1OCXA

E. coli maltose-o-acetyltransferase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
182
structure length
182
Chain Sequence
STEKEKMIAGELYRSADETLSRDRLRARQLIHRYNHSLAEEHTLRQQILADLFGQVTEAYIEPTFRCDYGYNIFLGNNFFANFDCVMLDVCPIRIGDNCMLAPGVHIYTATHPIDPVARNSGAELGKPVTIGNNVWIGGRAVINPGVTIGDNVVVASGAVVTKDVPDNVVVGGNPARIIKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MALTOSE O-ACETYLTRANSFERASE
publication title The Structure and Specificity of Escherichia Coli Maltose Acetyltransferase Give New Insight Into the Laca Family of Acyltransferases.
pubmed doi rcsb
source organism Escherichia coli
total genus 66
structure length 182
sequence length 182
chains with identical sequence B, C
ec nomenclature ec 2.3.1.79: Maltose O-acetyltransferase.
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12464 Mac Maltose acetyltransferase
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 1ocxA00
3OW5A 1XATA 4E75A 2IU9A 1KRRA 3I3AA 3IXCA 5E3PA 3BRKX 2OEFA 4FCEA 5E3QA 3VBJA 5ADXV 3OUPA 3VBPA 2QKXA 3I3XA 3D8VA 2VHEA 3VNPA 1HM8A 3P47A 5DEPA 2GGOA 2V0LA 2W0WA 4IHFA 1SSMA 1G97A 1KGTA 2IC7A 3C8VA 3EH0A 3MC4A 4E6UA 3FTTA 3R5CA 1MR7A 4MFGA 4M2BA 4N6AA 4R37A 1QREA 3R5DA 3BSWA 3GOSA 3TDTA 3R1WA 4N6BA 4MZUA 2WLDA 4MYOA 4KNRA 1KHRA 1MRLA 1Z90A 1XHDA 1HM9A 1YP3A 4M2AA 1HM0A 4AC3A 3R5BA 3VBIA 3VBLA 3FSYA 3TK8A 2JF2A 2ICYA 5DEMA 3R3RA 5L6SA 2JF3A 3R3IA 4N27A 4R7PA 1QRMA 1S80A 1LXAA 1YP4A 2WLFA 1KRUA 2ICXA 2V0KA 4J09A 3R0SA 1YP2A 3HJJA 3DK5A 1SSQA 4KPZA 3NZ2A 4M99A 4EQYA 2Q4JA 4HURA 4E6TA 3FWWA 3EEVA 3P1BA 2WLCA 1THJA 2V0IA 2IU8A 1KK6A 4ISXA 1J2ZA 2WLEA 4HUSA 3TISA 3VBMA 3FSXA 1HV9A 3VBNA 3GUEA 1QRLA 2OI5A 3R5AA 3ST8A 2IUAA 4G3SA 5AFUU 2TDTA 1KK5A 1V3WA 3DHOA 3OTMA 4G3PA 3BSYA 1TDTA 3BFPA 3EG4A 2QIAA 3ECTA 1SSTA 1V67A 3OU9A 4EA8A 3FSBA 1FXJA 1MR9A 2GGQA 5E3RA 4EA9A 1OCXA 2P2OA 3FOQA 4KPXA 3TIOA 4K6RA 4E1KA 3KWDA 2XATA 4M9CA 1KGQA 2W0VA 2OI6A 2QIVX 5L6VA 3TV0A 4R36A 4HZCA 4N69A 4KQLA 2FKOA 5DG3A 3R8YA 2WLGA 3BSSA 4KNXA 1T3DA 5ADXU 3FS8A 3PMOA 2VD4A 3JQYA 3Q1XA 4J18A 4HZDA 2OI7A 4M98A 1QRFA 3F1XA 5U2KA 