1OCXA

E. coli maltose-o-acetyltransferase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
182
structure length
182
Chain Sequence
STEKEKMIAGELYRSADETLSRDRLRARQLIHRYNHSLAEEHTLRQQILADLFGQVTEAYIEPTFRCDYGYNIFLGNNFFANFDCVMLDVCPIRIGDNCMLAPGVHIYTATHPIDPVARNSGAELGKPVTIGNNVWIGGRAVINPGVTIGDNVVVASGAVVTKDVPDNVVVGGNPARIIKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MALTOSE O-ACETYLTRANSFERASE
publication title The Structure and Specificity of Escherichia Coli Maltose Acetyltransferase Give New Insight Into the Laca Family of Acyltransferases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 66
structure length 182
sequence length 182
chains with identical sequence B, C
ec nomenclature ec 2.3.1.79: Maltose O-acetyltransferase.
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12464 Mac Maltose acetyltransferase
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 1ocxA00
3GUEA 1S80A 4MYOA 1MR9A 3MQHA 5AFUU 5F42A 4J09A 3KWDA 1QRMA 4M99A 1KRUA 2ICYA 1HV9A 2OEFA 1KK4A 4G3QA 4HZCA 1YP2A 3BSSA 1V67A 3VBNA 3FTTA 3MC4A 2V0KA 3KWCA 3JQYA 4HZDA 3TV0A 1YP4A 3DJ4A 1QRFA 2IU8A 3D98A 4H7OA 4N27A 4EA9A 4M2AA 3OTMA 2QIVX 3BXYA 3IXCA 4G3SA 3KWEA 2GGOA 4IHGA 2WLEA 5E3RA 3R5BA 3VBMA 1KK6A 3F1XA 2JF3A 3BFPA 2JF2A 3VBKA 2OEGA 2WLGA 3TK8A 1XHDA 3D8VA 4M9CA 4E75A 4E6UA 3BSWA 3VNPA 2QIAA 4G87A 3DHOA 3VBIA 1THJA 4KNXA 3DK5A 1SSMA 4R36A 3VBPA 4KNRA 3Q1XA 4K6RA 5AFUV 2AQ9A 1XATA 5E3PA 3FSXA 2P2OA 2V0JA 2W0WA 1QQ0A 1KGTA 4EGGA 2ICXA 1SSTA 3R1WA 2WLFA 5ADXU 1HM9A 5DEMA 3HJJA 3OU9A 3NZ2A 3R5DA 1KGQA 1MR7A 3FS8A 1SSQA 3OW5A 4MZUA 4N6BA 3FWWA 3TISA 1KK5A 3TIOA 4N69A 4J18A 4E79A 3C8VA 1QRLA 4MFGA 1HM0A 3R8YA 4AAWA 1LXAA 1TDTA 3OUPA 2OI6A 1HM8A 1G97A 3MQGA 4N6AA 3P47A 2IC7A 4G3PA 4AA7A 2OI5A 2XATA 4EA8A 4KPXA 3OTZA 2VHEA 2Q4JA 4FCEA 4E1KA 4E6TA 4R37A 4HCQA 3EEVA 5U2KA 3P1BA 3GOSA 4IHHA 4IHFA 3FSBA 4R7PA 3TDTA 2V0IA 2TDTA 1Z90A 2V0LA 5E3QA 3VBJA 2WLDA 2OI7A 2WLCA 3FSCA 3V4EA 3VBLA 5DG3A 3R0SA 2NPOA 3R2WA 5L6SA 2QKXA 5ADXV 1OCXA 2VD4A 3R3IA 1MRLA 1KRVA 2IU9A 3IGJA 4KPZA 3BRKX 3EG4A 2FKOA 3TWDA 1KHRA 3SPTA 1KRRA 2V0HA 4M98A 4HUSA 3CJ8A 4ISXA 3R3RA 4EQYA 4KQLA 4EAAA 1T3DA 3ECTA 3HSQA 3EH0A 3BSYA 1V3WA 1YP3A 1G95A 3GVDA 5DEPA 4DCLA 5L6VA 3FOQA 4HURA 4M2BA 4AC3A 4EA7A 1QREA 3R5AA 1J2ZA 3SRTA 4M28A 2I5KA 3FSYA 3ST8A 1KQAA 3I3XA 2IUAA 3PMOA 2RIJA 1FWYA 3I3AA 1QRGA 2GGQA 3R5CA 4EABA 1FXJA 2W0VA 3T57A
