4DCLA

Computationally designed self-assembling tetrahedron protein, t308, crystallized in space group f23
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
188
structure length
188
Chain Sequence
MTEKEKMLAEKWYDANFDQTLINERLRAKVICFALNHTNPSATLKRKVLIDALFQTTTDNVSISIPFDTDYGWNVKLGKNVYVNTNCYFMDGGQITIGDNVFIGPNCGFYTATHPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKVVRKIDNDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computational design of self-assembling protein nanomaterials with atomic level accuracy.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
molecule keywords Putative acetyltransferase SACOL2570
total genus 70
structure length 188
sequence length 188
ec nomenclature ec 2.3.1.-:
pdb deposition date 2012-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12464 Mac Maltose acetyltransferase
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4dclA00
4K6RA 1HM0A 1KGTA 2WLEA 3R5CA 1QRMA 3R3IA 4M28A 2Q4JA 3TK8A 1XHDA 1HM8A 3OU9A 3TIOA 3SRTA 3OTMA 3Q1XA 2NPOA 3V4EA 3BSYA 3R5DA 4G3SA 1MR9A 1LXAA 4N27A 1QQ0A 2ICYA 2OI7A 4AAWA 3BSSA 3VBPA 3R5BA 3VBNA 5AFUU 2IU8A 2JF2A 4HZDA 4M99A 1SSQA 2QIAA 3VNPA 1QREA 2V0KA 5E3PA 1J2ZA 4HUSA 3VBKA 1T3DA 4N69A 3IXCA 3IGJA 1KQAA 3T57A 3VBIA 3FSYA 3PMOA 2WLFA 3DHOA 3OTZA 3R3RA 2OI6A 4HZCA 4MYOA 5E3QA 1OCXA 3FWWA 3R1WA 1YP2A 4G3PA 4AA7A 1XATA 2OEFA 3I3AA 4EA9A 5L6SA 1MRLA 3GUEA 1SSMA 1V3WA 2IC7A 1KK6A 2XATA 2IU9A 3FOQA 4IHFA 1MR7A 4R37A 3FSBA 3R5AA 4E1KA 3FS8A 2VHEA 4EABA 3KWDA 4EAAA 4E6TA 3FTTA 4N6AA 3R8YA 2GGOA 3D98A 3FSXA 2JF3A 4M9CA 1KRUA 3EG4A 2QKXA 3I3XA 2FKOA 1S80A 3VBLA 3R2WA 4E6UA 2W0VA 1KK4A 2TDTA 2V0JA 3FSCA 1G95A 3BRKX 1KRVA 3CJ8A 1SSTA 3VBMA 1KRRA 4MZUA 4EA8A 3MC4A 5L6VA 4M98A 4KQLA 1THJA 1TDTA 4KNXA 3SPTA 5F42A 1YP3A 3F1XA 3MQGA 4KNRA 4DCLA 1FXJA 1V67A 3GVDA 4MFGA 1FWYA 4ISXA 3ECTA 1G97A 3BSWA 3TDTA 1HV9A 5ADXU 4KPXA 4G87A 2RIJA 4M2BA 2P2OA 3ST8A 4E79A 2ICXA 3P1BA 4G3QA 4KPZA 4IHHA 1KGQA 4EGGA 3OW5A 4IHGA 5DG3A 3HSQA 3NZ2A 3P47A 4H7OA 4EQYA 3D8VA 1QRGA 2AQ9A 3OUPA 1HM9A 3R0SA 1KHRA 2IUAA 4AC3A 3DJ4A 2QIVX 4M2AA 5DEPA 2WLDA 3KWCA 2OI5A 2I5KA 2GGQA 3GOSA 4FCEA 4J18A 2V0IA 2V0HA 2WLCA 3TWDA 5U2KA 3MQHA 4EA7A 3VBJA 5E3RA 4J09A 3KWEA 3EEVA 3C8VA 5ADXV 3BXYA 4E75A 1QRLA 3BFPA 1Z90A 1KK5A 2W0WA 2WLGA 2VD4A 5DEMA 4R7PA 3HJJA 4R36A 2OEGA 3JQYA 3DK5A 3EH0A 4HCQA 1YP4A 3TISA 5AFUV 4HURA 1QRFA 2V0LA 3TV0A 4N6BA
