4NFLA

Crystal structure of human mitochondrial 5'(3')-deoxyribonucleotidase in complex with the inhibitor npb-t
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
201
structure length
201
Chain Sequence
SNAASGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 5'(3')-deoxyribonucleotidase, mitochondrial
publication title Conformationally constrained nucleoside phosphonic acids - potent inhibitors of human mitochondrial and cytosolic 5'(3')-nucleotidases.
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 201
sequence length 201
ec nomenclature ec 3.1.3.-:
pdb deposition date 2013-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4nflA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4nflA01
1XVIA 2P11A 2EAUA 3L1UA 3OCWA 4CE6A 4F72A 5AM0A 1VJ5A 1ZS9A 1Z4IA 3BA6A 4NWIA 5AVXA 3UMBA 1WPGA 2IOFA 3P96A 4UARA 2X4DA 1ZD3A 3L0YA 3WGVA 4G9BA 5AKJA 3WK5A 4ZEVA 2FDRA 5AKYA 1WVIA 3L8EA 5ALDA 3WK7A 5AI0A 2B82A 5AW3A 4KNWA 1SWWA 2YMPA 1L7MA 1IWOA 5ALKA 3I1YA 2AMYA 4HGOA 2I6XA 2C8KA 4CNQA 4B6JA 2GMWA 3L5KA 2ZG6A 2NYVA 3QYPA 5ALZA 2WF5A 5AW4A 1YNSA 3WK8A 3AR2A 1LTQA 3OCVA 2YMQA 2FPWA 2HOQA 4J2TA 5AW9A 5AW0A 2PQ0A 5AVWA 3FPSA 2GO7A 5AKEA 3WKDA 3B8EA 4YH1A 4Y2JA 3SD7A 1Z4MA 1U02A 1Q91A 3PCTA 1YMQA 3ED5A 1Z4PX 3ET4A 4G63A 1RKVA 3AR8A 4HGQA 4OCZA 2VKQA 2JAWA 2YMMA 5ALTA 2YBDA 3MN1A 3DDHA 1L7PA 3R4CA 1Z88A 1Z5UA 1XP5A 3KBBA 5A3QA 2R8ZA 5AVSA 4UM5A 4Y2RA 4FFDA 3RFUA 5AVRA 2IA5A 5ALNA 2I7DA 1RQLA 2CFTA 4I9GA 1O08A 3UMCA 2YJ6A 1RMYA 5AVYA 5AHXA 1RLMA 1Z4JA 1PW5A 3OPXA 4UM7A 4OD0A 2HO4A 1T5TA 3QUCA 1LVHA 1YS9A 4CF5A 3L0BA 5ALWA 3U7EB 2JGAA 5AVZA 2C8LA 2RB5A 1ZRMA 4UMFA 2Q4TA 1YV9A 2B8JA 3DAOA 3PDWA 1EK1A 2Q4RA 4GXTA 4KNVA 3ESRA 1TJ3A 4KYTA 2O2XA 3AR9A 3W5DA 3SHQA 3WKEA 5ALJA 1CQZA 4UMVA 5AKLA 4HGRA 4L57A 1TJ4A 4BEVA 1S2OA 2G08A 1RDFA 3SF0A 4CF3A 3OCXA 2R8XA 3KD3A 3A1EA 3L7YA 4NV0A 4NFLA 5AI4A 1F5SA 5AKZA 5IS2A 1NF2A 2NO5A 3ZVLA 2AUTA 2WF7A 1ZJJA 3N1UA 2P9JA 4GIBA 5AK4A 4DWOA 4QQFA 3QU2A 3ZU6A 3CZ4A 1U7OA 5AVUA 3IJ5A 4BBJA 2Q5EA 1Z5GA 3PGVA 4MWOA 2WFAA 1CR6A 3EF1A 2WM8A 3EF0A 3E8MA 5ALMA 2G0AA 5IT4A 2EARA 2HEGA 3WKBA 3ZUPA 2IYEA 1O03A 4IG4A 4MUMA 4O8CA 1QH9A 2CFSA 1Z4NA 2B30A 2G80A 5AK3A 5AM3A 4UATA 1TJ5A 2OBBA 3AR7A 2B1RA 2O9JA 2RBKA 3R9KA 3E58A 3ZI4A 3U7GA 5ALSA 4HYTA 4NABA 3DNPA 1U2TA 3OCYA 3N07A 4ZEWA 2CFRA 3AR4A 2DQSA 4UW9A 2PR7A 5IT0A 1RLOA 1TA0A 4XQ0A 5AIAA 5AIBA 5AW6A 3A3YA 4UASA 4UU1A 2RARA 2HI0A 3ONNA 5AW1A 3W5BA 1YJ5A 2P27A 5AM2A 3KC2A 5AW7A 5ALPA 3A1CA 5AVVA 3QGMA 4FYPA 2HDOA 3I28A 2R8YA 4RESA 3N8GA 2FPUA 1L8OA 3ESQA 5JJBA 4DFDA 2YN4A 4L6CA 2W4MA 1L8LA 2BY4A 5ALYA 4EZEA 5AVQA 2JAUA 3QX7A 4AP9A 1T9ZA 3QLEA 5AKIA 2B8EA 3WK6A 1Z4QA 4OHFA 2FEAA 2C4NA 4EEKA 3ZW7A 3ZVMA 1Y8AA 5AICA 3KOOA 1N8NA 4UMDA 4Y2VA 1RMTA 2HCFA 4YGYA 4Y2QA 2GHQA 2BDEA 2OA0A 1QQ5A 1N9KA 4Y2PA 4BX2A 3N28A 3F9RA 3W5AA 2YJ5A 5AM1A 4C4TA 2OM6A 4C4RA 2RAVA 5E0OA 5A3RA 3FPBA 4HGPA 4L6AA 4KX3A 3B9RA 4JB3A 3I6BA 4HAIA 5AKHA 2W11A 3QU4A 3MPOA 1QYIA 1RMQA 3I76A 2YJ3A 2G07A 2WF8A 3L8FA 3TLMA 3WK9A 2NO4A 3VAYA 5AM4A 2FPXA 1U2SA 2I34A 3L8GA 3WKAA 5ALIA 5AKKA 1Z4LA 4J03A 3ZTYA 3AR5A 3QUTA 2HF2A 1U7PA 2R8EA 2YFYA 3OCZA 4KX5A 3B9BA 2BDUA 2HF7A 5ALUA 1RQNA 2ODAA 3MC1A 3CNHA 3ZX5A 1RKQA 5AK6A 4UAUA 1EK2A 2QLTA 3L0CA 1ZD5A 4DW8A 5AW2A 4EENA 2C88A 4EX7A 3PGLA 2AH5A 2JAOA 3SMVA 5AKGA 1KYTA 4C4SA 1FEZA 5ALRA 3N5KA 2JARA 4EELA 5ALEA 1WZCA 1RPZA 4RETA 2ZBEA 3U7HB 1ZD2P 3IRUA 5T41A 3QXGA 3QU7A 5AI6A 2G06A 4UAVA 3K1ZA 4Y2XA 5AM5A 4BX3A 2B0CA 1RKUA 3U7FB 2HSZA 2ZBFA 3M1YA 1T5SA 4YCNA 5ALQA 1RRCA 3U19A 3ET5A 4Y2SA 5A3SA 3QU9A 3WGUA 2CN1A 1RC8A 3ZTWA 5AI9A 5ALVA 3UM9A 1L6RA 3RF6A 3QU5A 2G1AA 3KZXA 1Q92A 3EWIA 2HHLA 3FZQA 1TE2A 4Y2YA 3EPRA 2FPSA 3W5CA 3ZWKA 4I9FA 3ZX4A 3NANA 2D2VA 3BWVA 3AR6A 3KDPA 3SKYA 1K1EA 1RLTA 4BKMA 2WF9A 1XPJA 1J97A 5ALGA 1QQ6A 3S6JA 3IB6A 1Z4OA 3U13A 2G09A 4YCMA 5ALFA 5ALXA 4ZEXA 2FUCA 1Z4KA 2WF6A 4XOUA 3J7TA 4E88A 2GFHA 4F71A 4PNHA 2ZXEA 1SU4A 3NALA 2GHTA 3FVVA 5AKXA 2PKEA 2AGVA 3NAMA 3QUBA 3L1VA 4Y2TA 2C9MA 2IOFK 1NRWA 5FP0A 2HX1A 2MU1A 5AW8A 3E81A 1YDFA 4BNDB 1AQ6A 2MSNA 4YCLA 4KN8A 1X42A 4Y3UA 1L7NA 1SWVA 4UU0A 4BEWA 2EATA 5AESA 3AR3A 3L8HA 4AS2A 3ZWDA 3NIWA 2P69A 4FE3A 4DCCA 4YIHA 1ZD4A 2IOHA 4BX0A 4NAVA 3DV9A 2FUEA 2WHEA 4AS3A 1VFPA 1WR8A 3FGOA 2OYCA 3A1DA 1ZRNA 2YMLA 3M9LA 3SKXA 2QYHA 2I33A 1L7OA 2YJ4A 5AI8A 3QNMA 3WKCA 4OFZA 4H1WA 4XPZA 1S8OA 5AK5A 1JUDA 5AI5A 3OTQA 3U26A 4XE5A 2ZBGA 2FI1A 5ALHA 5AVTA 4HGNA 1VJRA 3SLRA 3NUQA 4YIKA 5ALLA 2ZOSA 3FM9A 2FPRA 5AW5A 2I54A 3MMZA 4BYGA 4QJBA 1MH9A 2B1QA 4UMEA 2YY6A 2ZBDA 3QUQA 3HLTA 3HYCA 3UMGA 2W43A 1QQ7A 2I55A 3OCUA 4JDPA 3E84A 4Y2UA 4BNDA 4IFTA 3ZVNA 3WK4A 1ZOLA 3NASA 1J8DA 3R09A 3NRJA 4CF4A 1NNLA 5ALOA 3D6JA 3GYGA 4EX6A
chains in the Genus database with same CATH superfamily