chains in the Genus database with same CATH superfamily
3GUEA 1S80A 4MYOA 3OH4A 1MR9A 3MQHA 5AFUU 5F42A 4J09A 3KWDA 1EWWA 1QRMA 4M99A 1KRUA 2ICYA 1HV9A 3OH1A 2OEFA 1KK4A 4G3QA 4HZCA 1YP2A 3BSSA 1V67A 3VBNA 3FTTA 3MC4A 2V0KA 3KWCA 3JQYA 4HZDA 3TV0A 1YP4A 3DJ4A 1QRFA 2IU8A 3D98A 4H7OA 4N27A 4EA9A 4M2AA 3OTMA 2QIVX 3BXYA 3IXCA 4G3SA 3KWEA 2GGOA 3SUCA 4IHGA 2WLEA 5E3RA 3R5BA 3VBMA 1KK6A 3F1XA 2JF3A 3BFPA 2JF2A 3GQ8A 3VBKA 2OEGA 2WLGA 3TK8A 1XHDA 3D8VA 4M9CA 4E75A 4E6UA 3BSWA 3VNPA 2QIAA 4G87A 3DHOA 3VBIA 1THJA 4KNXA 3DK5A 1SSMA 4R36A 3VBPA 1L0SA 4KNRA 3Q1XA 4K6RA 5AFUV 2AQ9A 1XATA 5E3PA 3GQ9A 3FSXA 2P2OA 2V0JA 2W0WA 3GQAA 1QQ0A 1KGTA 4EGGA 2ICXA 1SSTA 3R1WA 2WLFA 5ADXU 1HM9A 5DEMA 3OGZA 3HJJA 3OU9A 3NZ2A 3R5DA 1KGQA 1MR7A 3FS8A 1SSQA 3OW5A 4MZUA 4N6BA 3FWWA 3TISA 1KK5A 3TIOA 4N69A 4J18A 4E79A 3C8VA 1QRLA 4MFGA 1HM0A 3R8YA 4AAWA 1LXAA 1TDTA 3OUPA 2OI6A 1HM8A 1M8NA 1G97A 3MQGA 4N6AA 3P47A 2IC7A 4G3PA 4AA7A 2OI5A 2XATA 4EA8A 4KPXA 3OTZA 2VHEA 2Q4JA 4FCEA 4E1KA 4E6TA 4R37A 4HCQA 3EEVA 5U2KA 1N4IA 3P1BA 3GOSA 4IHHA 3GQ7A 3OH3A 4IHFA 3FSBA 4R7PA 3TDTA 2V0IA 2TDTA 1Z90A 2V0LA 5E3QA 3VBJA 1Z2FA 2WLDA 2OI7A 2WLCA 3FSCA 3V4EA 3VBLA 5DG3A 3R0SA 2NPOA 3R2WA 5L6SA 2QKXA 5ADXV 1OCXA 2VD4A 3OH2A 3R3IA 1MRLA 1KRVA 2IU9A 3IGJA 4KPZA 3BRKX 3EG4A 2FKOA 3TWDA 1KHRA 3SPTA 1KRRA 2V0HA 4M98A 4HUSA 3CJ8A 4ISXA 3R3RA 4EQYA 4KQLA 4EAAA 1T3DA 3ECTA 3HSQA 3EH0A 3BSYA 1V3WA 1YP3A 1G95A 3GVDA 5DEPA 4DCLA 5L6VA 3FOQA 4HURA 4M2BA 4AC3A 4EA7A 1QREA 3R5AA 1J2ZA 3SRTA 4M28A 2I5KA 3FSYA 3ST8A 1KQAA 3I3XA 2IUAA 3PMOA 3OH0A 2RIJA 1FWYA 3I3AA 1QRGA 2GGQA 3R5CA 4EABA 1FXJA 2W0VA 3T57A
chains in the Genus database with same CATH topology