chains in the Genus database with same CATH superfamily
1M8NA 4K6RA 3GQ7A 1HM0A 1KGTA 2WLEA 3R5CA 1QRMA 3R3IA 3OH0A 4M28A 2Q4JA 3TK8A 1XHDA 1HM8A 3OU9A 3TIOA 3OH3A 3OTMA 3Q1XA 3SRTA 2NPOA 3V4EA 3BSYA 3R5DA 4G3SA 1MR9A 1LXAA 4N27A 1QQ0A 2ICYA 2OI7A 4AAWA 3BSSA 3VBPA 3R5BA 3VBNA 5AFUU 2IU8A 2JF2A 4HZDA 4M99A 1SSQA 2QIAA 3VNPA 1QREA 2V0KA 5E3PA 1J2ZA 4HUSA 3VBKA 1T3DA 4N69A 3IXCA 3IGJA 1KQAA 1N4IA 3T57A 3VBIA 3FSYA 3PMOA 2WLFA 3DHOA 3OTZA 3GQ9A 3R3RA 2OI6A 4HZCA 4MYOA 5E3QA 1OCXA 3FWWA 3R1WA 1YP2A 4G3PA 4AA7A 1XATA 2OEFA 3I3AA 4EA9A 5L6SA 1MRLA 3GUEA 1SSMA 1V3WA 2IC7A 1KK6A 2XATA 2IU9A 3FOQA 4IHFA 1MR7A 4R37A 3FSBA 3R5AA 4E1KA 3FS8A 2VHEA 4EABA 3KWDA 4EAAA 4E6TA 3FTTA 4N6AA 3R8YA 2GGOA 3D98A 3FSXA 2JF3A 4M9CA 1EWWA 1KRUA 3EG4A 2QKXA 3OH1A 3I3XA 2FKOA 1S80A 3VBLA 3GQ8A 3R2WA 4E6UA 1Z2FA 2W0VA 1KK4A 2TDTA 2V0JA 3FSCA 1G95A 3BRKX 1KRVA 3CJ8A 3SUCA 1SSTA 3VBMA 1KRRA 4MZUA 4EA8A 3MC4A 5L6VA 4M98A 4KQLA 1THJA 1TDTA 4KNXA 3SPTA 5F42A 1YP3A 3F1XA 3MQGA 3OH2A 4KNRA 4DCLA 1FXJA 1V67A 3GVDA 4MFGA 1FWYA 4ISXA 3ECTA 1G97A 3OH4A 3BSWA 3TDTA 3OGZA 1HV9A 5ADXU 4KPXA 4G87A 2RIJA 4M2BA 2P2OA 3ST8A 4E79A 2ICXA 3P1BA 4G3QA 4KPZA 4IHHA 1KGQA 4EGGA 3OW5A 4IHGA 1L0SA 5DG3A 3HSQA 3NZ2A 3P47A 4H7OA 4EQYA 3D8VA 1QRGA 2AQ9A 3OUPA 1HM9A 3R0SA 1KHRA 2IUAA 4AC3A 3DJ4A 2QIVX 4M2AA 5DEPA 2WLDA 3KWCA 2OI5A 2I5KA 2GGQA 3GOSA 4FCEA 3GQAA 2V0IA 2V0HA 2WLCA 4J18A 5U2KA 3MQHA 3TWDA 4EA7A 3VBJA 5E3RA 4J09A 3KWEA 3EEVA 3C8VA 5ADXV 3BXYA 4E75A 1QRLA 3BFPA 1Z90A 1KK5A 2W0WA 2WLGA 2VD4A 5DEMA 4R7PA 3HJJA 4R36A 2OEGA 3JQYA 3DK5A 3EH0A 4HCQA 1YP4A 3TISA 5AFUV 4HURA 1QRFA 2V0LA 3TV0A 4N6BA
chains in the Genus database with same CATH topology
