4NFLA

Crystal structure of human mitochondrial 5'(3')-deoxyribonucleotidase in complex with the inhibitor npb-t
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
201
structure length
201
Chain Sequence
SNAASGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase, mitochondrial
publication title Conformationally constrained nucleoside phosphonic acids - potent inhibitors of human mitochondrial and cytosolic 5'(3')-nucleotidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 69
structure length 201
sequence length 201
ec nomenclature ec 3.1.3.-:
pdb deposition date 2013-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4nflA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4nflA01
1Q92A 5AM0A 5AW5A 3D6JA 3AR2A 1YDFA 5AICA 3ZU6A 1NF2A 2D2VA 4L57A 1XP5A 4UM7A 3ZTWA 4CF5A 2WF9A 2FPWA 2HF7A 4ZEWA 5ALNA 3WK7A 1ZD2P 2ZBGA 3QGMA 2R8ZA 1XVIA 4J03A 2FPRA 5T41A 1RMYA 5AVWA 5AVUA 4BX0A 4DW8A 1L8LA 3L8FA 2CN1A 2HO4A 4ZEVA 2P11A 3ESQA 5AM5A 2OYCA 4CE6A 2W4MA 3ZX4A 1QH9A 3UMCA 2DQSA 1T5SA 2GO7A 1RMQA 4CF3A 1CQZA 5AI0A 1YNSA 2X4DA 4OCZA 4UMVA 3SMVA 2FPXA 5A3QA 2I33A 3U19A 4BNDA 5AM4A 3AR6A 3U26A 4BKMA 1RQNA 5AK4A 2RARA 4YCMA 5ALVA 5AI4A 1S8OA 2Q4RA 3I28A 3QU2A 2I55A 3L7YA 3QYPA 3RF6A 4E88A 3S6JA 2I7DA 1Z4OA 2ZOSA 4BYGA 3B8EA 3QUBA 4QJBA 5AKXA 3RFUA 3IRUA 4OD0A 4Y2SA 3N1UA 4QQFA 2HF2A 1YMQA 1U7PA 2HCFA 2R8YA 4HGOA 4BEVA 1ZOLA 2HEGA 3KOOA 2G07A 2B1QA 3EF1A 5ALFA 5A3SA 4YCNA 2CFSA 3WGUA 2C9MA 3CZ4A 2ZBFA 3KZXA 2RBKA 4GXTA 1WVIA 2PR7A 5ALZA 4KX5A 2P27A 3W5BA 3QU4A 3MMZA 4CF4A 1MH9A 2OA0A 4F72A 1RKVA 5AW4A 2JAOA 4Y3UA 4YH1A 3ET5A 3NALA 4FFDA 3SKXA 1QQ7A 3I1YA 3MC1A 3WK4A 2HOQA 4B6JA 3QU7A 1YV9A 2GFHA 2EATA 2R8EA 3OCXA 1L7NA 2O2XA 3OCVA 1Q91A 4AS3A 3QU5A 2PQ0A 3WGVA 4JDPA 5ALTA 4NFLA 2YJ4A 3VAYA 4BEWA 1X42A 3M1YA 4NWIA 1TJ5A 2G09A 2B0CA 3L1VA 3QLEA 3CNHA 5AM3A 1VFPA 3FPSA 2W43A 2C88A 3SLRA 5ALQA 2WF7A 4UAUA 2W11A 2O9JA 3ET4A 1RQLA 1TE2A 3NUQA 4JB3A 4OFZA 5AI9A 4UU1A 4XOUA 2GMWA 1O03A 3P96A 5AKZA 3W5AA 1RKUA 2FUEA 5AVYA 2QYHA 2YFYA 1K1EA 3ZW7A 4EX7A 5AKLA 3MN1A 3PDWA 2AH5A 4UARA 1QQ6A 3WK9A 2IA5A 2AUTA 1EK2A 5ALKA 2ZBDA 5AK6A 1L6RA 4RESA 4UM5A 2NO5A 3OCWA 3QX7A 4IG4A 4OHFA 5AVRA 5IT0A 2B8JA 3B9RA 3N8GA 4RETA 2JAWA 3I76A 3NANA 1SU4A 3FZQA 4Y2RA 1WPGA 5E0OA 2G1AA 2NO4A 2HX1A 1WZCA 4UMDA 1YS9A 3BWVA 3SHQA 3WK8A 2JARA 3ZWKA 3HYCA 2JGAA 4Y2JA 5ALUA 3FGOA 2YBDA 3OCZA 2EAUA 4L6AA 5AVZA 3I6BA 1PW5A 2B1RA 2WF8A 3IB6A 3QXGA 2BDUA 2B82A 3ZVMA 1XPJA 1LVHA 5AKGA 1VJ5A 3A3YA 5ALEA 3WKCA 4UMEA 3R09A 4F71A 5AESA 4YIHA 4C4SA 1Z4IA 3OCUA 1ZRMA 3KBBA 1Z4MA 4HGQA 3EWIA 5AIAA 3UM9A 3MPOA 3OPXA 1TJ4A 1U2SA 3WKDA 1Z5UA 2YJ5A 3N28A 2JAUA 1RLMA 2Q5EA 4IFTA 1U2TA 4EX6A 3ESRA 1Z88A 1J8DA 1RLTA 1N9KA 2I34A 4KNWA 5AW1A 4HYTA 5IT4A 3L1UA 1Z4KA 2WF5A 2P69A 2ZBEA 3DV9A 3OTQA 4XE5A 2YMLA 3OCYA 4HGNA 5AHXA 4MWOA 5AI6A 5AKIA 5AI5A 3B9BA 4I9GA 5ALDA 5ALRA 3R4CA 3TLMA 4BNDB 2OBBA 2HI0A 5ALSA 2VKQA 4HGRA 3AR5A 1VJRA 3ZWDA 5AKJA 3SF0A 5ALPA 3L8GA 1J97A 2HDOA 1FEZA 1RKQA 1Z5GA 3FVVA 5ALXA 5AVXA 3PGLA 3IJ5A 5ALMA 1SWVA 2YN4A 1RLOA 4Y2QA 4DCCA 4EZEA 4ZEXA 5AI8A 1ZRNA 3ZVNA 1S2OA 4XQ0A 5ALWA 5AKHA 2YMMA 3L5KA 4C4RA 4Y2TA 5AW0A 3F9RA 1F5SA 4CNQA 4DWOA 3L8EA 1Y8AA 2ZXEA 3M9LA 3AR3A 5ALIA 5AW6A 5IS2A 1EK1A 3UMBA 3R9KA 3WKBA 1U02A 5AM1A 1RPZA 1WR8A 2FPSA 1Z4QA 1JUDA 1U7OA 4AS2A 2FDRA 1QYIA 2YY6A 2MU1A 3DAOA 1NNLA 1TA0A 3A1DA 5AM2A 1LTQA 2BDEA 4I9FA 1T9ZA 3L0CA 2G80A 3KD3A 3U7FB 4Y2YA 4YGYA 4KN8A 3U7EB 1ZD3A 4MUMA 3E58A 2YJ3A 2EARA 4FE3A 1L7MA 2FPUA 4DFDA 4UASA 1ZD4A 4NV0A 5AVQA 4FYPA 1L7PA 4KYTA 2MSNA 4G9BA 3N07A 4YCLA 2QLTA 1KYTA 4C4TA 3NRJA 2I6XA 1L7OA 3UMGA 5ALYA 2R8XA 5AVVA 4O8CA 2IOFA 5ALJA 3HLTA 2BY4A 4UAVA 3AR4A 1Z4NA 1L8OA 5AW9A 3KDPA 3ZTYA 5AW2A 3NAMA 2C8KA 3ONNA 4KNVA 3SKYA 2C4NA 3J7TA 2ODAA 5ALGA 1TJ3A 4BBJA 4Y2UA 2C8LA 3WKAA 3L0BA 1RC8A 5AVTA 1Z4PX 3WK5A 1ZD5A 3DNPA 3U7HB 4HGPA 1IWOA 4Y2VA 3EPRA 1QQ5A 3E84A 4HAIA 1CR6A 4NABA 4XPZA 2G0AA 2FUCA 4UU0A 3W5DA 5AW8A 1ZJJA 1SWWA 4BX2A 1RDFA 4NAVA 2B30A 2G06A 2OM6A 2WM8A 3FM9A 3L8HA 5JJBA 5ALHA 1T5TA 1O08A 4UATA 2P9JA 2HSZA 4H1WA 4J2TA 3QUQA 3QNMA 2FI1A 3WK6A 2AGVA 4EELA 3AR8A 2G08A 4EEKA 1YJ5A 4Y2PA 2RB5A 4PNHA 1RMTA 3QUCA 3DDHA 4GIBA 1ZS9A 5AKEA 1Z4JA 3U13A 1Z4LA 2IYEA 3A1EA 5AKYA 5AK5A 5AIBA 5AVSA 3AR9A 3GYGA 2YMQA 3ZUPA 4G63A 4UMFA 2B8EA 2ZG6A 5AK3A 3SD7A 2WHEA 3E8MA 3N5KA 4YIKA 3ZI4A 3EF0A 3L0YA 3BA6A 2GHQA 2HHLA 4KX3A 3KC2A 3ED5A 4Y2XA 3PGVA 3W5CA 4EENA 2FEAA 3E81A 3NASA 1AQ6A 5ALOA 2GHTA 2CFRA 3NIWA 5ALLA 2PKEA 3ZVLA 2RAVA 3K1ZA 4AP9A 2IOFK 3FPBA 2WFAA 4BX3A 4L6CA 2YJ6A 2WF6A 3AR7A 3QUTA 2I54A 3WKEA 5A3RA 2YMPA 2CFTA 1NRWA 3QU9A 3ZX5A 2Q4TA 3A1CA 5FP0A 5AKKA 5AW7A 5AW3A 3PCTA 3U7GA 4UW9A 2AMYA 1RRCA 1N8NA 2NYVA 2IOHA
chains in the Genus database with same CATH superfamily