3GUEA 1S80A 4MYOA 1MR9A 3MQHA 5AFUU 5F42A 4J09A 3KWDA 1QRMA 4M99A 1KRUA 2ICYA 1HV9A 2OEFA 1KK4A 4G3QA 4HZCA 1YP2A 3BSSA 1V67A 3VBNA 3FTTA 3MC4A 2V0KA 3KWCA 3JQYA 4HZDA 3TV0A 1YP4A 3DJ4A 1QRFA 2IU8A 3D98A 4H7OA 4N27A 4EA9A 4M2AA 3OTMA 2QIVX 3BXYA 3IXCA 4G3SA 3KWEA 2GGOA 4IHGA 2WLEA 5E3RA 3R5BA 3VBMA 1KK6A 3F1XA 2JF3A 3BFPA 2JF2A 3VBKA 2OEGA 2WLGA 3TK8A 1XHDA 3D8VA 4M9CA 4E75A 4E6UA 3BSWA 3VNPA 2QIAA 4G87A 3DHOA 3VBIA 1THJA 4KNXA 3DK5A 1SSMA 4R36A 3VBPA 4KNRA 3Q1XA 4K6RA 5AFUV 2AQ9A 1XATA 5E3PA 3FSXA 2P2OA 2V0JA 2W0WA 1QQ0A 1KGTA 4EGGA 2ICXA 1SSTA 3R1WA 2WLFA 5ADXU 1HM9A 5DEMA 3HJJA 3OU9A 3NZ2A 3R5DA 1KGQA 1MR7A 3FS8A 1SSQA 3OW5A 4MZUA 4N6BA 3FWWA 3TISA 1KK5A 3TIOA 4N69A 4J18A 4E79A 3C8VA 1QRLA 4MFGA 1HM0A 3R8YA 4AAWA 1LXAA 1TDTA 3OUPA 2OI6A 1HM8A 1G97A 3MQGA 4N6AA 3P47A 2IC7A 4G3PA 4AA7A 2OI5A 2XATA 4EA8A 4KPXA 3OTZA 2VHEA 2Q4JA 4FCEA 4E1KA 4E6TA 4R37A 4HCQA 3EEVA 5U2KA 3P1BA 3GOSA 4IHHA 4IHFA 3FSBA 4R7PA 3TDTA 2V0IA 2TDTA 1Z90A 2V0LA 5E3QA 3VBJA 2WLDA 2OI7A 2WLCA 3FSCA 3V4EA 3VBLA 5DG3A 3R0SA 2NPOA 3R2WA 5L6SA 2QKXA 5ADXV 1OCXA 2VD4A 3R3IA 1MRLA 1KRVA 2IU9A 3IGJA 4KPZA 3BRKX 3EG4A 2FKOA 3TWDA 1KHRA 3SPTA 1KRRA 2V0HA 4M98A 4HUSA 3CJ8A 4ISXA 3R3RA 4EQYA 4KQLA 4EAAA 1T3DA 3ECTA 3HSQA 3EH0A 3BSYA 1V3WA 1YP3A 1G95A 3GVDA 5DEPA 4DCLA 5L6VA 3FOQA 4HURA 4M2BA 4AC3A 4EA7A 1QREA 3R5AA 1J2ZA 3SRTA 4M28A 2I5KA 3FSYA 3ST8A 1KQAA 3I3XA 2IUAA 3PMOA 2RIJA 1FWYA 3I3AA 1QRGA 2GGQA 3R5CA 4EABA 1FXJA 2W0VA 3T57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GUE A;  1S80 A;  4MYO A;  1MR9 A;  3MQH A;  5AFU U;  5F42 A;  4J09 A;  3KWD A;  1QRM A;  4M99 A;  1KRU A;  2ICY A;  1HV9 A;  2OEF A;  1KK4 A;  4G3Q A;  4HZC A;  1YP2 A;  3BSS A;  1V67 A;  3VBN A;  3FTT A;  3MC4 A;  2V0K A;  3KWC A;  3JQY A;  4HZD A;  3TV0 A;  1YP4 A;  3DJ4 A;  1QRF A;  2IU8 A;  3D98 A;  4H7O A;  4N27 A;  4EA9 A;  4M2A A;  3OTM A;  2QIV X;  3BXY A;  3IXC A;  4G3S A;  3KWE A;  2GGO A;  4IHG A;  2WLE A;  5E3R A;  3R5B A;  3VBM A;  1KK6 A;  3F1X A;  2JF3 A;  3BFP A;  2JF2 A;  3VBK A;  2OEG A;  2WLG A;  3TK8 A;  1XHD A;  3D8V A;  4M9C A;  4E75 A;  4E6U A;  3BSW A;  3VNP A;  2QIA A;  4G87 A;  3DHO A;  3VBI A;  1THJ A;  