4E79A 4M28A 5AFUV 3SPTA 3HSQA 1KK4A 3MQHA 4IHGA 3GVDA 1G95A 3SRTA 4H7OA 4DCLA 1QRGA 2I5KA 3BXYA 1FWYA 4EA7A 3DJ4A 4AAWA 4G3QA 3MQGA 3VBKA 1KRVA 3FSCA 4G87A 2OEGA 2NPOA 3T57A 3IGJA 2AQ9A 2RIJA 2V0HA 3D98A 3KWCA 5F42A 3TWDA 4AA7A 4EGGA 3KWEA 2V0JA 3V4EA 1KQAA 4IHHA 3R2WA 1QQ0A 4EAAA 3CJ8A 3OTZA 4HCQA 4EABA
chains in the Genus database with same CATH superfamily
3OW5A 1XATA 4E75A 2IU9A 1KRRA 3I3AA 3IXCA 5E3PA 3BRKX 2OEFA 4FCEA 5E3QA 3VBJA 5ADXV 3OUPA 3VBPA 2QKXA 3I3XA 3D8VA 1M8NA 2VHEA 3VNPA 1HM8A 3P47A 5DEPA 2GGOA 2V0LA 2W0WA 4IHFA 1SSMA 1G97A 1KGTA 2IC7A 3C8VA 3EH0A 3MC4A 4E6UA 3FTTA 3R5CA 1MR7A 4MFGA 4M2BA 4N6AA 4R37A 1QREA 3R5DA 3BSWA 3GOSA 3TDTA 3R1WA 4N6BA 4MZUA 2WLDA 4MYOA 1N4IA 4KNRA 1KHRA 1MRLA 1Z90A 1XHDA 1HM9A 1YP3A 4M2AA 1HM0A 3OH1A 4AC3A 3R5BA 3VBIA 3VBLA 3FSYA 3TK8A 2JF2A 2ICYA 3GQ8A 3OH3A 5DEMA 3R3RA 5L6SA 2JF3A 3R3IA 4N27A 4R7PA 1QRMA 1S80A 1LXAA 1YP4A 2WLFA 1KRUA 2ICXA 2V0KA 4J09A 3R0SA 1YP2A 3HJJA 3DK5A 3OH0A 3GQAA 1SSQA 4KPZA 3NZ2A 4M99A 4EQYA 2Q4JA 4HURA 4E6TA 3FWWA 3EEVA 3P1BA 2WLCA 1THJA 2V0IA 2IU8A 1KK6A 4ISXA 1J2ZA 2WLEA 3GQ7A 1EWWA 4HUSA 3TISA 3VBMA 3FSXA 1HV9A 3VBNA 3GUEA 1QRLA 2OI5A 3R5AA 3ST8A 2IUAA 4G3SA 5AFUU 2TDTA 1KK5A 1V3WA 3DHOA 3OTMA 4G3PA 3BSYA 1TDTA 3BFPA 3EG4A 2QIAA 3ECTA 1SSTA 1V67A 3OU9A 4EA8A 3FSBA 1FXJA 1MR9A 2GGQA 3OH2A 5E3RA 4EA9A 1OCXA 2P2OA 3FOQA 4KPXA 3TIOA 4K6RA 4E1KA 3KWDA 2XATA 4M9CA 3OH4A 1KGQA 2W0VA 3SUCA 2OI6A 2QIVX 5L6VA 3TV0A 4R36A 4HZCA 4N69A 4KQLA 2FKOA 5DG3A 3R8YA 2WLGA 3BSSA 4KNXA 1T3DA 5ADXU 3GQ9A 3FS8A 3PMOA 2VD4A 3JQYA 3OGZA 3Q1XA 1L0SA 2OI7A 4HZDA 4J18A 4M98A 1QRFA 3F1XA 5U2KA 4E79A 4M28A 5AFUV 3SPTA 3HSQA 1KK4A 3MQHA 4IHGA 3GVDA 1G95A 3SRTA 4H7OA 4DCLA 1QRGA 2I5KA 3BXYA 1FWYA 4EA7A 3DJ4A 4AAWA 4G3QA 3MQGA 3VBKA 1KRVA 3FSCA 4G87A 2OEGA 2NPOA 1Z2FA 3T57A 3IGJA 2AQ9A 2RIJA 2V0HA 3D98A 3KWCA 5F42A 3TWDA 4AA7A 4EGGA 3KWEA 2V0JA 3V4EA 1KQAA 4IHHA 3R2WA 1QQ0A 4EAAA 3CJ8A 3OTZA 4HCQA 4EABA
chains in the Genus database with same CATH topology
