3D98A

Crystal structure of glmu from mycobacterium tuberculosis, ligand-free form
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
390
structure length
390
Chain Sequence
TFPGDTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional protein glmU
publication title Structure and function of GlmU from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 148
structure length 390
sequence length 390
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3d98A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3d98A01
2D7RA 4FREA 1ZCVA 1J2ZA 1LZ7A 2QIAA 3F1CA 3CKQA 4D48A 2YQCA 2APCA 3V0QA 2BO8A 3V0NA 4DCLA 5DG3A 1G1LA 1ZJ2A 5C47A 1QRFA 4NANA 3SXAA 3SXCA 1WVCA 3VBMA 2VXLA 3TIOA 2WLDA 4YS8A 3V8ZA 4LW3A 3IOJA 5C38A 2E3DA 2FY7A 4FRMA 3OTZA 3I3XA 2YQJA 1ZI5A 4EA7A 2VS5A 1V84A 2RJ0A 3MC4A 3RMVA 4E79A 5ADXV 2WLCA 1H4DA 1ZIZA 4EE4A 2NPOA 3I0HA 1G3LA 2RITA 1H7HA 1R7XA 2Y4MA 4NALA 1LZIA 2QKXA 2VSIA 1OMXA 3BSYA 1FR9A 2PX7A 2YC5A 1G0RA 3ECTA 2WAWA 2GGQA 3V0OA 4LW6A 2X5ZA 1QRGA 4FRAA 1S80A 1FO8A 4ASYA 3DUVA 4M2AA 4M2BA 1INJA 5C48A 5E3QA 4DDZA 2RIZA 2O1FA 3VNPA 1FGXA 4AC3A 1I52A 4Y7FA 3K8DA 5CMGX 1INIA 1HM0A 5FTVA 1W57A 3VBPA 4Y7TA 1ZJ1A 4XWIA 3JUJA 5E3RA 1SSMA 4MFGA 1ON6A 3R0SA 4P02A 5C4BA 4HO3A 1E5KA 5L6SA 3JTJA 3LW6A 3R8YA 2FFVA 3EEVA 1H7EA 3QVBA 4KXOA 1KQAA 2WGZA 1TW5A 3BFPA 1Z90A 3HL3A 1R7VA 5C36A 1G97A 5FYEA 3I0IX 5U2KA 3OU9A 4FROA 2Y4LA 1HM9A 1KK6A 3I0DA 2XATA 1XZ6A 1QWJA 5L6VA 2WVMA 4EAAA 2V0LA 2P72A 1PZTA 2Z87A 1G2VA 2AH9A 1FWYA 1H4EA 5CQNX 2X65A 2YC3A 2WLFA 1NWGB 2Y6PA 2BO6A 5F42A 4AYJA 2QIVX 1H5SA 1FZWA 3EE5A 2V0IA 1VGZA 1XHBA 4B5BA 3OUPA 1ZI3A 4D0ZA 4K6RA 3SX8A 4D0TA 5DDVA 3OTMA 5J49A 2GGOA 3R3RA 2FFUA 4HO4A 4Y7UA 4N69A 1G95A 4HO9A 4DE7A 3E25A 1ZI1A 1XHDA 4Y64A 3C8VA 3U2XA 5C49A 5JQQA 3SRTA 3I0GA 3FSBA 3FSXA 2IU9A 2ZU7A 1KK5A 1VZUA 3ZGFA 1HV9A 1GWVA 4E1KA 4EA9A 4EQYA 3ZF8A 3VBIA 3Q1XA 1IIMA 1ZDFA 3I0FA 5C1HA 3SXEA 1SSQA 3D5NA 2AM4A 2AM5A 1YP4A 2WVKA 5FV9A 3CKOA 1QREA 1H5SB 2V0HA 3N9WA 2E8BA 3DJ4A 5AJOA 3R1WA 4ZDQA 1QG8A 1HM8A 1QGSA 3FSCA 1MR7A 1H7QA 1VZXA 1JVGA 1OCXA 1G8OA 4EE5A 1LL2A 5EIYA 4HCQA 3U0YA 3USRA 1MP5A 2VD4A 4EE3A 2ICYA 4G3QA 5C3BA 1JYLA 4B2XA 1LZJA 2WLEA 3KWCA 5CQMX 5EJZA 4ISXA 3TV0A 1O23B 5AFUV 3PMOA 1LXAA 1R82A 3SX7A 4G3SA 3F1YA 3OH4A 1VGTA 4EEOA 4EEAA 4HZDA 1YROB 2I5KA 3IGJA 3PKQA 4CJCA 4D11C 3OGZA 3P47A 3TZTA 5ADXU 4HO0A 4B4BA 3BRKX 2JCKA 3OH1A 4EA8A 1KRVA 3U0XA 1H5SC 5IDTA 3T57A 5C4EA 3R5CA 2O1HA 4Y6NA 1V82A 1OQMB 1SSTA 3TWDA 1ZCTA 2IC7A 2VS4A 5C1LA 4GBPA 1S4NA 2AESA 2NXVA 3USQA 1GWWA 4FRLA 4HO2A 2RJ9A 3ZLLA 4KQLA 2WLGA 1GX4A 3SXDA 1FR8A 4ARWA 1WT3A 5C3DA 3GOSA 3P1BA 5I1FA 2JCJA 1IINA 4IHGA 1R7YA 1KWSA 2Y4JA 3OH0A 5DEMA 1V3WA 3I3AA 2Z86A 3TK8A 1WT2A 2RJ4A 4N6BA 4L41C 5C4FA 3V8YA 4FQWA 4M4KA 3U2WA 4MYOA 4R37A 3VBLA 3D98A 1VICA 1KRRA 4M28A 1JYKA 2I7BA 4ECMA 3O3PA 4CJ8A 4D11A 3HSQA 3BSSA 1FGGA 2I5EA 4HZCA 3D8VA 2RJ1A 4BQHA 3R2WA 3VBJA 3K8EA 4Y6UA 3FTTA 2AQ9A 2YQSA 1ZCYA 4Y7GA 2JF3A 2RIXA 1GA8A 2FYAA 5DDTA 4KC2A 2FYBA 1GQCA 3GVDA 4P00A 1MR9A 2VXMA 1EZIA 4R7PA 4B2WA 2OEFA 1FO9A 4M98A 1S4OA 1H3MA 4Y62A 1JV3A 3RMWA 5EJ1A 1MC3A 3VBKA 3IOIA 2YQHA 2P2OA 4DECA 4KNXA 1JV1A 4J09A 5AJNA 1LZ0A 1FXJA 3I0CA 1KGQA 2XWNA 3V91A 3FSYA 3PNNA 3R5BA 4HO5A 2OI6A 3T7OA 3DK5A 1LVWA 2A8UA 1VM8A 3BCVA 1W55A 1PZYB 2BO4A 4HURA 3CKVA 1ZDGA 5CMFX 1V83A 2UX8A 4N27A 5FU8A 3R5AA 1H7LA 2PGYA 1TVYA 1VPAA 1ZHJA 1TW1A 3POLA 4J18A 3V4EA 3JQYA 1QRLA 5E3PA 1FOAA 2WEEA 4IRPA 4IRQA 3KWEA 5CQOA 1WT0A 5CMIA 4N6AA 3I0KA 4MZUA 3DHOA 3U2UA 2RJ5A 4G3PA 1SS9A 2VFZA 4BMAA 3R3IA 3U2VA 2FKOA 1NQIB 4KPXA 3V90A 4EGGA 4UEGA 3SX3A 3ST8A 1W77A 2RJ8A 5HS2A 3PKPA 1GQ9A 5CMJA 5C1GA 4M99A 2P6WA 2VHEA 4KRVA 1ON8A 3OH2A 3V0LA 2ZU8A 2QH5A 1GX0A 1H7FA 1HJJA 3OH3A 4FCEA 2CU2A 2D0JA 3V0MA 1TDTA 4AYLA 1LL0A 1O0RA 2VSHA 2WVLA 3RSBA 4FRQA 4G87A 4EEMA 1MRLA 1TZFA 1JVDA 4Y9XA 1MP4A 3CJ8A 3CKNA 4FRBA 2XMHA 1MP3A 4HUSA 5CQPA 3FS8A 4C2SA 1YP2A 1KGTA 5FU0A 2PGVA 2Q4JA 5DEPA 2O1GA 1O7QA 1R81A 1ZJPA 2YESA 2OI7A 2W0WA 2W0VA 2FYCB 4Y7VA 3SXGA 2V0KA 2WE9A 3R5DA 4Y63A 4E75A 1S4PA 1ZCUA 3CU0A 4IHFA 3EG4A 3ZLKA 2P73A 1R80A 1H5SD 3MQGA 4B4GA 1VGWA 2OEGA 1ZJ0A 1YP3A 4MYBA 5FTSA 3ZGGA 3I0EA 5C8RA 2AE7A 3SX5A 2A8WA 1G23A 4B3UA 4R36A 1XATA 1WSZA 3KWDA 4FRPA 2QGIA 1EYRA 3OW5A 3GUEA 4HG6A 2RIYA 3Q7UA 1H7TA 3OC9A 2X5SA 3TQDA 1H5TA 5IDSA 1H5RA 3U2TA 1FXOA 1FG5N 1QQ0A 4E6UA 1R7TA 1G9RA 3BXYA 3FOQA 3E26A 1ZI4A 3NZ2A 1R7UA 2IUAA 5C3AA 3HJJA 1HJLA 3T7NA 5CMHA 5C4DA 3NGWA 3Q80A 2D7IA 2Y4KA 1ZJOA 5AJPA 4HO6A 4CVHA 2JF2A 3SPTA 4FRDA 4HO8A 1NKHB 1H7GA 1VZTA 3IOHA 2RJ7A 3SXBA 2TDTA 3FWWA 4JISA 1NMMB 1NHEB 2Y7AA 4FRHA 1T3DA 1KRUA 3I0JA 1VH3A 4FCUA 4EABA 1VGUA 4EVWA 1FRWA 3V0PA 3Q4SA 1KHRA 1V67A 4MNDA 1H4CA 1O7OA 4KNRA 4CJBA 2MZBA 4KC1A 1G93A 4IHHA 2IU8A 3CKJA 1K4VA 5C4CA 2JCLA 2XWLA 4M9CA 1H5TB 1H5RB 2VS3A 4NAIA 3MQHA 2RJ6A 3I0LA 2DPWA 4HOCA 2X60A 2XMEA 5BXCA 1THJA 5IFYA 1QRMA 3TDTA 4AA7A 5FUHA 4KPZA 2ZU9A 4B4MA 1KK4A 1NF5B 2AGDA 2OI5A 4NAKA 4KC4A 3IXCA 3EH0A 3KIAA 3VBNA 4B42A 5CQLX 4AAWA 2FYDB 3CGXA 4KT7A 1QGQA 1ZJ3A 3TISA 1OMZA 2JCOA 4E6TA 2BO7A 2YCMA 4ASJA 1VH1A 3OKRA 2XWMA 2PA4A 3BSWA 4JD0A 3T7MA 4EEGA 4H7OA 2AECA 3F1XA 1WT1A 2AM3A 1LL3A 2RIJA 3JUKA 5AFUU 2ICXA 3OAMA 2V0JA