4I1YA 2BGKA 2BBOA 2FLWA 4AO6A 5GJBA 4B09A 2F6RA 1KRHA 3M70A 1NOIA 1E89A 1ECBA 4BATA 4H7JA 4DIFA 3GGDA 3CCCA 1V41E 3SR0A 4NF2A 5I7WA 4RTKA 2YKGA 1QRDA 3ZTWA 1U9CA 1LF0A 1XKTA 3GFTA 2ZM6B 2QRMA 1OBHA 4WLFA 5F4BA 1EFRD 2GVZC 2HR1A 5P21A 4BVGA 3TI7A 5C7OO 3SAJA 4A5OA 5CX1B 3L8MA 3HKDB 4FKBA 3U6KA 1ZX1A 1ACJA 1DQNA 1SR8A 3A14A 1J9ZA 3TG2A 3JW8A 3FXAA 3OJXA 3T9AA 3GLFE 4Q3LA 1WXDA 4KWCA 2D1QA 5BR8B 3TINA 4CWAA 3REFA 1JQEA 1HE5A 5A7FA 1Z5NA 1O94A 3VFDA 4CQLB 3AM4A 5TNXA 4EUFA 5FLXA 4EG7A 5LVAA 2HIMA 1YNSA 3AV0B 3OHSX 3ONFA 4IIJA 5BUZA 1TJYA 3HLYA 1O95C 4YRLA 5MFZA 4OCZA 4O4IB 3DBLA 1RBQA 3PIIA 3UAOA 3V2GA 2ZRMA 3QVWA 4Q7KA 3NP9A 1E2IA 3UMVA 4EMTA 5DB4A 3WLSA 5KOJA 2WA1A 3THSA 4DM7A 4YMHA 3PHBE 1Z38A 3RLIA 1N8TA 4IWYA 2FE4A 4R1SA 4A2PA 2XBLA 5H83A 3CYFA 2XZLA 2HHJA 1FS4A 1AKQA 1PGJA 2W6MA 3BFKA 4M54A 3TRKA 5P8WA 4CMJA 1NV9A 1SQFA 4LZOA 4RY2A 4ADLA 2FSFA 2GTIA 5DTJA 1MZVA 2EJCA 1XD9A 3S8EA 3CX4A 5JY1A 3O8CA 2IPXA 2VEOA 3CT6A 3BL8A 2BISA 3QUBA 3DBHB 3MRXA 1JRLA 1WMBA 4FFVA 4ENRA 1ZZGA 4EZBA 4OL9A 2NZUG 3WG9A 3KAJA 3O6VA 4IIFA 1VE3A 5EZYA 4P0QB 1GGKA 1EWVA 1QHXA 1MD9A 2MINA 3NCTA 4QQFA 2ZWIA 4IZ6A 4MVJE 4B4KA 1EHCA 3IEKA 3KYCA 4R7TA 1TM3E 2A4MA 5KNDD 4HGOA 3KQNA 3OQNA 1OD6A 1P7CA 3GA5A 3GJQA 4DQDA 4G0YA 4FYJA 2FOXA 1QBGA 2O3JA 1QHSA 2OCIA 4I5DA 1S4MA 2P5TB 2PSFA 4REMA 5CNIA 3QF7A 3T5GA 1E0AA 5HHTA 3FTFA 4GI5A 2QUZA 4C6TB 5FFNA 2HPZA 4PSUA 2QXTA 2VQ6A 3DNMA 4M6WA 1IN6A 3OPVA 2FH5B 3DFIA 4XM1A 3W5IA 3QVGA 5J4VA 2PUCA 4JJIA 5HBRA 3WWEA 3RODA 5DDIP 4US2R 4WGGA 1B2LA 1DB3A 4AROA 2FSGA 3GJ5A 1VG0B 4JC8A 4M46A 1MA3A 2ENWA 3BCHA 3OURA 4JZYA 5HF9A 3G0GA 4GLOA 3CVOA 1ITZA 5IBPA 1OH8A 5BN5A 2QE7D 1XRPA 4PPNA 3W8NA 4Y6GB 4J43A 4ZT5A 4DJFC 4ZAXA 3I1YA 2AN4A 2VDVE 1X8LA 4PN3A 4DRXB 3BN3A 1PG0A 1RJGA 2GFHA 2WOOA 1T2EA 4HUJA 5CVTA 1E7SA 2AC7A 4Y7CA 1XKXA 1GQOA 4E51A 3FPCA 2XR1A 3FYHA 4FIZA 3OMXA 2ZJ6A 4DWJA 1Y1QA 4AS3A 5A2GA 3ONWA 2JFGA 3L02A 2NX2A 5JATA 5L8VA 1IEVA 4UTVA 3FBWA 5HK9A 3WP0A 4PQYA 2PN1A 2X6QA 4YAFA 5DN6D 4QOGA 3LCUA 3IXLA 3OQ1A 1K6IA 1KI6B 1W9HA 1FLAA 4Q4JB 4YRKA 2UYGA 4LZAA 4X92A 2G09A 3JX9A 3UGTA 1Y34E 1SIUA 4C22A 3L8CA 2CD9A 5JU6A 1CQXA 3ML1A 4F4DA 5CJ2A 2FPKA 2NAPA 3SJCA 5CA1B 1RP1A 2QAGB 1YIOA 1EEHA 1MQ8B 3HCDA 4UAUA 4DDVA 3IDZA 2IX9A 1C1XA 3K15A 4U39A 4NDZA 5K0SA 4XFKA 1MIOB 3FKJA 3TXXA 1M6VA 3EWSA 3I2JA 3MWFA 4CUZA 1NZFA 3JARB 1V1JA 3D8BA 1G4HA 2YICA 3EBOA 1NVEA 5DJ5A 3IPCA 4Z4IA 3QF4A 1T4CB 4XJXA 2OWDA 4R1NA 5FOXA 3QSYA 1EIWA 2QL5A 3HLKA 2FZ4A 2MTBA 3NAGA 3WGGA 1D6NA 1JLLB 2HV9A 4JODA 3U17A 4DHWA 4F6RA 1IUPA 5JS8A 1QQ6A 4QATA 4R1LA 3VM6A 1JJFA 1O0SA 2A86A 4ZZ1A 5KQSA 1UBKS 2Y8EA 3E23A 3DT9A 4GXNA 3L0OA 3TLAA 5AXBA 1EB8A 1SHLA 4TTQA 5IZCA 3TTYA 3H4IA 1QLHA 1Z7WA 4ALMA 1PZNA 4EP1A 5GV7A 4G36A 4IG4A 2WWVD 1GNRA 5JQGA 3ZDYB 3I61A 3HUDA 1QHYA 1N0UA 2FMIA 2RB4A 1SZDA 4APAA 2LGJA 4GZLA 2Q3FA 4MGYR 4BZPA 4ZDJA 5F2NA 5KWVA 3NAZA 1CZKA 2JAWA 3I76A 5HF8A 1CY8A 3S0JA 1YQEA 1ZHFA 3O4GA 2CEAA 1G18A 4DRYA 1J23A 2HX1A 3AKCA 4IIYA 1WZCA 5JTTA 1YS9A 4HD8A 4C7JA 2XQJA 4ZOBA 5DMXA 3UBTA 2FEMA 1ZH0A 1RTTA 2FOLA 1A4RA 2SCUA 2I2AA 1KO8A 2X2OA 3R3SA 3R6WA 3VR5H 2VOEA 5LP6B 5D6NA 1H2AS 2DG2A 2QMYA 2Y93A 2I2WA 3PLRA 4AWAA 4BKQA 4E09A 2X8BA 3KV1A 3EPPA 1DBRA 1ZRHA 3DP7A 1SKMA 4DMRA 4MCJA 5KNCH 1LX6A 2AIRA 2I5PO 1KQ3A 3I6BA 4JT9A 2EFDB 4U8GA 2GWRA 1KQOA 4FP9A 2WAAA 1WKBA 2FUSA 3E2MA 3KQVA 4I4TF 2ONZA 2E4ZA 2VKTA 4PZEA 1XYVA 4RO0A 3ZLUA 4KQMA 5EESA 4E1VA 5A2QA 5AESA 1NR5A 1AHIA 2OCPA 1XL1A 1EINA 2AW5A 1RFLA 2OBMA 3MUOA 1HX7A 4D4JA 2QQGA 4RX1A 1XZNA 3HCBA 2VR1A 4A5SA 1EXDA 4U02A 1JAYA 3RGWS 1ZFNA 3WRWA 3RVQA 3WMFA 1HY3A 3HXMA 1U2SA 4X0EA 2JK0A 1SBCA 3W6NA 1D09A 3JY6A 3ZIUA 4ZDIA 5JISA 2XEXA 1LVGA 3OZEA 3OZAA 2RHRA 1L7DA 3G8YA 4Y1EA 1HNWB 1UIMA 4N1AA 3KZOA 2VT7A 1BJRE 2VDMB 2WFLB 3OOEA 4TKVA 4TL8A 4YQFA 5CDSA 5LKRA 1AH2A 3I9KA 3HXQA 3RFCA 3K0SA 2GBIA 1QFXA 1QYXA 4ZAZA 1N9KA 3SVTA 4JL8A 4EVQA 3V8EA 4M9SA 2EG9A 3QW2A 5FI3A 5K2OA 1I7NA 1EX9A 1W5EA 3RPEA 1MU0A 3DV9A 2WVJA 4G5RA 1U7DA 2Q9CA 1NTRA 5DCWA 4MIKA 4LYYA 2DQZA 1A7AA 1PVVA 2FVXA 1GRVA 5I5EA 3NYWA 1UXJA 2JGDA 3AP2A 4JJ4A 4XUCA 1GN8A 4A8JC 4G0WA 1B3BA 1KY3A 1MVOA 3GCXA 4MPPA 3K0FA 3MJEA 2AJBA 1ETHA 2V03A 1EFVB 1XWOA 4I55B 3VO8A 3KZKA 4D44A 5GZ6A 4C4ZA 2RJNA 2QSUA 3EGXA 4HSGA 5JO0A 1DO2A 1OLUA 3RSQA 5BRNA 3FPGA 2C7PA 2CJPA 1A0OA 3SQLA 2OYRA 1C9DB 1Z5GA 1RKQA 3FVVA 3WWPA 4EHAA 3DBRA 5DOVA 1ZMRA 5J40A 2Y6VA 2K7ZA 1DXQA 4QDKA 2DR2A 3HU5A 1JR6A 3WQBA 3ZVNA 4YRQA 3KG2A 3ETHA 1NVVQ 4KAJA 4TLDA 2IGBA 1O9GA 2YMMA 5EJEA 3SVZA 1AQJA 2QTMA 3MTIA 2O8VA 2QZZA 3AF4A 3BGDA 5EHNA 3TSOA 5K0FA 4MMZB 3G2LA 3AIMA 4M2LA 1B26A 1K5HA 1T0JB 4YT4A 4LN1A 1IAVA 4LF4B 4CIDA 5B3LA 2F9LA 2J87A 4LYDA 4RSRA 3L8DA 3R9KA 2DXIA 2J0UA 1KH1A 2PXXA 4IAOA 2CCGA 4QO7A 1Q0TA 4MUGA 3FROA 4XYGA 1R64A 2B99A 2Z3VA 3DPUA 4GBMA 2WSBA 4AQDA 1E5QA 2VK4A 1MRZA 2WZQA 4CODB 4E2FA 1Z6ZA 3AGPA 3JQAD 3LUCA 2G1JA 4ZVKA 5KMGA 4JQCA 3ZDFA 3SQNA 3VKGA 1FQJA 1TA0A 4F46A 4EL5A 2G5PA 3WFJA 1Y9DA 2YC2C 1YI8A 3FGPA 4QL3A 1DKMA 3R7BA 3GJ3A 2WKSA 1RYNA 2X2PA 2E7ZA 1E3WB 4ZQHA 2HV8A 4GRAA 5LZ7A 1P2UA 2WM9B 4D9MA 1IB0A 3HGQA 4MUMA 2ET6A 2ZSJA 3KBOA 4X7PA 4HXEB 3IEIA 1A2QA 5K4HA 3LYAA 2PSDA 4Y6SA 1SBQA 2NWQA 2ZSIA 2RH5A 3K0EA 3GROA 2VYVD 2WB2A 4UHJA 2KLBA 4IH1A 4KAAA 1W0JD 3U6BA 1QPZA 5KYNA 2OV3A 3DLAA 5FO1A 4ON9A 2R96A 3LA8A 1CW2B 3NOXA 1BGXT 1XDDA 5FQNA 1L5QA 