3OW5A 1XATA 4E75A 2IU9A 1KRRA 3I3AA 3IXCA 5E3PA 3BRKX 2OEFA 4FCEA 5E3QA 3VBJA 5ADXV 3OUPA 3VBPA 2QKXA 3I3XA 3D8VA 2VHEA 3VNPA 1HM8A 3P47A 5DEPA 2GGOA 2V0LA 2W0WA 4IHFA 1SSMA 1G97A 1KGTA 2IC7A 3C8VA 3EH0A 3MC4A 4E6UA 3FTTA 3R5CA 1MR7A 4MFGA 4M2BA 4N6AA 4R37A 1QREA 3R5DA 3BSWA 3GOSA 3TDTA 3R1WA 4N6BA 4MZUA 2WLDA 4MYOA 4KNRA 1KHRA 1MRLA 1Z90A 1XHDA 1HM9A 1YP3A 4M2AA 1HM0A 4AC3A 3R5BA 3VBIA 3VBLA 3FSYA 3TK8A 2JF2A 2ICYA 5DEMA 3R3RA 5L6SA 2JF3A 3R3IA 4N27A 4R7PA 1QRMA 1S80A 1LXAA 1YP4A 2WLFA 1KRUA 2ICXA 2V0KA 4J09A 3R0SA 1YP2A 3HJJA 3DK5A 1SSQA 4KPZA 3NZ2A 4M99A 4EQYA 2Q4JA 4HURA 4E6TA 3FWWA 3EEVA 3P1BA 2WLCA 1THJA 2V0IA 2IU8A 1KK6A 4ISXA 1J2ZA 2WLEA 4HUSA 3TISA 3VBMA 3FSXA 1HV9A 3VBNA 3GUEA 1QRLA 2OI5A 3R5AA 3ST8A 2IUAA 4G3SA 5AFUU 2TDTA 1KK5A 1V3WA 3DHOA 3OTMA 4G3PA 3BSYA 1TDTA 3BFPA 3EG4A 2QIAA 3ECTA 1SSTA 1V67A 3OU9A 4EA8A 3FSBA 1FXJA 1MR9A 2GGQA 5E3RA 4EA9A 1OCXA 2P2OA 3FOQA 4KPXA 3TIOA 4K6RA 4E1KA 3KWDA 2XATA 4M9CA 1KGQA 2W0VA 2OI6A 2QIVX 5L6VA 3TV0A 4R36A 4HZCA 4N69A 4KQLA 2FKOA 5DG3A 3R8YA 2WLGA 3BSSA 4KNXA 1T3DA 5ADXU 3FS8A 3PMOA 2VD4A 3JQYA 3Q1XA 4J18A 4HZDA 2OI7A 4M98A 1QRFA 3F1XA 5U2KA 4E79A 4M28A 5AFUV 3SPTA 3HSQA 1KK4A 3MQHA 4IHGA 3GVDA 1G95A 3SRTA 4H7OA 4DCLA 1QRGA 2I5KA 3BXYA 1FWYA 4EA7A 3DJ4A 4AAWA 4G3QA 3MQGA 3VBKA 1KRVA 3FSCA 4G87A 2OEGA 2NPOA 3T57A 3IGJA 2AQ9A 2RIJA 2V0HA 3D98A 3KWCA 5F42A 3TWDA 4AA7A 4EGGA 3KWEA 2V0JA 3V4EA 1KQAA 4IHHA 3R2WA 1QQ0A 4EAAA 3CJ8A 3OTZA 4HCQA 4EABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW5 A;  1XAT A;  4E75 A;  2IU9 A;  1KRR A;  3I3A A;  3IXC A;  5E3P A;  3BRK X;  2OEF A;  4FCE A;  5E3Q A;  3VBJ A;  5ADX V;  3OUP A;  3VBP A;  2QKX A;  3I3X A;  3D8V A;  2VHE A;  3VNP A;  1HM8 A;  3P47 A;  5DEP A;  2GGO A;  2V0L A;  2W0W A;  4IHF A;  1SSM A;  1G97 A;  1KGT A;  2IC7 A;  3C8V A;  3EH0 A;  3MC4 A;  4E6U A;  3FTT A;  3R5C A;  1MR7 A;  4MFG A;  4M2B A;  4N6A A;  4R37 A;  1QRE A;  3R5D A;  3BSW A;  3GOS A;  3TDT A;  3R1W A;  4N6B A;  4MZU A;  2WLD A;  4MYO A;  4KNR A;  1KHR A;  1MRL A;  1Z90 A;  1XHD A;  1HM9 A;  1YP3 A;  4M2A A;  1HM0 A;  4AC3 A;  3R5B A;  3VBI A;  3VBL A;  3FSY A;  3TK8 A;  2JF2 A;  2ICY A;  5DEM