chains in the Genus database with same CATH superfamily
2D7RA 1M8NA 4FREA 1ZCVA 1J2ZA 1LZ7A 2QIAA 3F1CA 3CKQA 4D48A 2YQCA 2APCA 3V0QA 2BO8A 3V0NA 4DCLA 5DG3A 1G1LA 1ZJ2A 5C47A 1QRFA 4NANA 3SXAA 3SXCA 1WVCA 3VBMA 2VXLA 3TIOA 2WLDA 4YS8A 3V8ZA 4LW3A 3IOJA 5C38A 2E3DA 2FY7A 4FRMA 3OTZA 3I3XA 2YQJA 1ZI5A 4EA7A 2VS5A 1V84A 2RJ0A 3MC4A 3RMVA 4E79A 3GQ7A 5ADXV 2WLCA 1H4DA 1ZIZA 4EE4A 2NPOA 3I0HA 1G3LA 2RITA 1H7HA 1R7XA 2Y4MA 4NALA 1LZIA 2QKXA 2VSIA 1OMXA 3BSYA 1FR9A 2PX7A 2YC5A 1G0RA 3ECTA 2WAWA 2GGQA 3V0OA 4LW6A 2X5ZA 1QRGA 4FRAA 1S80A 1FO8A 4ASYA 3DUVA 4M2AA 4M2BA 1INJA 5C48A 5E3QA 3GQ8A 4DDZA 2RIZA 2O1FA 3VNPA 1FGXA 4AC3A 1I52A 4Y7FA 3K8DA 5CMGX 1INIA 1HM0A 5FTVA 1W57A 3VBPA 4Y7TA 1ZJ1A 4XWIA 3JUJA 5E3RA 1SSMA 4MFGA 1ON6A 3R0SA 4P02A 5C4BA 4HO3A 1E5KA 5L6SA 3JTJA 3LW6A 3R8YA 2FFVA 3EEVA 1H7EA 3QVBA 4KXOA 1KQAA 2WGZA 1TW5A 3BFPA 1Z90A 3HL3A 1R7VA 5C36A 1G97A 5FYEA 3I0IX 5U2KA 3OU9A 4FROA 2Y4LA 1HM9A 1KK6A 3I0DA 4O6NA 2XATA 1XZ6A 1QWJA 5L6VA 2WVMA 4EAAA 2V0LA 2P72A 1PZTA 2Z87A 1G2VA 2AH9A 1FWYA 1H4EA 5CQNX 2X65A 2YC3A 2WLFA 1NWGB 2Y6PA 2BO6A 5F42A 4AYJA 2QIVX 1H5SA 1FZWA 3EE5A 2V0IA 1VGZA 1XHBA 4B5BA 3OUPA 1ZI3A 4D0ZA 4K6RA 3SX8A 4D0TA 5DDVA 3OTMA 5J49A 2GGOA 3R3RA 2FFUA 4HO4A 4Y7UA 4N69A 1G95A 4HO9A 4DE7A 3E25A 1ZI1A 1XHDA 4Y64A 3C8VA 3U2XA 5C49A 5JQQA 3SRTA 3I0GA 3FSBA 1Z2FA 3FSXA 2IU9A 2ZU7A 1KK5A 1VZUA 3ZGFA 1HV9A 1GWVA 4E1KA 4EA9A 4EQYA 3ZF8A 3VBIA 3Q1XA 1IIMA 1ZDFA 3I0FA 5C1HA 3SXEA 1SSQA 3D5NA 2AM4A 2AM5A 1YP4A 2WVKA 5FV9A 3CKOA 1QREA 1H5SB 2V0HA 3N9WA 4MIXA 2E8BA 3DJ4A 5AJOA 3R1WA 4ZDQA 1QG8A 2VK9A 1HM8A 1QGSA 3FSCA 1MR7A 1H7QA 1VZXA 1JVGA 1OCXA 1G8OA 4EE5A 1LL2A 5EIYA 4HCQA 3U0YA 3USRA 1MP5A 2VD4A 4EE3A 2ICYA 4G3QA 5C3BA 1JYLA 4B2XA 1LZJA 2WLEA 3KWCA 5CQMX 5EJZA 4ISXA 3TV0A 1O23B 5AFUV 3PMOA 1LXAA 1R82A 3SX7A 3OH4A 4G3SA 3F1YA 1VGTA 4EEOA 4EEAA 4HZDA 1YROB 2I5KA 3IGJA 3PKQA 4CJCA 5D92A 4D11C 3OGZA 3P47A 3TZTA 5ADXU 4HO0A 4FIYA 3BRKX 2JCKA 4B4BA 3OH1A 4EA8A 1KRVA 3U0XA 1H5SC 5IDTA 3T57A 5C4EA 3R5CA 2O1HA 4Y6NA 1V82A 1OQMB 1SSTA 3TWDA 1ZCTA 2IC7A 2VS4A 5C1LA 4GBPA 1S4NA 2AESA 2NXVA 3USQA 1GWWA 4FRLA 4HO2A 2RJ9A 3ZLLA 4KQLA 2WLGA 1GX4A 3SXDA 5D91A 1FR8A 4ARWA 1WT3A 5C3DA 3GOSA 3P1BA 3GQ9A 5I1FA 2JCJA 1IINA 4IHGA 1R7YA 1KWSA 3OH0A 2Y4JA 5DEMA 1V3WA 3I3AA 2Z86A 3TK8A 1WT2A 2RJ4A 4N6BA 4L41C 5C4FA 3V8YA 4FQWA 4M4KA 3U2WA 4MYOA 4R37A 3VBLA 3D98A 1VICA 1KRRA 4M28A 1JYKA 2I7BA 4ECMA 4Q7CA 3O3PA 4CJ8A 4D11A 3HSQA 3BSSA 1FGGA 2I5EA 4HZCA 3D8VA 2RJ1A 4BQHA 3R2WA 3VBJA 3K8EA 4Y6UA 3FTTA 2AQ9A 2YQSA 1ZCYA 4Y7GA 2JF3A 2RIXA 1GA8A 2FYAA 5DDTA 4KC2A 2FYBA 1GQCA 3GVDA 4P00A 1MR9A 2VXMA 1EZIA 4R7PA 4B2WA 2OEFA 1FO9A 4M98A 1S4OA 1H3MA 4Y62A 1JV3A 3RMWA 5EJ1A 1MC3A 3VBKA 3IOIA 2YQHA 2P2OA 4DECA 4KNXA 1JV1A 4J09A 5AJNA 1LZ0A 1FXJA 3I0CA 1KGQA 2XWNA 3V91A 3FSYA 3PNNA 3R5BA 4HO5A 2J0BA 2OI6A 3T7OA 3DK5A 1LVWA 2A8UA 1VM8A 3BCVA 1W55A 1PZYB 2BO4A 4HURA 3CKVA 1ZDGA 5CMFX 1V83A 2UX8A 4N27A 2C0NA 3R5AA 1H7LA 2PGYA 5FU8A 1TVYA 1VPAA 1ZHJA 1TW1A 3POLA 4J18A 3V4EA 3JQYA 1QRLA 5E3PA 1FOAA 2WEEA 4IRPA 4IRQA 3KWEA 5CQOA 1WT0A 5CMIA 4N6AA 3I0KA 4MZUA 3DHOA 3U2UA 2RJ5A 4G3PA 1SS9A 2VFZA 4BMAA 3R3IA 3U2VA 2FKOA 1NQIB 4KPXA 3V90A 4EGGA 4UEGA 3SX3A 3ST8A 4O6MA 1W77A 2RJ8A 5HS2A 3PKPA 1GQ9A 5CMJA 5C1GA 4M99A 2P6WA 2VHEA 4KRVA 1ON8A 3OH2A 3V0LA 2ZU8A 2QH5A 1GX0A 1H7FA 1HJJA 3OH3A 4FCEA 2CU2A 2D0JA 3V0MA 1TDTA 4AYLA 1LL0A 1O0RA 2VSHA 2WVLA 3RSBA 4FRQA 4G87A 4EEMA 1MRLA 1TZFA 1JVDA 4Y9XA 1MP4A 3CJ8A 3CKNA 4FRBA 2XMHA 1MP3A 4HUSA 5CQPA 3FS8A 4C2SA 1YP2A 1KGTA 5FU0A 2PGVA 2Q4JA 5DEPA 2O1GA 1O7QA 1R81A 1ZJPA 2YESA 2OI7A 2W0WA 2W0VA 2FYCB 4Y7VA 3SXGA 2V0KA 2WE9A 3R5DA 4Y63A 4E75A 1S4PA 1ZCUA 3CU0A 4IHFA 3EG4A 3ZLKA 2P73A 1R80A 1H5SD 3MQGA 4B4GA 1VGWA 2OEGA 1ZJ0A 1YP3A 4MYBA 5FTSA 3ZGGA 3I0EA 5C8RA 2AE7A 3SX5A 2A8WA 1G23A 4B3UA 4R36A 1XATA 1WSZA 3KWDA 4FRPA 2QGIA 1EYRA 3OW5A 3GUEA 4HG6A 2RIYA 