1SZJG 4J6EA 1DTWB 2H1SA 1M2NA 4WDRA 4F86A 5H3LA 1EUDA 3HB9A 1R8XA 1FDOA 5DNWA 5KC9A 3QMVA 4LQCA 1SBHA 3D1LA 3MWDB 2XVXA 2WDZA 2G67A 3DO5A 4ZRDA 1YONA 3FYSA 3DG9A 4WXEA 4IKEA 2WWRA 3ZCVA 4G84A 1J1UA 2MYPA 2Q0QA 1HYGA 1ZD3A 3WGVA 3QEMA 1PSZA 3DTTA 5AKJA 1SCAA 3JZMA 3W9UA 1QIEA 3RSHA 1BS1A 1YS2X 4QFDA 1GKKA 1OU0A 1Z0AA 4TKVA 2W6ZA 2ZUDA 3OY7A 1QH0A 5AI0A 1R5OA 1WV0A 1SU7A 1ML3A 3ULKA 3W2GA 5LOVB 2W5UA 3KSAC 1QFJA 4XQCA 3MD0A 1ZSYA 1T9AA 3KZKA 1K4MA 5FRDA 4NCNA 4KXXA 3FMIA 2GMWA 1E3WB 5A04A 1JKMA 4OAPA 1IVYA 4X9XA 1Q2XA 1FFHA 3WTCA 4RNDB 2O8NA 3VO2A 4AF7A 1XMSA 2GK4A 1IY8A 4FC7A 3IA2A 4R7TA 3NTQA 3GNQA 4EPXA 2HOQA 2PZFA 4UDOA 5EZ5A 4TVBA 4QU0A 4F4IA 5J5CA 2WWWA 3C7CB 2F3PA 3BE8A 3JPWA 3PJDA 5U4XA 4JYAB 5L3RA 2VK4A 4CM9D 3FPSA 1CQIA 4POOA 5EP2A 2X1VA 5IFKA 3I12A 3AVXA 1M33A 1C9EA 4FONA 3FPFA 4U9HS 1XBTA 3LHDA 1N5JA 2F4NA 3QKSB 2QL7A 2I2FA 1UM9A 2XHEA 5DM1A 4ITVA 5EAIA 5BOVA 4IQFA 4EL0A 4YT8A 5I9NA 1IZYA 3KHSA 3LC7O 2R1ZA 2YY5A 2Y1FA 4JU8A 5CLLA 1ODCA 2XUJA 5IJ0A 2VYQA 1EVYA 2PT6A 4NMMA 2ZWIA 2H1VA 1Q21A 1UMCB 4LY9A 1DFHA 4F91B 4GKAA 3NTUA 3ENQA 3QF7A 2WD9A 4N6GA 2F59A 5A3QA 4IWYA 1DV2A 4AW9A 2Q1XA 5LBIA 3TQTA 3E70C 4B2LA 4CCSA 3AEUA 2NZ8A 1IY9A 3P5BA 4C76A 1PQYA 5CITA 1NQAO 3O9ZA 2WTUA 2EBWA 2PZMA 3EZYA 4MS3B 1XTTA 5FUVA 2GZHA 3CG0A 3PIRA 1RMYA 3I9V1 4F4JA 1LJ8A 4ZTUB 1PGOA 3WY9A 3RR2A 1NBWB 3PPIA 4HLUC 2TYSB 2AK2A 2JG3A 4ZVRA 1ND6A 2HRBA 1I4EB 2WA1A 4YI5A 2I67A 3Q9LA 4C05A 5BSFA 2H5IA 2VTBB 1N77A 2DX7A 2VSFA 1OH8A 3WGTA 2Z56A 3A9CA 1D7AA 1VHQA 3LVBA 3TTWA 3LCRA 1TO6A 1R0XA 2Q4TA 1QONA 2NTNA 4HXYA 1KY5A 3LA8A 3CIFA 5JS8A 3U4DA 2IT1A 5DO9A 1MOQA 1C7FA 1GPH1 3OLZA 4PGMA 4L3VA 4GU5A 1M1YB 4NC9A 3ZWYA 2QG9A 1EHYA 2GZ3A 2XMSA 3R9XB 3URKA 2O2XA 4PZZA 5B6IA 5HM8A 1CY1A 3M6AA 2FN4A 4ICIA 4OQZA 3UH0A 3B1JA 1DIRA 5TMBA 2ID7A 4C0KA 3O26A 4J91A 1S2OA 2IUTA 2WOOA 2FWPA 2IYWA 1FRFS 4NYIQ 3UT5A 4JYZA 1PEDA 3L05A 4B73A 1UPUA 1C3CA 1UXJA 3NT5A 4AJOA 2R8XA 2WSIA 2VPZA 3PJEA 4NFLA 1F8FA 1ODIA 3BDIA 3D59A 3GEHA 4ISCA 4LDAA 1NF2A 2F48A 1V4BA 1YQQA 2N0SA 4YLEA 4O33A 3RW9A 4B48A 4IZ6A 1FBTA 4V2UA 2XCLA 5FDFA 3GD7A 1NXSA 2EXXA 2XB4A 1J33A 2X2OA 3ADOA 1TC2A 2RH8A 1C0KA 2Y27A 2HWYA 2PKXA 3B1WA 2KWIA 1NA5A 2J3LA 1NUQA 1RI3A 3C45A 1XRJA 3DE4X 4P81A 1XZIA 3VBEA 1E9CA 2HC9A 3JR7A 2ZP1A 3G23A 4WUVA 5G0SA 5HSGA 1Z36A 4BTLA 2FMIA 1B0PA 3K0FA 5C5DA 2IDKA 4EJFA 4EJSB 2CL0X 4RJLA 3T5TA 1BD3A 4GLOA 1MB3A 2HLDD 1Q95A 4I4IA 4WGGA 4KAFA 3CKYA 5F92A 3FSJX 4N8DA 4AQYB 5FF9A 1CE8A 1VMAA 1NZFA 1DEXA 1G4UR 3PHGA 3LKBA 1M2EA 4GBED 4QUIA 3T41A 5CA0F 3Q12A 1ZJ4A 3F7MA 3IAM6 4HXEB 2B1RA 1UBKS 4OGLA 2AZTA 1YIOA 1TRKA 1LNSA 4RVHA 3U7GA 4Q4HA 1O5OA 1UDWA 2HR1A 3I2YX 4ER3A 1WO8A 3WQHA 3ZN2A 3V2UA 4RF5A 3R9IA 3VDMA 2NPFA 4N7BA 3OQOA 2D5BA 3Q11A 5KYVA 1J8MF 1YRYE 4UD6A 3VYVA 2VDOB 1F4PA 4JLVA 4RZQA 4RVCA 5EFOA 2PJRA 1U90A 1MH1A 4G81A 1X7YA 4RA6A 5AIAA 1TJWA 4XSGA 4IIDA 2HQOA 2QDKA 2ZU6A 5EWJA 2ZSFA 3NRCA 4NCJA 4PN7A 1KI6A 1TF7A 2Z5GA 4GAEA 2XQGA 1T2UA 4LV5B 1P4AA 4IGFA 3BN3A 2CC2A 3O75A 4WCFA 3WDLA 5ADUS 4LJAA 3RB8A 3UVEA 1KJYA 4QFCA 1GTVA 2QV0A 1BDJA 1NIPA 3B5IA 3Q7RA 2XNCA 3GI1A 1RHKA 8ABPA 4BWVA 5FFNA 1OUMA 1EXDA 2SKCA 3U6KA 5B3JA 4FHEA 5FB3A 3FWKA 2HA3A 5L7YA 3DVQX 3L8YA 4AFNA 1PL7A 1UBGA 3FPEA 1J6UA 3DBRA 4KKXB 4WN9B 1ZESA 1N25A 5BUCA 2EZUA 1M6EX 3QJGA 1QDUA 5EMKA 3ZWVA 4MGKR 3IT3A 5TDHA 1Y9DA 1FUPA 2GCNA 4EEKA 4G1CA 4QSMA 5IKXA 1E60A 4OP2A 2C5BA 1VCOA 2JCSA 2G6TA 4O4IB 5ER9A 1B3BA 4YUAA 5JSZA 2OCBA 3PXEA 1A5TA 1RBZA 2M1XA 1RMTA 3C4QA 2VWHA 4I1RA 4EW2A 4DV4B 1BE1A 4G5FA 2OY0A 2XZLA 1SKQA 1E1RD 1NBAA 2FPIA 2V65A 3MRVA 4NX2A 2P5YA 4ER6A 4BX2A 3HZOA 2LE0A 3K53A 5FOQA 1AKYA 1IUNA 5ILOA 3ZU5A 3WHKA 1WXHA 3KSMA 4PYIA 3TRKA 4C4PA 3KZCA 4XASA 3OZCA 2EYUA 4I4LA 1VKJA 3DTVB 5FWXB 2E6UX 4JOSA 5IYZB 5KVCA 4D0SA 2V0NA 1U8EA 3NP9A 3V97A 4AY5A 5LDHA 5HRAA 2XMBA 1XEWY 2YL2A 3WA7A 3KV1A 4U1RA 1DAEA 2V3VA 4ZK6A 3FF4A 4FPXA 5LMUB 2NVOA 1VOTA 5FX2A 1AGYA 2HDNB 1SC1A 1I9GA 3K5WA 3TSOA 2ECFA 2PKRA 3USZA 1EGQA 1NMYA 1RXSA 2BMJA 2FZLA 4MLDA 3W04A 4WK0B 2VPXA 3AG6A 4WESB 2A9QA 3RI3A 2QD2A 3DCIA 3BWCA 3KTDA 1WX1A 3IKTA 1X1AA 1OB2A 4RL4A 5FLEX 1G6KA 4LAFA 2WHRA 3FAKA 4WASA 5D1NA 2BEVA 3SC2A 4DCMA 2XA1A 3F6PA 4QWMA 1WD7A 2I34A 2POQX 4CR8A 3CNNA 4G0QA 1XCJA 1FNMA 5CB4F 3U31A 1G63A 1YFMA 2AMJA 1E2LA 3AP2A 3ZDXB 5J2TB 3KSRA 2HF2A 2FKAA 3CEJA 4ZGGA 2YFYA 2BE9A 2O2CA 4LYEA 1G8AA 4IJKA 2ZWVA 1I01A 1T4MA 3EA0A 3QNWA 2R5FA 4HDQB 5KQLA 1E58A 1JHUA 1I3MA 2HK6A 4G1VA 1OZAA 3PKZA 3P9KA 1RBYA 5SV2A 1GR0A 1TMGE 1YE5A 5BWNA 1IEVA 2XCIA 2E6KA 3EG5A 2CNKA 1Y3DE 2ZJAA 2X8WA 2XD4A 5TVGA 3FOWA 3NXSA 3O1HB 2TRSB 5CLIA 3CW9A 1IY1A 5EPUA 3SMVA 3A2NA 3D31A 3ZK9A 3DZJA 4MX8A 1OYVA 1RPNA 2X1LA 3V1LA 1C4OA 2VH5R 3MTDA 4OL0A 1YQXA 3N87A 5A0FA 1WXGA 2G71A 4HYQA 4LRYA 1SBYA 1QFSA 5AR1A 4Z54A 2AV6A 4NBTA 1DQYA 1N1EA 1MOZA 3K1ZA 3TTUA 2P8SA 1ZMXA 2C84A 2JJQA 2P6OA 2QJFA 2AL7A 2JFFA 3HLKA 3IHKA 3LOPA 4Z7NB 1E3TA 3RKSA 1GCIA 3M1YA 1RI5A 2DWUA 3AONB 4H2DA 4PBRA 2O2HA 2ECKA 4QOEA 2HMYB 2XA2A 3DO8A 5AI9A 1QVVA 1JG1A 2AXQA 2W8BA 3ZGYA 2OFXA 4MYDA 4LPKA 3MAJA 3QU5A 5IDYA 1G66A 1RNLA 4AB1A 3RYIA 3VR5H 4S1PA 1SG9A 1BO6A 3PFIA 2R7NA 4Z3OA 2ONCA 4HN9A 4A5OA 4IDCA 3WP1B 1BYUA 2CFIA 2LVBA 3NB0A 3PPWA 4CGYA 2ZYDA 2VQDA 4EG8A 3FHLA 1ILEA 2G3YA 2J45A 3TVDA 2ZYIA 1XC7A 5A4KA 1CVRA 6AT1A 5JLJA 2I3AA 1WKCA 2CV2A 3LZDA 4OBBA 3JCZA 1H2YA 