3KWDA

Inactive truncation of the beta-carboxysomal gamma-carbonic anhydrase, ccmm, form 1
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
166
structure length
166
Chain Sequence
LAEPEIAPTAYVHSFSNLIGDVRIKDYVHIAPGTSIRADEGTPFHIGSRTNIQDGVVIHGLQQGRVIGDDGQEYSVWIGDNVSITHMALIHGPAYIGDGCFIGFRSTVFNARVGAGCVVMMHVLIQDVEIPPGKYVPSGMVITTQQQADRLPNVEESDIHFAQHVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase, protein binding, photosynthesis
molecule keywords Carbon dioxide concentrating mechanism protein
publication title Structural basis of the oxidative activation of the carboxysomal {gamma}-carbonic anhydrase, CcmM.
pubmed doi rcsb
source organism Thermosynechococcus elongatus
total genus 60
structure length 166
sequence length 166
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2009-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3kwdA00
1LXAA 1THJA 2V0KA 4HUSA 4KNXA 2XATA 3FS8A 1HM0A 1XATA 3JQYA 2QIVX 2TDTA 3R5BA 1QQ0A 3FSYA 3NZ2A 2IU8A 4E6TA 2RIJA 3D98A 4DCLA 2V0IA 2WLGA 4M2BA 2IU9A 3I3XA 1SSQA 3OUPA 3OU9A 4HURA 4HZCA 3TV0A 1MR9A 4J09A 3P47A 4G87A 4EAAA 5E3RA 2I5KA 2OEGA 4ISXA 4R37A 1FXJA 4IHHA 1TDTA 4KPXA 3DJ4A 3V4EA 3VBPA 5AFUU 3BFPA 1MRLA 4AA7A 3VNPA 5DEPA 3KWEA 4HZDA 3TISA 1QRFA 1QRMA 3MC4A 4M9CA 1QRLA 2OI5A 1HV9A 2W0WA 2IUAA 2WLEA 1QRGA 2Q4JA 2V0JA 4KQLA 4EA9A 1V67A 4AAWA 3ST8A 4KPZA 3P1BA 4KNRA 3T57A 4MYOA 4R36A 1KK6A 1SSMA 3VBLA 2OEFA 4J18A 3KWCA 4N69A 3ECTA 3VBJA 5DG3A 1XHDA 2WLCA 5DEMA 3VBNA 1HM9A 4G3PA 4M28A 1MR7A 1YP2A 2NPOA 3F1XA 3FSXA 3OW5A 4M2AA 4MFGA 3R8YA 4EA8A 3FTTA 2P2OA 3HSQA 4FCEA 4R7PA 4M98A 3GUEA 1S80A 3BSSA 1SSTA 5ADXV 4EQYA 3DK5A 4E75A 3R1WA 2OI7A 2V0HA 3CJ8A 2GGQA 4G3SA 2WLFA 2JF2A 1G97A 1V3WA 4EGGA 2VHEA 1KK4A 5L6VA 2FKOA 3OTMA 1KRUA 1YP3A 3GOSA 3EG4A 2AQ9A 4IHGA 3FOQA 4M99A 3R3IA 4K6RA 1OCXA 2W0VA 5E3PA 5L6SA 1KGQA 4AC3A 3VBMA 3EEVA 1FWYA 1HM8A 4N27A 3R3RA 1QREA 3IXCA 2GGOA 1KQAA 3R5DA 1J2ZA 3D8VA 5E3QA 3KWDA 4EA7A 2JF3A 2IC7A 1KRRA 4E79A 1KGTA 3IGJA 3DHOA 3R5AA 3R2WA 4E1KA 4MZUA 2VD4A 3FWWA 4E6UA 4N6BA 3R5CA 3R0SA 5AFUV 2QIAA 3SRTA 3OTZA 2OI6A 4G3QA 3EH0A 3VBKA 3VBIA 1KHRA 3Q1XA 3TDTA 1KK5A 4IHFA 3BXYA 3MQHA 3BSYA 3BRKX 1KRVA 2ICYA 2WLDA 3I3AA 1Z90A 5ADXU 4HCQA 3HJJA 3MQGA 3TK8A 2QKXA 3BSWA 3FSCA 1G95A 2V0LA 3PMOA 5F42A 3TWDA 4EABA 3SPTA 4N6AA 3C8VA 4H7OA 1T3DA 3TIOA 1YP4A 3FSBA 3GVDA 2ICXA 5U2KA