3Q7UA 1H7TA 3OC9A 2X5SA 4FIXA 1H5TA 3TQDA 5IDSA 1H5RA 3U2TA 1FXOA 1FG5N 1QQ0A 4E6UA 1R7TA 1G9RA 3BXYA 3FOQA 3E26A 1ZI4A 3NZ2A 1R7UA 2IUAA 5C3AA 3HJJA 1HJLA 3T7NA 5CMHA 5C4DA 3NGWA 3Q80A 2D7IA 2Y4KA 1ZJOA 5AJPA 4HO6A 4CVHA 2JF2A 3SPTA 4FRDA 4HO8A 1NKHB 1H7GA 1VZTA 3IOHA 2RJ7A 3SXBA 2TDTA 3FWWA 4JISA 1NMMB 1NHEB 2Y7AA 4FRHA 1T3DA 3SUCA 1KRUA 3I0JA 1VH3A 4FCUA 4EABA 1VGUA 4EVWA 1FRWA 3V0PA 3Q4SA 1KHRA 1V67A 4MNDA 1H4CA 1O7OA 4KNRA 4CJBA 2MZBA 4KC1A 1G93A 2J0AA 4IHHA 2IU8A 3CKJA 1K4VA 5C4CA 2JCLA 2XWLA 4M9CA 1H5TB 1H5RB 2VS3A 4NAIA 3MQHA 3GQAA 2RJ6A 3I0LA 2DPWA 4HOCA 2X60A 2XMEA 5BXCA 1THJA 5IFYA 1EWWA 1QRMA 3TDTA 4AA7A 5FUHA 4KPZA 2ZU9A 4B4MA 1KK4A 1NF5B 2AGDA 2OI5A 4NAKA 4KC4A 3IXCA 3EH0A 3KIAA 3VBNA 4B42A 5CQLX 4AAWA 2FYDB 3CGXA 4KT7A 1QGQA 1ZJ3A 3TISA 1OMZA 2JCOA 4E6TA 2BO7A 2YCMA 4ASJA 1VH1A 1L0SA 3OKRA 2XWMA 2PA4A 3BSWA 4JD0A 3T7MA 4EEGA 4H7OA 2AECA 3F1XA 1WT1A 1N4IA 2AM3A 1LL3A 2RIJA 3JUKA 5AFUU 2ICXA 3OAMA 2V0JA
chains in the Genus database with same CATH topology
2D7RA 4FREA 1ZCVA 1J2ZA 1LZ7A 2QIAA 3F1CA 3CKQA 4D48A 2YQCA 2APCA 3V0QA 2BO8A 3V0NA 4DCLA 5DG3A 1G1LA 1ZJ2A 5C47A 1QRFA 4NANA 3SXAA 3SXCA 1WVCA 3VBMA 2VXLA 3TIOA 2WLDA 4YS8A 3V8ZA 4LW3A 3IOJA 5C38A 2E3DA 2FY7A 4FRMA 3OTZA 3I3XA 2YQJA 1ZI5A 4EA7A 2VS5A 1V84A 2RJ0A 3MC4A 3RMVA 4E79A 5ADXV 2WLCA 1H4DA 1ZIZA 4EE4A 2NPOA 3I0HA 1G3LA 2RITA 1H7HA 1R7XA 2Y4MA 4NALA 1LZIA 2QKXA 2VSIA 1OMXA 3BSYA 1FR9A 2PX7A 2YC5A 1G0RA 3ECTA 2WAWA 2GGQA 3V0OA 4LW6A 2X5ZA 1QRGA 4FRAA 1S80A 1FO8A 4ASYA 3DUVA 4M2AA 4M2BA 1INJA 5C48A 5E3QA 4DDZA 2RIZA 2O1FA 3VNPA 1FGXA 4AC3A 1I52A 4Y7FA 3K8DA 5CMGX 1INIA 1HM0A 5FTVA 1W57A 3VBPA 4Y7TA 1ZJ1A 4XWIA 3JUJA 5E3RA 1SSMA 4MFGA 1ON6A 3R0SA 4P02A 5C4BA 4HO3A 1E5KA 5L6SA 3JTJA 3LW6A 3R8YA 2FFVA 3EEVA 1H7EA 3QVBA 4KXOA 1KQAA 2WGZA 1TW5A 3BFPA 1Z90A 3HL3A 1R7VA 5C36A 1G97A 5FYEA 3I0IX 5U2KA 3OU9A 4FROA 2Y4LA 1HM9A 1KK6A 3I0DA 4O6NA 2XATA 1XZ6A 1QWJA 5L6VA 2WVMA 4EAAA 2V0LA 2P72A 1PZTA 2Z87A 1G2VA 2AH9A 1FWYA 1H4EA 5CQNX 2X65A 2YC3A 2WLFA 1NWGB 2Y6PA 2BO6A 5F42A 4AYJA 2QIVX 1H5SA 1FZWA 3EE5A 2V0IA 1VGZA 1XHBA 4B5BA 3OUPA 1ZI3A 4D0ZA 4K6RA 3SX8A 4D0TA 5DDVA 3OTMA 5J49A 2GGOA 3R3RA 2FFUA 4HO4A 4Y7UA 4N69A 1G95A 4HO9A 4DE7A 3E25A 1ZI1A 1XHDA 4Y64A 3C8VA 3U2XA 5C49A 5JQQA 3SRTA 3I0GA 3FSBA 3FSXA 2IU9A 2ZU7A 1KK5A 1VZUA 3ZGFA 1HV9A 1GWVA 4E1KA 4EA9A 4EQYA 3ZF8A 3VBIA 3Q1XA 1IIMA 1ZDFA 3I0FA 5C1HA 3SXEA 1SSQA 3D5NA 2AM4A 2AM5A 1YP4A 2WVKA 5FV9A 3CKOA 1QREA 1H5SB 2V0HA 3N9WA 4MIXA 2E8BA 3DJ4A 5AJOA 3R1WA 4ZDQA 1QG8A 2VK9A 1HM8A 1QGSA 3FSCA 1MR7A 1H7QA 1VZXA 1JVGA 1OCXA 1G8OA 4EE5A 1LL2A 5EIYA 4HCQA 3U0YA 3USRA 1MP5A 2VD4A 4EE3A 2ICYA 4G3QA 5C3BA 1JYLA 4B2XA 1LZJA 2WLEA 3KWCA 5CQMX 5EJZA 4ISXA 3TV0A 1O23B 5AFUV 3PMOA 1LXAA 1R82A 3SX7A 4G3SA 3F1YA 3OH4A 1VGTA 4EEOA 4EEAA 4HZDA 1YROB 2I5KA 3IGJA 3PKQA 4CJCA 5D92A 4D11C 3OGZA 3P47A 3TZTA 5ADXU 4HO0A 4FIYA 3BRKX 2JCKA 4B4BA 3OH1A 4EA8A 1KRVA 3U0XA 1H5SC 5IDTA 3T57A 5C4EA 3R5CA 2O1HA 4Y6NA 1V82A 1OQMB 1SSTA 3TWDA 1ZCTA 2IC7A 2VS4A 5C1LA 4GBPA 1S4NA 2AESA 2NXVA 3USQA 1GWWA 4FRLA 4HO2A 2RJ9A 3ZLLA 4KQLA 2WLGA 1GX4A 3SXDA 5D91A 1FR8A 4ARWA 1WT3A 5C3DA 3GOSA 3P1BA 5I1FA 2JCJA 1IINA 4IHGA 1R7YA 1KWSA 2Y4JA 3OH0A 5DEMA 1V3WA 3I3AA 2Z86A 3TK8A 1WT2A 2RJ4A 4N6BA 4L41C 5C4FA 3V8YA 4FQWA 4M4KA 3U2WA 4MYOA 4R37A 3VBLA 3D98A 1VICA 1KRRA 4M28A 1JYKA 2I7BA 4ECMA 4Q7CA 3O3PA 4CJ8A 4D11A 3HSQA 3BSSA 1FGGA 2I5EA 4HZCA 3D8VA 2RJ1A 4BQHA 3R2WA 3VBJA 3K8EA 4Y6UA 3FTTA 2AQ9A 2YQSA 1ZCYA 4Y7GA 2JF3A 2RIXA 1GA8A 2FYAA 5DDTA 4KC2A 2FYBA 1GQCA 3GVDA 4P00A 1MR9A 2VXMA 1EZIA 4R7PA 4B2WA 2OEFA 1FO9A 4M98A 1S4OA 1H3MA 4Y62A 1JV3A 3RMWA 5EJ1A 1MC3A 3VBKA 3IOIA 2YQHA 2P2OA 4DECA 4KNXA 1JV1A 4J09A 5AJNA 1LZ0A 1FXJA 3I0CA 1KGQA 2XWNA 3V91A 3FSYA 3PNNA 3R5BA 4HO5A 2J0BA 2OI6A 3T7OA 3DK5A 1LVWA 2A8UA 1VM8A 3BCVA 1W55A 1PZYB 2BO4A 4HURA 3CKVA 1ZDGA 5CMFX 1V83A 2UX8A 4N27A 2C0NA 3R5AA 1H7LA 2PGYA 5FU8A 1TVYA 1VPAA 1ZHJA 1TW1A 3POLA 4J18A 3V4EA 3JQYA 1QRLA 5E3PA 1FOAA 2WEEA 4IRPA 4IRQA 3KWEA 5CQOA 1WT0A 5CMIA 4N6AA 3I0KA 4MZUA 3DHOA 3U2UA 2RJ5A 4G3PA 1SS9A 2VFZA 4BMAA 3R3IA 3U2VA 2FKOA 1NQIB 4KPXA 3V90A 4EGGA 4UEGA 3SX3A 3ST8A 4O6MA 1W77A 2RJ8A 5HS2A 3PKPA 1GQ9A 5CMJA 5C1GA 4M99A 2P6WA 2VHEA 4KRVA 1ON8A 3OH2A 3V0LA 2ZU8A 2QH5A 1GX0A 1H7FA 1HJJA 3OH3A 4FCEA 2CU2A 2D0JA 3V0MA 1TDTA 4AYLA 1LL0A 1O0RA 2VSHA 2WVLA 3RSBA 4FRQA 4G87A 4EEMA 1MRLA 1TZFA 1JVDA 4Y9XA 1MP4A 3CJ8A 3CKNA 4FRBA 2XMHA 1MP3A 4HUSA 5CQPA 3FS8A 4C2SA 1YP2A 1KGTA 5FU0A 2PGVA 2Q4JA 5DEPA 2O1GA 1O7QA 1R81A 1ZJPA 2YESA 2OI7A 2W0WA 