3IHLA 3UMGA 2XXAA 2QJFA 1PTKA 3ZGZA 3MW8A 1U80A 2VHYA 3Q12A 5FWDA 5LQRA 5FBHA 2G9ZA 2V1XA 2OV6A 3HG7A 2FSVC 2VNKA 4K03A 4MW6A 5FTJA 5B53A 4D97A 5L45A 5K0CA 4DV4B 2PMEA 2B4RO 4GOMD 5J1TB 1H8EA 1QG4A 2CBXA 2ZYDA 3HXLA 1B93A 2DECA 1RHMA 4BNJA 1V39A 3H2IA 3EG9A 3Q1LA 1SBTA 2F48A 3P20A 4LYGA 5CEJA 2GCOA 4H59A 1NNUA 5DLQC 3NTLA 2GJAA 1PK9A 1THZA 2ASEA 4CN9A 3ANSA 4Y2UA 5JFOA 3NWOA 3MS7A 1UMCB 2A9RA 4A92A 4DLWA 1OKKD 4RLQA 1J56A 3QLJA 1U94A 3HR7A 2QVBA 3U80A 1IQPA 1TIKA 2B7LA 2DSNA 2ID7A 3QLVA 2XMGA 3VR4A 1G8PA 4U6QA 5THKA 1C0PA 2M2IA 3D5TA 3N7TA 4P58A 5D7NA 4QDUA 4A73A 1YBAA 3ROZA 1PGQA 3PDHA 2HRQA 3PKZA 3V46A 1QQBA 1L4FA 3QKSA 3UUGA 4NJMB 4JXKA 4W5JA 4JV5B 1E3EA 1PG5A 1FP1D 1PO7A 3QJ5A 3ZXIA 5B2FA 2Q3HA 2AOTA 4QUKA 2B8TA 1L3CA 4WDRA 1N6LA 2ZJ8A 5B2ZA 1W4LA 4R1UA 5SY6A 2B30A 2QZSA 1JXAA 1SB8A 3P94A 3ZE0B 3ADCA 3PKJA 3U9SA 4MULA 4UATA 2C9BA 1BXKA 1A1VA 5AH0A 3AHCA 3KB8A 4Q3CA 4OAPA 2ORIA 1U6JA 3BJIC 1NZJA 2PD4A 4XUGB 4Z3DA 1HE4A 2HY7A 5EP3A 3RSOA 5EMNA 5JVDA 3TBFA 2XB2A 3TOSA 4E5MA 3CGWA 4PC3A 4JDUA 6GPBA 3AR8A 3MUFA 1SUPA 3UJPA 4C7XA 4EKEA 3Q3GE 4DMHA 3GEHA 1X39A 3LVRE 3TK1A 4DLUA 3UG7A 1P2GA 4MVJA 3EJWA 4R5HA 1G7TA 4EG3A 3BERA 1BDBA 1Z4LA 2IYEA 4GEGA 2XNHA 1Z7BA 4QPCA 5AK5A 2BGGA 2DWPA 1SU7A 5DNCA 3NNDA 1VG1A 3GCZA 1J5PA 1JDBC 4Q7MB 1Q77A 4RF5A 1EUQA 4KTTE 1Q21A 2WWFA 1R4NB 3ECSA 5HQTA 2RC6A 1E3IA 2CFOA 1QYDA 3IBTA 3PT9A 4BTVA 2BI8A 3DOIA 4FEGA 2WHEA 3DFFA 4R2LA 3TRJA 1EHIA 521PA 1XZEA 4MR7B 1QYRA 1EVLA 3JALA 1DBPA 3LM8A 1WUIS 3ZI4A 2EFGA 2GHQA 3PYLA 2FSSA 3D5QA 3A1VA 3INGA 1N78A 4MW1A 5BRJA 5LIPA 1R9NA 3TSCA 1AQ6A 1SHTX 1RXYA 2GHTA 5FHQA 1ZVVA 1LSUA 4PGMA 4XCXA 2OBYA 3LF2A 4ZODA 1T8WA 1KZ4A 3U49A 1D03A 4ZGWA 2HA2A 1TKBA 4RORA 1E1KA 2V7VA 3LQ1A 1KR5A 1QCYA 4KE9A 2H1CA 3VBCA 2XB4A 3H9BA 3NTVA 5EE9A 5KOHB 3QOYA 3WKEA 1L5ZA 4HPXB 1Y3BE 3AI2A 2YMPA 2GD2A 3CEAA 3T3GA 2FW0A 3AVTA 3KIPA 1MEOA 3NYRA 4F9TA 2E85A 2ZRPA 4FSHA 3N59A 1JEQB 2P40A 1JTVA 2J3EA 4HK4A 5DU2A 5E9WA 5ER6A 4KK3A 5CVJA 2PX5A 2XH8A 4IWXA 4DLPA 1FUIA 2AHRA 1PFWA 1C0LA 3EC1A 2OCLA 3CWCA 3NHRA 4MV0A 4PLTA 2BMFA 5TF4A 1DOFA 2ZUCA 1XZAA 3I42A 5CDFE 4KH0A 3KDSE 4ZZ2A 2PL3A 2VPZA 4QUBA 1RFGE 2FMHA 2A5YB 4JVMA 3I34X 4EHFA 4GKVA 3P5SA 2XCTB 5AW5A 3IIKA 4YREA 2W6CX 2ZATA 3FRIA 3PYMA 4L8FA 4RTJA 4FW8A 1HDRA 5C3MA 2RGAA 3EW7A 4R16A 1E7MA 1E92A 3QFSA 2QTLA 5CLLA 3UATA 1F2UA 2O1XA 3FX2A 5EKDA 3GD5A 1IJBA 1XV5A 3SM3A 4I4CA 3Q6NA 3WK7A 3JZMA 3PWZA 4O4HB 4UOQA 2V5AA 3JATA 5BO5A 1XHEA 2X8JA 1NN3A 1Y6GA 5FCDA 1U3DA 4AJ2A 4AS1A 5H5JA 2R1UA 4JBNA 3ZJ5A 5K01A 3WB0A 2F3TA 2IPNA 4FMPA 3HKEB 4Q4HA 2E2WA 4IMPA 4NMLA 3HWRA 3HDYA 1V7ZA 2OYCA 5EJMA 1NJ2A 1BS9A 1UBRS 2B2NA 2BR4A 2GO7A 3L7JA 2IYVA 2WNIA 1BGWA 3CM0A 5SYNA 4EJ6A 5ILQA 3ZV4A 5HKBA 3OQBA 4CV0A 2ZXUA 2PD3A 4ALIA 2XMDA 3AOEA 2ORVA 4BU1A 5IZ4A 5TT0A 1EFTA 5D3MB 1NU8A 4CMBA 1P19A 3PFCA 4J4BA 1W2HA 4CGZA 4XWOA 3HJTA 1K75A 2R8PA 1ZH2A 2O20A 2VWHA 1JHVA 3OPMA 4MRSA 3RH0A 2XY4A 3SFZA 3RS2A 4BMPB 5EKSA 2RONA 4XWWA 4A23A 4P4LA 3EE6A 1MIHA 4MV1A 1NRJB 4O2AA 1TYCA 1Z6XA 2V96A 1K5DA 2PFGA 5LDGA 2WK1A 4JWKA 1MO3A 4J3FA 3H6GA 4LMAA 4NOMA 1D4FA 5CGQB 3SC3A 5FV4A 1UJ2A 4XPIB 4YJ3B 2GPAA 1TVKB 4KCGA 2H2AA 3RIYA 2Q45A 1RWNA 3TLYA 3H8VA 1YFEA 3O90A 1ISFA 3HV2A 2PXHA 5CG1A 4FLEA 3O9ZA 4CLOB 4UTPA 5B36A 5ELMA 3GK3A 1ONPA 4K9DA 1EVYA 4AJ4A 3KOWA 1T0BA 2RH4A 4A6EA 4E31A 3I2YX 4M83A 4MVWA 1LPSA 1M73E 1XMOB 1AU9A 1UBHS 1G5HA 2QQ5A 1W6RA 2J45A 3UV3A 1JB9A 1O58A 2Q4DA 8ADHA 2ISQA 4B6SA 3IAEA 1T10A 2B4KA 4PAQA 4Q03A 4RHCA 5DHQA 1JHXA 1QHHA 1XQ9A 3P9QA 1ULZA 1XL0A 2G8NA 2AL7A 1KL7A 3U7IA 3PL5A 3W2GA 1V4BA 3JV7A 2ZRKA 5DEOA 5GOZA 4XQ9A 3FVTA 1NFRA 4JLSA 3GAZA 4NAUA 2EZTA 3P0EA 4U7PB 3W5BA 1CRWG 3TEFA 2ZPAA 5K0LA 3G9QA 2KS6A 4B71A 2R1TB 3BBLA 3D6NB 1YCFA 2G82A 3OIYA 5DEIA 3I23A 4ZDWA 1IEWA 2QENA 3R3YA 3GLHA 4X1OA 1LS1A 4RABA 2COUA 2FOIA 2P62A 4DWVA 3I9LA 4B85A 4P5DA 3BX1A 2UXDB 1U1IA 3TQOA 3H5OA 1E6LA 5I7VA 3L46A 1NC1A 1Y48E 1WXFA 2YH2A 4HVCA 3NTOA 3CT4A 4BTEA 2VJDA 4IOJA 4LJ9A 4KDRA 2IH2A 1SURA 2POQX 1HC7A 2QYTA 1LWOA 1LNQA 2HMTA 4UM9D 4K3UA 3CNEA 2XIQA 3WZMA 1NRIA 3C8MA 3STTA 3IVGA 1H66A 2I1LA 2OOSA 2ODEA 1H23A 3KAQA 2C57A 2ZRBA 4GVLA 4H3HB 1S9HA 4KVGA 4S1TA 4WBXC 4F11A 3N86A 3PX7A 1G6KA 3UMYA 5B37A 3HVKA 2J08A 2ZBVA 3MS4A 4NRDA 3UMMA 2J3KA 1L2TA 4RTQA 2XB6A 4G67A 3CNHA 3EMBA 3B20A 4DR7B 1EE1A 2ZPTX 2QUKA 5AUQA 4HZUB 3QTTA 4JLJA 4WY2A 2BBSA 4R8RA 4GNKA 1ZR4A 2QM3A 4Q3EA 4MGZR 4FZ3A 2V3WA 5EN4A 1Z6GA 5BVHB 5CG2A 5JAPA 4WHMA 3DMYA 1N3YA 3HE3A 3WGOA 2AR7A 5A5GA 1YVEI 3G0IA 2W2KA 2ZRFA 1RWQA 3SY8A 3UAXA 1P2SA 1KE2A 3M5DA 4KQKA 4QZVA 2M98A 3DVSX 4WL0A 5AKZA 1FP2A 3A2LA 2MYUA 3VTZA 5H70A 3DWIA 4M7PA 3KQUA 1E1QA 2J6CA 3FAKA 4GX5A 1K1EA 4WOJA 5F7ZA 4Z51A 4ZYWA 1L5WA 5CMLA 3DEAA 4AJIA 2CFIA 2JH9A 2WIGA 3B3GA 3WMXA 1MJGM 4F06A 2AE2A 2QUHA 2WHRA 5EXSA 3GRFA 1YQGA 4L7VA 2ZETA 5EWLA 4DXAA 4Q9LA 4LDZA 1QIGA 4KFTA 5F78A 4IUYA 4WH0A 2GRUA 1THMA 1L6IA 2F8SA 5L3RA 4PLWA 3ELYA 3HM9A 4ZZIA 2OSVA 5BWMA 2TYSB 1U04A 2IXDA 3FYUB 4OI4A 1LU9A 2AYZA 4UHDA 3IIIA 1W34A 4YAUA 5L7YA 3HJUA 2ACVA 4IVRA 3DWGA 4MQ4A 4NKRA 