1I2AA 1R37A 2PD3A 4D56A 5BN5A 4AIIA 3MGBA 1E5DA 1QQ6A 3NFYA 5DNDA 3BUSA 1R9MA 2RJOA 3IB3A 3MCWA 3NATA 2OORA 5ALFA 3HMKA 3TTXA 3FHTA 5C3UA 2YCLA 4Q19A 5B4TA 3UZUA 5JE8A 4HDOB 4R7ZA 4NYIR 1OROA 3AYZB 4TWZA 2ZXEA 3DA8A 3IELA 4H9GA 1LWNA 4NF2A 4KE6A 4KDFA 4MCJA 2UXBB 4Z53A 4GT1A 4U9UA 1EG7A 1I6WA 1SZCA 3GCGA 4GBMA 4MA5A 4NV3A 3WV5A 2DHDA 4DLZA 4ZCRA 5JH7F 5K6AC 1N2CB 4IDNA 2AEMA 1W52X 1OIWA 1J56A 1H4QA 2VATA 2E49A 4ZI7A 1Z26A 1KY3A 3S40A 2QN7A 3M4JA 3OZSA 1XWOA 2P0YA 4Z8XA 4I81A 5K2OA 1WCIB 2EIHA 2FUNB 1FURA 2NU8A 3F9IA 1GSIA 4TZTA 1N6PA 2O7SA 4NOMA 1KE1A 5EESA 3VPSA 4W9NC 3LT2A 1AQ6A 3DAPA 2V6GA 2PUCA 3FOBA 5EKTA 1X92A 3FCEA 1YQ9A 1E4VA 4JR0A 5F91A 1I9CA 1FP4A 3NYQA 2BMFA 4X92A 3BULA 3CE9A 2H48A 1GGKA 3NHSA 4PQYA 4IGIA 4JOQA 1NI3A 2WAXA 4KG7A 3TTTA 2CNDA 4DQUA 1E2IA 1TYAE 2DCMA 2NSLA 3HEMA 3DV9A 2R8OA 3MTEA 4NAVA 4Q1EA 4RQBA 5NULA 2FQQA 2P5SA 3LSTA 4QM7A 1VFPA 3H3FA 1KJWA 1YKGA 3PUWA 3EQ7A 1QFYA 4I6GA 3X1XA 4FMCF 4BTVA 3AHGA 4TMVA 2LZ0A 4WJKB 4ZRMA 2NNWB 2V7UA 2H31A 1XKQA 2R97A 1G7CA 1LJLA 3A27A 1JZQA 2PSHA 5M7EA 1JAHA 4KRGA 4ZARA 5JAQA 1THGA 2WVHA 1Q7CA 4G07A 4CW7A 3OTWA 1BE0A 1Z39A 2O2IA 1V4VA 2C2BA 3DHNA 1TTPB 3PTZA 4X1IB 5DTJA 1R0KA 2GILA 2ZAOA 3BCUA 3L7DA 4OYYA 1JR3E 4PC7A 4KIJA 5KNCA 2VLIA 2W0MA 2Y71A 1AU9A 3OTQA 3FDFA 2JJ2A 3H2YA 4WFIA 4FEYA 3ZEAA 4I1YA 2PUHA 2BGGA 1QLJA 2GYWA 4HR7A 1M76A 1TZCA 5EMHA 5LDGA 4B2YA 4LHWA 2OD7A 2H0QA 1C29B 1WHTB 2FQ1A 2JK1A 5HQ3A 2GNAA 5JDIA 5FULA 1AX9A 1Z6PA 3PNBA 1JPJA 5DXJA 3AOGA 1RP7A 4M89A 2ZFUA 1MZVA 2FPRA 4MYHA 4TPKA 1E4EB 1V3UA 2GLTA 1Q0TA 4DM4A 4YO7A 4LRUA 5C4GB 4Y30A 3Q7PA 2GN4A 2XE4A 5AVKA 4CLRB 5KJ6A 3LX4A 4DV7B 2IVFA 3D43A 3EC7A 1GXSA 2BDTA 1IRIA 2R48A 3DYBA 5TRTA 2P79A 3QKIA 4ZGBA 1X19A 3SBOA 1MMFB 3OM0A 1NZJA 5K4AA 1UZLA 2FZ4A 3OJFA 1A04A 3ISVA 1W75A 2C5AA 2NTVA 4JT4A 4F93B 2ESRA 3NRJA 4EG7A 2NUPA 2YXEA 2ZPUA 3D6JA 3GYGA 3KQQA 3K0BA 1W30A 2M2IA 3LFTA 1PO7A 3BREA 4KSCA 5HOQA 1OTYA 2FDCA 3HV0A 2NU7B 1GN9A 5JQGF 1JT9A 1J7KA 2JAPA 3O4FA 1Z45A 5AM0A 5JRDS 3GJ4A 1E3SA 5SYNA 4MR7B 5HG0A 1ARZA 3BA6A 3KPYA 1TKBA 3N8HA 2GS9A 3L3BA 4GLJA 1M1ZA 4NOJA 5ULLA 4QT4A 5IJZA 4J0EA 3ZW9A 3LGXA 2HLNA 3IIEA 4OOFA 3GFRA 1KO4A 2ZPAA 3TKLA 4EEIA 1O6ZA 1CZRA 5ES4B 4BKRA 1XXHE 4BV3A 2PD4A 1CRZA 3U37A 2GK6A 2FRDC 3ESDA 3EQ8A 2JKVA 3WK7A 4A0GA 5JCPA 1F2TA 3PEFA 3VH2A 4B45A 1KFBB 3QV2A 4IRUB 4L72A 4UUPA 3CN7A 3DNFA 3OO1A 3LE8A 4MQ5A 4X6LA 3RUEA 4A23A 4B3DA 5CK5A 2J5KA 3NBXX 1YUNA 5K8VA 4JEIA 4Y9SA 2ISCA 2E5WA 3PE3A 2QLBA 1TNDA 4IDOA 2BEUB 3R9WA 3K92A 1ECGA 4K5QA 1N34B 1BN6A 1X7WB 4HQOA 5ALZA 2W2XA 3GDOA 3D6HA 1D1SA 3EPHA 4EGFA 3KQYA 1LTQA 3VMMA 1Z7YA 2QRQA 4J0QA 1L8AA 3JQQA 3IJEB 4I8DA 1QIGA 1EUYA 3K2QA 5BQPA 2PZBA 2F64A 1GO2A 1KAGA 2QL9A 1AHNA 1V6CA 1YOBA 4IHJF 3SZLA 5BNFA 3PUKA 3BILA 1XRNA 2FK8A 4L51A 4CF7A 1NUHA 3BK7A 1MEEA 5DBEX 4YLYA 4II7A 1VGVA 5I9LA 2VF7A 4OLJA 1RWVA 3OLQA 1QZZA 1U02A 3OMLA 3KR9A 2BFWA 4CMEA 4E0BA 1RKBA 2XRYA 5C8ZA 4AROA 4OMUA 4ND6A 5HNKA 4WLFA 2YVLA 2OCAA 4RDIA 3ICCA 3ENWA 3N70A 3A9TA 5CNKA 4KR2A 4Z9XA 2NTEA 2P7HA 2E4YA 4I5FA 1WRBA 4KIFA 4W1QA 4J1QA 2CLIB 5BT8A 3DDHA 4WJZA 3NVKI 4JJEA 1U4OA 1ZJ5A 3GGJA 4Q1FA 4Q4AA 3TJMA 2RGWA 2RI0A 1YWGO 4Q4DA 2VUSA 4CU5A 4YTEA 3STHA 4A0SA 3LQRA 3WGGA 2Q3EA 4FKBA 3M70A 2CWDA 3CUVA 5HCIA 1TIKA 4R9RA 1Z5PA 5B5SA 2BGMA 4GL2A 4J1NA 4B7UA 1O08A 2OXIA 3UMCA 3ILVA 3O8DA 4G4IA 5HFNA 2FZKA 1XF9A 2GJAA 1T8TA 3CX6A 4NNJA 4ZJZA 5AVYA 1O4VA 4FYWA 1Z37A 1DS6A 3VR6H 4A2QA 5F5LA 3T5CA 1E6LA 2G1KA 1L8XA 1SBZA 2H5LA 3H9GA 3EIQA 1XOIA 5DBIA 1T1JA 3ZXIA 3WOHA 5KYGA 3L0BA 3T9BA 4DMCA 3VJKA 2AF4C 3WLJA 5AVZA 4TUYA 3IQEA 2D2EA 2XTMA 3V9AA 1IIRA 4EI8A 4HRAA 3NM5A 3ONWA 3PC4A 4ND2A 2Z8YA 3NJRA 3G1UA 3E04A 1Q0SA 3AIOA 2B8JA 2JFNA 3A7DA 3BWDD 3FJOA 4GUAA 3WNVA 1OT5A 1ZCJA 3DR5A 3P4UA 2OCLA 2MSKA 1E7RA 3ESRA 1POXA 2R7LA 3P9IA 4NBWA 4BZZA 1JG4A 1GCAA 1TJ3A 4MROA 1TI7A 1U1FA 3VH1A 1X1RA 3L82B 5EY5B 3TQOA 3V4OA 4ZZ3A 3TN7A 3UV3A 1D0IA 3QWFA 4XM0A 2DVMA 2GF2A 3WKEA 1USGA 2ZXFA 4UEWA 3B3GA 1OOEA 2W6QA 4LI3X 1JQKA 1AC5A 1H2XA 1IAVA 1J4AA 3GB9A 4H17A 4I4CA 3GBVA 2YINC 1VIMA 2MSWA 1LLQA 1YZ3A 3HC7A 3LLMA 4NBUA 4IZOA 1PUIA 1U8TA 1U81A 3RYHB 1U0BB 2XBMA 2JGJA 2CLOB 4MP3A 5TARA 5C7YA 5LA6B 1GQRA 5D7NA 1T6ZA 1ZOOA 1PDWA 2QTRA 2IH5A 1NW4A 4WK4B 3UK2A 2GBLC 3AM1A 1J0CA 1VCHA 1I51A 3FFBA 4MPJA 4BBJA 1GAEO 2Q5EA 2LCFA 4GYYA 8AT1A 3T5PA 5LQAA 1DAPA 1KAQA 1UM8A 2PX6A 3CV3A 3AFOA 5AOVA 3ROEA 3KKLA 1ZLXA 2EWMA 1E5TA 1V11B 2MDTA 3BKXA 4P8RA 2H4ZA 2Q6VA 4BB9A 4KQXA 5DIZA 4BQFA 5IM4F 4V0ME 4CN8A 1Q19A 1T0JB 1YB6A 4V1CA 3ESCA 3QPCA 1XMPA 5KNCD 3K09A 1WMFA 2VP5A 4DCNA 4HV4A 2VH2A 3LBAA 1KU0A 3L4KA 4DS3A 1Z0KA 3IAAA 2JJ2D 3H9QA 5I4KA 5TPZD 4QQ8A 1QO0A 4IEIA 1GITA 1RCTE 2D7DA 3K16A 2H2HA 3MK31 1LS6A 5EIOA 3JVIA 3BHMA 3ZW8A 4H4DA 5LXTB 1D1TA 1SQ0A 2PQ2A 1NMSA 3MTBA 2C4TA 4LOLA 4LYGA 2AFIE 2IF2A 2VOEA 3DNPA 4Q12A 4UBLA 3UV7A 3HTXA 5AJTA 1QWSA 3MSXA 4ZEWA 1PQ4A 5EZQA 1AT1A 4G86A 4NH4A 3OOSA 2QMOA 4UW9A 2OGSA 3SJ7A 4BHTA 1ADCA 3TMKA 2N46A 1PVVA 5CCBA 4UDXX 4MW4A 3LZCA 4F96A 4GG1A 3ZLTA 2E4XA 5KTTA 1K4KA 1FCJA 1ENOA 1MBZA 2OV2A 