2W0VA 2FYCB 4Y7VA 3SXGA 2V0KA 2WE9A 3R5DA 4Y63A 4E75A 1S4PA 1ZCUA 3CU0A 4IHFA 3EG4A 3ZLKA 2P73A 1R80A 1H5SD 3MQGA 4B4GA 1VGWA 2OEGA 1ZJ0A 1YP3A 4MYBA 5FTSA 3ZGGA 3I0EA 5C8RA 2AE7A 3SX5A 2A8WA 1G23A 4B3UA 4R36A 1XATA 1WSZA 3KWDA 4FRPA 2QGIA 1EYRA 3OW5A 3GUEA 4HG6A 2RIYA 3Q7UA 1H7TA 3OC9A 2X5SA 4FIXA 1H5TA 3TQDA 5IDSA 1H5RA 3U2TA 1FXOA 1FG5N 1QQ0A 4E6UA 1R7TA 1G9RA 3BXYA 3FOQA 3E26A 1ZI4A 3NZ2A 1R7UA 2IUAA 5C3AA 3HJJA 1HJLA 3T7NA 5CMHA 5C4DA 3NGWA 3Q80A 2D7IA 2Y4KA 1ZJOA 5AJPA 4HO6A 4CVHA 2JF2A 3SPTA 4FRDA 4HO8A 1NKHB 1H7GA 1VZTA 3IOHA 2RJ7A 3SXBA 2TDTA 3FWWA 4JISA 1NMMB 1NHEB 2Y7AA 4FRHA 1T3DA 1KRUA 3I0JA 1VH3A 4FCUA 4EABA 1VGUA 4EVWA 1FRWA 3V0PA 3Q4SA 1KHRA 1V67A 4MNDA 1H4CA 1O7OA 4KNRA 4CJBA 2MZBA 4KC1A 1G93A 2J0AA 4IHHA 2IU8A 3CKJA 1K4VA 5C4CA 2JCLA 2XWLA 4M9CA 1H5TB 1H5RB 2VS3A 4NAIA 3MQHA 2RJ6A 3I0LA 2DPWA 4HOCA 2X60A 2XMEA 5BXCA 1THJA 5IFYA 1QRMA 3TDTA 4AA7A 5FUHA 4KPZA 2ZU9A 4B4MA 1KK4A 1NF5B 2AGDA 2OI5A 4NAKA 4KC4A 3IXCA 3EH0A 3KIAA 3VBNA 4B42A 5CQLX 4AAWA 2FYDB 3CGXA 4KT7A 1QGQA 1ZJ3A 3TISA 1OMZA 2JCOA 4E6TA 2BO7A 2YCMA 4ASJA 1VH1A 3OKRA 2XWMA 2PA4A 3BSWA 4JD0A 3T7MA 4EEGA 4H7OA 2AECA 3F1XA 1WT1A 2AM3A 1LL3A 2RIJA 3JUKA 5AFUU 2ICXA 3OAMA 2V0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D7R A;  4FRE A;  1ZCV A;  1J2Z A;  1LZ7 A;  2QIA A;  3F1C A;  3CKQ A;  4D48 A;  2YQC A;  2APC A;  3V0Q A;  2BO8 A;  3V0N A;  4DCL A;  5DG3 A;  1G1L A;  1ZJ2 A;  5C47 A;  1QRF A;  4NAN A;  3SXA A;  3SXC A;  1WVC A;  3VBM A;  2VXL A;  3TIO A;  2WLD A;  4YS8 A;  3V8Z A;  4LW3 A;  3IOJ A;  5C38 A;  2E3D A;  2FY7 A;  4FRM A;  3OTZ A;  3I3X A;  2YQJ A;  1ZI5 A;  4EA7 A;  2VS5 A;  1V84 A;  2RJ0 A;  3MC4 A;  3RMV A;  4E79 A;  5ADX V;  2WLC A;  1H4D A;  1ZIZ A;  4EE4 A;  2NPO A;  3I0H A;  1G3L A;  2RIT A;  1H7H A;  1R7X A;  2Y4M A;  4NAL A;  1LZI A;  2QKX A;  2VSI A;  1OMX A;  3BSY A;  1FR9 A;  2PX7 A;  2YC5 A;  1G0R A;  3ECT A;  2WAW A;  2GGQ A;  3V0O A;  4LW6 A;  2X5Z A;  1QRG A;  4FRA A;  1S80 A;  1FO8 A;  4ASY A;  3DUV A;  4M2A A;  4M2B A;  1INJ A;  5C48 A;  5E3Q A;  4DDZ A;  2RIZ A;  2O1F A;  3VNP A;  1FGX A;  4AC3 A;  1I52 A;  4Y7F A;  3K8D A;  5CMG X;  1INI A;  1HM0 A;  5FTV A;  1W57 A;  3VBP A;  4Y7T A;  1ZJ1 A;  4XWI A;  3JUJ A;  5E3R A;  1SSM A;  4MFG A;  1ON6 A;  3R0S A;  4P02 A;  5C4B A;  4HO3 A;  1E5K A;  5L6S A;  3JTJ A;  3LW6 A;  3R8Y A;  2FFV A;  3EEV A;  1H7E A;  3QVB A;  4KXO A;  1KQA A;  2WGZ A;  1TW5 A;  3BFP A;  1Z90 A;  3HL3 A;  1R7V A;  5C36 A;  1G97 A;  5FYE A;  3I0I X;  5U2K A;  3OU9 A;  4FRO A;  2Y4L A;  1HM9 A;  1KK6 A;  3I0D A;  2XAT A;  1XZ6 A;  1QWJ A;  5L6V A;  2WVM A;  4EAA A;  2V0L A;  2P72 A;  1PZT A;  2Z87 A;  1G2V A;  2AH9 A;  1FWY A;  1H4E A;  5CQN X;  2X65 A;  2YC3 A;  2WLF A;  1NWG B;  2Y6P A;  2BO6 A;  5F42 A;  4AYJ A;  2QIV X;  1H5S A;  1FZW A;  3EE5 A;  2V0I A;  1VGZ A;  1XHB A;  4B5B A;  3OUP A;  1ZI3 A;  4D0Z A;  4K6R A;  3SX8 A;  4D0T A;  5DDV A;  3OTM A;  5J49 A;  2GGO A;  3R3R A;  2FFU A;  4HO4 A;  4Y7U A;  4N69 A;  1G95 A;  4HO9 A;  4DE7 A;  3E25 A;  1ZI1 A;  1XHD A;  4Y64 A;  3C8V A;  3U2X A;  5C49 A;  5JQQ A;  3SRT A;  3I0G A;  3FSB A;  3FSX A;  2IU9 A;  2ZU7 A;  1KK5 A;  1VZU A;  3ZGF A;  1HV9 A;  1GWV A;  4E1K A;  4EA9 A;  4EQY A;  3ZF8 A;  3VBI A;  3Q1X A;  1IIM A;  1ZDF A;  3I0F A;  5C1H A;  3SXE A;  1SSQ A;  3D5N A;  2AM4 A;  2AM5 A;  1YP4 A;  2WVK A;  5FV9 A;  3CKO A;  1QRE A;  1H5S B;  2V0H A;  3N9W A;  2E8B A;  3DJ4 A;  5AJO A;  3R1W A;  4ZDQ A;  1QG8 A;  1HM8 A;  1QGS A;  3FSC A;  1MR7 A;  1H7Q A;  1VZX A;  1JVG A;  1OCX A;  1G8O A;  4EE5 A;  1LL2 A;  5EIY A;  4HCQ A;  3U0Y A;  3USR A;  1MP5 A;  2VD4 A;  4EE3 A;  2ICY A;  4G3Q A;  5C3B A;  1JYL A;  4B2X A;  1LZJ A;  2WLE A;  3KWC A;  5CQM X;  5EJZ A;  4ISX A;  3TV0 A;  1O23 B;  5AFU V;  3PMO A;  1LXA A;  1R82 A;  3SX7 A;  4G3S A;  3F1Y A;  3OH4 A;  1VGT A;  4EEO A;  4EEA A;  4HZD A;  1YRO B;  2I5K A;  3IGJ A;  3PKQ A;  4CJC A;  4D11 C;  3OGZ A;  3P47 A;  3TZT A;  5ADX U;  4HO0 A;  4B4B A;  3BRK X;  2JCK A;  3OH1 A;  4EA8 A;  1KRV A;  3U0X A;  1H5S C;  5IDT A;  3T57 A;  5C4E A;  3R5C A;  2O1H A;  4Y6N A;  1V82 A;  1OQM B;  1SST A;  3TWD A;  1ZCT A;  2IC7 A;  2VS4 A;  5C1L A;  4GBP A;  1S4N A;  2AES A;  2NXV A;  3USQ A;  1GWW A;  4FRL A;  4HO2 A;  2RJ9 A;  3ZLL A;  4KQL A;  2WLG A;  1GX4 A;  3SXD A;  1FR8 A;  4ARW A;  1WT3 A;  5C3D A;  3GOS A;  3P1B A;  5I1F A;  2JCJ A;  1IIN A;  4IHG A;  1R7Y A;  1KWS A;  2Y4J A;  3OH0 A;  5DEM A;  1V3W A;  3I3A A;  2Z86 A;  3TK8 A;  1WT2 A;  