4K6RA 1HM0A 1KGTA 2WLEA 3R5CA 1QRMA 3R3IA 4M28A 2Q4JA 3TK8A 1XHDA 1HM8A 3OU9A 3TIOA 3SRTA 3OTMA 3Q1XA 2NPOA 3V4EA 3BSYA 3R5DA 4G3SA 1MR9A 1LXAA 4N27A 1QQ0A 2ICYA 2OI7A 4AAWA 3BSSA 3VBPA 3R5BA 3VBNA 5AFUU 2IU8A 2JF2A 4HZDA 4M99A 1SSQA 2QIAA 3VNPA 1QREA 2V0KA 5E3PA 1J2ZA 4HUSA 3VBKA 1T3DA 4N69A 3IXCA 3IGJA 1KQAA 3T57A 3VBIA 3FSYA 3PMOA 2WLFA 3DHOA 3OTZA 3R3RA 2OI6A 4HZCA 4MYOA 5E3QA 1OCXA 3FWWA 3R1WA 1YP2A 4G3PA 4AA7A 1XATA 2OEFA 3I3AA 4EA9A 5L6SA 1MRLA 3GUEA 1SSMA 1V3WA 2IC7A 1KK6A 2XATA 2IU9A 3FOQA 4IHFA 1MR7A 4R37A 3FSBA 3R5AA 4E1KA 3FS8A 2VHEA 4EABA 3KWDA 4EAAA 4E6TA 3FTTA 4N6AA 3R8YA 2GGOA 3D98A 3FSXA 2JF3A 4M9CA 1KRUA 3EG4A 2QKXA 3I3XA 2FKOA 1S80A 3VBLA 3R2WA 4E6UA 2W0VA 1KK4A 2TDTA 2V0JA 3FSCA 1G95A 3BRKX 1KRVA 3CJ8A 1SSTA 3VBMA 1KRRA 4MZUA 4EA8A 3MC4A 5L6VA 4M98A 4KQLA 1THJA 1TDTA 4KNXA 3SPTA 5F42A 1YP3A 3F1XA 3MQGA 4KNRA 4DCLA 1FXJA 1V67A 3GVDA 4MFGA 1FWYA 4ISXA 3ECTA 1G97A 3BSWA 3TDTA 1HV9A 5ADXU 4KPXA 4G87A 2RIJA 4M2BA 2P2OA 3ST8A 4E79A 2ICXA 3P1BA 4G3QA 4KPZA 4IHHA 1KGQA 4EGGA 3OW5A 4IHGA 5DG3A 3HSQA 3NZ2A 3P47A 4H7OA 4EQYA 3D8VA 1QRGA 2AQ9A 3OUPA 1HM9A 3R0SA 1KHRA 2IUAA 4AC3A 3DJ4A 2QIVX 4M2AA 5DEPA 2WLDA 3KWCA 2OI5A 2I5KA 2GGQA 3GOSA 4FCEA 4J18A 2V0IA 2V0HA 2WLCA 3TWDA 5U2KA 3MQHA 4EA7A 3VBJA 5E3RA 4J09A 3KWEA 3EEVA 3C8VA 5ADXV 3BXYA 4E75A 1QRLA 3BFPA 1Z90A 1KK5A 2W0WA 2WLGA 2VD4A 5DEMA 4R7PA 3HJJA 4R36A 2OEGA 3JQYA 3DK5A 3EH0A 4HCQA 1YP4A 3TISA 5AFUV 4HURA 1QRFA 2V0LA 3TV0A 4N6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K6R A;  1HM0 A;  1KGT A;  2WLE A;  3R5C A;  1QRM A;  3R3I A;  4M28 A;  2Q4J A;  3TK8 A;  1XHD A;  1HM8 A;  3OU9 A;  3TIO A;  3SRT A;  3OTM A;  3Q1X A;  2NPO A;  3V4E A;  3BSY A;  3R5D A;  4G3S A;  1MR9 A;  1LXA A;  4N27 A;  1QQ0 A;  2ICY A;  2OI7 A;  4AAW A;  3BSS A;  3VBP A;  3R5B A;  3VBN A;  5AFU U;  2IU8 A;  2JF2 A;  4HZD A;  4M99 A;  1SSQ A;  2QIA A;  3VNP A;  1QRE A;  2V0K A;  5E3P A;  1J2Z A;  4HUS A;  3VBK A;  1T3D A;  4N69 A;  3IXC A;  3IGJ A;  1KQA A;  3T57 A;  3VBI A;  3FSY A;  3PMO A;  2WLF A;  3DHO A;  3OTZ A;  3R3R A;  2OI6 A;  4HZC A;  4MYO A;  5E3Q A;  1OCX A;  3FWW A;  3R1W A;  1YP2 A;  4G3P A;  4AA7 A;  1XAT A;  2OEF