chains in the Genus database with same CATH superfamily
1LXAA 1THJA 2V0KA 4HUSA 4KNXA 2XATA 3FS8A 1HM0A 1XATA 3JQYA 3OH1A 2QIVX 2TDTA 3R5BA 3SUCA 1QQ0A 3FSYA 3NZ2A 2IU8A 4E6TA 2RIJA 3D98A 4DCLA 2V0IA 2WLGA 4M2BA 2IU9A 3I3XA 1SSQA 3OUPA 3OGZA 3OU9A 4HURA 4HZCA 3TV0A 1MR9A 4J09A 3P47A 4G87A 4EAAA 5E3RA 2I5KA 2OEGA 4ISXA 4R37A 1FXJA 4IHHA 1TDTA 4KPXA 3DJ4A 3V4EA 3VBPA 5AFUU 3BFPA 1MRLA 4AA7A 3VNPA 5DEPA 3KWEA 4HZDA 3TISA 1QRFA 1QRMA 3MC4A 4M9CA 1QRLA 2OI5A 3OH2A 1HV9A 2W0WA 2IUAA 2WLEA 1QRGA 2Q4JA 2V0JA 3OH0A 4KQLA 4EA9A 1V67A 4AAWA 3ST8A 4KPZA 1EWWA 3P1BA 4KNRA 3T57A 4MYOA 4R36A 1KK6A 1SSMA 3VBLA 2OEFA 3GQAA 4J18A 3KWCA 4N69A 3ECTA 3VBJA 5DG3A 1XHDA 2WLCA 5DEMA 3VBNA 1L0SA 1HM9A 3GQ7A 4G3PA 4M28A 1MR7A 1YP2A 2NPOA 3F1XA 3FSXA 3OW5A 4M2AA 4MFGA 3R8YA 4EA8A 3FTTA 2P2OA 3HSQA 4FCEA 4R7PA 4M98A 3GUEA 1S80A 3BSSA 1SSTA 5ADXV 4EQYA 3DK5A 4E75A 3R1WA 2OI7A 2V0HA 3CJ8A 2GGQA 4G3SA 2WLFA 2JF2A 1Z2FA 1G97A 1V3WA 4EGGA 2VHEA 1KK4A 3OH3A 5L6VA 2FKOA 3OTMA 1KRUA 1YP3A 3GOSA 3EG4A 2AQ9A 4IHGA 3FOQA 4M99A 3R3IA 4K6RA 1OCXA 2W0VA 5E3PA 5L6SA 1KGQA 4AC3A 3VBMA 3EEVA 3GQ9A 1FWYA 1HM8A 4N27A 3R3RA 1QREA 3IXCA 2GGOA 1KQAA 3R5DA 1J2ZA 3D8VA 5E3QA 3KWDA 4EA7A 2JF3A 2IC7A 1KRRA 1M8NA 4E79A 1KGTA 3IGJA 3GQ8A 3DHOA 3R5AA 3R2WA 4E1KA 4MZUA 2VD4A 3OH4A 3FWWA 4E6UA 4N6BA 1N4IA 3R5CA 3R0SA 5AFUV 2QIAA 3SRTA 3OTZA 2OI6A 4G3QA 3EH0A 3VBKA 3VBIA 1KHRA 3Q1XA 3TDTA 1KK5A 4IHFA 3BXYA 3MQHA 3BSYA 3BRKX 1KRVA 2ICYA 2WLDA 3I3AA 1Z90A 5ADXU 4HCQA 3HJJA 3MQGA 3TK8A 2QKXA 3BSWA 3FSCA 1G95A 2V0LA 3PMOA 5F42A 3TWDA 4EABA 3SPTA 4N6AA 3C8VA 4H7OA 1T3DA 3TIOA 1YP4A 3FSBA 3GVDA 2ICXA 5U2KA
chains in the Genus database with same CATH topology