2RJ4 A;  4N6B A;  4L41 C;  5C4F A;  3V8Y A;  4FQW A;  4M4K A;  3U2W A;  4MYO A;  4R37 A;  3VBL A;  3D98 A;  1VIC A;  1KRR A;  4M28 A;  1JYK A;  2I7B A;  4ECM A;  3O3P A;  4CJ8 A;  4D11 A;  3HSQ A;  3BSS A;  1FGG A;  2I5E A;  4HZC A;  3D8V A;  2RJ1 A;  4BQH A;  3R2W A;  3VBJ A;  3K8E A;  4Y6U A;  3FTT A;  2AQ9 A;  2YQS A;  1ZCY A;  4Y7G A;  2JF3 A;  2RIX A;  1GA8 A;  2FYA A;  5DDT A;  4KC2 A;  2FYB A;  1GQC A;  3GVD A;  4P00 A;  1MR9 A;  2VXM A;  1EZI A;  4R7P A;  4B2W A;  2OEF A;  1FO9 A;  4M98 A;  1S4O A;  1H3M A;  4Y62 A;  1JV3 A;  3RMW A;  5EJ1 A;  1MC3 A;  3VBK A;  3IOI A;  2YQH A;  2P2O A;  4DEC A;  4KNX A;  1JV1 A;  4J09 A;  5AJN A;  1LZ0 A;  1FXJ A;  3I0C A;  1KGQ A;  2XWN A;  3V91 A;  3FSY A;  3PNN A;  3R5B A;  4HO5 A;  2OI6 A;  3T7O A;  3DK5 A;  1LVW A;  2A8U A;  1VM8 A;  3BCV A;  1W55 A;  1PZY B;  2BO4 A;  4HUR A;  3CKV A;  1ZDG A;  5CMF X;  1V83 A;  2UX8 A;  4N27 A;  5FU8 A;  3R5A A;  1H7L A;  2PGY A;  1TVY A;  1VPA A;  1ZHJ A;  1TW1 A;  3POL A;  4J18 A;  3V4E A;  3JQY A;  1QRL A;  5E3P A;  1FOA A;  2WEE A;  4IRP A;  4IRQ A;  3KWE A;  5CQO A;  1WT0 A;  5CMI A;  4N6A A;  3I0K A;  4MZU A;  3DHO A;  3U2U A;  2RJ5 A;  4G3P A;  1SS9 A;  2VFZ A;  4BMA A;  3R3I A;  3U2V A;  2FKO A;  1NQI B;  4KPX A;  3V90 A;  4EGG A;  4UEG A;  3SX3 A;  3ST8 A;  1W77 A;  2RJ8 A;  5HS2 A;  3PKP A;  1GQ9 A;  5CMJ A;  5C1G A;  4M99 A;  2P6W A;  2VHE A;  4KRV A;  1ON8 A;  3OH2 A;  3V0L A;  2ZU8 A;  2QH5 A;  1GX0 A;  1H7F A;  1HJJ A;  3OH3 A;  4FCE A;  2CU2 A;  2D0J A;  3V0M A;  1TDT A;  4AYL A;  1LL0 A;  1O0R A;  2VSH A;  2WVL A;  3RSB A;  4FRQ A;  4G87 A;  4EEM A;  1MRL A;  1TZF A;  1JVD A;  4Y9X A;  1MP4 A;  3CJ8 A;  3CKN A;  4FRB A;  2XMH A;  1MP3 A;  4HUS A;  5CQP A;  3FS8 A;  4C2S A;  1YP2 A;  1KGT A;  5FU0 A;  2PGV A;  2Q4J A;  5DEP A;  2O1G A;  1O7Q A;  1R81 A;  1ZJP A;  2YES A;  2OI7 A;  2W0W A;  2W0V A;  2FYC B;  4Y7V A;  3SXG A;  2V0K A;  2WE9 A;  3R5D A;  4Y63 A;  4E75 A;  1S4P A;  1ZCU A;  3CU0 A;  4IHF A;  3EG4 A;  3ZLK A;  2P73 A;  1R80 A;  1H5S D;  3MQG A;  4B4G A;  1VGW A;  2OEG A;  1ZJ0 A;  1YP3 A;  4MYB A;  5FTS A;  3ZGG A;  3I0E A;  5C8R A;  2AE7 A;  3SX5 A;  2A8W A;  1G23 A;  4B3U A;  4R36 A;  1XAT A;  1WSZ A;  3KWD A;  4FRP A;  2QGI A;  1EYR A;  3OW5 A;  3GUE A;  4HG6 A;  2RIY A;  3Q7U A;  1H7T A;  3OC9 A;  2X5S A;  3TQD A;  1H5T A;  5IDS A;  1H5R A;  3U2T A;  1FXO A;  1FG5 N;  1QQ0 A;  4E6U A;  1R7T A;  1G9R A;  3BXY A;  3FOQ A;  3E26 A;  1ZI4 A;  3NZ2 A;  1R7U A;  2IUA A;  5C3A A;  3HJJ A;  1HJL A;  3T7N A;  5CMH A;  5C4D A;  3NGW A;  3Q80 A;  2D7I A;  2Y4K A;  1ZJO A;  5AJP A;  4HO6 A;  4CVH A;  2JF2 A;  3SPT A;  4FRD A;  4HO8 A;  1NKH B;  1H7G A;  1VZT A;  3IOH A;  2RJ7 A;  3SXB A;  2TDT A;  3FWW A;  4JIS A;  1NMM B;  1NHE B;  2Y7A A;  4FRH A;  1T3D A;  1KRU A;  3I0J A;  1VH3 A;  4FCU A;  4EAB A;  1VGU A;  4EVW A;  1FRW A;  3V0P A;  3Q4S A;  1KHR A;  1V67 A;  4MND A;  1H4C A;  1O7O A;  4KNR A;  4CJB A;  2MZB A;  4KC1 A;  1G93 A;  4IHH A;  2IU8 A;  3CKJ A;  1K4V A;  5C4C A;  2JCL A;  2XWL A;  4M9C A;  1H5T B;  1H5R B;  2VS3 A;  4NAI A;  3MQH A;  2RJ6 A;  3I0L A;  2DPW A;  4HOC A;  2X60 A;  2XME A;  5BXC A;  1THJ A;  5IFY A;  1QRM A;  3TDT A;  4AA7 A;  5FUH A;  4KPZ A;  2ZU9 A;  4B4M A;  1KK4 A;  1NF5 B;  2AGD A;  2OI5 A;  4NAK A;  4KC4 A;  3IXC A;  3EH0 A;  3KIA A;  3VBN A;  4B42 A;  5CQL X;  4AAW A;  2FYD B;  3CGX A;  4KT7 A;  1QGQ A;  1ZJ3 A;  3TIS A;  1OMZ A;  2JCO A;  4E6T A;  2BO7 A;  2YCM A;  4ASJ A;  1VH1 A;  3OKR A;  2XWM A;  2PA4 A;  3BSW A;  4JD0 A;  3T7M A;  4EEG A;  4H7O A;  2AEC A;  3F1X A;  1WT1 A;  2AM3 A;  1LL3 A;  2RIJ A;  3JUK A;  5AFU U;  2ICX A;  3OAM A;  2V0J A; 
#chains in the Genus database with same CATH topology
 2D7R A;  1M8N A;  4FRE A;  1ZCV A;  1J2Z A;  1LZ7 A;  2QIA A;  3F1C A;  3CKQ A;  4D48 A;  2YQC A;  2APC A;  3V0Q A;  2BO8 A;  3V0N A;  4DCL A;  5DG3 A;  1G1L A;  1ZJ2 A;  5C47 A;  1QRF A;  4NAN A;  3SXA A;  3SXC A;  1WVC A;  3VBM A;  2VXL A;  3TIO A;  2WLD A;  4YS8 A;  3V8Z A;  4LW3 A;  3IOJ A;  5C38 A;  2E3D A;  2FY7 A;  4FRM A;  3OTZ A;  3I3X A;  2YQJ A;  1ZI5 A;  4EA7 A;  2VS5 A;  1V84 A;  2RJ0 A;  3MC4 A;  3RMV A;  4E79 A;  3GQ7 A;  5ADX V;  2WLC A;  1H4D A;  1ZIZ A;  4EE4 A;  2NPO A;  3I0H A;  1G3L A;  2RIT A;  1H7H A;  1R7X A;  2Y4M A;  4NAL A;  1LZI A;  2QKX A;  2VSI A;  1OMX A;  3BSY A;  1FR9 A;  2PX7 A;  2YC5 A;  1G0R A;  3ECT A;  2WAW A;  2GGQ A;  3V0O A;  4LW6 A;  2X5Z A;  1QRG A;  4FRA A;  1S80 A;  1FO8 A;  4ASY A;  