1T8RA 2NO7A 4UUBA 1JLSA 1YI0A 1K3FA 2HMVA 3R7WA 3MIIA 4OQXA 3QUSA 1E9EA 1VL5A 1NV8A 1GV1A 4AZTA 5AVVA 4TYQA 3V7FA 3VO9A 3B89A 3FOAA 2G4CA 1NRXA 5DT9A 1ABBA 2J46A 4DLNA 5JJBA 1JTFA 4BMNA 5KSOA 3R3UA 4LRXA 2C4HA 1C0PA 2YN4A 4NYMQ 1ZONA 4E08A 1D7OA 1Q1NA 3H2IA 3LIIA 2NADA 3B51X 4HZGA 1C8BA 2FXIA 2F9LA 4JLMA 3CCBA 1RJ9A 4R1OA 5D01A 5D7BA 3CWQA 4KW7A 1JXAA 4AJ1A 1GGEA 4BZPA 3AQIA 3V8MA 3A6PC 3N2EA 3KKEA 1I5OA 5JD6A 4MEBA 4WFKA 1GZSA 1O87A 4QDTA 3NDPA 3GJQA 3EFOA 3N2NA 3C87A 2ADOA 2BFDB 2SECE 3CLVA 4W5JA 4B47A 4KN5A 1CQJA 3IVGA 4CLOB 5T7BA 4LFCB 3BFXA 1JBQA 1ZIOA 2Y1XA 1LPMA 1NX9A 3PICA 3G89A 2ZYRA 3I8XA 1KETA 2V7GA 3NETA 1UT5A 4M60A 2CMKA 5IULC 3HFJA 2YJ5A 2HFJA 4OEHA 5HKOA 2NP7A 2QRHA 3OH8A 1U7HA 2VJMA 5HCUA 1CIVA 4RDXA 2C1ZA 1DKPA 3ZGNA 4E03A 2IZ1A 2WTEA 3L0SA 1P3JA 5JO0A 3FBWA 1W0KA 4YCCA 4PHFA 1CUFA 2Z3VA 4WKOA 4X1KA 5G1OA 4QGSA 1IK6A 1S7GA 1PEKE 2W11A 1V48A 3IP8A 4G41A 5CYOA 3WYGA 5F23A 3T1YB 2NU9A 2W83A 4H0NA 4DG8A 3GH3A 1DAIA 1D03A 2GQ0A 4D5GA 4TROA 2O7QA 1DG1G 1M7BA 3E15A 4FYJA 1RCUA 2ZPTX 4XEUA 4Y2HA 2XB2A 3UJDA 3PR3A 1P4SA 2RD2A 1DCFA 3P20A 2X9QA 1U15A 1Q0PA 1T6XA 1U6KA 3W2IA 1UXGA 3PC2A 4KVZA 5CFLA 2Z9CA 3SOZA 4B3SB 4NNPA 1K7CA 1P5HA 5FAKA 1JEJA 2PA0A 2HF8A 1R0LA 2O4CA 2J7PA 4MQLA 2IV7A 1DQSA 3JW8A 3PITA 4A6EA 3UJHA 5AKKA 4Z4QA 4NZZA 1Z4LA 3O8OB 1NPTO 4J03A 3IFSA 1NUTA 3KS9A 4EHHA 2O8FB 4M8SA 4IMIB 3ZGXA 2QL5A 1U1EA 1HE3A 3E8XA 4AURA 2PCJA 1VSBA 1V0JA 2QJTA 1YAJA 1NV9A 2PNFA 2XTZA 4P08A 4RM2A 5JSYA 3KDSE 3EW9A 4JGIA 2OFWA 1M5RA 3FG9A 1NTRA 4CIYA 3MMXA 1GYQA 4WVLA 4KWEA 2V7BA 3EUEA 1H2EA 2AUMA 3QFHA 2BM1A 3F4LA 4N5NA 5DE3A 4AY3A 4Z4CA 2QR2A 1MQAA 1R9NA 3KZNA 4X45A 4D0GA 4QLAA 3NVDA 4N01A 1KK1A 3WMWA 1CWUA 1UPXA 2DJIA 4ZAWA 5AKGA 1FRQA 3SNHA 1FSFA 1ZU5A 3S1AB 3ITNA 4LC0A 3GVXA 1WPXA 3CEPB 3MEQA 1MNAA 5HPYB 1P7PA 2PSSA 1KO8A 1UPAA 3D2AA 3QPVA 3M3HA 4BNVA 4DCSA 2VF5X 3R7FA 2GBFA 2QRZA 3OWOA 3TI9A 1A8UA 1M34B 1P9NA 4LVUA 2G17A 2C3YA 5AI6A 2C99A 4OF4A 1XYGA 3O4GA 3VO1A 5CDHA 1GYPA 4LFAB 2AYXA 4XD2A 1GCOA 1TIBA 1ZH6A 2OBFA 4KTVE 4JXKA 4CLHA 5L3QA 1L7VC 3GLFA 2DKOA 4L27A 3A9WA 3HXOA 1WB9A 3F73A 1WABA 3FPAA 3PJFA 2V97A 4J43A 1EVZA 3ROGA 4ZYYA 4AY2A 1X0VA 2X76A 2A3RA 2CN1A 1RC8A 5HS6A 2HJ9A 5BO5A 3FHCB 1GQYA 2POCA 1DKNA 3LPMA 3AHFA 3DMPA 3M6VA 3QXCA 4N7RA 4QUGA 2FWNA 4RZUA 4U9IS 5ELLA 3SS8A 5JUWA 2NQTA 1ZQ9A 1TT7A 3K8QA 3O2NA 1O0CA 2P2LA 2QPLA 4OXKA 4EF4A 1PS0A 1JXOA 1M8PA 4RMGA 4BVLA 2OBXA 3PUJA 3QOXA 4MVYA 3EQZA 1KBQA 4UJ5A 3DHYA 1GAJA 4Y18A 1V8PA 4YCAA 5H8WA 3K31A 3OPNA 2OXTA 1CQWA 4OHVA 5DLQC 2QT1A 3SKYA 3BL8A 1D2NA 1HM5A 2VK1A 3U16A 2XNHA 4Z49A 3IAS6 2BEKA 3JPYA 3GEIA 1K92A 2FGKA 2QEQA 4PQGA 4ZQBA 2IBSA 1P0CA 4L4ZA 4XX0B 2HL6A 3IJRA 4B4WA 3KCNA 3PC6A 1CQPA 2R3SA 4JMPA 3SJBA 4ZOBA 4BKOA 5DHTA 2G0TA 1Z2AA 3UFXA 2XCOA 3DVLA 1M9NA 4IMPA 4M7WA 2I4LA 2OHVA 3OPMA 4DIDA 1QO0D 4Y1FA 3TQHA 3AHIA 3B1KA 5EGNA 2GHTA 2GM5A 3EZ2A 4CMAA 3P0HA 4EKEA 3WRXC 4DIOA 1YDHA 4HVCA 4R51A 4PONA 3ZR4B 6NULA 1VPTA 1QXSA 4PLFA 5CM9C 3P8ZA 1AS0A 5JO9A 5IZCA 3FOCA 2W0SA 2WKPA 3IH5A 3OX3A 3ETLA 3QXXA 2PCLA 4IR7A 5DLEA 1I10A 5AW8A 4RIFA 2BSXA 2IGBA 2DXIA 2B4RO 1YJ8A 4I8IA 2QI9F 1WDLA 4HH1A 2QUAA 1IULA 1X42A 4Y3UA 1WCYA 1M1UA 1A77A 1WMAA 2EATA 3SLKA 3WRVA 2Z43A 5DULA 5IANA 1WXQA 3EN0A 3JD4A 4IOMA 2Q6LA 4K9PA 3VH3A 3NHAA 1M6NA 4PC1A 4QNNA 3I0NA 4XVCA 4F92B 1D0VA 2GCPA 5IXYA 2ZT5A 3ZQJA 1EWVA 2QP9X 4F4CA 1MC5A 1HDXA 1MPXA 5I4BA 1Y8RA 3CHYA 4MV3A 3QEBZ 1WR8A 3MS7A 1QLWA 1QYRA 1L4NA 4FD2A 2ZQYA 3FTQA 4IVPA 4YRSA 1RC1A 3BA1A 2D3WA 2H4HA 1ZMTA 4JYCA 2E9FA 5CPBA 1L3IA 3KL2A 4KYIB 3INRA 3TI7A 4G5QA 1I13A 2C82A 4IPTA 5D6NA 1OPXA 3H83A 5I7WA 2EZTA 1QGED 1DT5A 1CS0A 3HXMA 2H0RA 3MILA 4YP0A 3UXMA 1J9GA 1PJZA 1D5CA 1MQ8B 3T6KA 3DDNA 4YPOA 4APAA 3G9TA 3P52A 2OVFA 1G2IA 3RC9A 6GPBA 5AI5A 2CDRA 4D6YA 1YZYA 3CBQA 3WYDA 3LF2A 1N8TA 4DTIA 3QE2A 3L46A 4GOND 2A86A 5HE8A 5KKAA 4YUXA 3PPYA 5CX4A 1O54A 4BFSA 2IFTA 2JLCA 3ANYB 1VKOA 1TT5B 5K7SA 2OFOA 1UPTA 3CJTA 2C07A 1QBGA 1YCHA 1U8CB 1ZA1A 2HJGA 5FUYA 3TW8B 3WX0A 1C7RA 4EY5A 3KQHA 3TAUA 2C8JA 3IQHX 5JZSA 1RFGE 1E1NA 1NN3A 2CXRA 3DF7A 2EWVA 4J94A 4U5QA 5E7QA 4NS1A 1VE9A 1QGDA 2Y6UA 1SVKA 4JB8A 4JZYA 3R8FA 1I1OA 4N3GA 4NYMR 1W1UA 2B5WA 3CH7A 4J2HA 4TM8A 5EMNA 4Z6KA 1N1MA 3LHKA 2JFWA 4PEVA 1W2HA 2BF7A 1WXDA 1JA0A 1LC0A 4TV8F 4MUIA 4N49A 2FJUA 4B4VA 5KOJB 3WGIA 1W0KD 2YRFA 4C7OA 4J4TA 3HVRA 3DR3A 5FNVF 1G5RA 4PBSA 3MJTA 1R6UA 4RVFA 4YRMA 3R5TA 3ZCRA 3ZWMA 5HJEA 2FSPA 1CEQA 2HSDA 2EAUA 2BJHA 3DEFA 3JQBC 3M2TA 1EE9A 5K8TA 4W5OA 4FMPA 4D81A 1Y82A 4DZTA 1POWA 4EG0A 4FFBB 5JJKA 2XRMA 3AL2A 3KKZA 4JGGA 2OHIA 1FDUA 3K8YA 3G2KA 3PHIA 4P5EA 3LUBA 4QOHA 1Z08A 1YR2A 4M38A 1RVV1 4WEOA 4IX1A 5GJCA 3SMQA 3ZQUA 1R0BA 4UE2A 1J23A 1W4LA 4AC9A 1MRNA 2QUBA 4JI2B 1T4CB 2B34A 3S2FA 4CT5A 1WSDA 3UMFA 4ZEVA 2IELA 5KSYA 1LKZA 1R6AA 3D6NB 1WVIA 4ZMSA 4NPAA 3ZE6A 2DFDA 1VJCA 5EEGA 4CCYA 1MW9X 4PX2A 2I6UA 5FR1A 2GSDA 3M81A 4QO8A 4KC0A 1AB5A 4WKPA 4CDMA 1GKYA 1Q44A 4EEXA 1BVHA 1YZHA 1HRDA 2OL4A 1WMDA 2OSVA 4FDUA 4TS3A 3TLGA 1E7MA 1TZMA 1U3VA 3OZXA 1WY5A 2NPIA 2OO5C 2PRZA 3R3HA 4LZLA 