1PEDA 5TQ2B 1H4TA 5EE3A 4XLZA 1L5MA 3V4PB 3A26A 4LGMA 3GLIB 1XAJA 5KUTA 3R76A 1XQYA 4LFCB 4COKA 5DXFA 4W5NA 4QGGA 2LKCA 4Y2JA 3H0CA 3RRJA 3S4YA 4L95C 2YBDA 4L8GA 1D4AA 2SKEA 3JYQA 4QSHA 1JDVA 2QRHA 2XDAA 4AJNA 3LCRA 2E5FA 4PRLA 4RTOA 2EGUA 4YUAA 3AP1A 3E7WA 3ICOA 2BDUA 1UMDB 1O5TA 2J0VA 2O3UA 3MWEB 1LB1B 1GCIA 3F4KA 4R8KA 4OO3A 1ZC3A 2RI0A 1L7BA 3D2BA 5ALEA 3E3AA 1G5IA 2F3QA 1G0NA 2X8WA 3GGGA 3L49A 4CU5A 4CDRA 2PQ6A 3GAAA 4ER7A 1VL6A 1Z4IA 5EP2A 4YWHA 4DBVO 4NARA 4RMIA 3S70A 1P9LA 3IC5A 2XQFA 5FBQB 2OQ2A 4I50F 4MQEB 5J3JA 4RF2A 1M7HA 4OIFA 1BWPA 1JHPA 3OPXA 1YRBA 3U4CA 4D4KA 3ND8A 5H02A 1FYFA 1Z5UA 2K6GA 4TL7A 1EBBA 2IHUA 2NPIA 3ACCA 1XA4A 3HDTA 3ZHVA 5HR5A 2QG9A 5IXJA 1C3UA 2BH9A 5JEDA 1P18A 1Z34A 3G5AA 3I04M 1OTYA 3TL2A 2AEFA 2IYXA 5F7JA 5B1SA 5KQLA 1PCXA 1E60A 2D1SA 2ZI7A 3QHAA 3YASA 4NFYA 4Q66C 1QRAA 3LX5A 4JJKA 3ENKA 5FOQA 2I34A 4J29A 1DRUA 2O48X 3OPYA 1WE2A 5E3JA 2IXTA 3VMFA 1KKMA 1WEKA 3QPAA 4F9EA 4NBUA 1DSSG 1R3UA 4O3FA 3OBBA 2CLMB 4XB1A 4M1WA 2WWWA 2WYVA 2X22A 4QLOA 5JD3A 3VDQA 2DJIA 1OC4A 5EE0A 3NDPA 1U2GA 3RU3A 1VHWA 4B2IA 5JZSA 4OVKA 1NWHA 1C9EA 2I7TA 4LVUA 4EITA 3I8OA 3WSWA 4DG5A 4PO1A 3TIIA 1NUHA 1V1MB 4I9HA 4Q1AA 5EWJA 2QMOA 4OLFA 5BQ5A 3P27A 3GARA 1F17A 1W94A 2B8WA 1C8LA 1NVGA 2H5EA 2HREA 2JFVA 2Y2UA 1PI3A 1P4HA 2J3DA 2VP4A 2YYZA 1OY1A 4NECA 4CETA 5HKOA 4GHWA 4ZOLA 5HOEA 1EJ2A 4OHMA 1NNI1 2Z08A 3E9CA 4HRXA 2R1VA 1VL2A 3N3BC 2IODA 1SCUB 3BH7A 2Z30A 3GFOA 5ALPA 2B9VA 3FMVA 4FGJA 3I62A 1JG7A 2VTVA 4EJ2A 3Q8LA 2BLNA 4INJA 4RV4A 3NPMA 1DAEA 2WZBA 2HXGA 1FMLA 3OZWA 4L27A 3NHPA 1C3OB 1YDHA 4II3A 1M1NA 1LSSA 3BD9A 4PLHA 1PYDA 2PX6A 4GMFA 2NTEA 1ZGAA 3PIDA 1PZMA 1M5UA 1RYFA 4Q7QA 1VBFA 1EFCA 4Z49A 2EBHX 2B0JA 4KQ1A 4MS3B 5FYDA 1ELOA 3QBVA 4Z1MA 1EK1A 5IS2A 2DF8A 3SZMA 2LE0A 1QK3A 1AHHA 1P3Y1 1AUWA 4W1QA 4RZ3A 5J2UB 1FUPA 1KGSA 1TZMA 5ENVA 4D6XA 2NU9B 3QFTA 1PDOA 2M6KA 1GFSA 1A9RA 1JUDA 1U7OA 3HUTA 2PXAA 1W4ZA 2G76A 3VR5A 4LWPA 4BLRA 1AK9A 2MU1A 4PG5A 2GPJA 1CV2A 1UFRA 3OM8A 2C98A 3KO8A 2WP0A 4QJIA 5C7YA 2IEIA 1NQAO 4YT5A 5KNCA 4GXQA 1H2HA 3BG5A 3H1TA 1LTQA 4OB6A 2ZSHA 1MB3A 3WQQA 4DL9A 1DVRA 3TLJA 4PV7A 5LLTA 4EMUA 4HNVA 1G66A 4YRTA 1O0CA 5LQUA 2I0FA 2R6CA 3N2IA 4AG6A 2FZWA 1YB7A 1NRXA 1DPGA 2G04A 5KYUA 4KQ2A 3SBOA 1POXA 2EERA 1E69A 4V0RA 3LQ4A 2JHAA 2GJKA 3CR8A 1U8YA 4LX8A 1H69A 1X8KA 2FMUA 2JIMA 2QUBA 5FWXA 5LJIA 3RC8A 1C30B 1J9GA 2H48A 3SZGA 1QZXA 5TPWA 3HR4A 4GGOA 1ENOA 4TT3D 1T8SA 2DH6A 4YECA 4C4TA 3CUKA 2WKRA 5TC4A 3JAWA 1EEXB 4PC2A 5EXXA 5FTNA 1W35A 5JWHA 2GM3A 1BJKA 1GPMA 3PE4A 4J0HA 5DWVA 1Z16A 3SHTA 1MFZA 1SEVA 4BGDA 5ITZB 4BMVA 1W36B 4BVEA 5HOQA 5C5EA 3PJDA 2GDJA 4ZEMA 1QM5A 2Y1EA 3QQ5A 1ORVA 2C4UA 3HY6A 5DBHX 3SK0A 4EO4A 1YB6A 1PZXA 4UNNA 3KLBA 2Z1NA 5DT2A 1RBZA 4KLCA 1XUOA 1O5OA 4GDFA 3CX3A 4WTOA 4AMYA 3PIRA 1Y6ZA 3HJBA 2ZRCA 3ZNPA 4L3OA 4AZ3B 3D2AA 3F5MA 4MYTA 2GQ0A 2WRZA 1U1GA 1KSGA 2C2YA 2V1UA 4H7DA 3PXAA 3H04A 4PZPA 4KQWA 3O74A 4Y2GA 3SKYA 3V1TC 2O6LA 5L3QB 1QDLB 4NDNE 5EIAA 2YV3A 2I1QA 3B1KA 5B7NA 1KP3A 2C8LA 5I47A 3KVYA 5IASA 5CEEA 1HKUA 3CF0A 3IT3A 3NPAA 4HLDA 2DPXA 1SUSA 2LR0A 4UPVA 4ND3A 1T5OA 2CB0A 3KSUA 4FGUA 3G1TA 1TO6A 4Z9BA 3AW8A 2QR3A 1WD5A 2X7XA 2Y2VA 1GGNA 1P5FA 4OGFA 1QQ5A 2HGZA 4IIUA 1ECPA 3R5XA 3UXHA 1EVQA 2WVAA 1FUQA 3PLAE 4JJ8A 3P2MA 4M99A 2PS1A 3H7AA 3AM3A 2Q2WA 4CKYA 1CQWA 1DKNA 1FTGA 5AW8A 1QZUA 4C88A 4NPHA 3URMA 5B4VA 5ALXA 1ONNA 6ABPA 4X8OA 1FP4B 1C8VB 2ABWA 2C42A 2WJJA 1KGDA 3HXKA 4TTSA 2VBGA 3QFHA 5CT6A 5ALHA 1GJRA 1TQHA 2ORWA 1X7XA 2BGLA 2W58A 4HDSB 2PRKA 2XTZA 3T54A 3ZHZA 1JHRA 2HSZA 5BORA 4L50A 1A4UA 4MW0A 3NEJA 4B34A 3C8TA 5BW5A 3EASA 1TMGE 3S29A 5KJFA 2NOAA 1K62A 1EP9A 2OFPA 3ZLBA 4O2BA 1TM2A 4OOFA 1KDTA 3EISA 2BKXA 4DIOA 1EA5A 2WKWA 1FFXA 4JOCA 5FOTA 3DMGA 4FWBA 5AFSA 3IR7A 2GYYA 2JHPA 2O3SA 3ZLTA 2RD2A 1CZLA 1PT6A 3OP4A 4GIBA 5HMLA 2YIDA 4KIGA 1VIDA 2AEEA 4M7OA 3K9LA 4TKMA 4A26A 2ZRQA 3C5CA 4DYVA 1NHWA 1NLUA 1V2HE 5AUPB 3A1SA 3AZPA 2Z6QA 2QY6A 1GR1A 1ESEA 1DTEA 2E4UA 4V0OA 5DASA 4LCBA 5INTA 4OJTA 4MDFA 1TMYA 2C54A 2FLVA 1A5ZA 2WM2A 3NYQA 1XF1A 4MRRA 2GEBA 2PZGA 1W44A 1S3FA 5AK3A 6REQB 4TQGA 1QNFA 2PTSA 3SD7A 1ZJWA 1V26A 4QQRA 3E7FA 1RQPA 3LLMA 2OGUA 3JQEA 2CXRA 1HK7A 2XIJA 2Y0CA 5LP6C 3WWDA 1MABA 3FAZA 3JQ6A 4EHKA 1I32A 3D3EA 1FYDA 2XRMA 3Q9SA 4IFIA 2WUWE 1JP7A 2I6FA 1FU8A 1VDZA 2FK7A 3JQRA 5EWMB 4ER0A 4WZAA 5ALOA 1W87A 4DLSA 1TM7E 3WMEA 1TUGA 2Y67A 1E79A 2C2BA 4RQUA 1NW9B 3U81A 2EKBA 5A6VA 4CEHB 1FA9A 2AZDA 2C78A 3W9SA 1QAQA 4DR2B 4QBHA 2Q6VA 1CT9A 1DJPA 2FYTA 1E77A 2IW1A 2B94A 2GO1A 3D3NA 3U4GA 3SIXA 5DLPA 2G88A 3VZSA 1G2IA 1U9IA 5I9NA 1ZUD1 1BO6A 3BKXA 5LBTA 4X7MA 3A1CA 2R4QA 3W2TA 1E2UA 3HB0A 1M74A 3P0IA 3Q7TA 2AMYA 2AQIA 4B80A 3DO6A 4C6RA 5ER9A 4KJXA 3CPJB 1K9VF 4LOIA 3TLZA 4EI2A 3SZOA 3JQPA 4WLNA 3JZIA 4NBKA 2VG8A 4LTDA 4IJ6A 4ZTUB 1BTOA 4IL5A 1J0DA 4ROTA 4B7ZA 4FOTA 5CTJA 4W9MC 2O8CB 3RU7A 2J46A 2OO5A 3GDGA 2WYWA 4B7AA 4PX3A 3EQ9A 4Y9TA 5IAJA 3L0SA 2E18A 5SZIA 1CQIA 2YZ7A 2DBYA 2P2ZA 4ZVUA 3UUWA 1V3TA 4TKLA 4C7OB 1PT7A 4LF8B 1FFSA 4EW1A 2VNSA 4UHCA 1YR2A 2ZBRA 2PYDA 4Y9UA 5K3AA 1HNZB 