3OTZA

Crystal structure of gamma-carbonic anhydrase w19a mutant from metanosarcina thermophila
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
205
structure length
205
Chain Sequence
SNIRENPVTPANPEPSAPVIDPTAYIDPQASVIGEVTIGANVMVSPMASIRSDEGMPIFVGDRSNVQDGVVLHALETINEEGEPIEDNIVEVDGKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFKSKVGNNCVLEPRSAAIGVTIPDGRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYVNVHLAEGYKETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonic anhydrase
publication title Crystal structure of gamma-carbonic anhydrase W19A mutant from Metanosarcina thermophila
rcsb
source organism Methanosarcina thermophila
molecule tags Lyase
total genus 70
structure length 205
sequence length 205
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3otzA00
1KHRA 4M9CA 4HURA 3VNPA 2W0WA 4N69A 1YP4A 2GGOA 4E75A 3MQGA 1V3WA 4HCQA 3BFPA 2NPOA 4KPZA 5AFUV 4AAWA 1TDTA 2VHEA 4FCEA 4K6RA 3VBPA 3OU9A 2QKXA 2ICXA 3BSYA 4EGGA 3P47A 3PMOA 2WLGA 4M98A 1KK6A 5F42A 4EQYA 3CJ8A 3KWEA 1MR9A 5E3RA 1KK4A 3GUEA 1YP2A 3HSQA 4ISXA 3R3RA 1MR7A 1KK5A 4IHHA 3GVDA 3BSWA 5E3PA 1THJA 2WLFA 3GOSA 4N27A 2RIJA 3F1XA 3FSYA 4DCLA 1KGQA 4M28A 5E3QA 3EEVA 1SSTA 5ADXU 4G87A 2FKOA 3DJ4A 3ECTA 2W0VA 3OUPA 3VBNA 2TDTA 3FWWA 1G97A 1FWYA 2V0KA 1OCXA 3JQYA 4EAAA 3Q1XA 3R8YA 2GGQA 1KQAA 2OI6A 4E79A 2QIAA 1T3DA 2AQ9A 2ICYA 3FSBA 3EG4A 2OI5A 3TK8A 2WLCA 4KNXA 3NZ2A 4EA7A 1QRGA 2V0IA 4G3QA 4E1KA 4KPXA 5DEPA 2I5KA 3FTTA 3R5AA 1QREA 3R1WA 3HJJA 3EH0A 3R5BA 3BRKX 4H7OA 3I3AA 1HM0A 4M2AA 4R37A 3V4EA 4E6TA 4MFGA 3FOQA 1MRLA 1KRUA 1QQ0A 2VD4A 2JF3A 4KNRA 1HM9A 3TDTA 3R2WA 2QIVX 1KRRA 5DEMA 4M2BA 5ADXV 5AFUU 4AC3A 3KWDA 4EABA 1SSQA 4IHGA 2P2OA 4IHFA 1QRMA 3R0SA 1FXJA 4J18A 3T57A 3TIOA 3VBJA 4EA8A 3D98A 3DHOA 3IXCA 4G3SA 3VBKA 4AA7A 4MZUA 3D8VA 3TISA 3BSSA 3FS8A 1SSMA 3DK5A 3P1BA 4R7PA 3SPTA 2IUAA 1J2ZA 1QRFA 3R5CA 3I3XA 4HZDA 5U2KA 2OEGA 3OW5A 2IU8A 3VBIA 2OEFA 3ST8A 4EA9A 2IU9A 1S80A 1LXAA 3C8VA 4G3PA 3TV0A 1YP3A 3R5DA 4MYOA 1QRLA 1KRVA 2OI7A 2V0HA 5L6SA 1HV9A 3KWCA 3OTZA 4N6AA 5DG3A 3SRTA 3R3IA 3FSCA 1HM8A 4E6UA 1V67A 1G95A 2WLEA 3BXYA 3MC4A 1XATA 3VBMA 3MQHA 3TWDA 3OTMA 4R36A 4M99A 2IC7A 3VBLA 2WLDA 4HUSA 4J09A 5L6VA 2XATA 4N6BA 4HZCA 2JF2A 4KQLA 2Q4JA 1Z90A 2V0JA 1XHDA 1KGTA 3IGJA 3FSXA 2V0LA