4M1EA 3GLGE 3L4BA 1A7UA 1UK7A 1FQKA 3GF4A 3QY9A 5JPDA 5J43A 3AVVA 2J67A 1IWPB 1RHJA 4CODB 1JBEA 1BS9A 1E3QA 1L4LA 2MSDB 3IX7A 1KJNA 4YRAA 4ZKDA 2XF2A 3C3MA 1DC8A 4GO1A 3WB9A 2AI1A 3P19A 1RJWA 3GGGA 5AW9A 2VEDA 5AW0A 4PCLA 4B3IA 3IEUA 1Z3CA 4HNAA 1QV7A 4C20A 3U3KA 1SB9A 2O8EB 3MXOA 4MUBA 2FMFA 1UFOA 1WBJB 2WINI 5TLSA 2PL9A 3EBLA 4RPLA 4Z4IA 1T6BY 3EVFA 4H35A 1O5IA 5HUJA 1ZSNA 3HDJA 1GG9A 1TU3A 1T8PA 2BZGA 3T15A 1UC8A 2P67A 2SHKA 2FOIA 3PNKA 4Q01A 4L3WA 5DTEA 2W6CX 3Q3IA 1SQ6A 3CVJA 4FI3C 1OH6A 1QWOA 1XXHB 3QVVA 4CGZA 5ALTA 5SZJA 2O1SA 2NSDA 2FRXA 4UNPA 1JFFB 4RHEA 4I2VA 4KR9A 3AMVA 1D04A 3GLIA 2X1MA 4ILEA 2XSZA 4PRLA 1US8B 1P3DA 1AQIA 4MWTA 1JPUA 4Q00A 4ZVTA 1U63A 3BXFA 2RH4A 2CUKA 2X6QA 2CLCX 3ZQ6A 1ZGHA 5C3MA 2R751 4BQQA 3RS5A 4H1TA 1B1AA 4XJTA 3JQ8A 2ZB8A 3V8VA 1D1PA 5C46F 1RPTA 3N2GB 1U3DA 5HIKA 4G0VA 5FOWA 2RGYA 2R4TA 3GA0A 5CFOA 1V8DA 1SUCA 4HZIA 3Q98A 3TRIA 4D4HA 5AHXA 3CNBA 1RLMA 4ZOCA 3OPXA 4LVOA 1XTUA 1GTRA 1AE1A 2A5GA 2PZ8A 2WWGA 3I2FA 4DNXA 1GPDG 3EG9B 5C81A 1PV4A 3HVUA 3ER8A 3PXAA 3ZIAA 2ZQZA 4XB1A 1PT9A 4ZC8A 2ZYVX 5ICGA 1GZUA 3QSGA 3K72B 3JZAA 4HD8A 4UULA 4M0EA 3VQTA 1HL3A 3ORHA 5E1MA 1E2UA 3GO4A 3TOXA 4AAYA 2TMGA 3QHPA 3NMUF 3W6NA 1YHZA 1N6LA 4MQ6A 5LPNA 1JE0A 2O1WA 3P4YA 3PEUA 4GXTA 4HG2A 4DIKA 3THXA 1XQYA 1P0IA 3NH9A 2QAGA 2AF3C 1V9CA 2EC5A 2GF9A 4IJMA 1K8QA 4HGVA 1KQOA 4CIAA 4A0RA 1M2OB 3BB4A 3BIJA 3YASA 2ZRFA 4AVYA 1BW9A 1K7EB 4L57A 1DCTA 2X5OA 3LDFA 5DYNA 1MV5A 4M7PA 4O25A 4AJJA 3W77A 1HDOA 4HX2A 1N6HA 2HWUA 2F67A 2KLHA 2PUJA 5EQJB 2IXFA 2XV1A 3LPNA 1O1YA 3EXFA 3L7YA 3NIGB 4NV0A 4DA9A 3B60A 4I99A 3KJQA 3D4PA 3VSDA 4TTAA 5LL6P 2JLBA 2ZE6A 1E62A 4I1UA 1LB1B 4A8TA 1Z15A 4HX9A 4QEKA 2BE7A 2XIQA 3UAVA 3F2VA 3R3ZA 1LBHA 1PGNA 2EJCA 2G83A 4DEVA 1KNXA 1U7DA 3TSWA 3ISJA 1KIFA 3E5MA 1D4AA 2I3BA 5BRNA 2IHTA 3DMTC 3GJ3A 4X3PA 5K4HA 3V4VB 4DCUA 1PR5A 2O59A 4QYXA 3KT6A 1INLA 1WOMA 1SHLA 2GCOB 2HPHA 2FWBA 1KFKB 2QL6A 4KE7A 3WLAA 4KVGA 1E0AA 1DC3A 4B76A 4JNKA 5B1DA 3HCCA 5COBA 2AJDA 3IP9A 1DXQA 2IYEA 2VP2A 2WP8J 1Z16A 5EI5A 3B2NA 4HH3C 1QH9A 3ICWA 1PU2A 1KSHA 1MFPA 1O94C 4EB3A 1ST2A 4MUFA 5AK3A 1W88A 1C4XA 1XTPA 4H7EA 2QA5A 5HZKA 4CR7A 1B8VA 2FGJA 2EX4A 1JTVA 4HQ6A 1W73A 1U99A 3AR7A 3WMEA 4F2PA 4CIBA 1H94A 1BX1A 1C3EA 1UMBA 2RBKA 4H4EA 3K15A 1E1CB 3MJEA 5D3MB 1SVSA 5SY4A 3KRTA 4GFDA 3CT6A 1KVSA 2KBFA 2UKDA 3AF3A 2P9YA 3VPXA 1V35A 2O54A 3N2YA 3SJZA 5HP4A 1E0DA 13PKA 4DV0B 4S1NA 2A1IA 4Y9RA 1MB0A 1R10A 2C2KA 3HNPA 6Q21A 2O0LA 4QOSA 1ZK4A 1C41A 1FS5A 1DIBA 2FHSA 3FYTA 1GY8A 1I3OA 3JWGA 3K6RA 2CZQA 4N3CA 5AW6A 5BSUA 2OWEA 1DQPA 1OZFA 4NPCA 5BV8A 5JTUA 1NN5A 4WLUA 4YAOA 4KLZA 3U60B 10MHA 1DINA 2YVUA 1HTWA 2W2KA 3FPJA 5CYFA 4O2RA 3GG2A 4HNSA 1TEZA 1SPBS 1II8A 1K06A 2E89A 2G72A 2YQZA 4Z9YA 3CWZA 4FBGA 5J9FA 3SHTA 1RWOA 3LCJA 4DT1B 3S8EA 1J8VA 2GT1A 2YZMA 4TQAA 4WFJA 4CEJA 4HMQA 1WF3A 2QRMA 4GVPA 5JZMA 2A35A 4ZANA 1GRNA 3BWBA 4B4DA 4DY6A 5CBPA 2FMXA 1XLUA 1I0ZA 2XUOA 4OI1A 3SEAA 5K03A 3T7KA 2VTKA 3OQIB 2XB9A 3Q1KA 4A10A 4EZEA 1YVRA 4JX8A 5LP6A 3QLEA 3OZ7A 1P19A 3LIPA 4UC0A 2JI7A 3AJ8A 4DNQA 1RVDA 1KYVA 1TVMA 2PMCA 3N76A 2XGMA 1FE8A 1R8JA 4LYFA 4CCAA 5FXMA 4MV6A 1KHHA 2HN9A 4JEMA 3OOJA 1V2GA 1Z5NA 1I1HA 3L1IA 1KZ1A 1W2WB 3EIEA 4MV4A 2UAGA 4S1VA 2Q4OA 5KDDA 2AFIB 2DU8A 3RJZA 4JITA 4QYIA 4RUKA 3TL2A 5CD1A 3RTGA 4DC1A 2HCFA 1EM8B 1F20A 5G1NA 3IKMB 2C96A 3BTOA 2C9CA 2GFIA 1H1LB 1KDRA 4DJFC 4RD1A 2VDUE 4HMPA 1YZTA 4QU8A 5DP2A 2IYVA 1DXHA 3FFTA 3H1AA 3I6ZA 3LOQA 5GMOA 2QX9A 2WVGA 3CLKA 4G1EB 4HGPA 1JR4A 2QZ9A 3WZMA 3RJMA 2J9GA 3GD5A 1A97A 2YWHA 2WKSA 1FFSA 3NKFA 4JB3A 3ZS9A 3KFXA 2RK4A 2E4AA 1OWPA 3VSBA 4FX2A 1JA1A 4ZCLA 3ZWXA 3QU4A 4FGKA 2W70A 2D7CA 1VL8A 3E3AA 3J80A 3D6UA 2J0UA 4HEA6 2AWOA 1T3HA 1W5FA 2W00A 1GPBA 3MMPA 4P58A 4YDSA 2UVDA 3RIMA 1AY0A 1XMJA 3BKWA 1WXIA 1UJ4A 2QRLA 1DKLA 4AZ0A 1DKRA 1HX7A 4IKPA 2XOXA 4GQAA 4N7MA 4AJKA 5DGCA 4B6GA 4Q1AA 1L7AA 2ZVQX 7REQB 5L3VA 3CVVA 4MVJD 4JI7B 4YACA 3H04A 2VDWB 3EIWA 3A1TA 2WHPA 2FZGA 2QVCA 2RHMA 2EGHA 4HPJB 2XSZD 2Q7XA 4PIPA 2IYYA 4ZYVA 1LNQA 3LDUA 3PFNA 3F8SA 3RVSA 1Z6AA 1U9JA 3VYTB 5BWMA 3H75A 4KPGA 3QVGB 1C0LA 2FG5A 3FVTA 3PQ7A 2Y1LA 4D97A 1YR8A 5KWSA 2NQ8A 5M5BA 1DV1A 2C2ZA 1THZA 1YZVA 2ZRKA 2AYZA 1VKRA 2C8VA 3BH6A 3D4BA 3FE2A 3GEGA 3M9XA 4OP3A 2E1PA 4PYRA 3U44B 2PS1A 1G17A 3LQ1A 4PLVA 1XZLA 4ZT5A 3LY5A 2OQVA 5JRZA 1UCFA 5JY1A 4N48A 2JIRA 1QCDA 2D2IA 3STXA 5JC1A 2AQ8A 5JAOA 1K8ZB 2QLTA 3L0CA 5D85A 4FGZA 5GM2A 2W2PA 3OLYA 3GFSA 3RBXA 3Q10A 4RXTA 1CV2A 3WBJA 3A25A 5H7XA 2ACEA 3LI2A 3ZIAD 1Z0IA 2CLHB 4J0FA 2VYVA 1BXRA 1KH1A 4YJFA 3GJ8A 3IP7A 3F47A 3TPFA 4DDVA 2JARA 3HHEA 1C1DA 1JI0A 4DZRA 5CDFA 2ZBEA 2E1RA 1O95C 3OP1A 4B35A 4MV8A 2ZAGA 4PQFA 4QLBA 1AN9A 1IZ7A 2FEOA 3Q2OA 5L4SA 4ZP1A 1V71A 4INAA 3CZ5A 1C3XA 1UKZA 1WU7A 2ZBUA 3K0AA 5CB0A 2I65A 3AILA 1RYEA 2HD4A 1OWLA 3BOSA 5I6DA 4I9NA 3BMQA 4HQRA 2G4VA 4CM8B 1SCQA 1MRZA 5BN3A 3ZK8A 2V9PA 1IZ9A 1XDSA 1IXRC 2VBFA 2OR3A 2J3JA 4Y2SA 1DXYA 2NGRA 2WKWA 2ZRCA 5FTJA 1N2GA 3ZTWA 4YRFA 1BOOA 3AM4A 1Z17A 4KO2S 5ECYA 3RYCA 4F9TA 1AUXA 1T9GS 4KSYA 1PZNA 3R6GA 3BD8A 1XQXA 