1LXAA 1THJA 2V0KA 4HUSA 4KNXA 2XATA 3FS8A 1HM0A 1XATA 3JQYA 2QIVX 2TDTA 3R5BA 1QQ0A 3FSYA 3NZ2A 2IU8A 4E6TA 2RIJA 3D98A 4DCLA 2V0IA 2WLGA 4M2BA 2IU9A 3I3XA 1SSQA 3OUPA 3OU9A 4HURA 4HZCA 3TV0A 1MR9A 4J09A 3P47A 4G87A 4EAAA 5E3RA 2I5KA 2OEGA 4ISXA 4R37A 1FXJA 4IHHA 1TDTA 4KPXA 3DJ4A 3V4EA 3VBPA 5AFUU 3BFPA 1MRLA 4AA7A 3VNPA 5DEPA 3KWEA 4HZDA 3TISA 1QRFA 1QRMA 3MC4A 4M9CA 1QRLA 2OI5A 1HV9A 2W0WA 2IUAA 2WLEA 1QRGA 2Q4JA 2V0JA 4KQLA 4EA9A 1V67A 4AAWA 3ST8A 4KPZA 3P1BA 4KNRA 3T57A 4MYOA 4R36A 1KK6A 1SSMA 3VBLA 2OEFA 4J18A 3KWCA 4N69A 3ECTA 3VBJA 5DG3A 1XHDA 2WLCA 5DEMA 3VBNA 1HM9A 4G3PA 4M28A 1MR7A 1YP2A 2NPOA 3F1XA 3FSXA 3OW5A 4M2AA 4MFGA 3R8YA 4EA8A 3FTTA 2P2OA 3HSQA 4FCEA 4R7PA 4M98A 3GUEA 1S80A 3BSSA 1SSTA 5ADXV 4EQYA 3DK5A 4E75A 3R1WA 2OI7A 2V0HA 3CJ8A 2GGQA 4G3SA 2WLFA 2JF2A 1G97A 1V3WA 4EGGA 2VHEA 1KK4A 5L6VA 2FKOA 3OTMA 1KRUA 1YP3A 3GOSA 3EG4A 2AQ9A 4IHGA 3FOQA 4M99A 3R3IA 4K6RA 1OCXA 2W0VA 5E3PA 5L6SA 1KGQA 4AC3A 3VBMA 3EEVA 1FWYA 1HM8A 4N27A 3R3RA 1QREA 3IXCA 2GGOA 1KQAA 3R5DA 1J2ZA 3D8VA 5E3QA 3KWDA 4EA7A 2JF3A 2IC7A 1KRRA 4E79A 1KGTA 3IGJA 3DHOA 3R5AA 3R2WA 4E1KA 4MZUA 2VD4A 3FWWA 4E6UA 4N6BA 3R5CA 3R0SA 5AFUV 2QIAA 3SRTA 3OTZA 2OI6A 4G3QA 3EH0A 3VBKA 3VBIA 1KHRA 3Q1XA 3TDTA 1KK5A 4IHFA 3BXYA 3MQHA 3BSYA 3BRKX 1KRVA 2ICYA 2WLDA 3I3AA 1Z90A 5ADXU 4HCQA 3HJJA 3MQGA 3TK8A 2QKXA 3BSWA 3FSCA 1G95A 2V0LA 3PMOA 5F42A 3TWDA 4EABA 3SPTA 4N6AA 3C8VA 4H7OA 1T3DA 3TIOA 1YP4A 3FSBA 3GVDA 2ICXA 5U2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LXA A;  1THJ A;  2V0K A;  4HUS A;  4KNX A;  2XAT A;  3FS8 A;  1HM0 A;  1XAT A;  3JQY A;  2QIV X;  2TDT A;  3R5B A;  1QQ0 A;  3FSY A;  3NZ2 A;  2IU8 A;  4E6T A;  2RIJ A;  3D98 A;  4DCL A;  2V0I A;  2WLG A;  4M2B A;  2IU9 A;  3I3X A;  1SSQ A;  3OUP A;  3OU9 A;  4HUR A;  4HZC A;  3TV0 A;  1MR9 A;  4J09 A;  3P47 A;  4G87 A;  4EAA A;  5E3R A;  2I5K A;  2OEG A;  4ISX A;  4R37 A;  1FXJ A;  4IHH A;  1TDT A;  4KPX A;  3DJ4 A;  3V4E A;  3VBP A;  5AFU U;  3BFP A;  1MRL A;  4AA7 A;  3VNP A;  5DEP A;  3KWE A;  4HZD A;  3TIS A;  1QRF A;  1QRM A;  3MC4 A;  4M9C A;  1QRL A;  2OI5 A;  1HV9 A;  2W0W A;  2IUA A;  2WLE A;  1QRG A;  2Q4J A;  2V0J A;  4KQL A;  4EA9 A;  