chains in the Genus database with same CATH superfamily
1KHRA 4M9CA 4HURA 3VNPA 2W0WA 4N69A 1YP4A 2GGOA 4E75A 3MQGA 1V3WA 4HCQA 3BFPA 2NPOA 4KPZA 5AFUV 4AAWA 1TDTA 2VHEA 4FCEA 4K6RA 3VBPA 3OU9A 2QKXA 2ICXA 3BSYA 3GQ8A 4EGGA 3P47A 3PMOA 2WLGA 4M98A 1KK6A 5F42A 4EQYA 3CJ8A 3KWEA 1MR9A 5E3RA 1KK4A 3GUEA 1YP2A 3HSQA 4ISXA 3OH2A 3R3RA 1MR7A 1KK5A 4IHHA 3GVDA 3BSWA 5E3PA 1THJA 2WLFA 3GOSA 4N27A 2RIJA 3F1XA 3FSYA 4DCLA 1KGQA 4M28A 5E3QA 3EEVA 1SSTA 5ADXU 4G87A 2FKOA 3DJ4A 3ECTA 2W0VA 3OUPA 3VBNA 2TDTA 3FWWA 1G97A 1FWYA 2V0KA 1OCXA 3JQYA 4EAAA 3Q1XA 3R8YA 2GGQA 1KQAA 1M8NA 2OI6A 4E79A 2QIAA 1T3DA 2AQ9A 3OGZA 2ICYA 3FSBA 3OH3A 3EG4A 2OI5A 3TK8A 2WLCA 4KNXA 3NZ2A 4EA7A 1QRGA 2V0IA 4G3QA 4E1KA 4KPXA 5DEPA 2I5KA 3FTTA 3R5AA 1QREA 3R1WA 3HJJA 3EH0A 3R5BA 3BRKX 4H7OA 3I3AA 1HM0A 4M2AA 3OH0A 4R37A 3V4EA 4MFGA 4E6TA 3FOQA 1MRLA 1KRUA 1QQ0A 2JF3A 2VD4A 4KNRA 1HM9A 3TDTA 3R2WA 2QIVX 1KRRA 5DEMA 4M2BA 5ADXV 5AFUU 4AC3A 3KWDA 4EABA 1SSQA 4IHGA 2P2OA 4IHFA 1QRMA 3R0SA 1FXJA 4J18A 3T57A 3TIOA 3VBJA 4EA8A 3D98A 3DHOA 3IXCA 1Z2FA 4G3SA 3VBKA 4AA7A 4MZUA 3D8VA 3TISA 3BSSA 3FS8A 1SSMA 1EWWA 3DK5A 3P1BA 4R7PA 3GQAA 3SPTA 1N4IA 3OH1A 2IUAA 1J2ZA 1QRFA 3R5CA 3I3XA 4HZDA 5U2KA 2OEGA 3OW5A 2IU8A 3VBIA 2OEFA 3ST8A 4EA9A 2IU9A 1S80A 1LXAA 3C8VA 4G3PA 3SUCA 3TV0A 1YP3A 3R5DA 4MYOA 3OH4A 1QRLA 1KRVA 2OI7A 2V0HA 5L6SA 1HV9A 3KWCA 3OTZA 4N6AA 5DG3A 3SRTA 3R3IA 3FSCA 1HM8A 4E6UA 1V67A 1G95A 2WLEA 3BXYA 3MC4A 1XATA 3VBMA 1L0SA 3MQHA 3TWDA 3GQ9A 3OTMA 4R36A 4M99A 2IC7A 3VBLA 2WLDA 4HUSA 4J09A 3GQ7A 5L6VA 2XATA 4N6BA 4HZCA 2JF2A 4KQLA 2Q4JA 1Z90A 2V0JA 1XHDA 1KGTA 3IGJA 3FSXA 2V0LA
chains in the Genus database with same CATH topology