1IUPA 5CA1B 1O2DA 2Q5CA 5H0IA 1D1QA 1NVVQ 5HMLA 1X1TA 2CKMA 1UT8A 3N0TA 1GDHA 2J0QA 2X77A 4HOYA 4TWIA 4Z9BA 2XDAA 2I2WA 4N3BA 1CY8A 1C3VA 5E2BA 3BWVA 3ZDFA 3QBDA 2BJWA 4JYBA 1JLRA 2PZGA 2BGJA 1XALA 3LUGA 1IQUA 3N7AA 4OFWA 4WY5A 3RKRA 4F56A 2GD6A 4D46A 3A4IA 1U6JA 5L45A 3W8DA 1GPJA 3AU8A 1J00A 4W5WA 3AJEA 4HFJA 1S8AA 4OQLA 3SNKA 5LQDA 3Q9NA 1ZVVA 2V6JA 2XQVA 1PWEA 1ZL0A 3CGGA 3H18A 1HEIA 1RYZA 4UBKA 4EHNA 6REQA 4PG4A 5LZ2A 4N41A 2B0JA 2F1KA 2FSSA 4ZI3A 3P0RA 4FD3A 2FQWA 1BH2A 3DLCA 1XMXA 4R8VA 2FTKE 1K0FA 1PS9A 2BI4A 2O06A 1N6RA 4OB7A 3RJTA 5EMMA 2OXRA 2RHJA 1U0OC 4O5OA 1U7TA 5IAKA 3WSTA 1VQ1A 4DMMA 3COPA 4LSWA 2YASA 4BE4A 1KKUA 1JLKA 3U39A 5BRJA 1KZHA 2TSYB 5KNCH 2QUHA 4BLTA 4EJ2A 3FF1A 4EB6B 4Y6QA 3QUBA 3FTFA 5AJXA 3D4LA 3A1NA 2W2NA 2O2SA 3G02A 1HE4A 2XYGA 4HAOA 1DG9A 5BVHA 1Q7BA 1SVUA 2V54A 2IOFK 4GKJB 4AWXA 1XKTA 2J7KA 2IQ5A 4OHOA 2RBGA 1Z34A 3LWDA 3OZRA 1XL0A 4J9VA 4C08A 3PB3A 3E81A 4HDSB 4HI0E 1YDFA 4DL9A 5JMTA 4X60A 4L5IA 4TWAA 4EITA 4G0OA 3IVRA 5IAAA 3DV2A 3JZFA 4W63A 2RC6A 3V80A 3OZFA 5KNBA 3V4ZA 1Z7EA 1KQ3A 5BQ5A 1FX0A 2X41A 4O2AA 2Q0XA 1GAXA 3PYMA 1EUZA 1IRXA 3HRIA 1F60A 1D2GA 2WSSA 3JALB 4KGDA 3WO1A 2PVCA 3DHWC 1OLSB 1QLHA 3MINB 4MO9A 3I32A 1NFRA 1H8EA 2IPMA 3DVAA 3TX2A 3A1DA 2A9FA 5A71A 2YY7A 4MV1A 3RVMA 3EAFA 1IEWA 3EOZA 2YMLA 5CX1A 5HGJA 4HL6A 1Q1QA 2QLMA 3LC0A 4PSUA 4YJ3B 2QYHA 3SKXA 5B7GA 5JOQA 4JJ7A 2LWIA 4PTLA 5LBUA 1FMCA 3EIFA 1FXWF 1OXKB 4GOJA 1L9XA 2J9RA 4LECA 1L5KA 1X1BA 1YS1X 2KW5A 5EXPA 2GN0A 3BDVA 4H1WA 5LMNB 3NVAA 4K6HA 3HEBA 4A27A 3OSUA 2I3ZA 1JUDA 4XWOA 1RAGA 4NHEA 2EBUA 2VDLB 1JU4A 1XA0A 3I9JA 1E20A 3PNVA 1EIWA 3AW8A 4US2R 1Y1LA 1ECLA 3IR5A 4OQYA 3QOYA 1JEEA 1CUCA 2VCHA 3NHRA 1V7QA 3OFVA 3PL1A 2HMAA 1BMQA 2EHDA 2X7HA 1JX6A 2PE5A 1DBPA 5KBYA 3NU1A 2O8DA 1M66A 2J5QA 1ZK0A 2WT4A 2I54A 1HA3A 4QUBA 1GKIA 1LW7A 4PPYA 4B34A 2Q7DA 1MH9A 2AFHE 1NKSA 3OQ6A 4LWOA 2B36A 1K7SN 3QUQA 2PU7A 1L5LA 3GJYA 2JGDB 4IQGA 5HF6A 1D6NA 1U4NA 2WSLA 1K8YB 1KS9A 2EKPA 5CGZA 4Y2UA 4DG9A 5A5EA 4UREA 1DBIA 4JI1B 1HSZA 2XWQA 4AF8A 2MTBA 2I66A 1I6MA 3WWPA 5JCOA 1F6DA 1XHFA 1SBQA 2NUTB 4R8LA 3T3OA 3R6TA 3EFEA 1E2MA 4RHFA 4I4TF 2OB1A 3OD1A 3NPAA 3O3OB 4PAGA 2G04A 2OEPA 3LX5A 2WMNB 3A11A 2GBCA 5EZYA 5JNRA 1JB1A 1YCFA 2EG9A 2ZANA 2Q1SA 4M6WB 1U9ZA 1DZIA 3BH7A 5BSGA 1KJJA 1U9YA 4R2IA 1TZ2A 2B2CA 3C3WA 5F2OA 2A7XA 2GN1A 4ZYTA 2CSXA 1FNDA 4LISA 1GSOA 1ZICA 1RW4A 1K7YA 3FZEA 4UARA 5E6UB 4NESA 3VJMA 4W5HA 2BGIA 3CNOA 3L0YA 3UAYA 2H29A 2W6OA 1IIBA 3VMFA 1YB7A 1BMDA 1I7DA 2JIDA 1PHRA 2QRGA 2IBTA 2DY1A 3RGWS 2ZJZA 1VL2A 1IXSB 1JVBA 4NDZA 1PBTA 1SA0A 4RK0A 3BHJA 3TKAA 3VU8A 3SQXA 3BC1A 3UAZA 5K0JA 1UXOA 1IPHA 4EHIA 3PENA 1PJCA 2NZ2A 3KWFA 1HDYA 5AW3A 3NGMA 2I4NA 4JFAA 3E35A 4AULA 4C43A 2XUZA 3ROXA 1LDMA 2I6XA 3LY9A 3Q15C 3QYAA 4XGQA 4W5RA 1XZHA 5AT1A 4BFUA 3LPCA 3VX3A 1UKEA 3R5XA 1C80A 2JIPA 3QELA 3F3SA 4U39A 4X5OA 3ZCTA 5IJXA 1E2DA 1LFAA 3AR2A 4PHHA 2X22A 2XW6A 1MX5A 2VYVD 5LIRA 1JFLA 3STYA 4MWBA 1MGPA 1SD5A 2QSYA 1NBMA 3UB3A 4COOA 1EFVB 3F97A 2ZSHA 5EIBD 4FDTA 4REOA 2QGAB 1DMSA 4EVQA 1OXUA 3SEFA 3UYKA 3WKDA 2QTFA 2RH9B 2YWRA 4PZCA 2GM9A 3A31A 3A6GA 3AXTA 2I2AA 2MCFA 5J2UB 1ID8A 3I92A 1KY4A 4NI5A 2FEKA 4QUKA 4X1OA 2JBAB 3D8SA 1DTWA 1H22A 3R5JA 4HSEA 3PCRB 2RH5A 3MBIA 4IXWA 4N39A 3HRHA 3Q7SA 1C9JA 4HGQA 3MA0A 1HY3A 1CDEA 5T8KA 2BGLA 2YMMA 3MWDA 2YHBA 1E8MA 4HN4B 3MN1A 4TYPA 1Z28A 4ZT7A 1HDEA 1TRHA 3CW8X 5LQNA 1TC1A 3EZNA 4KQFA 4EHLA 1PJQA 3G8YA 4J7XA 4PICA 1KTVA 1OAOC 5EZYF 4FDAA 4BECA 4BVEA 4YYEA 3H6KA 3GPLA 1UDBA 5IXSA 5HFJA 4DSTA 1AGNA 5AVRA 5ICEA 3EUWA 1KOLA 1JG6A 3H5TA 3D1VA 4QPCA 4S2EA 3A4LA 3I5XA 2ZRBA 1U1DA 1YH3A 3GRRA 1NONA 1P7WA 2IEGA 2PGNA 5FOUA 4EH1A 5IASA 2RGNA 5CFRA 4B31A 4MZDA 4DTCA 4UM7A 3T7RA 1D2MA 2XMPA 3E2PA 4XDGA 4OXIA 2B78A 2ENWA 6ADHA 1E6MA 1KJ8A 3CG4A 1PQPA 5KHLB 1JDUA 3LQ2A 1B6RA 4GLLA 4FNOA 3W3ZB 5FUXA 2X3FA 2VP9A 2VZEA 3X1JA 3Q8WA 4BO8A 5IMBA 5I01A 1I7PA 1SOVA 1QDLB 2O2JA 2ZK7A 1PG0A 2WBLC 4DXDA 2IUUA 2XOEA 5BNWA 1NVVR 1YACA 3SXUB 1Q15A 4D9EA 5KIAA 4WNCA 4FGJA 3VNVA 1KO7A 1TJ7A 5JHHB 2ZJBA 1FOEB 4WXMA 2GJ4A 3OCFA 3PCXA 1VL0A 1EGAA 3E9DA 5KU7A 5IF9A 1J0XO 1HZZC 3IPLA 4F3NA 4M36A 1W85B 3ZBQA 5HX7A 2QRKA 4CT0A 1R4AA 1A9QA 3OFSA 1KXZA 5CYGA 1FMFA 1SQGA 2C5SA 2WTNA 3QKSA 1NZDA 2RHDA 2ZYAA 1CJKC 4C0JA 5C8YB 5C7OO 4D92A 1GZ5A 3LPLA 4DCPA 5JSQA 3LC2O 3N0XA 3O2SB 4MGYR 2R6DA 4P4GA 3CX8A 5EHXA 3U40A 3GHYA 1Y8CA 3IOBA 2IKSA 1UMCA 2V9CA 4Y7CA 5GM1A 4BV9A 1EZ1A 2WSSD 5AK4A 2G5CA 2J9YB 3D3WB 4IS2A 5FBHA 1AOXA 5FWYB 5AVUA 3TGWA 4WACA 4C7JA 4YMWA 3KVNA 3KVOA 2ECPA 1SR8A 3IAXA 4KI0A 1VRVA 3WYBA 4MS3A 1WQ4A 3Q6IA 4OM8A 3M49A 5LR6A 2GSWA 5ALMA 4QDJA 1T0UA 2QMQA 4PRYA 3FKJA 2RGBA 4YBRA 1Y1PA 3A06A 3BBLA 3WKBA 2NVBA 2XUGA 1YZUA 1IN8A 4HUJA 4KZKA 3I8OA 3B3FA 3RU3A 3I2JA 1T0BA 3D0RA 2IYXA 1WDMA 2DC1A 5DMHA 2NV6A 4LWPA 1FLAA 1DPGA 1FW8A 1KFJB 2BGKA 1UBLS 1DOZA 1P73A 3E0XA 3G8BA 4CMKA 2VTBA 4H0CA 4PO1A 4YJGB 2PYZA 3KT8A 1PNRA 2LUOA 2E85A 2JHFA 5BURA 1K6JA 3BTUA 1EDZA 1EGVB 1XHLA 2PV0A 1QK5A 2XQIA 2OHHA 3KOMA 2PGAA 4LE1A 2PWYA 4TRJA 3MCZA 1VYUA 2FR8C 4BZXA 1VYHA 