1V67 A;  4AAW A;  3ST8 A;  4KPZ A;  3P1B A;  4KNR A;  3T57 A;  4MYO A;  4R36 A;  1KK6 A;  1SSM A;  3VBL A;  2OEF A;  4J18 A;  3KWC A;  4N69 A;  3ECT A;  3VBJ A;  5DG3 A;  1XHD A;  2WLC A;  5DEM A;  3VBN A;  1HM9 A;  4G3P A;  4M28 A;  1MR7 A;  1YP2 A;  2NPO A;  3F1X A;  3FSX A;  3OW5 A;  4M2A A;  4MFG A;  3R8Y A;  4EA8 A;  3FTT A;  2P2O A;  3HSQ A;  4FCE A;  4R7P A;  4M98 A;  3GUE A;  1S80 A;  3BSS A;  1SST A;  5ADX V;  4EQY A;  3DK5 A;  4E75 A;  3R1W A;  2OI7 A;  2V0H A;  3CJ8 A;  2GGQ A;  4G3S A;  2WLF A;  2JF2 A;  1G97 A;  1V3W A;  4EGG A;  2VHE A;  1KK4 A;  5L6V A;  2FKO A;  3OTM A;  1KRU A;  1YP3 A;  3GOS A;  3EG4 A;  2AQ9 A;  4IHG A;  3FOQ A;  4M99 A;  3R3I A;  4K6R A;  1OCX A;  2W0V A;  5E3P A;  5L6S A;  1KGQ A;  4AC3 A;  3VBM A;  3EEV A;  1FWY A;  1HM8 A;  4N27 A;  3R3R A;  1QRE A;  3IXC A;  2GGO A;  1KQA A;  3R5D A;  1J2Z A;  3D8V A;  5E3Q A;  3KWD A;  4EA7 A;  2JF3 A;  2IC7 A;  1KRR A;  4E79 A;  1KGT A;  3IGJ A;  3DHO A;  3R5A A;  3R2W A;  4E1K A;  4MZU A;  2VD4 A;  3FWW A;  4E6U A;  4N6B A;  3R5C A;  3R0S A;  5AFU V;  2QIA A;  3SRT A;  3OTZ A;  2OI6 A;  4G3Q A;  3EH0 A;  3VBK A;  3VBI A;  1KHR A;  3Q1X A;  3TDT A;  1KK5 A;  4IHF A;  3BXY A;  3MQH A;  3BSY A;  3BRK X;  1KRV A;  2ICY A;  2WLD A;  3I3A A;  1Z90 A;  5ADX U;  4HCQ A;  3HJJ A;  3MQG A;  3TK8 A;  2QKX A;  3BSW A;  3FSC A;  1G95 A;  2V0L A;  3PMO A;  5F42 A;  3TWD A;  4EAB A;  3SPT A;  4N6A A;  3C8V A;  4H7O A;  1T3D A;  3TIO A;  1YP4 A;  3FSB A;  3GVD A;  2ICX A;  5U2K A; 
#chains in the Genus database with same CATH topology
 1LXA A;  1THJ A;  2V0K A;  4HUS A;  4KNX A;  2XAT A;  3FS8 A;  1HM0 A;  1XAT A;  3JQY A;  3OH1 A;  2QIV X;  2TDT A;  3R5B A;  3SUC A;  1QQ0 A;  3FSY A;  3NZ2 A;  2IU8 A;  4E6T A;  2RIJ A;  3D98 A;  4DCL A;  2V0I A;  2WLG A;  4M2B A;  2IU9 A;  3I3X A;  1SSQ A;  3OUP A;  3OGZ A;  3OU9 A;  4HUR A;  4HZC A;  3TV0 A;  1MR9 A;  4J09 A;  3P47 A;  4G87 A;  4EAA A;  5E3R A;  2I5K A;  2OEG A;  4ISX A;  4R37 A;  1FXJ A;  4IHH A;  1TDT A;  4KPX A;  3DJ4 A;  3V4E A;  3VBP A;  5AFU U;  3BFP A;  