5KWEA 4GPAA 5FFMA 3WGKA 4JEIA 4N6NA 1FL9A 2I4OA 2QJOA 3O0TA 4KB5A 3EIFA 1OH6A 5KDOA 3QKRB 5C5IA 3HYTA 1YS1X 1EUCB 2OXRA 2Q1TA 1QZ3A 4G5SA 3EY9A 3MEQA 1L1FA 3SBEA 4BX0A 4P2BA 5JCOA 3IEVA 4FFBB 4YQYA 1IDN1 3PWSA 3F0TA 4C3UA 3KXLA 4C06A 4MZXA 3WLNA 4YK7A 2EKQA 3EBPA 3I39X 3JVEA 4E0BA 2VP2A 2PSSA 5KS2A 2FF7A 1EIZA 3A4NA 1IWBB 2WU8A 3R1IA 2C03A 3QMWA 1GL9B 2IP2A 1RJ9B 3T0GA 3KZNA 4EO9A 2ZIGA 1NI4A 2IW3A 4HYYA 4ZC8A 2ZE7A 4BVAA 4ZZ3A 5BSFA 1W5TA 5JJCA 5JNUA 5LDDC 3RTAA 4LF6B 3BK7A 1X14A 3SX0A 3ZY2A 2FETA 3IP6A 4NV1A 4ZK6A 4G0UA 1U0GA 3UMSA 2RGCA 3BCSA 3C5EA 3WNDA 4C21A 3RIMA 2M6LA 5DN6A 2BGIA 2QMEA 1VKZA 3BREA 1L5RA 3AEQA 4XW2A 2VC2B 2ZIEA 3QU2A 2ODNA 1WPXA 2A5FA 4TYQA 1CUIA 2HBZA 1YULA 2MYNA 3DULA 2JI7A 1GGEA 3IMEA 3MBOA 4PQRA 3DAYA 4DLLA 1ZN7A 3C70A 3M5WA 3T5PA 4LDNA 2OT3B 3UEOA 4PANA 3BMOB 3ETGA 4BYGA 4JR2A 3RU2A 3TQSA 4AZWA 1QPGA 2Z0MA 3CSDA 3B8EA 3JASB 1N6PA 2E87A 1GA4A 2FGKA 5DBIA 5ADWA 4Y2SA 3QSGA 2QROA 4J1TC 5EKXA 5CM2Z 3CG0A 1ECLA 3WLLA 2WPDA 5CLFA 2YZ2A 4HAUA 5L4NA 4L3WA 1A1SA 1I3NA 4JSTA 2CK3D 2UU9B 4YNBA 5F98A 2OZLA 4CTOA 3P52A 2N46A 4WPGA 5IKXA 2H17A 2X4IA 1JAHA 4Z4QA 1T9GR 5M29A 1AE1A 4YASA 1SZCA 2PANA 3A05A 4PLZA 3DV0A 3CRNA 3E5HA 4JVOA 5KVAA 1U1CA 1P62B 3PU6A 3MJHA 4GXTA 1TQDA 2J6BA 3BIOA 4FOOA 1NPYA 3MELA 2ONYA 1KYWA 3RTDA 1WBBA 2HJ9A 1LV7A 4Z6KA 1ZI9A 1SC6A 2E4XA 1IXRC 1GRNA 2VSNA 1MVNA 2EYUA 3M6LA 4H77A 1XEWY 3C5VA 2VAPA 2NQ8A 3GLUA 4XM2A 3CLTD 5AOVA 3ESBA 5KQMA 5B1HA 3N2KB 3ELWA 3RYFB 4CCAA 2HYIC 1W88B 3NALA 3MTDA 1N2BA 1T4DA 1OX6A 2O19A 4KR0A 2QTBA 3TEJA 2R6AA 1F9EA 1H0KA 2Q2VA 1QR6A 1CJBA 1UXKA 1RQXA 1QQ7A 2I6UA 1QFMA 3RC9A 4AP5A 1OIVA 3LP6A 4XX0A 4ZIRA 1ZCFA 1WHTB 2P2GA 1J25A 2VHCA 1QKKA 4TN1A 4OIMA 1HZZA 4Q16A 1LQ2A 2X2EA 4RZ2A 2QP3A 3PD7A 3ZI7A 1FVFA 2XE6A 4UBIA 4X8HA 3UC9A 4GD3Q 2X41A 3ESXA 4KMOA 3TQFA 1ADJA 3SC4A 3ZWOA 1ECGA 5C9ZA 2ZCJA 3CLRD 4N7MA 2GEKA 2ZYWX 3W3AH 1A5AB 4V0ME 2HU7A 3ILSA 4M1MA 2VN8A 4FYXA 3GWGA 1LDYA 2Q8NA 4GE0A 3AERA 3KOXA 5EHIA 5CCEA 1JF8A 4HDKB 1Z7YA 2GBGA 1X1DA 2WSSD 3OHPA 3MB8A 2AI2A 4TLEA 2B0CA 1ZSNA 3ISTA 3HB7A 5BOSA 3AVPA 3JQ7A 1KHHA 2QM8A 4DR6B 3PUVA 1F8XA 1I3MA 3UYKA 3VKUA 1L7XA 1QRUA 4PFSA 2GAJA 2WSIA 1CDZA 4GI2A 4W5HA 1W73A 3GB9A 3UV7A 5DI3B 4YV7A 1TE2A 3LYUA 2CC2A 4BRUA 1KWKA 3HCCA 3Q8XB 3IPLA 3WP1B 4A8PA 5JCJA 4K8OA 5GY7A 2VYFA 1SOVA 2X7HA 2XYHA 2QAIA 3EG5A 4UHBA 4OXIA 4E5NA 2WMDA 4EX7A 2JRCA 3QENA 4C20A 1Z6QA 4OHCA 5AKLA 5JJKA 1AV7A 3LU1A 5BMVA 1OLXB 2A9JA 4II2A 5FI1B 3VH2A 4BJHB 3MFQA 4CV1A 1YU9A 1TZBA 1A2KC 2JFNA 4FYYA 2RIRA 3F4TA 4PIPA 3IELA 4XDGA 2BFDA 4X1IB 5FADA 2ANBA 3WTBA 2FJUA 1OWOA 3LPNA 1PZHA 3IPXA 1E1RD 4AY3A 1WLSA 4BQRA 1N1GA 2XCQA 4BO4A 3UK0A 1E8NA 5IJAA 4NR0A 1Q3HA 2HIGA 1FUYB 4BO9A 3GFPA 2B8JA 2CNNA 3T34A 2Z2IA 4URHA 1TJPB 4G5XA 1J4AA 3NG1A 2UUOA 2VPXA 3X2FA 2NTJA 5IVIA 4WA8A 4BNNA 4ZVQA 1PYOA 3R7LA 4J4TA 3D2LA 3BD7A 5EINA 3SHQA 4ZFNA 5AWFC 3KT6A 1G6HA 1MQSA 3F3SA 3QVMA 4B7CA 4BB6A 4JC0A 1ODCA 3N7UA 4MV3A 3ZIAD 5ABPA 4POOA 2O8EB 4A0SA 3NETA 4U7FA 5F5XA 4YX9A 2F1OA 3THWA 3AEYA 3FHOA 3W6PA 1X80B 4D74A 3VR2D 4RA6B 1W8DA 4BPRA 2GEDA 2QUAA 1I2AA 5KYXB 4KSBA 3ORYA 2FP4B 1KMIY 1OI4A 4QHYA 2Z5FA 3B1VA 3A3YA 4NQZA 1Z08A 3R09A 1SKAA 3PI7A 4TXLA 2R00A 2ZE8A 1HR0B 1NXOA 3ED1A 4KXYA 1P9WA 2C0CA 3EEBA 4C0HA 1CR0A 1X7HA 3ZBUA 2WMNB 3R6QA 3S2EA 5HVNA 2NO6A 4IUBS 1YJQA 5HRCA 3ZK9A 4MI6A 5BMOA 4OM7A 4DC1A 3DKRA 3GL9A 5LB2A 1AA6A 2VPTA 1JG1A 2WJ3A 3I6ZA 4PC1A 1MA0A 2RJOA 5C1DA 1RWXA 2PTGA 2WZCA 4BEJA 2ISSD 4P4NA 2JBAB 1J20A 4HTFA 1SNYA 3R6GA 4DG8A 5ECDA 2AJDA 2D5LA 4PYOA 3B5JA 1T6YA 5G0UA 3U3RA 5DNWA 4EX6A 4X60A 1LPOA 4LOLA 5G3YA 3W79A 2WJHA 2WPNA 5HP4A 5HUJA 4R01A 4DMLA 3TOXA 2C5FA 3VPGA 2VDQB 4S05A 1ZMBA 4NSNA 1QVVA 1E7QA 3H8SA 1ZW6A 1DAFA 2OMKA 3ZWWA 2F9MA 4G8DA 4UUMA 1ADYA 2W6ID 3EVFA 3W2EA 5CT5A 3KL4A 1ZIXA 4XE5A 4NV3A 1W5BA 3G0DA 1ADGA 1Z56C 3G2KA 3FE2A 1PJ4A 1GITA 5KPDA 2VF4X 1VBNA 1VMAA 4CKBA 5IEJA 1W0JA 3Q15C 5E7QA 3D4IA 2BE9A 4HZIA 4G1UC 4CW7A 4IOKA 4OXYA 3WAKA 3D0QA 4HATA 2NUAB 3PCRB 3K32A 3ZS8A 4JUFA 2H1SA 2OXCA 4L07A 2Q62A 2N9UA 3PQ6A 1JN0A 1ZGJA 1NP7A 3IUPA 4J1NA 1RPTA 1RVV1 3VNUA 3FCXA 3QOWA 1AD2A 5EYPB 1FEZA 3STVA 1Z73A 4U7DA 1YDWA 1ZOOA 1V43A 5AVXA 6ADHA 1MX1A 1YKGA 1RLOA 1ARZA 2J6HA 3IA2A 3GNTA 1AX9A 1ZWLA 4NE7A 1AUOA 4R84A 4XIIA 5CCXA 2GYUA 4HAYA 3D3WA 1PJZA 4BX8A 4FZRA 3EUAA 4DUZB 1OKKA 1G8GA 3GH1A 1F5SA 2ZQ5A 2H29A 4CNQA 1GZSA 1P1BA 1UDRA 2CJYA 1KK2A 5LYYA 4RVNA 4ZEOA 3LNCA 3OHMA 3D5EA 3REOA 1SUEA 4UJ3A 1OFVA 1C1DB 3F7TA 4JGBA 1XRQA 2V6MA 2ZULA 2A1UA 2KYRA 3SYNA 5CFQA 4JLVA 3H87A 4MQ6A 1Z0JA 5ESWA 1CUHA 4G9EA 3WYDA 3G5TA 5JCZA 1MW9X 1QNLA 2VH2A 1BHO1 3AESB 3WFIA 3TZ6A 3C5WP 2VK2A 1C9JA 3I1JA 4JBWA 2O2IA 3Q3CA 1QTQA 3I5MA 1MJFA 2IE8A 2ODQA 3KELA 3IP3A 3PNBA 1SZPA 4JLBA 1FRNA 1ZXLA 8AT1A 5K8UA 1E1CB 1YRLA 5I4BA 1CJKC 4CKEB 3SNHA 1T35A 2AD5A 2P2DA 3BDVA 1FX0B 3EDOA 2G80A 4J1SA 2FEWB 3DD5A 2CHQA 3SLGA 3ZYZA 4KV7A 5IMSA 3TG8A 4Y2YA 1XZPA 4UDXX 2CE7A 1G19A 4U7WA 4Y1RA 4A0RA 2ICAA 1EQ2A 3KQOA 3PXXA 4US1R 3ZQ6A 3ZW9A 1PJ3A 3HP7A 4J2OA 4ZP1A 1KEUA 3O3MB 3LPMA 5JECA 3EVGA 4JR1A 1WCIA 