2ZB2A 1Z2OX 1IPFA 3C3CA 2JH9A 1M1YA 5TMPA 2ONKA 4HTFB 4CU2A 1V5GA 2CL6X 3B5JA 2QT0A 3GTDA 2BYTA 3AR4A 3R9XA 3EE6A 4PLZA 4LF6B 3OPYI 4MB2A 4UUMA 2ZI4A 2V7WA 5L4NA 5EMLA 1TA0A 2CVZA 5BUQA 4OKSA 5F33A 4HAYA 1Y3IA 1QYXA 3AVOA 4U7WA 4V38A 2CBXA 2RARA 4LRQA 4C0HA 2HTFA 2FYTA 4NMWA 3WLNA 3PGKA 3D4OA 2CZCA 2J3MA 4JJIA 1PFKA 1AKWA 4BFCA 4OSPA 1PJAA 4IVRA 4ZO6A 5HA5A 4E46A 3GMTA 2GD2A 3PE6A 3GCXA 3BMCB 1L3CA 3O91A 4UAGA 1WVGA 2IPNA 4W9MC 3ZDZB 1AIPA 1Z0JA 3PL5A 1U28A 2H5JA 2OCDA 5KNDA 1KYIA 4GWGA 5IH3A 4QRHA 4YCBA 5DTIA 3V5NA 4DGQA 5GONB 1SK8A 3I72A 3T34A 3LP8A 2EW1A 2UZ3A 2VUTA 2G5GX 3EHEA 3FOEC 1UAGA 5FTMA 2QM7A 3ROPA 5AVQA 1HQCA 3DOEA 1JDBB 3FMOB 2Y0EA 3H05A 3M4NA 4AP9A 5B55A 1QH1B 4QPPA 2QHXA 5F64A 1XRPA 2FEAA 4EJSA 5F4BA 4ER5A 4EPRA 1BDIA 2C4NA 2RGDA 2FQYA 3HBMA 3K0HA 1W49A 4LZOA 4DR2B 4FWBA 3R77A 1Z7BA 1L5NA 1MB2A 3DBLB 1S9HA 2QP4A 1QYCA 1VC2A 4QASA 4ETIA 5LUAA 3RAEC 3WXBA 4BIIA 1SRQA 1RQRA 3GIDA 3VJLA 2WE8A 3E7XA 1ONPA 2OV8A 4OM7A 5FADA 1XTVA 2CD7A 1JHVA 3E82A 4MIYA 1VJ0A 4MZXA 2BDEA 2HA0A 2OA0A 1KDOA 4BJHB 4DQ0A 1TJPB 4M9XA 4MUYA 3U09A 4A8JC 2CJYA 2DERA 2AC2A 1T4DA 5DASA 4F6LA 1W5EA 3FFWA 4JOCA 3IEPA 4MPPA 4PHCA 1L2TA 1IHOA 3EXHB 1NBMD 3B9RA 2Q5QA 3DOFA 3CXRA 4BJ6A 1NF3A 1WQ1R 1C0EA 1XO1A 4M0DA 4MQFA 4JHXA 2R11A 3ZG6A 4N3AA 1YL7A 1N5OX 3QF4B 4PTYA 4DMLA 2I2DA 5FPHA 5HWSA 3L84A 2OM2A 3IYLW 1V8FA 1ZK2A 2HMUA 3FJYA 4FLEA 1OQAA 4QOGA 3T9AA 1SELA 4OUDB 2DEUA 2OO7A 3TLMA 1NQXA 2ZIEA 4WWHA 3OUZA 1CDDA 2V7QD 4K3UA 4ZFNA 1QGOA 1NAIA 3QEMB 4NKRA 3ZWQA 3Q6MA 3C8HA 4PZ0A 3T38A 3KJEA 3SZGA 2UZ1B 4YAJA 4DR1B 2JRCA 3QQPA 1UBCA 3QIVA 1IBRA 3PXBA 4BN5A 2H1HA 5EQDA 3U9TA 1I2DA 1DRVA 2JA1A 3DDOA 3MQFA 4G67A 5T67A 1ATZA 4UPEA 3V4RA 1SXPA 1J1IA 5ANRB 4WN9A 4ZEMA 3T7EA 4BMYA 1ZJZA 4IIVA 2ILTA 5AOCA 4W4TA 1Q77A 3NYWA 3L0OA 2HF7A 2AC7A 2NV0A 3OE7A 2IL1A 4KVFA 3X43A 4LF5B 1G98A 1LK0A 3RUAA 2VRNA 1G16A 5TQ2B 1NUUA 1UBFA 4H0FA 1T0PA 4RF3A 3RD8A 1NWHA 1AKRA 4O4IA 3TQQA 3EGDB 4KH0A 3HEAA 4I3GA 1RQ7A 2ERXA 5A4DA 2WJ4A 2P7IA 3DS8A 1HEUA 3HFRA 5SYMA 3H17A 2A9KA 4E12A 1KYTA 4KWCA 4TGLA 3AB7A 1P9WA 5AJZA 1GRRA 3KQTA 3QPAA 2H2AA 2VWQA 3D0KA 4U63A 1DQZA 1QP0A 1E3MA 4E94A 2WYVA 1XK6A 2J3KA 2O2YA 2P2NA 3QM1A 3DTVA 2SBTA 4A36A 4ZRNA 5FWXA 5IYZA 5KQGA 4RH1A 2ZRJA 3SR4A 1B8NA 5AM5A 3D3QA 3PUIA 4UNRA 1MIOB 1QQBA 2HK7A 4Z7OB 1X14A 2QN1A 3U7FB 4EMBA 2DBYA 3CPJB 3T06B 5HKAA 2A9RA 4AMGA 3KPUA 1OI3A 1USVA 1S2IA 4JIMA 5TXGA 3EWAA 1H8HA 1XHEA 4MS1B 5LVAA 4WESA 3ZGOA 5ITSA 1F48A 1QV6A 4YAWA 4JI4B 5ALVA 4KVAA 1PJ4A 2WVAA 2R6HA 3TAXA 2P77A 1T2AA 2PSEA 1Q92A 4K1LA 4QX6A 5KB3A 1WA5A 2C78A 1YQUA 2GEUA 1I4TD 1B1CA 1WUJS 2AD1A 2WG1A 3VSCA 3H11B 5BUSA 1UEXC 2X0KA 3GLVA 2WR8A 1KQGA 5GIPE 2D27A 3CZ9A 3UY4A 3TW0A 4KUGA 2GPNA 3FMVA 4EKDA 5J2TA 2ZT6A 1TM7E 3HP1A 4G9EA 4RABA 4X0EA 1DRWA 2H54A 3O83A 4IZHA 4MW7A 5F3RA 4CIWA 5CPFA 1F38A 5CAEB 4IIXA 5CDUA 1UH5A 1JDJA 1FXSA 2QD4A 1MJHA 3GPBA 2EJBA 3CNQS 1DIOB 4ZCMA 4KJXA 2JI4A 1LQUA 1NXPA 1IXYA 3H86A 1FP1D 1UKYA 2IUEA 3KQUA 1QNLA 2Y2VA 5KOYA 1I14A 1NLZA 4BGVA 2Q2NA 1ICIA 4MMYB 4WKBA 5D5HA 4X3CA 3RH0A 5HIAA 4Q24A 4PHGA 1Y1RA 4CQJA 2AXEA 3E9NA 3EODA 4R1LA 4GVXA 2RGGA 1TMOA 1Y4ZA 2WMOB 3G2LA 1UK8A 2J4CA 4B85A 4DLKA 3DM5A 4S05A 1ZRHA 3KOWA 3HO6A 2ZIUB 3UCXA 2J9FB 1PEYA 3W9BA 2C9MA 4BS9A 1NC1A 3TINA 4XI9A 1D2RA 1GUFA 2NXWA 5JCXA 2IHNA 1DIHA 1PR9A 2ORED 4DRYA 4FZ3A 4DM3A 1KZ4A 2JH3A 1ETUA 2IYUA 3DQQA 3F4BA 1SBNE 5BP7A 1XZEA 2ZIXB 1N2OA 5IYZF 3S27A 1IW7D 2NNLD 4JOBA 4DJ5X 1CLUA 2O3TA 1YTLA 4RA9B 4MK4A 3V1YA 1UPBA 3L93A 1YFEA 4YIHA 4ZQEA 2OYSA 3ZLBA 2XTNA 3QLUA 1RXEA 1RHQA 1TCAA 3GR6A 3IV6A 3OHSX 4HDCA 3STWA 2VJDA 3KEQA 5BPFA 5JAZA 1IATA 4YBZA 2INGX 2ZJ4A 4DLYA 5FBVB 4MW2A 5I51A 1I3CA 2AOUB 4O59O 3GJXC 3OIWA 1U9CA 4ZIRB 2ATEA 2I4TA 2EKBA 4IHQA 5KNDD 3DNMA 1YR9A 3COJA 4LGMA 1ECFA 2Q3JA 3AUUA 1AKMA 2HA2A 3AUXA 4M87A 5CA1A 1E66A 4DQKA 2P6NA 4B5LA 4Z1MA 1S8OA 2FE1A 3HCBA 4C2AA 1LBQA 5FR2A 3K9WA 5J2TF 4AO6A 3N8DA 3P1JA 1H2FA 3ZS8A 2YW9A 4KK3A 1IM5A 1Y33E 2W2QA 2XNDA 5CLHA 1H6CA 1ECJA 1FSSA 4JLDA 4M83A 3BXOA 4NBLA 4Q82A 4DABA 1QQTA 3DMYA 2AW3A 2Z58A 4IGKA 3KVYA 3W4JA 5I8ZA 1R0WA 5FUQA 1J2UA 5DK4A 1N2CA 1QTNA 3EEYA 3SBEA 4CTMA 2WM9B 2XYRA 1MA3A 2C5EA 2QPTA 3FSRA 4RA6B 1N7GA 4EGCB 2JH8A 1FP2A 3TS1A 2VNSA 1HBJA 1WCIA 2PRSA 1A5ZA 4IG9A 3GAAA 4MW0A 1TF2A 4N6NA 4X62B 3A6JA 2M1ZA 4G4JA 4Y67A 5KYXB 4OA5A 1XV5A 3OZUA 3B82A 3FYHA 4LXXA 3NBMA 1VBFA 4E2WA 5I3CA 1ND5A 5DI9A 3IEVA 2YYYA 5AXAA 1J5XA 4UTNA 4B4OA 1ZR4A 4L4XA 2W2TA 2AHOA 2XXJA 1HSOA 3W6PA 4LYDA 4LOAA 4MRNA 3IIMA 5CURA 5CT9A 3OCWA 2DTXA 4FEEA 4FR0A 5GV7A 2Z2IA 3EGWA 2VAVA 3JWPA 3RC1A 1VJ5A 3SHOA 4ODIA 3DM9B 1ZS9A 2FW0A 2E18A 1TUBB 3L41A 4PWZA 1QVWA 2XKKA 4I50A 3DBRB 4NECA 3QG5A 1V4NA 1SXIA 2JASA 3UMBA 2YWXA 3GUZA 5G41A 4QLOA 5JZOA 1CUIA 1B8OA 1FMLA 1XQWA 3HWX1 3QQ5A 1R6TA 4G9BA 2JIZA 1C30B 3EWSA 4E14A 1EI9A 3HDGA 2DPMA 3MPUA 4AZ3B 3UOAB 1KZ7B 4X1IA 2BRUC 2BCJQ 3LBIA 3LWZA 4MVJH 2G1PA 2FQXA 1MEJA 1U8FO 4IH9A 2O2GA 3L9XA 2QQFA 3HKCB 1H3NA 3OE7D 1QE0A 3AF5A 4UVGA 1GNVA 1EH5A 1SWWA 4M9ZA 1M8GA 3I1YA 1DJPA 3ZY4A 2AFHB 1JDNA 3UJAA 1L1RA 