4KNX A;  3DK5 A;  1SSM A;  4R36 A;  3VBP A;  4KNR A;  3Q1X A;  4K6R A;  5AFU V;  2AQ9 A;  1XAT A;  5E3P A;  3FSX A;  2P2O A;  2V0J A;  2W0W A;  1QQ0 A;  1KGT A;  4EGG A;  2ICX A;  1SST A;  3R1W A;  2WLF A;  5ADX U;  1HM9 A;  5DEM A;  3HJJ A;  3OU9 A;  3NZ2 A;  3R5D A;  1KGQ A;  1MR7 A;  3FS8 A;  1SSQ A;  3OW5 A;  4MZU A;  4N6B A;  3FWW A;  3TIS A;  1KK5 A;  3TIO A;  4N69 A;  4J18 A;  4E79 A;  3C8V A;  1QRL A;  4MFG A;  1HM0 A;  3R8Y A;  4AAW A;  1LXA A;  1TDT A;  3OUP A;  2OI6 A;  1HM8 A;  1G97 A;  3MQG A;  4N6A A;  3P47 A;  2IC7 A;  4G3P A;  4AA7 A;  2OI5 A;  2XAT A;  4EA8 A;  4KPX A;  3OTZ A;  2VHE A;  2Q4J A;  4FCE A;  4E1K A;  4E6T A;  4R37 A;  4HCQ A;  3EEV A;  5U2K A;  3P1B A;  3GOS A;  4IHH A;  4IHF A;  3FSB A;  4R7P A;  3TDT A;  2V0I A;  2TDT A;  1Z90 A;  2V0L A;  5E3Q A;  3VBJ A;  2WLD A;  2OI7 A;  2WLC A;  3FSC A;  3V4E A;  3VBL A;  5DG3 A;  3R0S A;  2NPO A;  3R2W A;  5L6S A;  2QKX A;  5ADX V;  1OCX A;  2VD4 A;  3R3I A;  1MRL A;  1KRV A;  2IU9 A;  3IGJ A;  4KPZ A;  3BRK X;  3EG4 A;  2FKO A;  3TWD A;  1KHR A;  3SPT A;  1KRR A;  2V0H A;  4M98 A;  4HUS A;  3CJ8 A;  4ISX A;  3R3R A;  4EQY A;  4KQL A;  4EAA A;  1T3D A;  3ECT A;  3HSQ A;  3EH0 A;  3BSY A;  1V3W A;  1YP3 A;  1G95 A;  3GVD A;  5DEP A;  4DCL A;  5L6V A;  3FOQ A;  4HUR A;  4M2B A;  4AC3 A;  4EA7 A;  1QRE A;  3R5A A;  1J2Z A;  3SRT A;  4M28 A;  2I5K A;  3FSY A;  3ST8 A;  1KQA A;  3I3X A;  2IUA A;  3PMO A;  2RIJ A;  1FWY A;  3I3A A;  1QRG A;  2GGQ A;  3R5C A;  4EAB A;  1FXJ A;  2W0V A;  3T57 A; 
#chains in the Genus database with same CATH topology
 3GUE A;  1S80 A;  4MYO A;  3OH4 A;  1MR9 A;  3MQH A;  5AFU U;  5F42 A;  4J09 A;  3KWD A;  1EWW A;  1QRM A;  4M99 A;  1KRU A;  2ICY A;  1HV9 A;  3OH1 A;  2OEF A;  1KK4 A;  4G3Q A;  4HZC A;  1YP2 A;  3BSS A;  1V67 A;  3VBN A;  3FTT A;  3MC4 A;  2V0K A;  3KWC A;  3JQY A;  4HZD A;  3TV0 A;  1YP4 A;  3DJ4 A;  1QRF A;  2IU8 A;  3D98 A;  4H7O A;  4N27 A;  4EA9 A;  4M2A A;  3OTM A;  2QIV X;  3BXY A;  3IXC A;  4G3S A;  3KWE A;  2GGO A;  3SUC A;  4IHG A;  2WLE A;  5E3R A;  3R5B