1JLSA 4B47A 1QYVA 3DUFB 3TR0A 1N0IA 1PTJA 1SKUA 2C04A 1WW2A 1E3QA 2W2VA 2C5GA 3A6JA 3EA4A 3TOCA 4DMKA 2PWZA 1ZY2A 4OMDA 1P7VA 2NYRA 4JOQA 5MN4A 4TT8A 3GWZA 3UB3A 2Q99A 1Y8QA 3H0KA 3I9MA 5GOTA 3UUEA 1KVQA 1U0NA 3MCTA 4IMRA 4HQ0A 4X6YA 2CDRA 5C46F 4FNOA 1DLJA 2ECQA 1I5EA 1OOEA 3KT8A 2ZI3A 2H3EA 3H42B 3OE5A 4LMRA 3ZHOA 4AIIA 4DIEA 3TR5A 5J1SB 2PZAA 4D5EA 1JHZA 1NKSA 2CLKB 2FRXA 4CM7A 2OGSA 1HY0A 4OI2A 5FB3A 3S1SA 2O0JA 5AW2A 4ZJYA 3KKPA 3BGIA 2PT5A 3NAMA 1P77A 1WVGA 3D6AA 3MJRA 3MWDB 5GZ1A 4DCVA 4HH0A 2MSLA 1E3JA 4BN5A 1O54A 1VMEA 4I1VA 3VH3A 2ODAA 4Q3NA 3LY9A 5AXDA 5IABA 1GM5A 3L2OB 4N6OA 5JSZA 1TQ2A 1QGDA 1VCMA 4FS8A 4TYYA 2VPIA 5AVTA 1M1ZA 1EUZA 1ML3A 2YS7A 2UYOA 1YRYE 3DNPA 3LBFA 3MCWA 5EERA 3WK5A 4M8IA 4ANFA 1K86A 3ZHSA 3BIXA 5HPYB 4FYWA 4ZYXA 1X70A 1NFQA 4U6SA 3S44A 4C0KA 4AUMA 4E4YA 1E2NA 1SD2A 1CR2A 2OAEA 3EMKA 5F2KA 2W8BB 3JQ9C 3DLPX 1W4CA 2YNMD 4TVSA 1U0BB 2BSXA 4OMUA 5F3RA 3ZN2A 1TMKA 1W85B 3K4PA 3AY0A 1PR6A 1Z35A 5AXAA 2VDUE 1PLJA 2KBEA 3G2MA 4PCAA 3RRZA 1UZUA 3ZCPA 3Q85A 1JT2A 3ZWYA 4C2BA 4BX9A 4NAVA 3Q6MA 1AQLA 3IO3A 5IK2A 5D1NA 2OUIA 3AUUA 4Q21A 3H19A 5DNAA 5EI5A 4B40A 4OFWA 4DCNA 3DVAB 3MJSA 4IBOA 2XZTA 3ETDA 4N0QA 3WO1A 5B7PA 2J0EA 3ICPA 3RYIB 3P0RA 4RSGA 3FWKA 3Q10A 4PZCA 3VOTA 3W9BA 1EJ0A 3RNLA 5E3HA 4FR5A 1KQ7A 3RG2A 2CT8A 2VNHA 3ICEA 5IDVA 1VRVA 4NY1A 5A5EA 2PJDA 3DDCA 3TRFA 4UU7A 1DXHA 1HPLA 3BVPA 2OLEA 2UYQA 2ZS8A 3QMMA 4KIFA 4B0OA 4D0NA 5JNVA 3IKJA 3C6YA 4QXQA 5AKYA 3RRMA 4U7TB 4D3DA 2OD9A 4B3MB 3VKWA 1RCFA 4KAXA 4Q18A 4WWHA 4K6HA 1UT6A 2FN4A 2P6UA 1P5HA 4MUHA 2JI6A 3A3OA 1SXJB 2EIHA 5TQ0A 4ZCIA 2A5GA 4Z9XA 4RD4A 3AINA 4A36A 3HGMA 5K7SA 2A1TS 5HDQA 1COWD 1SQ5A 4YMLA 4QFMA 3GEDA 3U5TA 3OTHA 2GF0A 4PAOA 5CGZA 4UVIA 1YC5A 2IH4A 4CLRA 2ZW9A 4NLLA 3R8CA 2VCHA 3R0QA 3EZ9A 1BYUA 3BMXA 2FWMX 2LXNA 3LDUA 2XYRA 3HC7A 4G5HA 1ZG3A 1YRAA 4HF7A 3QBDA 2O5RA 2ACWA 1W5SA 1R0WA 2QDKA 1H65A 2NU7A 4MMXB 2BUAA 4FNAA 5IAAA 1H8HD 1N1MA 3IHKA 3RJTA 4DARA 4H7PA 4OFXA 4AP9A 1SUIA 5KI6A 1TQ8A 2OHHA 2WFAA 2YRXA 1M2NA 2G9QA 2I4IA 2P9BA 1RAGA 3K09A 3MT0A 3MYRA 4Y1GA 1T29A 3L6BA 1HNNA 1A9YA 1OPXA 3THYB 1UMBA 3IESA 2A4KA 2B5WA 5EG5A 2PM8A 4OY3A 4ENUA 1DIHA 1T6ZA 4BIMA 2OILA 4MA5A 5IKPA 3CCFA 4PPGA 4YMSA 2VUSA 2GI4A 3E9EA 1ACMA 4ISCA 2NQ2C 3GEPA 5ICEA 2AOUA 2PZ8A 1G98A 1YOVB 3HB1A 4MWGA 3WGQA 4G1FA 4V0MA 3ZJUA 3B3FA 4CLDA 4KYVA 5AW3A 2ZI5A 4N03A 4RVOA 2CZQA 5REQB 3TSZA 1Q57A 1U0HC 3BF8A 1OHHD 4FCWA 4IIJF 4X3OA 1H0HA 4Y2HA 1B6GA 1R7RA 3BFJA 2PTRA 2GBCA 1VHJA 5G4KA 4RJLA 2OG2A 2F8TA 2XGJA 1VB3A 3LC0A 3NHZA 8GPBA 1NBEA 5A04A 1J0CA 1TAHA 2Z9BA 1PWHA 2E1PA 4PRZA 4HUTA 3G59A 1UODA 1XTBA 5SZJA 3W0LB 1GUYA 1DOZA 5DHUA 2HU8A 3G23A 3G89A 5KJ6A 1WMFA 5G1NA 4BUCA 5DGIA 3BMNB 3NHWA 1Q19A 3UGKA 1KPHA 1IAQA 3BCRA 3KXKA 2A0XA 3QPDA 3PZBA 2HU2A 3V1MA 4EJSC 3PNYA 2P2NA 4IZHA 3JQBA 2BEWB 5L7TA 2NG1A 3H05A 2B35A 5AVUA 1I80A 1GARA 4TTIA 5CX4A 4JX8A 3ZJTA 4EY6A 1PD0A 3HU1A 5EZYF 3GP5A 5DBGA 1YB5A 1T26A 3LKZA 4RQBA 3UN1A 3BTSA 3A3PA 1QSGA 3OLCX 3KQHA 4HVAA 2XUZA 3KEOA 1YCDA 3HHEA 1U11A 2H1VA 4CF3A 4L72A 4LNUB 5AI0A 3LZCA 1DOAA 5B58T 2XA1A 4L1KA 4ZO9A 4NEGA 2FPXA 2B21A 5I01A 2QTVA 2XYPA 4FPXA 4AK9A 1I7DA 2Z2KA 5A9SA 4D1YA 2VJQA 1O0BA 1YUMA 1DTWB 2ZAMA 3ZGVA 3EGIA 3ZXUB 5C0OE 4FD2A 4YP7A 2QY9A 3FFBA 5ALVA 5D6OA 4APBA 1ODIA 3GNQA 1A95A 4UBNA 4X65B 1S2LA 3R3WA 4D98A 4OX9Y 3PHGA 4D57A 2C9DA 4LUCA 4R0NA 4HH1A 5HF5A 1E0SA 2XBMA 2D0IA 2YC4C 3L7YA 3HWWA 3THXB 1VC2A 4GR5A 1DEHA 2XMRA 5ENZA 1OXSC 2QMZA 2OWEA 3M3DA 1ZIOA 2P9GA 4BC1A 1OU0A 4EGAA 1A82A 1CB7A 1N0WA 2WDPA 3AY7A 2Q07A 1R50A 3T7DA 4B3RB 1FSSA 1W30A 3AUJB 4PYMA 2O54A 1CS0A 1YBVA 3FJOA 4GKBA 5H4GA 1DQSA 3G2IA 1RQGA 1QU2A 3FHCB 1CDEA 2ZEJA 3TLEA 2WILA 4DPMA 3O95A 1YSCA 3EOBI 4EY4A 2UUAB 4R54A 3WFZA 4X6UA 4YTEA 4KQJA 3NTUA 2G07A 3VQTA 4YCNA 1LPMA 3AHFA 4PHFA 3IR5A 3WGUA 1WABA 4D6PA 3B9PA 4PYKA 3F6YA 1G5FA 1CJTC 3SWWA 1RE0A 2DT5A 3BSSA 4QQKA 1FTQA 4FX5A 2RGBA 3MXOA 1PLKA 4DIBA 3KEMA 4XIFA 3TTTA 3AWDA 3NHYA 1CRZA 2GF2A 4JYMA 5M34A 1UJ4A 4MP8A 2XB9A 4YDSA 2PUWA 2Z2XA 1HLPA 2BELA 2YHIA 1T3GA 2G9RA 3C85A 3I4LA 3PFHA 4MDYA 1IC6A 4R1PA 3PUWA 1W52X 1KJNA 3OPNA 1IHPA 4FFDA 2G9NA 1JZTA 4D8WA 4JXXA 1ETUA 3BRCA 4QTZA 2EC5A 1MPXA 3L3BA 2DTDA 1YMVA 3IERA 2V58A 3CRMA 4NU0A 3RABA 4ZOAA 2YVAA 3U3MA 3RVJA 4AZ0A 4XWTA 3D4LA 2NAFA 2VNAA 3ZJYA 3C1UA 3O03A 1IL0A 2EBWA 2YCLA 3RRXA 2JC3A 4CIWA 3CEJA 2F1JA 3GRUA 5LR6A 4LRUA 4RBNA 2O2XA 1BCSB 3EZ2A 5CK5A 5JYEA 3SP1A 2O07A 3OX2A 1YTLA 3A1TA 3QEMB 1GV0A 1SRRA 1LDMA 2BGRA 3F3YA 4KXLA 4TX1A 5LPNA 1MZPA 1IN7A 2Y0BA 4FGKA 3E1KA 3LC2O 5JQGF 2BOVA 2NZ2A 1NXPA 5IJ0A 2EF1A 5DM1A 3E9YA 3HR8A 1TK3A 1XAHA 1ZI6A 1NW5A 2R8RA 3BCUA 3M1YA 3QLEA 2P91A 5IANA 5AM3A 4QOHA 1VFPA 3AJDA 3WAGA 1XKLA 2ZLBA 1T2UA 4GMGA 4DIDA 2QTWB 3O26A 3PGXA 4CUKA 2IVZA 1JDNA 3GHYA 1G8AA 3OQVA 4UEOA 2CVFA 4I3HA 3UK6A 2W11A 3H1AA 3QIAA 2KI5A 4J8PA 3CXRA 4KRYA 1GG8A 2Q3CA 3JVIA 2C4TA 3RT9A 5ED0A 3VTAA 4RE5A 1TQ4A 3A6LA 4O08A 4BP8A 3N2EA 4DDHA 3OE7D 1L7QA 2FEXA 2AFVA 2QA5A 3EXIA 2D0PB 2VJMB 3AVYA 2EGGA 5F9HA 3G6WA 1A7KA 2CHUA 1DX4A 1TRKA 2PD6A 3KLMX 4I50B 