3DUV A;  4M2A A;  4M2B A;  1INJ A;  5C48 A;  5E3Q A;  3GQ8 A;  4DDZ A;  2RIZ A;  2O1F A;  3VNP A;  1FGX A;  4AC3 A;  1I52 A;  4Y7F A;  3K8D A;  5CMG X;  1INI A;  1HM0 A;  5FTV A;  1W57 A;  3VBP A;  4Y7T A;  1ZJ1 A;  4XWI A;  3JUJ A;  5E3R A;  1SSM A;  4MFG A;  1ON6 A;  3R0S A;  4P02 A;  5C4B A;  4HO3 A;  1E5K A;  5L6S A;  3JTJ A;  3LW6 A;  3R8Y A;  2FFV A;  3EEV A;  1H7E A;  3QVB A;  4KXO A;  1KQA A;  2WGZ A;  1TW5 A;  3BFP A;  1Z90 A;  3HL3 A;  1R7V A;  5C36 A;  1G97 A;  5FYE A;  3I0I X;  5U2K A;  3OU9 A;  4FRO A;  2Y4L A;  1HM9 A;  1KK6 A;  3I0D A;  4O6N A;  2XAT A;  1XZ6 A;  1QWJ A;  5L6V A;  2WVM A;  4EAA A;  2V0L A;  2P72 A;  1PZT A;  2Z87 A;  1G2V A;  2AH9 A;  1FWY A;  1H4E A;  5CQN X;  2X65 A;  2YC3 A;  2WLF A;  1NWG B;  2Y6P A;  2BO6 A;  5F42 A;  4AYJ A;  2QIV X;  1H5S A;  1FZW A;  3EE5 A;  2V0I A;  1VGZ A;  1XHB A;  4B5B A;  3OUP A;  1ZI3 A;  4D0Z A;  4K6R A;  3SX8 A;  4D0T A;  5DDV A;  3OTM A;  5J49 A;  2GGO A;  3R3R A;  2FFU A;  4HO4 A;  4Y7U A;  4N69 A;  1G95 A;  4HO9 A;  4DE7 A;  3E25 A;  1ZI1 A;  1XHD A;  4Y64 A;  3C8V A;  3U2X A;  5C49 A;  5JQQ A;  3SRT A;  3I0G A;  3FSB A;  1Z2F A;  3FSX A;  2IU9 A;  2ZU7 A;  1KK5 A;  1VZU A;  3ZGF A;  1HV9 A;  1GWV A;  4E1K A;  4EA9 A;  4EQY A;  3ZF8 A;  3VBI A;  3Q1X A;  1IIM A;  1ZDF A;  3I0F A;  5C1H A;  3SXE A;  1SSQ A;  3D5N A;  2AM4 A;  2AM5 A;  1YP4 A;  2WVK A;  5FV9 A;  3CKO A;  1QRE A;  1H5S B;  2V0H A;  3N9W A;  4MIX A;  2E8B A;  3DJ4 A;  5AJO A;  3R1W A;  4ZDQ A;  1QG8 A;  2VK9 A;  1HM8 A;  1QGS A;  3FSC A;  1MR7 A;  1H7Q A;  1VZX A;  1JVG A;  1OCX A;  1G8O A;  4EE5 A;  1LL2 A;  5EIY A;  4HCQ A;  3U0Y A;  3USR A;  1MP5 A;  2VD4 A;  4EE3 A;  2ICY A;  4G3Q A;  5C3B A;  1JYL A;  4B2X A;  1LZJ A;  2WLE A;  3KWC A;  5CQM X;  5EJZ A;  4ISX A;  3TV0 A;  1O23 B;  5AFU V;  3PMO A;  1LXA A;  1R82 A;  3SX7 A;  3OH4 A;  4G3S A;  3F1Y A;  1VGT A;  4EEO A;  4EEA A;  4HZD A;  1YRO B;  2I5K A;  3IGJ A;  3PKQ A;  4CJC A;  5D92 A;  4D11 C;  3OGZ A;  3P47 A;  3TZT A;  5ADX U;  4HO0 A;  4FIY A;  3BRK X;  2JCK A;  4B4B A;  3OH1 A;  4EA8 A;  1KRV A;  3U0X A;  1H5S C;  5IDT A;  3T57 A;  5C4E A;  3R5C A;  2O1H A;  4Y6N A;  1V82 A;  1OQM B;  1SST A;  3TWD A;  1ZCT A;  2IC7 A;  2VS4 A;  5C1L A;  4GBP A;  1S4N A;  2AES A;  2NXV A;  3USQ A;  1GWW A;  4FRL A;  4HO2 A;  2RJ9 A;  3ZLL A;  4KQL A;  2WLG A;  1GX4 A;  3SXD A;  5D91 A;  1FR8 A;  4ARW A;  1WT3 A;  5C3D A;  3GOS A;  3P1B A;  3GQ9 A;  5I1F A;  2JCJ A;  1IIN A;  4IHG A;  1R7Y A;  1KWS A;  3OH0 A;  2Y4J A;  5DEM A;  1V3W A;  3I3A A;  2Z86 A;  3TK8 A;  1WT2 A;  2RJ4 A;  4N6B A;  4L41 C;  5C4F A;  3V8Y A;  4FQW A;  4M4K A;  3U2W A;  4MYO A;  4R37 A;  3VBL A;  3D98 A;  1VIC A;  1KRR A;  4M28 A;  1JYK A;  2I7B A;  4ECM A;  4Q7C A;  3O3P A;  4CJ8 A;  4D11 A;  3HSQ A;  3BSS A;  1FGG A;  2I5E A;  4HZC A;  3D8V A;  2RJ1 A;  4BQH A;  3R2W A;  3VBJ A;  3K8E A;  4Y6U A;  3FTT A;  2AQ9 A;  2YQS A;  1ZCY A;  4Y7G A;  2JF3 A;  2RIX A;  1GA8 A;  2FYA A;  5DDT A;  4KC2 A;  2FYB A;  1GQC A;  3GVD A;  4P00 A;  1MR9 A;  2VXM A;  1EZI A;  4R7P A;  4B2W A;  2OEF A;  1FO9 A;  4M98 A;  1S4O A;  1H3M A;  4Y62 A;  1JV3 A;  3RMW A;  5EJ1 A;  1MC3 A;  3VBK A;  3IOI A;  2YQH A;  2P2O A;  4DEC A;  4KNX A;  1JV1 A;  4J09 A;  5AJN A;  1LZ0 A;  1FXJ A;  3I0C A;  1KGQ A;  2XWN A;  3V91 A;  3FSY A;  3PNN A;  3R5B A;  4HO5 A;  2J0B A;  2OI6 A;  3T7O A;  3DK5 A;  1LVW A;  2A8U A;  1VM8 A;  3BCV A;  1W55 A;  1PZY B;  2BO4 A;  4HUR A;  3CKV A;  1ZDG A;  5CMF X;  1V83 A;  2UX8 A;  4N27 A;  2C0N A;  3R5A A;  1H7L A;  2PGY A;  5FU8 A;  1TVY A;  1VPA A;  1ZHJ A;  1TW1 A;  3POL A;  4J18 A;  3V4E A;  3JQY A;  1QRL A;  5E3P A;  1FOA A;  2WEE A;  4IRP A;  4IRQ A;  3KWE A;  5CQO A;  1WT0 A;  5CMI A;  4N6A A;  3I0K A;  4MZU A;  3DHO A;  3U2U A;  2RJ5 A;  4G3P A;  1SS9 A;  2VFZ A;  4BMA A;  3R3I A;  3U2V A;  2FKO A;  1NQI B;  4KPX A;  3V90 A;  4EGG A;  4UEG A;  3SX3 A;  3ST8 A;  4O6M A;  1W77 A;  2RJ8 A;  5HS2 A;  3PKP A;  1GQ9 A;  5CMJ A;  5C1G A;  4M99 A;  2P6W A;  2VHE A;  4KRV A;  1ON8 A;  3OH2 A;  3V0L A;  2ZU8 A;  2QH5 A;  1GX0 A;  1H7F A;  1HJJ A;  3OH3 A;  4FCE A;  2CU2 A;  2D0J A;  3V0M A;  1TDT A;  4AYL A;  1LL0 A;  1O0R A;  2VSH A;  2WVL A;  3RSB A;  4FRQ A;  4G87 A;  4EEM A;  1MRL A;  1TZF A;  1JVD A;  4Y9X A;  1MP4 A;  3CJ8 A;  3CKN A;  4FRB A;  2XMH A;  1MP3 A;  4HUS A;  5CQP A;  3FS8 A;  4C2S A;  1YP2 A;  1KGT A;  5FU0 A;  2PGV A;  2Q4J A;  5DEP A;  2O1G A;  1O7Q A;  1R81 A;  1ZJP A;  2YES A;  2OI7 A;  2W0W A;  2W0V