1MRL A;  4AA7 A;  3VNP A;  5DEP A;  3KWE A;  4HZD A;  3TIS A;  1QRF A;  1QRM A;  3MC4 A;  4M9C A;  1QRL A;  2OI5 A;  3OH2 A;  1HV9 A;  2W0W A;  2IUA A;  2WLE A;  1QRG A;  2Q4J A;  2V0J A;  3OH0 A;  4KQL A;  4EA9 A;  1V67 A;  4AAW A;  3ST8 A;  4KPZ A;  1EWW A;  3P1B A;  4KNR A;  3T57 A;  4MYO A;  4R36 A;  1KK6 A;  1SSM A;  3VBL A;  2OEF A;  3GQA A;  4J18 A;  3KWC A;  4N69 A;  3ECT A;  3VBJ A;  5DG3 A;  1XHD A;  2WLC A;  5DEM A;  3VBN A;  1L0S A;  1HM9 A;  3GQ7 A;  4G3P A;  4M28 A;  1MR7 A;  1YP2 A;  2NPO A;  3F1X A;  3FSX A;  3OW5 A;  4M2A A;  4MFG A;  3R8Y A;  4EA8 A;  3FTT A;  2P2O A;  3HSQ A;  4FCE A;  4R7P A;  4M98 A;  3GUE A;  1S80 A;  3BSS A;  1SST A;  5ADX V;  4EQY A;  3DK5 A;  4E75 A;  3R1W A;  2OI7 A;  2V0H A;  3CJ8 A;  2GGQ A;  4G3S A;  2WLF A;  2JF2 A;  1Z2F A;  1G97 A;  1V3W A;  4EGG A;  2VHE A;  1KK4 A;  3OH3 A;  5L6V A;  2FKO A;  3OTM A;  1KRU A;  1YP3 A;  3GOS A;  3EG4 A;  2AQ9 A;  4IHG A;  3FOQ A;  4M99 A;  3R3I A;  4K6R A;  1OCX A;  2W0V A;  5E3P A;  5L6S A;  1KGQ A;  4AC3 A;  3VBM A;  3EEV A;  3GQ9 A;  1FWY A;  1HM8 A;  4N27 A;  3R3R A;  1QRE A;  3IXC A;  2GGO A;  1KQA A;  3R5D A;  1J2Z A;  3D8V A;  5E3Q A;  3KWD A;  4EA7 A;  2JF3 A;  2IC7 A;  1KRR A;  1M8N A;  4E79 A;  1KGT A;  3IGJ A;  3GQ8 A;  3DHO A;  3R5A A;  3R2W A;  4E1K A;  4MZU A;  2VD4 A;  3OH4 A;  3FWW A;  4E6U A;  4N6B A;  1N4I A;  3R5C A;  3R0S A;  5AFU V;  2QIA A;  3SRT A;  3OTZ A;  2OI6 A;  4G3Q A;  3EH0 A;  3VBK A;  3VBI A;  1KHR A;  3Q1X A;  3TDT A;  1KK5 A;  4IHF A;  3BXY A;  3MQH A;  3BSY A;  3BRK X;  1KRV A;  2ICY A;  2WLD A;  3I3A A;  1Z90 A;  5ADX U;  4HCQ A;  3HJJ A;  3MQG A;  3TK8 A;  2QKX A;  3BSW A;  3FSC A;  1G95 A;  2V0L A;  3PMO A;  5F42 A;  3TWD A;  4EAB A;  3SPT A;  4N6A A;  3C8V A;  4H7O A;  1T3D A;  3TIO A;  1YP4 A;  3FSB A;  3GVD A;  2ICX A;  5U2K A; 
#chains in the Genus database with same CATH homology