2P0EA 3M1LA 1LTKA 1WHTA 5K5EA 1CNFA 4N03A 1KYZA 3PDIB 3GDFA 3QBJA 4XGRA 2EF1A 1MU0A 4DR5B 4BVHA 3STTA 3ETEA 4O2BF 5IC6A 4ZYXA 1NWCA 4K9RA 1WB6A 4B3HA 1UL1X 4GBJA 4KO4S 1E4EA 5BNTA 5IHPA 5KTKA 2H1CA 2HBRA 4RBNA 5A03A 3UMYA 3PVCA 1P2DA 5D3KA 1P80A 4TXJA 3RRMA 3GK3A 1XNQB 1HGXA 4OK5A 4CLRA 3DEKA 2CT8A 5I5EA 1FTYA 1B41A 1ZM7A 3DTVD 1GTSA 1AK2A 4BO3A 4IQ0A 4MWDA 2WG0A 2ORVA 4E6EA 2PANA 4EABA 5JNLA 4X65B 2ZTMA 2O19A 4KDCA 1I36A 2R5NA 1JFSA 4IIJF 3Q3GE 4UE6A 1EP9A 1XAIA 1PDVA 3MT8A 3VYWA 1AF7A 2BEVB 1GPLA 2ZI6A 3PDCA 3AETB 1W8IA 1KI7A 2NU7A 1XSEA 2Q6KA 1KMNA 3AJ9A 3BJZA 3N8NA 4V0KA 2QS9A 1LI4A 1AXGA 2OLJA 2P41A 1TQ2A 4IFEA 1M2WA 4Y9TA 4BE9A 1H8HD 1CY7A 2FPPA 1PTJC 1SU8A 4MR7A 4YROA 1UOQA 1R5JA 1TVKB 2YBDA 3UATA 3ERCA 4ZAXA 4KXUA 3IEKA 4FYVA 3RBAA 1EB9A 4BFXA 2XYPA 3GX1A 2H7CA 3IESA 5EUCA 1FDVA 3I4FA 1PVOA 3U3OA 1KKMA 1X38A 1Z5UA 1XZDA 1W9HA 1XP5A 4KGZA 1E5XA 2VDRB 1ESCA 5C7IO 1XJ0A 4XM1A 4NK4A 2IZ0A 3FTCA 1JW9B 4F3RA 1Z25A 4AN4A 2A2ZA 3QE0A 2PK3A 2B1GA 1TU4A 3RFUA 3U56A 4XCVA 1RABA 1WY7A 2GBIA 4DLPA 2PTSA 3NJ8A 4ETMA 1RQLA 2CFTA 4JBNA 1NKVA 1XVAA 1XTSA 3CLRD 4FFNA 3TBKA 2C4WA 3WIOA 1G3RA 3LQKA 1J0AA 2YC2C 4M9CA 2YZGA 3WBBA 1ZCFA 3KM0A 4BGEA 1E2GA 5JJCA 4OQNA 4ARCA 1LC3A 2EW2A 3HSYA 4FHDA 3K5HA 3GUUA 4PCUA 1SULA 4W7HA 5JSFA 2BEUA 1EBFA 1UZAA 2BEWB 2JZOA 2O05A 5G0WA 1X1QA 2W8ZA 2R62A 5DW3A 2RBEA 3NV7A 2RB5A 3O1JC 2OECA 5E7IA 3HUTA 3A9SA 2VQFB 1UZUA 1KH2A 3H5NA 3T7SA 4B8ZA 2FW6A 3IT1A 4OY3A 1QAMA 2QKYA 1MAWA 4KO8A 4R8KA 1TU0A 3GJSA 1CJMA 1YBMA 2R00C 4HQ0A 3FR8A 2IWHA 2VK8A 3S2YA 2C2XA 2V7TA 3QG1A 4C9BA 4K9QA 3RRJA 3K70C 3GLQA 5FL7A 4B84A 5DLYA 1LPPA 3AR9A 4DIBA 3SHQA 1PV2A 1XX6A 5A4MS 3HHPA 3ILYA 1RRPA 4L3OA 1ESNA 1DXOA 4MYSA 3V3TA 2Z95A 4DNOA 2EX1A 3BSFA 1Z56C 3I2GA 1RDFA 4TSKA 5HTOA 3PNQA 5IP5A 4E5VA 2H7YA 2VHXA 2IZZA 2IITA 2P78A 3Q5GA 3WLRA 1ZVMA 1KZ6A 1FDSA 1Z2EA 4RZIA 3CI0K 4RDHA 4BLPA 4JX9A 3O4HA 1MHPA 4MX2A 1O89A 1Q14A 2A3NA 4PSCA 3TRJA 3AGPA 2RGCA 4HWSA 2R6R1 3RIXA 4TS4A 4XIIA 5C2JB 1SKYB 3V48A 1PJSA 3EXG2 3DXXA 4MKHA 3LY7A 4ES6A 2XWJI 1NC3A 2EEZA 4Y1EA 2DUWA 4EHJA 2HLPA 1H5NA 4GMDA 2H1WA 2J5XA 4HNRA 1AM4D 3VC3A 1QB8A 5F5NA 3PA8A 1JYEA 3PX2A 5IT4A 5GGYA 2QZ4A 1NASA 3RC2A 1HQYE 2J31A 2XLCA 3Q0EA 4Z1MD 2JFZA 4Q4JA 5JCJA 5L8VA 3JWIA 1YCDA 3A36A 3D7KA 3LCCA 4NDAA 2XNDD 3F5MA 5FBLB 2C83A 3D0QA 4K6CA 3KEMA 3H0CA 4LXYA 5GVRA 2BGUA 3FYUC 1LPBB 3Q1LA 3R9KA 2J9ZB 3GWGA 4H3HB 3ZI4A 4AUMA 2PIAA 3W3AD 1JQAA 1A50B 4EI9A 1BWQA 1RLJA 3NOVA 4JLJA 3QKUA 4CIVA 4ABTA 4IDBA 1YC2A 3AUAA 2AKYA 4OJYA 1TGYA 2HIAA 1KO5A 3FCSB 2PUBA 2OQIA 1H2RS 1KF0A 4N8EA 3R0JA 4GEKA 1N4AA 3R7DA 2NZXA 4YP1A 1YZNA 1GPYA 4XQ0A 5ARDA 4TUYB 5FCDA 3R3WA 5FBZA 5AIBA 3EASA 1N33B 1BWPA 3QPUA 2W58A 3DWIA 2AEJA 2JCBA 1KEZA 3PZRA 3UAOA 1UKVY 3EH2A 3W5BA 3U4QB 3ZU4A 4Q9DA 1AKVA 3WLMA 3RYHA 5IC5A 1NQ5A 4BLOA 3ML1A 4YV7A 5LA6A 4EAAA 3R5FA 4W8HA 4F3KA 3I6MA 2O5RA 1DE0A 4C07A 2C9BA 3I28A 4ND5A 4FTWA 4ZICA 3EC1A 1QFXA 3IIJA 1Z9BA 1V7PC 3PFHA 3T4UA 5K0GA 3NNNA 3RVPA 3ZZNA 1QTIA 2B69A 4XGIA 3HDYA 4NK5A 2W4MA 2NX2A 2FPOA 4JYPA 1L4BA 5FWNA 3ANXA 1LX6A 4C4ZA 1VG1A 1V11A 3AHHA 3SDBA 1F06A 5MFZA 1UF9A 2PFKA 2JIZD 5TC4A 4QVIA 3F6CA 1Z4QA 4DDHA 3RSLA 5K8UA 2AEFA 2FFQA 3HU2A 5HQ3B 2ETVA 4M1OA 5CNJA 3H6GA 4KMOA 1JIXA 1N36B 3SYKA 4AN1A 1G8YA 1PAUA 2P9GA 3HZHA 3JQ9A 4JNCA 1BU8A 3L1HA 5KQSA 3H65A 1E9DA 1UQTA 1ZXBA 2OLEA 3B9QA 2JDIA 3KR0A 4QULA 2BISA 1TYDE 4PVDA 4L0MA 3LTEA 4R16A 4KSBA 3B85A 4JENA 1GXSB 5ESWA 5LXTA 3CR7A 2XWSA 3IQDB 2MHCA 3DEIA 4PU0A 4W8GA 5TGDA 1ZVQA 2BZSA 3ZWBA 1AQUA 5ADVA 2F90A 2OM6A 2J4FA 3BJEA 1FFXA 4D8YA 1YA6A 2CJXA 1WMSA 5C5CA 3DKKA 4K6OA 4D57A 1T6YA 4QGAA 1DAHA 2PKWA 3EXG1 2WSBA 2F55A 3IAUA 5E4FA 2IYAA 1IJKA 1ZN8A 4UTVA 1A7AA 1MDFA 1JHMA 2L82A 3DL2A 3KE8A 4NMLA 4DLAA 3A2KA 1SMKA 1BKSB 1EXMA 5IKMA 4HP8A 1LSJA 3H5IA 4UEKA 3A4NA 1KI2A 1D4FA 2QQGA 2Q45A 4DWWA 3N86A 5DEOA 1CUDA 1FFDA 2B25A 3K9NA 3HKBB 5TS3A 2L2QA 4ZODA 4ND4A 2P35A 1Z6YA 5MFPA 5AM4A 4YLGA 4MVJE 3WADA 4F06A 3FETA 3ZOZA 4MKXA 1W0CA 2E87A 2QZSA 4PIMA 1F0YA 1TGVA 1T1RA 4D6XA 3DV0A 3NBAA 1SHJA 1F2TB 3HDVA 4R1SA 4WCFC 1Q57A 1T2VA 4PQEA 4REQB 3AR5A 4YPFA 3ZYZA 4E15A 1XELA 1OBOA 4E7PA 1LY1A 3G5AA 1DWUA 4OBXA 2P40A 4Z9FA 5CBPB 3PC8C 4LSZA 3EQ6A 4KX5A 1FYVA 4D80A 3F6BX 3EGXB 1Y0BA 2WICA 1H9AA 1P31A 3PEVA 3P0IA 4V24A 5TB5A 1RKQA 1N3IA 5B3JC 3VVMA 1PUXA 3DE2X 2BFDA 2C31A 3P9PA 1EK2A 1WSBA 5EJ4A 4KB5A 2JLSA 2Q0HA 3LPAA 4KMMA 4P6VF 1V5WA 1EP1B 2FHPA 3LHIA 3RRXA 1L5OA 4CLOA 3PE4A 3QEKA 3HU3A 1U0LA 1SUIA 2YCBA 3AU9A 3B6ZA 4PX3A 4U2BA 4WZBB 1CUXA 4N5DA 1U7ZA 2KM1A 5FOSA 1TAQA 5JVDB 3GDWA 1G8KA 3DXFA 2HXSA 4RPGA 3VPBA 1WVMA 3EIUA 3G2QA 5B1EA 3WWEA 5HILA 1ZW6A 1DC5A 1EFAA 3FUUA 3R6QA 3V9PA 4HQLA 5LXTF 3DOHA 1J24A 1Z2CA 3COVA 3ZHSA 2ZVPX 2HKIA 3G0DA 3B6EA 4GW3A 4U3JA 4BPRA 3ZXUB 2XY4A 3S29A 5FL7D 2OGWA 4RKWA 4Y8VA 3WB2A 4PYQA 3LNTA 4Z99A 4F84A 4QDZA 3UK0A 4XW2A 1VG0B 2F3RA 5DB4A 2CB9A 4TL6A 2DZDA 3V1NA 3ZOKA 6ABPA 1CUGA 1SOMA 1X8XA 3F3KA 1A8SA 1GFWA 4JCOA 3ZZ1A 1Z63A 2DPGA 3E61A 5HQJA 3EDMA 3SCZA 4HUTA 1K8RA 2HHLA 1YFJA 2XYVA 3SYTA 1EJ2A 3N9IA 3O8OA 4FFPA