A;  3R3R A;  5L6S A;  2JF3 A;  3R3I A;  4N27 A;  4R7P A;  1QRM A;  1S80 A;  1LXA A;  1YP4 A;  2WLF A;  1KRU A;  2ICX A;  2V0K A;  4J09 A;  3R0S A;  1YP2 A;  3HJJ A;  3DK5 A;  1SSQ A;  4KPZ A;  3NZ2 A;  4M99 A;  4EQY A;  2Q4J A;  4HUR A;  4E6T A;  3FWW A;  3EEV A;  3P1B A;  2WLC A;  1THJ A;  2V0I A;  2IU8 A;  1KK6 A;  4ISX A;  1J2Z A;  2WLE A;  4HUS A;  3TIS A;  3VBM A;  3FSX A;  1HV9 A;  3VBN A;  3GUE A;  1QRL A;  2OI5 A;  3R5A A;  3ST8 A;  2IUA A;  4G3S A;  5AFU U;  2TDT A;  1KK5 A;  1V3W A;  3DHO A;  3OTM A;  4G3P A;  3BSY A;  1TDT A;  3BFP A;  3EG4 A;  2QIA A;  3ECT A;  1SST A;  1V67 A;  3OU9 A;  4EA8 A;  3FSB A;  1FXJ A;  1MR9 A;  2GGQ A;  5E3R A;  4EA9 A;  1OCX A;  2P2O A;  3FOQ A;  4KPX A;  3TIO A;  4K6R A;  4E1K A;  3KWD A;  2XAT A;  4M9C A;  1KGQ A;  2W0V A;  2OI6 A;  2QIV X;  5L6V A;  3TV0 A;  4R36 A;  4HZC A;  4N69 A;  4KQL A;  2FKO A;  5DG3 A;  3R8Y A;  2WLG A;  3BSS A;  4KNX A;  1T3D A;  5ADX U;  3FS8 A;  3PMO A;  2VD4 A;  3JQY A;  3Q1X A;  4J18 A;  4HZD A;  2OI7 A;  4M98 A;  1QRF A;  3F1X A;  5U2K A;  4E79 A;  4M28 A;  5AFU V;  3SPT A;  3HSQ A;  1KK4 A;  3MQH A;  4IHG A;  3GVD A;  1G95 A;  3SRT A;  4H7O A;  4DCL A;  1QRG A;  2I5K A;  3BXY A;  1FWY A;  4EA7 A;  3DJ4 A;  4AAW A;  4G3Q A;  3MQG A;  3VBK A;  1KRV A;  3FSC A;  4G87 A;  2OEG A;  2NPO A;  3T57 A;  3IGJ A;  2AQ9 A;  2RIJ A;  2V0H A;  3D98 A;  3KWC A;  5F42 A;  3TWD A;  4AA7 A;  4EGG A;  3KWE A;  2V0J A;  3V4E A;  1KQA A;  4IHH A;  3R2W A;  1QQ0 A;  4EAA A;  3CJ8 A;  3OTZ A;  4HCQ A;  4EAB A; 
#chains in the Genus database with same CATH topology
 3OW5 A;  1XAT A;  4E75 A;  2IU9 A;  1KRR A;  3I3A A;  3IXC A;  5E3P A;  3BRK X;  2OEF A;  4FCE A;  5E3Q A;  3VBJ A;  5ADX V;  3OUP A;  3VBP A;  2QKX A;  3I3X A;  3D8V A;  1M8N A;  2VHE A;  3VNP A;  1HM8 A;  3P47 A;  5DEP A;  2GGO A;  2V0L A;  2W0W A;  4IHF A;  1SSM A;  1G97 A;  1KGT A;  2IC7 A;  3C8V A;  3EH0 A;  3MC4 A;  4E6U A;  3FTT A;  3R5C A;  1MR7 A;  4MFG A;  4M2B A;  4N6A A;  4R37 A;  1QRE A;  3R5D A;  3BSW A;  3GOS A;  3TDT A;  3R1W A;  4N6B A;  4MZU A;  2WLD