A;  2FYC B;  4Y7V A;  3SXG A;  2V0K A;  2WE9 A;  3R5D A;  4Y63 A;  4E75 A;  1S4P A;  1ZCU A;  3CU0 A;  4IHF A;  3EG4 A;  3ZLK A;  2P73 A;  1R80 A;  1H5S D;  3MQG A;  4B4G A;  1VGW A;  2OEG A;  1ZJ0 A;  1YP3 A;  4MYB A;  5FTS A;  3ZGG A;  3I0E A;  5C8R A;  2AE7 A;  3SX5 A;  2A8W A;  1G23 A;  4B3U A;  4R36 A;  1XAT A;  1WSZ A;  3KWD A;  4FRP A;  2QGI A;  1EYR A;  3OW5 A;  3GUE A;  4HG6 A;  2RIY A;  3Q7U A;  1H7T A;  3OC9 A;  2X5S A;  4FIX A;  1H5T A;  3TQD A;  5IDS A;  1H5R A;  3U2T A;  1FXO A;  1FG5 N;  1QQ0 A;  4E6U A;  1R7T A;  1G9R A;  3BXY A;  3FOQ A;  3E26 A;  1ZI4 A;  3NZ2 A;  1R7U A;  2IUA A;  5C3A A;  3HJJ A;  1HJL A;  3T7N A;  5CMH A;  5C4D A;  3NGW A;  3Q80 A;  2D7I A;  2Y4K A;  1ZJO A;  5AJP A;  4HO6 A;  4CVH A;  2JF2 A;  3SPT A;  4FRD A;  4HO8 A;  1NKH B;  1H7G A;  1VZT A;  3IOH A;  2RJ7 A;  3SXB A;  2TDT A;  3FWW A;  4JIS A;  1NMM B;  1NHE B;  2Y7A A;  4FRH A;  1T3D A;  3SUC A;  1KRU A;  3I0J A;  1VH3 A;  4FCU A;  4EAB A;  1VGU A;  4EVW A;  1FRW A;  3V0P A;  3Q4S A;  1KHR A;  1V67 A;  4MND A;  1H4C A;  1O7O A;  4KNR A;  4CJB A;  2MZB A;  4KC1 A;  1G93 A;  2J0A A;  4IHH A;  2IU8 A;  3CKJ A;  1K4V A;  5C4C A;  2JCL A;  2XWL A;  4M9C A;  1H5T B;  1H5R B;  2VS3 A;  4NAI A;  3MQH A;  3GQA A;  2RJ6 A;  3I0L A;  2DPW A;  4HOC A;  2X60 A;  2XME A;  5BXC A;  1THJ A;  5IFY A;  1EWW A;  1QRM A;  3TDT A;  4AA7 A;  5FUH A;  4KPZ A;  2ZU9 A;  4B4M A;  1KK4 A;  1NF5 B;  2AGD A;  2OI5 A;  4NAK A;  4KC4 A;  3IXC A;  3EH0 A;  3KIA A;  3VBN A;  4B42 A;  5CQL X;  4AAW A;  2FYD B;  3CGX A;  4KT7 A;  1QGQ A;  1ZJ3 A;  3TIS A;  1OMZ A;  2JCO A;  4E6T A;  2BO7 A;  2YCM A;  4ASJ A;  1VH1 A;  1L0S A;  3OKR A;  2XWM A;  2PA4 A;  3BSW A;  4JD0 A;  3T7M A;  4EEG A;  4H7O A;  2AEC A;  3F1X A;  1WT1 A;  1N4I A;  2AM3 A;  1LL3 A;  2RIJ A;  3JUK A;  5AFU U;  2ICX A;  3OAM A;  2V0J A; 
#chains in the Genus database with same CATH homology
 2D7R A;  4FRE A;  1ZCV A;  1J2Z A;  1LZ7 A;  2QIA A;  3F1C A;  3CKQ A;  4D48 A;  2YQC A;  2APC A;  3V0Q A;  2BO8 A;  3V0N A;  4DCL A;  5DG3 A;  1G1L A;  1ZJ2 A;  5C47 A;  1QRF A;  4NAN A;  3SXA A;  3SXC A;  1WVC A;  3VBM A;  2VXL A;  3TIO A;  2WLD A;  4YS8 A;  3V8Z A;  4LW3 A;  3IOJ A;  5C38 A;  2E3D A;  2FY7 A;  4FRM A;  3OTZ A;  3I3X A;  2YQJ A;  1ZI5 A;  4EA7 A;  2VS5 A;  1V84 A;  2RJ0 A;  3MC4 A;  3RMV A;  4E79 A;  5ADX V;  2WLC A;  1H4D A;  1ZIZ A;  4EE4 A;  2NPO A;  3I0H A;  1G3L A;  2RIT A;  1H7H A;  1R7X A;  2Y4M A;  4NAL A;  1LZI A;  2QKX A;  2VSI A;  1OMX A;  3BSY A;  1FR9 A;  2PX7 A;  2YC5 A;  1G0R A;  3ECT A;  2WAW A;  2GGQ A;  3V0O A;  4LW6 A;  2X5Z A;  1QRG A;  4FRA A;  1S80 A;  1FO8 A;  4ASY A;  3DUV A;  4M2A A;  4M2B A;  1INJ A;  5C48 A;  5E3Q A;  4DDZ A;  2RIZ A;  2O1F A;  3VNP A;  1FGX A;  4AC3 A;  1I52 A;  4Y7F A;  3K8D A;  5CMG X;  1INI A;  1HM0 A;  5FTV A;  1W57 A;  3VBP A;  4Y7T A;  1ZJ1 A;  4XWI A;  3JUJ A;  5E3R A;  1SSM A;  4MFG A;  1ON6 A;  3R0S A;  4P02 A;  5C4B A;  4HO3 A;  1E5K A;  5L6S A;  3JTJ A;  3LW6 A;  3R8Y A;  2FFV A;  3EEV A;  1H7E A;  3QVB A;  4KXO A;  1KQA A;  2WGZ A;  1TW5 A;  3BFP A;  1Z90 A;  3HL3 A;  1R7V A;  5C36 A;  1G97 A;  5FYE A;  3I0I X;  5U2K A;  3OU9 A;  4FRO A;  2Y4L A;  1HM9 A;  1KK6 A;  3I0D A;  4O6N A;  2XAT A;  1XZ6 A;  1QWJ A;  5L6V A;  2WVM A;  4EAA A;  2V0L A;  2P72 A;  1PZT A;  2Z87 A;  1G2V A;  2AH9 A;  1FWY A;  1H4E A;  5CQN X;  2X65 A;  2YC3 A;  2WLF A;  1NWG B;  2Y6P A;  2BO6 A;  5F42 A;  4AYJ A;  2QIV X;  1H5S A;  1FZW A;  3EE5 A;  2V0I A;  1VGZ A;  1XHB A;  4B5B A;  3OUP A;  1ZI3 A;  4D0Z A;  4K6R A;  3SX8 A;  4D0T A;  5DDV A;  3OTM A;  5J49 A;  2GGO A;  3R3R A;  2FFU A;  4HO4 A;  4Y7U A;  4N69 A;  1G95 A;  4HO9 A;  4DE7 A;  3E25 A;  1ZI1 A;  1XHD A;  4Y64 A;  3C8V A;  3U2X A;  5C49 A;  5JQQ A;  3SRT A;  3I0G A;  3FSB A;  3FSX A;  2IU9 A;  2ZU7 A;  1KK5 A;  1VZU A;  3ZGF A;  1HV9 A;  1GWV A;  4E1K A;  4EA9 A;  4EQY A;  3ZF8 A;  3VBI A;  3Q1X A;  1IIM A;  1ZDF A;  3I0F A;  5C1H A;  3SXE A;  1SSQ A;  3D5N A;  2AM4 A;  2AM5 A;  1YP4 A;  2WVK A;  5FV9 A;  3CKO A;  1QRE A;  1H5S B;  2V0H A;  3N9W A;  4MIX A;  2E8B A;  3DJ4 A;  5AJO A;  3R1W A;  4ZDQ A;  1QG8 A;  2VK9 A;  1HM8 A;  1QGS A;  3FSC A;  1MR7 A;  1H7Q A;  1VZX A;  1JVG A;  1OCX A;  1G8O A;  4EE5 A;  1LL2 A;  5EIY A;  4HCQ A;  3U0Y A;  3USR A;  1MP5 A;  2VD4 A;  4EE3 A;  2ICY A;  4G3Q A;  5C3B A;  1JYL A;  4B2X A;  1LZJ A;  2WLE A;  3KWC A;  5CQM X;  5EJZ A;  4ISX A;  3TV0 A;  1O23 B;  5AFU V;  3PMO A;  1LXA A;  1R82 A;  3SX7 A;  4G3S