1EU1A 4HEA1 4LDQA 3AY3A 2I6QA 3GFSA 2DPGA 4A0QA 1II0A 1CPYA 2HAEA 3D6MA 4J16C 4NCJA 1JKJB 5FBWB 1GUZA 4F4JA 5DTRA 5FUYA 4FEAA 3EGDA 3R75A 5LJLA 1JIUA 1Z0SA 1Z6YA 3CR7A 4Q39A 1VDKA 2NO5A 5EHGA 3WV5A 3OQJA 1DIBA 5DTEA 3HL0A 5LQNA 1F1BA 4OK5A 1QIEA 5K3CA 3H75A 3ROQA 3DTVD 1E4EB 1P8JA 3EAQA 2ZRLA 2X0DA 3T9FA 1P9OA 3N8GA 1GWNA 1WCYA 2QTHA 2XODA 5GIPE 2AOXA 3LX8A 1DEOA 2VTKA 1Y9ZA 3CEHA 3OZRA 4K9QA 2NO9A 4B84A 1M2FA 2NO4A 2I2XB 1XZIA 4IH4A 4MS1A 3COJA 1O9HA 3D7SA 2JARA 4BZZA 3VI4B 4U00A 4A2QA 2AE1A 3B1JA 3TDMA 4LF7B 4FYVA 4GICA 4BO8A 4M76B 3OZGA 4X20A 5IF3A 5K3DA 4G4IA 2Z04A 3A1UA 3FA2A 3HPRA 3GF4A 5AVZA 4CUJA 1JFFB 2H2GA 3B1WA 1G7SA 3IB6A 3IBCA 1JTFA 4DT1A 3HEBA 4BDTA 1LVHA 1II8A 4CM6A 4G07A 5K8JB 1T8UA 3JSXA 1KRWA 2V8BA 4IHQA 1WPRA 1YJBA 2VQSA 4E08A 5JPCA 4HJRA 3SE0A 5IKMA 1ORWA 1NJGA 1MX5A 3LRTA 3KJIA 3O1HB 3UK7A 1D5WA 2IKSA 5AIAA 1RT9A 3DL7A 3MIZA 1XFDA 2FSPA 2K2QB 3EIOA 2Y27A 1DRJA 3N28A 2O3RA 3ONEA 2VWGA 3NI2A 4J0IA 1ND5A 2RK6A 4L74A 1N4AA 2EWMA 4I5GA 2Z6UA 2A5LA 3NGXA 5KX5A 3R77A 3INTA 5KTPA 3W3AA 4FW9A 5TPZA 1R6UA 1QUFA 3A4VA 3ESZA 4JELA 3ESDA 3ZD6A 3DMHA 4ZPJA 2GBLC 2V9ZA 1WY7A 2PU7A 1R4AA 3QA3E 4JI6B 4Y7DA 2ZREA 5E95A 4FKZA 3BWDD 1ZHOA 2Q1WA 3R6TA 3BT7A 2QX4A 4IKEA 4QYIA 4R6XA 4Y6OA 2JVIA 4HDNB 1DFHA 4P54A 4CQNA 1VXOA 5E0KB 3UMRA 3K1JA 5CFPA 3GHHA 3CRW1 1KI3A 3ZUGA 4ZYTA 1SXQA 1WW8A 3G0HA 1SELA 5K0JA 3NZEA 1NQ5A 1E61A 1PD1A 3N7AA 2BFAA 2BCGY 2IIPA 4KUEA 3WGNA 3IUNA 5AJXA 2CLIB 5LOVF 1T5HX 5ALRA 3FOZA 1BMDA 3LK7A 5CUQA 2DEUA 1RC1A 4FC7A 3M3HA 3KQLA 4KDCA 1T8RA 1LBHA 3JYHA 3LAWA 2W70A 4B6GA 4YCCA 2VP5A 1Y3DE 2F4NA 3W7BA 5IPFA 4MO2A 2OENG 2IEGA 2ZR9A 3H1FA 4RNDB 1TW2A 4B1FA 4XYLA 2M9MA 3QEJA 1J33A 1MR3F 1D2MA 1LH0A 1P74A 4DREA 3U5ZB 4MKXA 4YXWD 4Q19A 1E5TA 3ADOA 4MI1A 1HYBA 5G2OA 2DLCX 1YT5A 1P0IA 2H11A 4V0LA 3V4VB 5FNVA 1Q16A 3B8HA 3GT0A 3I9V1 5AVKA 1FF9A 2NVWA 1Z5ZA 5ICSA 1J7JA 2Y4OA 1Q1AA 1EE2A 1DHRA 1PGOA 2QZJA 3GUZA 4KQEA 4RF3A 4O59O 4RTLA 4XQCA 3WKBA 1OX4B 2XOKD 3NHBA 3PUIA 2I3ZA 4A3SA 4D26A 4FD3A 4CMHA 1QYCA 5SZKB 1IJFA 3TAXA 1EDEA 4GWGA 5IJXA 3FWYA 3MM4A 3ZHCA 4AS2A 1K8XB 1XLTA 4B7XA 4HWKA 5EEGA 2Z3WA 1BWRA 3GJ6A 4M38A 3RYHB 2GM5A 3AKDA 4ZXFA 1IK6A 1CTQA 3ZWNA 1UBJS 2W6QA 1VJGA 4WBNB 1MT3A 2PRYA 4XDHA 4CM4B 4ZKDA 3U7FB 4O63O 1HG1A 3A4MA 1YI1A 5K3BA 2QJRA 4KN8A 4A9AA 4D8VA 5BV2P 1ZI8A 4W5QA 4M9RA 4PW0A 3B3AA 2GXSA 2D59A 1IVYA 1MT0A 3NUGA 4UASA 4H15A 3DEIA 4MJXA 1EJBA 1PWEA 3JQ8B 4RGBA 3PNSA 4KYTA 1M6WA 2RC5A 3L4EA 4UDNA 3WRXC 4JKOA 2R7NA 2QLTA 3L1HA 4ZAVA 3IDQA 3IHTA 3B85A 1FNCA 1S0UA 4M9QA 1JFRA 2JD0A 2AFIB 1L7OA 1Q22A 1BN7A 4KXVA 4RKQA 3UJ3X 1YDEA 4RHYA 3K94A 4XSGA 1D1SA 4RD1A 4XKJA 1ZNXA 4ZGGA 3U09A 1YAHA 4DV7B 4FLFA 3MF4A 2H7XA 1D5CA 2FX3A 2X0RA 3R20A 1N77A 1U2DA 4FFNA 3FYSA 5EUMA 1Z4NA 1L8OA 1UJBA 1BEEA 1T3HA 4KFUA 4F4CA 2PJUA 3UCEA 2YXDA 3GIWA 1Z2EA 1PQWA 2BFCB 1DCFA 4EGCB 1C3JA 1HEYA 1LI4A 1SCAA 1BXRB 3OM9A 4JNKA 4ZMSA 5CXQA 1GSIA 4M9CA 4XWKA 2AC4A 4JYAB 2ZYAA 1MPTA 5HIJA 3E2PA 3CRRA 4WK2B 3U7JA 3CBGA 2O8BA 5F23A 3TW4A 4TMZA 3COPA 1RRMA 2PAFA 2MSEB 3F7OA 3N2YA 4IEIA 3TLBA 4MVJF 4G0MA 1FK8A 5KEIA 3CI0K 4YB8A 1KK3A 4BOYA 4BPBA 1PR4A 1HH4A 1R0BA 2P30A 5JDCC 5TQVA 2R5WA 3GIDA 3NQ41 4K6CA 3A2KA 2PUEA 1HDXA 4UTRA 4HQOA 1A2BA 1JI3A 4WDQA 1L5HA 4FXOA 4LHSA 3BSYA 4GP6A 2VZLA 3AM5A 3A9UA 2G0AA 3GZJA 1GEEA 1NULA 1F60A 2A92A 3JQGB 1Z22A 4IYJA 4Q15A 3T94A 4C6SA 1ND6A 5B58C 3ER9A 2IZ0A 1B14A 1GAJA 3HCFA 4CIBA 4YPOA 2XECA 2DBVO 1AN9A 2ZM5A 3EN0A 2O2GA 3U7QA 2Q29A 2G06A 1VPTA 4B6RA 5KYYA 1QORA 1CY7A 1Y8RA 1QHFA 3GGCA 1M72A 5KTTA 3L40A 5JFTA 1GXSB 4JVSB 5J5VA 3E22B 2NUPB 2QVGA 3IQFA 3ZDBA 3GZNB 1IG3A 3F8TA 1JR4A 3G1WA 3SE7A 2OB1A 3KSAC 3L6EA 2E89A 2JLBA 2Q49A 3RFTA 4II7A 3OQOA 1UOPA 5F64A 3DS8A 2H85A 1Y0BA 1HBJA 1JXQA 2G08A 4OBBA 2C4KA 4X90A 4KMSA 1Q1ZA 1UMKA 2W4QA 1WMSA 1P1IA 2XTAA 2R9VA 3GW8A 4LQDA 4MK4A 2HCRA 3OMLA 3W05A 5IDQA 5EQFA 5IDXA 3CZ9A 3M6MD 1PZFA 5LXTB 2HW8A 1MOZA 1I2DA 3LHIA 2Z95A 2ZITA 3HJFA 2E5WA 2IOYA 1NR7A 1P33A 2QD2A 4ZPXA 5TMDA 3S7ZA 2AN1A 3SHWA 3T5MA 1K8YB 3VOSA 2W2LD 2W93A 4HRAA 3BRWD 3RBZA 2DFLA 4BLSA 4Z4CA 4UD6A 4Y30A 5C4MA 3CO5A 2WVHA 2PA3A 2QUIA 3CIOA 5FJIA 3E8MA 1LC0A 1G5RA 2PRZA 3FYTA 3A25A 4CTJA 4CIAA 4C9BA 2XYVA 1NBMD 1JNYA 3IEMA 3H9QA 3MSXA 3OZVA 5C1IA 4GKKB 1Y1TA 3PGVA 4N7JA 4OLBA 2FEAA 4KXNA 3KPYA 3QUSA 1XD2B 1JDUA 3RBXA 1ZGZA 4G37A 1U0JA 3F6SA 3DDNA 4EYSA 1UFVA 2JGNA 2Z98A 3W5VA 3AHGA 3ZNQA 2WTXA 1KIMA 4URUR 4X00A 1Z15A 4OYYA 4BX3A 3DL4A 2DE0X 4C0QC 5BWLA 3ZJVA 3NYIA 4TVOA 5JYCA 5CNMA 1RTKA 5DTIA 1SCKA 2QLFA 1SBNE 4DIKA 1DI0A 1ZU5A 5KSWB 2JNWA 2D3TA 3HWSA 1AKTA 3O1LA 1WZIA 4IY1A 1JI0A 1JJ7A 1W581 4KR7A 2GN8A 2PO7A 3C39A 2K2WA 3HMKA 2LWIA 3RROA 1UC9A 4F96A 1G8JA 4Q02A 1ORRA 2BP7A 2REOA 2GESA 4OUDB 5JYBA 4UTZA 5ENDA 1F3LA 1JWBB 4OHPA 5C7LO 4V03A 1IH8A 2FX5A 2PG3A 2UDPA 1KJWA 4GYKA 3R7SA 4YAJA 1Z0FA 2AVDA 2OUKA 1BC5A 4BFTA 3IQXA 4LVOA 4OXKA 4YRNA 1EQAA 1FW8A 2GN0A 1A98A 4L57A 1B6SA 2ID8A 4HR7A 4YRPA 1QO7A 1UM9A 2BTOA 2Z4SA 3IAM6 3IIMA 3R5FA 4IQGA 4LZNA 3ZV7A 4O2AF 4BE4A 3CIFA 4DYDA 3H2JA 4DLZA 1MX9A 1TCBA 1XCJA 2WJZB 