A;  3I3A A;  4EA9 A;  5L6S A;  1MRL A;  3GUE A;  1SSM A;  1V3W A;  2IC7 A;  1KK6 A;  2XAT A;  2IU9 A;  3FOQ A;  4IHF A;  1MR7 A;  4R37 A;  3FSB A;  3R5A A;  4E1K A;  3FS8 A;  2VHE A;  4EAB A;  3KWD A;  4EAA A;  4E6T A;  3FTT A;  4N6A A;  3R8Y A;  2GGO A;  3D98 A;  3FSX A;  2JF3 A;  4M9C A;  1KRU A;  3EG4 A;  2QKX A;  3I3X A;  2FKO A;  1S80 A;  3VBL A;  3R2W A;  4E6U A;  2W0V A;  1KK4 A;  2TDT A;  2V0J A;  3FSC A;  1G95 A;  3BRK X;  1KRV A;  3CJ8 A;  1SST A;  3VBM A;  1KRR A;  4MZU A;  4EA8 A;  3MC4 A;  5L6V A;  4M98 A;  4KQL A;  1THJ A;  1TDT A;  4KNX A;  3SPT A;  5F42 A;  1YP3 A;  3F1X A;  3MQG A;  4KNR A;  4DCL A;  1FXJ A;  1V67 A;  3GVD A;  4MFG A;  1FWY A;  4ISX A;  3ECT A;  1G97 A;  3BSW A;  3TDT A;  1HV9 A;  5ADX U;  4KPX A;  4G87 A;  2RIJ A;  4M2B A;  2P2O A;  3ST8 A;  4E79 A;  2ICX A;  3P1B A;  4G3Q A;  4KPZ A;  4IHH A;  1KGQ A;  4EGG A;  3OW5 A;  4IHG A;  5DG3 A;  3HSQ A;  3NZ2 A;  3P47 A;  4H7O A;  4EQY A;  3D8V A;  1QRG A;  2AQ9 A;  3OUP A;  1HM9 A;  3R0S A;  1KHR A;  2IUA A;  4AC3 A;  3DJ4 A;  2QIV X;  4M2A A;  5DEP A;  2WLD A;  3KWC A;  2OI5 A;  2I5K A;  2GGQ A;  3GOS A;  4FCE A;  4J18 A;  2V0I A;  2V0H A;  2WLC A;  3TWD A;  5U2K A;  3MQH A;  4EA7 A;  3VBJ A;  5E3R A;  4J09 A;  3KWE A;  3EEV A;  3C8V A;  5ADX V;  3BXY A;  4E75 A;  1QRL A;  3BFP A;  1Z90 A;  1KK5 A;  2W0W A;  2WLG A;  2VD4 A;  5DEM A;  4R7P A;  3HJJ A;  4R36 A;  2OEG A;  3JQY A;  3DK5 A;  3EH0 A;  4HCQ A;  1YP4 A;  3TIS A;  5AFU V;  4HUR A;  1QRF A;  2V0L A;  3TV0 A;  4N6B A; 
#chains in the Genus database with same CATH topology
 1M8N A;  4K6R A;  3GQ7 A;  1HM0 A;  1KGT A;  2WLE A;  3R5C A;  1QRM A;  3R3I A;  3OH0 A;  4M28 A;  2Q4J A;  3TK8 A;  1XHD A;  1HM8 A;  3OU9 A;  3TIO A;  3OH3 A;  3OTM A;  3Q1X A;  3SRT A;  2NPO A;  3V4E A;  3BSY A;  3R5D A;  4G3S A;  1MR9 A;  1LXA A;  4N27 A;  1QQ0 A;  2ICY A;  2OI7 A;  4AAW A;  3BSS A;  3VBP A;  3R5B A;  3VBN A;  5AFU U;  2IU8 A;  2JF2 A;  4HZD A;  4M99 A;  1SSQ A;  2QIA A;  3VNP A;  1QRE A;  2V0K A;  5E3P A;  1J2Z A;  4HUS A;  3VBK A;  1T3D A;  4N69 