A;  4MYO A;  1N4I A;  4KNR A;  1KHR A;  1MRL A;  1Z90 A;  1XHD A;  1HM9 A;  1YP3 A;  4M2A A;  1HM0 A;  3OH1 A;  4AC3 A;  3R5B A;  3VBI A;  3VBL A;  3FSY A;  3TK8 A;  2JF2 A;  2ICY A;  3GQ8 A;  3OH3 A;  5DEM A;  3R3R A;  5L6S A;  2JF3 A;  3R3I A;  4N27 A;  4R7P A;  1QRM A;  1S80 A;  1LXA A;  1YP4 A;  2WLF A;  1KRU A;  2ICX A;  2V0K A;  4J09 A;  3R0S A;  1YP2 A;  3HJJ A;  3DK5 A;  3OH0 A;  3GQA A;  1SSQ A;  4KPZ A;  3NZ2 A;  4M99 A;  4EQY A;  2Q4J A;  4HUR A;  4E6T A;  3FWW A;  3EEV A;  3P1B A;  2WLC A;  1THJ A;  2V0I A;  2IU8 A;  1KK6 A;  4ISX A;  1J2Z A;  2WLE A;  3GQ7 A;  1EWW A;  4HUS A;  3TIS A;  3VBM A;  3FSX A;  1HV9 A;  3VBN A;  3GUE A;  1QRL A;  2OI5 A;  3R5A A;  3ST8 A;  2IUA A;  4G3S A;  5AFU U;  2TDT A;  1KK5 A;  1V3W A;  3DHO A;  3OTM A;  4G3P A;  3BSY A;  1TDT A;  3BFP A;  3EG4 A;  2QIA A;  3ECT A;  1SST A;  1V67 A;  3OU9 A;  4EA8 A;  3FSB A;  1FXJ A;  1MR9 A;  2GGQ A;  3OH2 A;  5E3R A;  4EA9 A;  1OCX A;  2P2O A;  3FOQ A;  4KPX A;  3TIO A;  4K6R A;  4E1K A;  3KWD A;  2XAT A;  4M9C A;  3OH4 A;  1KGQ A;  2W0V A;  3SUC A;  2OI6 A;  2QIV X;  5L6V A;  3TV0 A;  4R36 A;  4HZC A;  4N69 A;  4KQL A;  2FKO A;  5DG3 A;  3R8Y A;  2WLG A;  3BSS A;  4KNX A;  1T3D A;  5ADX U;  3GQ9 A;  3FS8 A;  3PMO A;  2VD4 A;  3JQY A;  3OGZ A;  3Q1X A;  1L0S A;  2OI7 A;  4HZD A;  4J18 A;  4M98 A;  1QRF A;  3F1X A;  5U2K A;  4E79 A;  4M28 A;  5AFU V;  3SPT A;  3HSQ A;  1KK4 A;  3MQH A;  4IHG A;  3GVD A;  1G95 A;  3SRT A;  4H7O A;  4DCL A;  1QRG A;  2I5K A;  3BXY A;  1FWY A;  4EA7 A;  3DJ4 A;  4AAW A;  4G3Q A;  3MQG A;  3VBK A;  1KRV A;  3FSC A;  4G87 A;  2OEG A;  2NPO A;  1Z2F A;  3T57 A;  3IGJ A;  2AQ9 A;  2RIJ A;  2V0H A;  3D98 A;  3KWC A;  5F42 A;  3TWD A;  4AA7 A;  4EGG A;  3KWE A;  2V0J A;  3V4E A;  1KQA A;  4IHH A;  3R2W A;  1QQ0 A;  4EAA A;  3CJ8 A;  3OTZ A;  4HCQ A;  4EAB A; 
#chains in the Genus database with same CATH homology