A;  3VBM A;  1KK6 A;  3F1X A;  2JF3 A;  3BFP A;  2JF2 A;  3GQ8 A;  3VBK A;  2OEG A;  2WLG A;  3TK8 A;  1XHD A;  3D8V A;  4M9C A;  4E75 A;  4E6U A;  3BSW A;  3VNP A;  2QIA A;  4G87 A;  3DHO A;  3VBI A;  1THJ A;  4KNX A;  3DK5 A;  1SSM A;  4R36 A;  3VBP A;  1L0S A;  4KNR A;  3Q1X A;  4K6R A;  5AFU V;  2AQ9 A;  1XAT A;  5E3P A;  3GQ9 A;  3FSX A;  2P2O A;  2V0J A;  2W0W A;  3GQA A;  1QQ0 A;  1KGT A;  4EGG A;  2ICX A;  1SST A;  3R1W A;  2WLF A;  5ADX U;  1HM9 A;  5DEM A;  3OGZ A;  3HJJ A;  3OU9 A;  3NZ2 A;  3R5D A;  1KGQ A;  1MR7 A;  3FS8 A;  1SSQ A;  3OW5 A;  4MZU A;  4N6B A;  3FWW A;  3TIS A;  1KK5 A;  3TIO A;  4N69 A;  4J18 A;  4E79 A;  3C8V A;  1QRL A;  4MFG A;  1HM0 A;  3R8Y A;  4AAW A;  1LXA A;  1TDT A;  3OUP A;  2OI6 A;  1HM8 A;  1M8N A;  1G97 A;  3MQG A;  4N6A A;  3P47 A;  2IC7 A;  4G3P A;  4AA7 A;  2OI5 A;  2XAT A;  4EA8 A;  4KPX A;  3OTZ A;  2VHE A;  2Q4J A;  4FCE A;  4E1K A;  4E6T A;  4R37 A;  4HCQ A;  3EEV A;  5U2K A;  1N4I A;  3P1B A;  3GOS A;  4IHH A;  3GQ7 A;  3OH3 A;  4IHF A;  3FSB A;  4R7P A;  3TDT A;  2V0I A;  2TDT A;  1Z90 A;  2V0L A;  5E3Q A;  3VBJ A;  1Z2F A;  2WLD A;  2OI7 A;  2WLC A;  3FSC A;  3V4E A;  3VBL A;  5DG3 A;  3R0S A;  2NPO A;  3R2W A;  5L6S A;  2QKX A;  5ADX V;  1OCX A;  2VD4 A;  3OH2 A;  3R3I A;  1MRL A;  1KRV A;  2IU9 A;  3IGJ A;  4KPZ A;  3BRK X;  3EG4 A;  2FKO A;  3TWD A;  1KHR A;  3SPT A;  1KRR A;  2V0H A;  4M98 A;  4HUS A;  3CJ8 A;  4ISX A;  3R3R A;  4EQY A;  4KQL A;  4EAA A;  1T3D A;  3ECT A;  3HSQ A;  3EH0 A;  3BSY A;  1V3W A;  1YP3 A;  1G95 A;  3GVD A;  5DEP A;  4DCL A;  5L6V A;  3FOQ A;  4HUR A;  4M2B A;  4AC3 A;  4EA7 A;  1QRE A;  3R5A A;  1J2Z A;  3SRT A;  4M28 A;  2I5K A;  3FSY A;  3ST8 A;  1KQA A;  3I3X A;  2IUA A;  3PMO A;  3OH0 A;  2RIJ A;  1FWY A;  3I3A A;  1QRG A;  2GGQ A;  3R5C A;  4EAB A;  1FXJ A;  2W0V A;  3T57 A; 
#chains in the Genus database with same CATH homology