4CKWB 1X3LA 2EIXA 4Y9DA 5J4KA 1NI3A 5KPJA 3D8NA 2YS6A 2VXBA 5BVGB 3W4KA 1FC0A 4NS4A 3WLKX 1M2OA 3IAUA 3NBMA 4RSHA 1I1QB 4DRZA 2I3AA 2WIAA 2ZI9A 3CS3A 4XUDA 4UULA 2GNAA 5E6UA 5GGXA 1L8LA 2OV4A 4D82A 2HO4A 4W63A 2Y9MB 3I09A 1RI1A 4OOEA 1X7YB 1PFQA 5AM5A 3TUIC 3UT0A 1NIPA 5EJ6A 1U9ZA 2CJWB 3M9XA 1ZVMA 4OMFG 2I8CA 2UZAA 3P9ZA 3RAFC 3EZFA 5HNKA 4DVGA 1M9NA 4WECA 1VCNA 1MJHA 1IU9A 1ILWA 5MDHA 1XPUA 1VM6A 2DB3A 1FFCA 1N2SA 3ELBA 3UK2A 2ZYVX 1HF3A 1DQPA 4EI7A 3IILA 4Z2AA 3LQ2A 5L6MB 4ZTBA 1YL6A 1JEOA 1RQNA 4PSKA 2IJGX 2IHVA 4TUYA 4WK6A 3EAFA 2V3CC 3WLTA 3ZDDA 2QP9X 1NAHA 2V7UA 1XDBA 2R85A 3FBGA 2W6JD 5JOQA 3CNNA 4FCVA 3MTGA 1D2NA 2H1FA 3O4RA 1JEDA 3TW8A 1F2VA 2H07A 3P4YA 2REQA 3F9IA 3UJBA 1TO2E 3QYPA 3G82C 4F92B 1RLIA 4WN9A 4DGSA 2B9EA 2JKYA 1K6EA 3ROXA 4UAGA 4DB4A 2GVNA 2IRWA 4IHKA 2JLRA 1E2JA 3ZDRA 1EM8B 1YZTA 2ALJA 3OQIB 2FW9A 4RZQA 2XCSB 3Q5DA 1GAWA 3AH8A 3IRUA 1DRKA 4I14A 2HNKA 5EIFA 2YYSA 2DBQA 2BFBA 1E62A 2V7EA 3REQB 3LHDA 4YWJA 2WZDA 2DFDA 4BNUA 3KS9A 5HXAA 5TS3A 5I7FA 1AGPA 1X19A 1U7PA 4LXYA 4XUEA 5H7XA 4PXYA 3HPQA 4LJYA 4QGBA 2PRSA 3V7NA 3RADC 1JHQA 1ZKMA 1JAXA 3P45A 3A9RA 5SZHB 1TJNA 2JCBA 1TAQA 1RYMA 2C0QA 2IH5A 2A3RA 3K6KA 4WCFA 3FJYA 4D9IA 4W1SA 4MJ7A 4DNQA 3RYCA 3O31A 1QCCA 1U1FA 1Z7EA 3EGCA 1JVSA 4HQRA 2DWOA 4R2WA 1BXGA 1OBCA 1RC0A 2HMVA 3IALA 4KACA 3S40A 2JFFA 4EFDA 4G0NA 3D7KA 3HJCA 4IF6A 4KYUA 1VG8A 4DMMA 5JH7B 1JH9A 4R31A 5JJ5A 1JU3A 5B3JC 4RTSA 3TL6A 2WJ4A 3TJMA 1RKVA 4O4JB 3H6HA 5L3ZA 4CQJA 1SCBA 4DLRA 1HV8A 2DFTA 3KAPA 5BNZA 3EXFA 3U40A 2BCJQ 2ESRA 4YH1A 2NO0A 5DZSA 3ZQUA 3K2EA 3FDXA 5KHOC 3C43A 4TS4A 2QN1A 2QTAA 2VJAA 3X1ZA 1E2KA 2BL4A 4PO3X 2OORC 3I5UA 1E18A 1XTKA 4YHHB 2AG1A 5CAEA 3QJYA 4JYPA 1YR3A 1CF9A 2D7DA 3K6RA 1IDOA 2VQ3A 3SEAA 2OKCA 3L7NA 5F9MA 5TT1A 1E9AA 1V4NA 4GSYA 3WIVA 4DIUA 1R8JA 2FEOA 3UJ8A 5LQAA 1NPDA 2Q1UA 3BAZA 3MTJA 2F1HA 3OSZA 4OAQA 3MGGA 4TV9B 1WUJS 3GFGA 5HZKA 4QQNA 5FL7D 1FTYA 1PEKE 2ZAGA 3PFKA 4OI1A 4Q4CA 2XCLA 3VAYA 3ORHA 1U7HA 1MO5A 4FINA 3ZNOA 1RIIA 1GCAA 2O23A 2Q3BA 2CLLB 2X77A 4NWIA 2XI4A 2A57A 4MH0R 4FJ1A 4K9PA 1XWFA 2GTPA 3O3CA 3TQHA 1L4MA 2NGRA 2W43A 3CLKA 4Q7EA 2HA7A 5BSGA 2C5HA 2HMYB 2JLQA 2RHTA 2XHEA 1U2RA 2XDWA 3MIIA 5ALQA 3THOA 3EHDA 1W46A 3PRKE 3VKFA 1RQLA 3P9SA 3NDJA 2H4HA 2LIPA 3H6KA 3HA7A 3PFGA 3SQDA 3KUCA 2QN7A 1SJ9A 2A8YA 1O03A 1IEXA 2FPLA 2ZJZA 3AUKA 3KLNA 1Z2CA 2YRWA 4YEDA 4HVLA 3MHTA 5AVYA 2J9RA 4M9XA 3UWMA 2H7VA 2YFYA 3ZVRA 5FPYA 1CERA 5AHWA 3STYA 3ZW7A 1CY0A 5LP1A 4EW2A 2V0NA 4R9SA 3F2VA 4U2CA 1PFYA 4FBGA 4KXMA 3LH5A 2NSHA 5KKNB 4R71A 5FFFA 1JA1A 2QR5A 3I2HA 3RANA 1F48A 1ESZA 1NBWB 1EK2A 1R0XA 3KCQA 3O8BA 4QG7A 4ZVPA 2G4CA 2HD4A 3HYNA 4X6XA 4BQFA 1KOLA 1YS2X 5KSOA 1CJVC 3O47A 1NYQA 3UK1A 4CR7A 1MAUA 3D7NA 1JDSA 3R5TA 1G63A 3NC1C 1OLSA 3SYMA 4ARVA 4QHTA 4GECA 3S2IA 1LDBA 4X1KB 2IHYA 2X0NA 1YR6A 2YWHA 3UT6A 3EUFA 5FD8A 4ZVLA 4B44A 2BT4A 2VUIB 3C4JA 4KQGA 2QD5A 4PPFA 4QVKA 3NANA 2QD1A 4FDAA 5DNDA 2Y1FA 4E22A 3HFGA 2WICA 2PKWA 1BVHA 2P8SA 5LZ8A 1WSBA 3LRXA 1RKBA 5CURA 1Z26A 3QM1A 4IQ4A 3ZWAA 1Q0HA 3W06A 1JQLB 3U48A 3T1TA 1EGMB 4DJDC 2BHSA 2PXCA 2O6HA 2QTRA 5IC5A 3NKLA 4F5ZA 1KE1A 2JJMA 1PUJA 3FGOA 4MQFA 3MRSA 4IVNA 4PZAA 1JX6A 1OIWA 5EP4A 4L6AA 1HE3A 3GJ4A 3EPHA 1REQA 3Q11A 4IZIA 3QXGA 1M75A 4BJ3A 2B82A 1DBSA 4ZCMA 4PCLA 4TZ6A 1WSWA 4RV9A 4CMAA 2ZUFA 2QIPA 2A2ZA 3S1LA 1JIQA 3R0JA 4R3UC 1KJJA 4UNSA 3WKCA 1DFIA 4A6DA 3T61A 4F71A 3H18A 4DQLA 4QFBA 1FFHA 4FR2A 3KYJB 3MGBA 3K72B 1K7XB 4RVCA 1Z4MA 4HGQA 2LZ0A 4ZOLF 5HX7A 1L4EA 3GXOA 4DB2A 1PU2A 4EHHA 1TTTA 4PAWA 1TJ4A 3FSGD 4JHLA 5IM5A 5JXJA 3DAHA 3GPLA 2C7QA 2Q8PA 4EEIA 3GJ0A 4F5WA 3SYRA 4TMYA 2PUDA 1EDZA 2NV2B 4IF4A 1P72A 1JQAA 2CD7A 4TN5A 2PX4A 1A96A 2GJ4A 5DISB 1KKLA 1NXTA 1N5IA 2XYQA 3E9DA 2ORED 4JA0A 1TB4A 1XNJA 5AHOA 4OAOA 3FVQA 2R3SA 1OQAA 2JD2A 1TLFA 4KGDA 4QEZA 3D1JA 1BVYF 2WWXA 2G77B 1P75A 3NRBA 4M36A 4Q4AB 4YYZA 3Q7SA 3BWYA 4GLBA 3B48A 4WEOA 4AJHA 3WQRA 2IU3A 3EUEA 2GTHA 1UK8A 2GN1A 2YMLA 5K3SA 1NE2A 3PUZA 2FWBA 4DDMA 1YTUA 2VF2A 4NCKA 4NMWA 1LI7A 3AB7A 2H51A 1NN1A 2OLJA 4YP1A 4CFSA 4F1KA 1XDUA 5BURA 3LFUA 1XAIA 4OXXA 1B7GO 4CT4B 4UHEA 1Z83A 4MPRA 3B78A 3E70C 2GNOA 4KQHA 4LOJA 1N0HA 1SRQA 5ALDA 1Y7PA 1N33B 2IYUA 3TLMA 1OCEA 2BH2A 4ZO7A 4EFLA 3HEAA 4HO1X 1KQFA 2GKGA 4NDAA 2C8VA 2I7XA 3KQMA 3A6DA 4AP6A 4PLYA 1V7CA 3RS0A 5F52A 4M21A 1PQ4A 3B1FA 3DLTA 3U4IA 5DFAA 1JYSA 4NXMB 4QNRA 4BL5A 5LUBA 1K7FB 2CXUA 4CMIB 5IM4A 1D04A 3AB8A 3GEMA 4KHZA 1SCDA 2ADMA 1WXWA 1ULUA 1S2OA 1E4OA 2GT1A 4MRAA 3JQCA 2EW8A 2XW6A 4DLBA 4C4RA 4MNTA 3AWIA 3HDJA 4MUAA 4JQSA 3D54D 3ZKAA 5GMOA 3DM5A 4LC0A 3QFFA 3B36A 2P2YA 3H3XA 1E9CA 2HLHA 4UZFA 5HQ3B 3LUBA 1NC3A 3OEHD 1EDBA 3PRJA 4LQ4A 4NU8X 4XTCS 4BNIA 3B7WA 4F0JA 3QHQA 3V4FA 2ODPA 2Z5VA 4I6JA 4BKPA 5K3OA 1XMPA 4TRRA 1D2GA 3LBHA 2ZUWA 1K7CA 4O4IA 5D84A 3VO2A 4E5SA 1JFTA 3VYUB 4BO7A 2MSDB 2GEJA 2JZCA 4Q7JB 1X87A 1INLA 4G25A 4JGIA 4EY8A 4DAOA 4H08A 3G2PA 1J49A 1Z0DA 1X1QA 3A32A 1F9AA 2PBRA 3OKFA 2CLCX 4PHHA 3T3IA 3UXEA 4DUYB 1DJNA 3EXHA 1E5DA 3NHSA 4BFWA 2VNJA 1MJGA 3NVMB 3PDJA 4IUDS 3CLHA 5H3LA 2LUOA 2WHPB 4YJH