 3OW5 A;  1XAT A;  4E75 A;  2IU9 A;  1KRR A;  3I3A A;  3IXC A;  5E3P A;  3BRK X;  2OEF A;  4FCE A;  5E3Q A;  3VBJ A;  5ADX V;  3OUP A;  3VBP A;  2QKX A;  3I3X A;  3D8V A;  2VHE A;  3VNP A;  1HM8 A;  3P47 A;  5DEP A;  2GGO A;  2V0L A;  2W0W A;  4IHF A;  1SSM A;  1G97 A;  1KGT A;  2IC7 A;  3C8V A;  3EH0 A;  3MC4 A;  4E6U A;  3FTT A;  3R5C A;  1MR7 A;  4MFG A;  4M2B A;  4N6A A;  4R37 A;  1QRE A;  3R5D A;  3BSW A;  3GOS A;  3TDT A;  3R1W A;  4N6B A;  4MZU A;  2WLD A;  4MYO A;  4KNR A;  1KHR A;  1MRL A;  1Z90 A;  1XHD A;  1HM9 A;  1YP3 A;  4M2A A;  1HM0 A;  4AC3 A;  3R5B A;  3VBI A;  3VBL A;  3FSY A;  3TK8 A;  2JF2 A;  2ICY A;  5DEM A;  3R3R A;  5L6S A;  2JF3 A;  3R3I A;  4N27 A;  4R7P A;  1QRM A;  1S80 A;  1LXA A;  1YP4 A;  2WLF A;  1KRU A;  2ICX A;  2V0K A;  4J09 A;  3R0S A;  1YP2 A;  3HJJ A;  3DK5 A;  1SSQ A;  4KPZ A;  3NZ2 A;  4M99 A;  4EQY A;  2Q4J A;  4HUR A;  4E6T A;  3FWW A;  3EEV A;  3P1B A;  2WLC A;  1THJ A;  2V0I A;  2IU8 A;  1KK6 A;  4ISX A;  1J2Z A;  2WLE A;  4HUS A;  3TIS A;  3VBM A;  3FSX A;  1HV9 A;  3VBN A;  3GUE A;  1QRL A;  2OI5 A;  3R5A A;  3ST8 A;  2IUA A;  4G3S A;  5AFU U;  2TDT A;  1KK5 A;  1V3W A;  3DHO A;  3OTM A;  4G3P A;  3BSY A;  1TDT A;  3BFP A;  3EG4 A;  2QIA A;  3ECT A;  1SST A;  1V67 A;  3OU9 A;  4EA8 A;  3FSB A;  1FXJ A;  1MR9 A;  2GGQ A;  5E3R A;  4EA9 A;  1OCX A;  2P2O A;  3FOQ A;  4KPX A;  3TIO A;  4K6R A;  4E1K A;  3KWD A;  2XAT A;  4M9C A;  1KGQ A;  2W0V A;  2OI6 A;  2QIV X;  5L6V A;  3TV0 A;  4R36 A;  4HZC A;  4N69 A;  4KQL A;  2FKO A;  5DG3 A;  3R8Y A;  2WLG A;  3BSS A;  4KNX A;  1T3D A;  5ADX U;  3FS8 A;  3PMO A;  2VD4 A;  3JQY A;  3Q1X A;  4J18 A;  4HZD A;  2OI7 A;  4M98 A;  1QRF A;  3F1X A;  5U2K A;  4E79 A;  4M28 A;  5AFU V;  3SPT A;  3HSQ A;  1KK4 A;  3MQH A;  4IHG A;  3GVD A;  1G95 A;  3SRT A;  4H7O A;  4DCL A;  1QRG A;  2I5K A;  3BXY A;  1FWY A;  4EA7 A;  3DJ4 A;  4AAW A;  4G3Q A;  3MQG A;  3VBK A;  1KRV A;  3FSC A;  4G87 A;  2OEG A;  2NPO A;  3T57 A;  3IGJ A;  2AQ9 A;  2RIJ A;  2V0H A;  3D98 A;  3KWC A;  5F42 A;  3TWD A;  4AA7 A;  4EGG A;  3KWE A;  2V0J A;  3V4E A;  1KQA A;  4IHH A;  3R2W A;  1QQ0 A;  4EAA A;  3CJ8 A;  3OTZ A;  4HCQ A;  4EAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...