHYA 1LZKA 1QZUA 3PNYA 5IK2A 3SZGA 4AD8A 4EFMA 3STXA 2HWWA 4F72A 4P7GA 3SZOA 3C6BA 3ORYA 3WWYA 2BGJA 4KRYA 1IBSA 3EBLA 3HEAA 1PT9A 3IT1A 3CVXA 1FCJA 2DGDA 3IP5A 2VQSA 1ZM2A 3PVCA 4KQHA 1S3IA 3JD4A 2QRZA 4TZTA 4WECA 5DYTA 4FGSA 4IZHA 1QJCA 3DBOB 3VZRA 7YASA 3JWGA 4B8ZA 3HH8A 2R8OA 3BICA 2Q21A 3B1WA 5KWSA 1FS4A 3IP6A 2R6R1 3FROA 3ILXA 4W5JA 3U3DA 4BLWA 5JCJD 5K09A 1D4ZA 4LI0A 4EP1A 3ADDA 2EYQA 2O48X 1W581 2RBGA 3I04M 1WVGA 3TRDA 2J9YB 4NZNA 3C15C 3O3NB 4DBZA 3NHZA 3LXRA 1ZKDA 2OBNA 3LX8A 4PE5B 4TMKA 1BHJA 1TYZA 1VCMA 2QYOA 1R0BA 3DAHA 3OZXA 4YJGA 4EAQA 4LRYA 4YQYA 4D44A 1XK6A 5CK5A 4NV1A 4WGFA 5GMOA 2E2WA 3R0VA 2Q2WA 1YZNA 2C95A 4COKA 5JJ5A 1YKGA 3A9RA 4D6PA 1OFTA 2YXPX 3FMPB 3MS4A 4KQFA 4RDIA 3JYLA 4MPDA 3PF9A 2GEFA 1NM5C 2X2FA 3SD7A 5FTWA 4QWMA 1N92A 4L8WB 3QU7A 2VH5R 4MUHA 4MYSA 2IYWA 2O2ZA 1UAAA 1Z82A 3ELUA 5A4IS 2KLBA 2H1WA 3CINA 1RBZA 2ZI9A 4J0KA 3W79A 4DMCA 1UK8A 2R7NA 2G1PA 1XZCA 3Q98A 1XMSA 4D56A 3ESRA 4POAA 2NT3A 1OX4A 3BZBA 3G8BA 4MPTA 4YWHA 3GCWA 2CL5A 2VSFA 3O7WA 3R3VA 4X1IA 5THQA 4EW1A 3AVUA 1Q44A 1M0WA 3KC2A 2OZVA 3KEGA 4MEJA 3SHWA 4PLVA 1YNSA 4EABA 2PT7A 3MEQA 1YO6A 2OORA 2VDVE 2VF4X 2ZJ5A 2A9RA 4CIVA 4EPYA 3TXAA 3S3TA 1GJRA 4FWTA 1H2EA 1HEYA 4LZPA 3BMXA 2P0YA 2YHIA 3KXIA 5JDCC 1NR1A 1ZVJA 3ZHCA 5BN1A 3L7JA 1QCDA 3QIAA 3PDHA 4U2GA 4WCVA 5ER9A 4QHTA 1U1DA 3L01A 3O47A 3DBVO 5F91A 2IDMA 5AW0A 3IO3A 1Q22A 2EW1A 4HNAA 3AU8A 3UKJA 2FZEA 1P73A 1YQGA 3ZU2A 3TGLA 1JG3A 2OO7A 4YUVA 5HZKA 3T9AA 4RXTA 5EUMA 1ESNA 1Q3KA 5KVCA 3GP8A 5LSAA 1Y6QA 4ZYTA 4GDFA 4XXHA 2GEDA 2GO1A 2P1ZA 1G63A 1JU9A 1SEVA 4TS4A 2FN7A 2XYRA 1BW9A 2GF2A 5D86A 4ILKA 2YJZA 2GZ2A 2OK8A 3MWFA 1MT0A 4N01A 1W36D 1KEPA 3P9QA 2K4MA 3L7LA 3QV2A 5ALZA 1KETA 2PVPA 2QZ4A 1G98A 1O1YA 3OKFA 3RVQA 4BASA 2R6GA 2OCPA 2NOAA 3DMRA 1NQUA 4JLVA 1DAOA 4RWZA 1GRCA 2YHUA 4AJKA 5DEOA 5EHXA 2CC2A 5ECYA 4RF4A 2VNHA 4LQ4A 5HK9A 3EDYA 4XYLA 4IV0A 1RWNA 1ZH2A 3MJTA 1AE1A 1RVDA 4P32A 