A;  3IXC A;  3IGJ A;  1KQA A;  1N4I A;  3T57 A;  3VBI A;  3FSY A;  3PMO A;  2WLF A;  3DHO A;  3OTZ A;  3GQ9 A;  3R3R A;  2OI6 A;  4HZC A;  4MYO A;  5E3Q A;  1OCX A;  3FWW A;  3R1W A;  1YP2 A;  4G3P A;  4AA7 A;  1XAT A;  2OEF A;  3I3A A;  4EA9 A;  5L6S A;  1MRL A;  3GUE A;  1SSM A;  1V3W A;  2IC7 A;  1KK6 A;  2XAT A;  2IU9 A;  3FOQ A;  4IHF A;  1MR7 A;  4R37 A;  3FSB A;  3R5A A;  4E1K A;  3FS8 A;  2VHE A;  4EAB A;  3KWD A;  4EAA A;  4E6T A;  3FTT A;  4N6A A;  3R8Y A;  2GGO A;  3D98 A;  3FSX A;  2JF3 A;  4M9C A;  1EWW A;  1KRU A;  3EG4 A;  2QKX A;  3OH1 A;  3I3X A;  2FKO A;  1S80 A;  3VBL A;  3GQ8 A;  3R2W A;  4E6U A;  1Z2F A;  2W0V A;  1KK4 A;  2TDT A;  2V0J A;  3FSC A;  1G95 A;  3BRK X;  1KRV A;  3CJ8 A;  3SUC A;  1SST A;  3VBM A;  1KRR A;  4MZU A;  4EA8 A;  3MC4 A;  5L6V A;  4M98 A;  4KQL A;  1THJ A;  1TDT A;  4KNX A;  3SPT A;  5F42 A;  1YP3 A;  3F1X A;  3MQG A;  3OH2 A;  4KNR A;  4DCL A;  1FXJ A;  1V67 A;  3GVD A;  4MFG A;  1FWY A;  4ISX A;  3ECT A;  1G97 A;  3OH4 A;  3BSW A;  3TDT A;  3OGZ A;  1HV9 A;  5ADX U;  4KPX A;  4G87 A;  2RIJ A;  4M2B A;  2P2O A;  3ST8 A;  4E79 A;  2ICX A;  3P1B A;  4G3Q A;  4KPZ A;  4IHH A;  1KGQ A;  4EGG A;  3OW5 A;  4IHG A;  1L0S A;  5DG3 A;  3HSQ A;  3NZ2 A;  3P47 A;  4H7O A;  4EQY A;  3D8V A;  1QRG A;  2AQ9 A;  3OUP A;  1HM9 A;  3R0S A;  1KHR A;  2IUA A;  4AC3 A;  3DJ4 A;  2QIV X;  4M2A A;  5DEP A;  2WLD A;  3KWC A;  2OI5 A;  2I5K A;  2GGQ A;  3GOS A;  4FCE A;  3GQA A;  2V0I A;  2V0H A;  2WLC A;  4J18 A;  5U2K A;  3MQH A;  3TWD A;  4EA7 A;  3VBJ A;  5E3R A;  4J09 A;  3KWE A;  3EEV A;  3C8V A;  5ADX V;  3BXY A;  4E75 A;  1QRL A;  3BFP A;  1Z90 A;  1KK5 A;  2W0W A;  2WLG A;  2VD4 A;  5DEM A;  4R7P A;  3HJJ A;  4R36 A;  2OEG A;  3JQY A;  3DK5 A;  3EH0 A;  4HCQ A;  1YP4 A;  3TIS A;  5AFU V;  4HUR A;  1QRF A;  2V0L A;  3TV0 A;  4N6B A; 
#chains in the Genus database with same CATH homology