 3GUE A;  1S80 A;  4MYO A;  1MR9 A;  3MQH A;  5AFU U;  5F42 A;  4J09 A;  3KWD A;  1QRM A;  4M99 A;  1KRU A;  2ICY A;  1HV9 A;  2OEF A;  1KK4 A;  4G3Q A;  4HZC A;  1YP2 A;  3BSS A;  1V67 A;  3VBN A;  3FTT A;  3MC4 A;  2V0K A;  3KWC A;  3JQY A;  4HZD A;  3TV0 A;  1YP4 A;  3DJ4 A;  1QRF A;  2IU8 A;  3D98 A;  4H7O A;  4N27 A;  4EA9 A;  4M2A A;  3OTM A;  2QIV X;  3BXY A;  3IXC A;  4G3S A;  3KWE A;  2GGO A;  4IHG A;  2WLE A;  5E3R A;  3R5B A;  3VBM A;  1KK6 A;  3F1X A;  2JF3 A;  3BFP A;  2JF2 A;  3VBK A;  2OEG A;  2WLG A;  3TK8 A;  1XHD A;  3D8V A;  4M9C A;  4E75 A;  4E6U A;  3BSW A;  3VNP A;  2QIA A;  4G87 A;  3DHO A;  3VBI A;  1THJ A;  4KNX A;  3DK5 A;  1SSM A;  4R36 A;  3VBP A;  4KNR A;  3Q1X A;  4K6R A;  5AFU V;  2AQ9 A;  1XAT A;  5E3P A;  3FSX A;  2P2O A;  2V0J A;  2W0W A;  1QQ0 A;  1KGT A;  4EGG A;  2ICX A;  1SST A;  3R1W A;  2WLF A;  5ADX U;  1HM9 A;  5DEM A;  3HJJ A;  3OU9 A;  3NZ2 A;  3R5D A;  1KGQ A;  1MR7 A;  3FS8 A;  1SSQ A;  3OW5 A;  4MZU A;  4N6B A;  3FWW A;  3TIS A;  1KK5 A;  3TIO A;  4N69 A;  4J18 A;  4E79 A;  3C8V A;  1QRL A;  4MFG A;  1HM0 A;  3R8Y A;  4AAW A;  1LXA A;  1TDT A;  3OUP A;  2OI6 A;  1HM8 A;  1G97 A;  3MQG A;  4N6A A;  3P47 A;  2IC7 A;  4G3P A;  4AA7 A;  2OI5 A;  2XAT A;  4EA8 A;  4KPX A;  3OTZ A;  2VHE A;  2Q4J A;  4FCE A;  4E1K A;  4E6T A;  4R37 A;  4HCQ A;  3EEV A;  5U2K A;  3P1B A;  3GOS A;  4IHH A;  4IHF A;  3FSB A;  4R7P A;  3TDT A;  2V0I A;  2TDT A;  1Z90 A;  2V0L A;  5E3Q A;  3VBJ A;  2WLD A;  2OI7 A;  2WLC A;  3FSC A;  3V4E A;  3VBL A;  5DG3 A;  3R0S A;  2NPO A;  3R2W A;  5L6S A;  2QKX A;  5ADX V;  1OCX A;  2VD4 A;  3R3I A;  1MRL A;  1KRV A;  2IU9 A;  3IGJ A;  4KPZ A;  3BRK X;  3EG4 A;  2FKO A;  3TWD A;  1KHR A;  3SPT A;  1KRR A;  2V0H A;  4M98 A;  4HUS A;  3CJ8 A;  4ISX A;  3R3R A;  4EQY A;  4KQL A;  4EAA A;  1T3D A;  3ECT A;  3HSQ A;  3EH0 A;  3BSY A;  1V3W A;  1YP3 A;  1G95 A;  3GVD A;  5DEP A;  4DCL A;  5L6V A;  3FOQ A;  4HUR A;  4M2B A;  4AC3 A;  4EA7 A;  1QRE A;  3R5A A;  1J2Z A;  3SRT A;  4M28 A;  2I5K A;  3FSY A;  3ST8 A;  1KQA A;  3I3X A;  2IUA A;  3PMO A;  2RIJ A;  1FWY A;  3I3A A;  1QRG A;  2GGQ A;  3R5C A;  4EAB A;  1FXJ A;  2W0V A;  3T57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...