4PXSA 2RHJA 2HXGA 4BAUA 2PZEA 2UVDA 2E55A 4URXR 5L6MB 1P2SA 1ZY2A 1CQIB 5EJAA 5HA5A 2R79A 1SC4A 4H7IA 4KVGA 2QTFA 2N1MA 3ABRB 3JQFA 5BT9A 2IU0A 1JHOA 5K0TA 2HXSA 2PX0A 5DMXA 3HCOA 3KOZA 4FSXA 4BHTA 2ZI3A 1CR6A 1Y33E 2H5EA 1ST3A 1PG5A 2EFEB 5G2OA 5ITVA 4IQGA 5EG5A 5C9ZA 2WP8J 4HDKA 1AUVA 2ACEA 3F3YA 1Q92A 3EDMA 4ZAGA 3NVMB 3U31A 4AUMA 3A9TA 3AR9A 1TKAA 5DYYA 4OI1A 4CF6A 4JP8A 4QUKA 4UCXA 4NH0A 4J7UA 1CB0A 3NH9A 3SF0A 2QVCA 5AKGA 3EGIA 3W5HA 3R74A 2GEUA 4PN7A 1VPWA 1DP4A 1QH8B 3C45A 3M6XA 1T15A 1G0OA 2JPDA 3VJRA 1CQIA 1TE2A 3CKLA 4GGMX 1POWA 1VHLA 3L0OA 5A5DA 5JARA 2IHNA 5JNTA 2I7VA 3QX3A 4R1OA 1L5ZA 2R47A 5AIBA 2F00A 1WHTA 4JMLA 2ZI4A 5JSUA 2ZZKA 1CLUA 3IQFA 1XQ9A 4R69A 2Z1MA 3A4YA 4RD6A 1ZGAA 4WLVA 1Z5NA 1XROA 2Y0EA 3M34A 4IOKA 3QV1A 4HMPA 5HCUA 1UBSB 2ZQ5A 3D8NA 4BNFA 4C0XA 5E9JA 3CLTD 4K1XA 3JD0A 2M1XA 2PUCA 3NIDB 5FJIA 3MINB 3ETNA 5JSHA 1LI7A 3WMGA 1YHZA 2R5NA 1VGQA 2RI6A 1UCFA 4P84A 3OX2A 4QTZA 1XCGB 1UK7A 4XFKA 1GGJA 4XEHA 3KKOA 4Y2RA 5I7EA 5EQFA 1JV2B 1C9KA 2OLEA 2XB8A 4A92A 5I6DA 4JT8A 4Y0NA 3TSWA 5IEJA 4HGZA 1FFCA 3MTJA 1G21E 1HKUA 2EFCB 3ILHA 4LBWA 1M6YA 1R00A 2ACKA 2PJZA 2QD5A 2I4MA 2R7LA 4BFTA 2H2DA 1ZJJA 4MQFA 4US2R 5KU7A 3RK0A 3RSCA 3QLJA 3D6FA 2OAP1 3HEMA 2V7GA 1CR2A 2B35A 4BJ3A 3KJQA 3OOSA 3ZWMA 2G77B 3PDUA 1AMOA 5AW6A 1HZZC 2IRWA 4IRMA 4BNXA 2C5HA 3FTCA 1DCKA 3DBRB 3UEOA 5B4TA 3DMTA 3EVBA 3N58A 5BXQC 4FI3C 3OP1A 1U3CA 2RHOA 1LDGA 1O7JA 1XAHA 2KHZA 2WYWA 4M1YA 3DL0A 3QUSA 4YP0A 2LV8A 1ZGZA 4DQLA 4ESEA 3QUTA 1TVCA 2E82A 2IEZA 4ZAYA 4IEEA 5CDHA 3RJ9A 3OT4A 2VAXA 3H5AA 3FX2A 4DLKA 4RD2A 2OECA 3FCEA 2AN5A 3E61A 3FZQA 5EGNA 1CY7A 3JXEA 3QI7A 5HDQA 3RKUA 4JI0B 1UM8A 4GVPA 5IKXA 4YDQA 3SVLA 3K5PA 3M70A 5G1OA 4IJKA 2IUTA 1PT5A 2FWPA 3O83A 2E6KA 4ZZ2A 5LZ7A 3VFDA 4EHAA 4UDOA 4HFNA 5EJ2A 5JQGA 3E27A 2HLDD 5KKCA 3I61A 1DEOA 1PVOA 4GPAA 4ND4A 5BPFA 1DFGA 3DV9A 4KN6A 1E0DA 2IXGA 2O8NA 2VUHB 1DOFA 5DBFA 4TVOA 4X8OA 4D7AA 1BX0A