 4K6R A;  1HM0 A;  1KGT A;  2WLE A;  3R5C A;  1QRM A;  3R3I A;  4M28 A;  2Q4J A;  3TK8 A;  1XHD A;  1HM8 A;  3OU9 A;  3TIO A;  3SRT A;  3OTM A;  3Q1X A;  2NPO A;  3V4E A;  3BSY A;  3R5D A;  4G3S A;  1MR9 A;  1LXA A;  4N27 A;  1QQ0 A;  2ICY A;  2OI7 A;  4AAW A;  3BSS A;  3VBP A;  3R5B A;  3VBN A;  5AFU U;  2IU8 A;  2JF2 A;  4HZD A;  4M99 A;  1SSQ A;  2QIA A;  3VNP A;  1QRE A;  2V0K A;  5E3P A;  1J2Z A;  4HUS A;  3VBK A;  1T3D A;  4N69 A;  3IXC A;  3IGJ A;  1KQA A;  3T57 A;  3VBI A;  3FSY A;  3PMO A;  2WLF A;  3DHO A;  3OTZ A;  3R3R A;  2OI6 A;  4HZC A;  4MYO A;  5E3Q A;  1OCX A;  3FWW A;  3R1W A;  1YP2 A;  4G3P A;  4AA7 A;  1XAT A;  2OEF A;  3I3A A;  4EA9 A;  5L6S A;  1MRL A;  3GUE A;  1SSM A;  1V3W A;  2IC7 A;  1KK6 A;  2XAT A;  2IU9 A;  3FOQ A;  4IHF A;  1MR7 A;  4R37 A;  3FSB A;  3R5A A;  4E1K A;  3FS8 A;  2VHE A;  4EAB A;  3KWD A;  4EAA A;  4E6T A;  3FTT A;  4N6A A;  3R8Y A;  2GGO A;  3D98 A;  3FSX A;  2JF3 A;  4M9C A;  1KRU A;  3EG4 A;  2QKX A;  3I3X A;  2FKO A;  1S80 A;  3VBL A;  3R2W A;  4E6U A;  2W0V A;  1KK4 A;  2TDT A;  2V0J A;  3FSC A;  1G95 A;  3BRK X;  1KRV A;  3CJ8 A;  1SST A;  3VBM A;  1KRR A;  4MZU A;  4EA8 A;  3MC4 A;  5L6V A;  4M98 A;  4KQL A;  1THJ A;  1TDT A;  4KNX A;  3SPT A;  5F42 A;  1YP3 A;  3F1X A;  3MQG A;  4KNR A;  4DCL A;  1FXJ A;  1V67 A;  3GVD A;  4MFG A;  1FWY A;  4ISX A;  3ECT A;  1G97 A;  3BSW A;  3TDT A;  1HV9 A;  5ADX U;  4KPX A;  4G87 A;  2RIJ A;  4M2B A;  2P2O A;  3ST8 A;  4E79 A;  2ICX A;  3P1B A;  4G3Q A;  4KPZ A;  4IHH A;  1KGQ A;  4EGG A;  3OW5 A;  4IHG A;  5DG3 A;  3HSQ A;  3NZ2 A;  3P47 A;  4H7O A;  4EQY A;  3D8V A;  1QRG A;  2AQ9 A;  3OUP A;  1HM9 A;  3R0S A;  1KHR A;  2IUA A;  4AC3 A;  3DJ4 A;  2QIV X;  4M2A A;  5DEP A;  2WLD A;  3KWC A;  2OI5 A;  2I5K A;  2GGQ A;  3GOS A;  4FCE A;  4J18 A;  2V0I A;  2V0H A;  2WLC A;  3TWD A;  5U2K A;  3MQH A;  4EA7 A;  3VBJ A;  5E3R A;  4J09 A;  3KWE A;  3EEV A;  3C8V A;  5ADX V;  3BXY A;  4E75 A;  1QRL A;  3BFP A;  1Z90 A;  1KK5 A;  2W0W A;  2WLG A;  2VD4 A;  5DEM A;  4R7P A;  3HJJ A;  4R36 A;  2OEG A;  3JQY A;  3DK5 A;  3EH0 A;  4HCQ A;  1YP4 A;  3TIS A;  5AFU V;  4HUR A;  1QRF A;  2V0L A;  3TV0 A;  4N6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...