A;  3F1Y A;  3OH4 A;  1VGT A;  4EEO A;  4EEA A;  4HZD A;  1YRO B;  2I5K A;  3IGJ A;  3PKQ A;  4CJC A;  5D92 A;  4D11 C;  3OGZ A;  3P47 A;  3TZT A;  5ADX U;  4HO0 A;  4FIY A;  3BRK X;  2JCK A;  4B4B A;  3OH1 A;  4EA8 A;  1KRV A;  3U0X A;  1H5S C;  5IDT A;  3T57 A;  5C4E A;  3R5C A;  2O1H A;  4Y6N A;  1V82 A;  1OQM B;  1SST A;  3TWD A;  1ZCT A;  2IC7 A;  2VS4 A;  5C1L A;  4GBP A;  1S4N A;  2AES A;  2NXV A;  3USQ A;  1GWW A;  4FRL A;  4HO2 A;  2RJ9 A;  3ZLL A;  4KQL A;  2WLG A;  1GX4 A;  3SXD A;  5D91 A;  1FR8 A;  4ARW A;  1WT3 A;  5C3D A;  3GOS A;  3P1B A;  5I1F A;  2JCJ A;  1IIN A;  4IHG A;  1R7Y A;  1KWS A;  2Y4J A;  3OH0 A;  5DEM A;  1V3W A;  3I3A A;  2Z86 A;  3TK8 A;  1WT2 A;  2RJ4 A;  4N6B A;  4L41 C;  5C4F A;  3V8Y A;  4FQW A;  4M4K A;  3U2W A;  4MYO A;  4R37 A;  3VBL A;  3D98 A;  1VIC A;  1KRR A;  4M28 A;  1JYK A;  2I7B A;  4ECM A;  4Q7C A;  3O3P A;  4CJ8 A;  4D11 A;  3HSQ A;  3BSS A;  1FGG A;  2I5E A;  4HZC A;  3D8V A;  2RJ1 A;  4BQH A;  3R2W A;  3VBJ A;  3K8E A;  4Y6U A;  3FTT A;  2AQ9 A;  2YQS A;  1ZCY A;  4Y7G A;  2JF3 A;  2RIX A;  1GA8 A;  2FYA A;  5DDT A;  4KC2 A;  2FYB A;  1GQC A;  3GVD A;  4P00 A;  1MR9 A;  2VXM A;  1EZI A;  4R7P A;  4B2W A;  2OEF A;  1FO9 A;  4M98 A;  1S4O A;  1H3M A;  4Y62 A;  1JV3 A;  3RMW A;  5EJ1 A;  1MC3 A;  3VBK A;  3IOI A;  2YQH A;  2P2O A;  4DEC A;  4KNX A;  1JV1 A;  4J09 A;  5AJN A;  1LZ0 A;  1FXJ A;  3I0C A;  1KGQ A;  2XWN A;  3V91 A;  3FSY A;  3PNN A;  3R5B A;  4HO5 A;  2J0B A;  2OI6 A;  3T7O A;  3DK5 A;  1LVW A;  2A8U A;  1VM8 A;  3BCV A;  1W55 A;  1PZY B;  2BO4 A;  4HUR A;  3CKV A;  1ZDG A;  5CMF X;  1V83 A;  2UX8 A;  4N27 A;  2C0N A;  3R5A A;  1H7L A;  2PGY A;  5FU8 A;  1TVY A;  1VPA A;  1ZHJ A;  1TW1 A;  3POL A;  4J18 A;  3V4E A;  3JQY A;  1QRL A;  5E3P A;  1FOA A;  2WEE A;  4IRP A;  4IRQ A;  3KWE A;  5CQO A;  1WT0 A;  5CMI A;  4N6A A;  3I0K A;  4MZU A;  3DHO A;  3U2U A;  2RJ5 A;  4G3P A;  1SS9 A;  2VFZ A;  4BMA A;  3R3I A;  3U2V A;  2FKO A;  1NQI B;  4KPX A;  3V90 A;  4EGG A;  4UEG A;  3SX3 A;  3ST8 A;  4O6M A;  1W77 A;  2RJ8 A;  5HS2 A;  3PKP A;  1GQ9 A;  5CMJ A;  5C1G A;  4M99 A;  2P6W A;  2VHE A;  4KRV A;  1ON8 A;  3OH2 A;  3V0L A;  2ZU8 A;  2QH5 A;  1GX0 A;  1H7F A;  1HJJ A;  3OH3 A;  4FCE A;  2CU2 A;  2D0J A;  3V0M A;  1TDT A;  4AYL A;  1LL0 A;  1O0R A;  2VSH A;  2WVL A;  3RSB A;  4FRQ A;  4G87 A;  4EEM A;  1MRL A;  1TZF A;  1JVD A;  4Y9X A;  1MP4 A;  3CJ8 A;  3CKN A;  4FRB A;  2XMH A;  1MP3 A;  4HUS A;  5CQP A;  3FS8 A;  4C2S A;  1YP2 A;  1KGT A;  5FU0 A;  2PGV A;  2Q4J A;  5DEP A;  2O1G A;  1O7Q A;  1R81 A;  1ZJP A;  2YES A;  2OI7 A;  2W0W A;  2W0V A;  2FYC B;  4Y7V A;  3SXG A;  2V0K A;  2WE9 A;  3R5D A;  4Y63 A;  4E75 A;  1S4P A;  1ZCU A;  3CU0 A;  4IHF A;  3EG4 A;  3ZLK A;  2P73 A;  1R80 A;  1H5S D;  3MQG A;  4B4G A;  1VGW A;  2OEG A;  1ZJ0 A;  1YP3 A;  4MYB A;  5FTS A;  3ZGG A;  3I0E A;  5C8R A;  2AE7 A;  3SX5 A;  2A8W A;  1G23 A;  4B3U A;  4R36 A;  1XAT A;  1WSZ A;  3KWD A;  4FRP A;  2QGI A;  1EYR A;  3OW5 A;  3GUE A;  4HG6 A;  2RIY A;  3Q7U A;  1H7T A;  3OC9 A;  2X5S A;  4FIX A;  1H5T A;  3TQD A;  5IDS A;  1H5R A;  3U2T A;  1FXO A;  1FG5 N;  1QQ0 A;  4E6U A;  1R7T A;  1G9R A;  3BXY A;  3FOQ A;  3E26 A;  1ZI4 A;  3NZ2 A;  1R7U A;  2IUA A;  5C3A A;  3HJJ A;  1HJL A;  3T7N A;  5CMH A;  5C4D A;  3NGW A;  3Q80 A;  2D7I A;  2Y4K A;  1ZJO A;  5AJP A;  4HO6 A;  4CVH A;  2JF2 A;  3SPT A;  4FRD A;  4HO8 A;  1NKH B;  1H7G A;  1VZT A;  3IOH A;  2RJ7 A;  3SXB A;  2TDT A;  3FWW A;  4JIS A;  1NMM B;  1NHE B;  2Y7A A;  4FRH A;  1T3D A;  1KRU A;  3I0J A;  1VH3 A;  4FCU A;  4EAB A;  1VGU A;  4EVW A;  1FRW A;  3V0P A;  3Q4S A;  1KHR A;  1V67 A;  4MND A;  1H4C A;  1O7O A;  4KNR A;  4CJB A;  2MZB A;  4KC1 A;  1G93 A;  2J0A A;  4IHH A;  2IU8 A;  3CKJ A;  1K4V A;  5C4C A;  2JCL A;  2XWL A;  4M9C A;  1H5T B;  1H5R B;  2VS3 A;  4NAI A;  3MQH A;  2RJ6 A;  3I0L A;  2DPW A;  4HOC A;  2X60 A;  2XME A;  5BXC A;  1THJ A;  5IFY A;  1QRM A;  3TDT A;  4AA7 A;  5FUH A;  4KPZ A;  2ZU9 A;  4B4M A;  1KK4 A;  1NF5 B;  2AGD A;  2OI5 A;  4NAK A;  4KC4 A;  3IXC A;  3EH0 A;  3KIA A;  3VBN A;  4B42 A;  5CQL X;  4AAW A;  2FYD B;  3CGX A;  4KT7 A;  1QGQ A;  1ZJ3 A;  3TIS A;  1OMZ A;  2JCO A;  4E6T A;  2BO7 A;  2YCM A;  4ASJ A;  1VH1 A;  3OKR A;  2XWM A;  2PA4 A;  3BSW A;  4JD0 A;  3T7M A;  4EEG A;  4H7O A;  2AEC A;  3F1X A;  1WT1 A;  2AM3 A;  1LL3 A;  2RIJ A;  3JUK A;  5AFU U;  2ICX A;  3OAM A;  2V0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...