 1LXA A;  1THJ A;  2V0K A;  4HUS A;  4KNX A;  2XAT A;  3FS8 A;  1HM0 A;  1XAT A;  3JQY A;  2QIV X;  2TDT A;  3R5B A;  1QQ0 A;  3FSY A;  3NZ2 A;  2IU8 A;  4E6T A;  2RIJ A;  3D98 A;  4DCL A;  2V0I A;  2WLG A;  4M2B A;  2IU9 A;  3I3X A;  1SSQ A;  3OUP A;  3OU9 A;  4HUR A;  4HZC A;  3TV0 A;  1MR9 A;  4J09 A;  3P47 A;  4G87 A;  4EAA A;  5E3R A;  2I5K A;  2OEG A;  4ISX A;  4R37 A;  1FXJ A;  4IHH A;  1TDT A;  4KPX A;  3DJ4 A;  3V4E A;  3VBP A;  5AFU U;  3BFP A;  1MRL A;  4AA7 A;  3VNP A;  5DEP A;  3KWE A;  4HZD A;  3TIS A;  1QRF A;  1QRM A;  3MC4 A;  4M9C A;  1QRL A;  2OI5 A;  1HV9 A;  2W0W A;  2IUA A;  2WLE A;  1QRG A;  2Q4J A;  2V0J A;  4KQL A;  4EA9 A;  1V67 A;  4AAW A;  3ST8 A;  4KPZ A;  3P1B A;  4KNR A;  3T57 A;  4MYO A;  4R36 A;  1KK6 A;  1SSM A;  3VBL A;  2OEF A;  4J18 A;  3KWC A;  4N69 A;  3ECT A;  3VBJ A;  5DG3 A;  1XHD A;  2WLC A;  5DEM A;  3VBN A;  1HM9 A;  4G3P A;  4M28 A;  1MR7 A;  1YP2 A;  2NPO A;  3F1X A;  3FSX A;  3OW5 A;  4M2A A;  4MFG A;  3R8Y A;  4EA8 A;  3FTT A;  2P2O A;  3HSQ A;  4FCE A;  4R7P A;  4M98 A;  3GUE A;  1S80 A;  3BSS A;  1SST A;  5ADX V;  4EQY A;  3DK5 A;  4E75 A;  3R1W A;  2OI7 A;  2V0H A;  3CJ8 A;  2GGQ A;  4G3S A;  2WLF A;  2JF2 A;  1G97 A;  1V3W A;  4EGG A;  2VHE A;  1KK4 A;  5L6V A;  2FKO A;  3OTM A;  1KRU A;  1YP3 A;  3GOS A;  3EG4 A;  2AQ9 A;  4IHG A;  3FOQ A;  4M99 A;  3R3I A;  4K6R A;  1OCX A;  2W0V A;  5E3P A;  5L6S A;  1KGQ A;  4AC3 A;  3VBM A;  3EEV A;  1FWY A;  1HM8 A;  4N27 A;  3R3R A;  1QRE A;  3IXC A;  2GGO A;  1KQA A;  3R5D A;  1J2Z A;  3D8V A;  5E3Q A;  3KWD A;  4EA7 A;  2JF3 A;  2IC7 A;  1KRR A;  4E79 A;  1KGT A;  3IGJ A;  3DHO A;  3R5A A;  3R2W A;  4E1K A;  4MZU A;  2VD4 A;  3FWW A;  4E6U A;  4N6B A;  3R5C A;  3R0S A;  5AFU V;  2QIA A;  3SRT A;  3OTZ A;  2OI6 A;  4G3Q A;  3EH0 A;  3VBK A;  3VBI A;  1KHR A;  3Q1X A;  3TDT A;  1KK5 A;  4IHF A;  3BXY A;  3MQH A;  3BSY A;  3BRK X;  1KRV A;  2ICY A;  2WLD A;  3I3A A;  1Z90 A;  5ADX U;  4HCQ A;  3HJJ A;  3MQG A;  3TK8 A;  2QKX A;  3BSW A;  3FSC A;  1G95 A;  2V0L A;  3PMO A;  5F42 A;  3TWD A;  4EAB A;  3SPT A;  4N6A A;  3C8V A;  4H7O A;  1T3D A;  3TIO A;  1YP4 A;  3FSB A;  3GVD A;  2ICX A;  5U2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...