1KHRA 4M9CA 4HURA 3VNPA 2W0WA 4N69A 1YP4A 2GGOA 4E75A 3MQGA 1V3WA 4HCQA 3BFPA 2NPOA 4KPZA 5AFUV 4AAWA 1TDTA 2VHEA 4FCEA 4K6RA 3VBPA 3OU9A 2QKXA 2ICXA 3BSYA 4EGGA 3P47A 3PMOA 2WLGA 4M98A 1KK6A 5F42A 4EQYA 3CJ8A 3KWEA 1MR9A 5E3RA 1KK4A 3GUEA 1YP2A 3HSQA 4ISXA 3R3RA 1MR7A 1KK5A 4IHHA 3GVDA 3BSWA 5E3PA 1THJA 2WLFA 3GOSA 4N27A 2RIJA 3F1XA 3FSYA 4DCLA 1KGQA 4M28A 5E3QA 3EEVA 1SSTA 5ADXU 4G87A 2FKOA 3DJ4A 3ECTA 2W0VA 3OUPA 3VBNA 2TDTA 3FWWA 1G97A 1FWYA 2V0KA 1OCXA 3JQYA 4EAAA 3Q1XA 3R8YA 2GGQA 1KQAA 2OI6A 4E79A 2QIAA 1T3DA 2AQ9A 2ICYA 3FSBA 3EG4A 2OI5A 3TK8A 2WLCA 4KNXA 3NZ2A 4EA7A 1QRGA 2V0IA 4G3QA 4E1KA 4KPXA 5DEPA 2I5KA 3FTTA 3R5AA 1QREA 3R1WA 3HJJA 3EH0A 3R5BA 3BRKX 4H7OA 3I3AA 1HM0A 4M2AA 4R37A 3V4EA 4E6TA 4MFGA 3FOQA 1MRLA 1KRUA 1QQ0A 2VD4A 2JF3A 4KNRA 1HM9A 3TDTA 3R2WA 2QIVX 1KRRA 5DEMA 4M2BA 5ADXV 5AFUU 4AC3A 3KWDA 4EABA 1SSQA 4IHGA 2P2OA 4IHFA 1QRMA 3R0SA 1FXJA 4J18A 3T57A 3TIOA 3VBJA 4EA8A 3D98A 3DHOA 3IXCA 4G3SA 3VBKA 4AA7A 4MZUA 3D8VA 3TISA 3BSSA 3FS8A 1SSMA 3DK5A 3P1BA 4R7PA 3SPTA 2IUAA 1J2ZA 1QRFA 3R5CA 3I3XA 4HZDA 5U2KA 2OEGA 3OW5A 2IU8A 3VBIA 2OEFA 3ST8A 4EA9A 2IU9A 1S80A 1LXAA 3C8VA 4G3PA 3TV0A 1YP3A 3R5DA 4MYOA 1QRLA 1KRVA 2OI7A 2V0HA 5L6SA 1HV9A 3KWCA 3OTZA 4N6AA 5DG3A 3SRTA 3R3IA 3FSCA 1HM8A 4E6UA 1V67A 1G95A 2WLEA 3BXYA 3MC4A 1XATA 3VBMA 3MQHA 3TWDA 3OTMA 4R36A 4M99A 2IC7A 3VBLA 2WLDA 4HUSA 4J09A 5L6VA 2XATA 4N6BA 4HZCA 2JF2A 4KQLA 2Q4JA 1Z90A 2V0JA 1XHDA 1KGTA 3IGJA 3FSXA 2V0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KHR A;  4M9C A;  4HUR A;  3VNP A;  2W0W A;  4N69 A;  1YP4 A;  2GGO A;  4E75 A;  3MQG A;  1V3W A;  4HCQ A;  3BFP A;  2NPO A;  4KPZ A;  5AFU V;  4AAW A;  1TDT A;  2VHE A;  4FCE A;  4K6R A;  3VBP A;  3OU9 A;  2QKX A;  2ICX A;  3BSY A;  4EGG A;  3P47 A;  3PMO A;  2WLG A;  4M98 A;  1KK6 A;  5F42 A;  4EQY A;  3CJ8 A;  3KWE A;  1MR9 A;  5E3R A;  1KK4 A;  3GUE A;  1YP2 A;  3HSQ A;  4ISX A;  3R3R A;  1MR7 A;  1KK5 A;  4IHH A;  3GVD A;  3BSW A;  5E3P A;  1THJ A;  2WLF A;  3GOS A;  4N27 A;  2RIJ A;  3F1X A;  3FSY A;  4DCL A;  1KGQ A;  4M28 A;  5E3Q A;  3EEV A;  1SST A;  5ADX U;  4G87 A;  2FKO A;  3DJ4 A;  3ECT A;  2W0V A;  3OUP A;  3VBN A;  2TDT A;  3FWW A;  1G97 A;  1FWY A;  2V0K A;  1OCX A;  3JQY A;  4EAA A;  3Q1X A;  3R8Y A;  2GGQ A;  1KQA A;  2OI6 A;  4E79 A;  2QIA A;  1T3D A;  2AQ9 A;  2ICY A;  3FSB A;  3EG4 A;  2OI5 A;  3TK8 A;  2WLC A;  4KNX A;  3NZ2 A;  4EA7 A;  1QRG A;  2V0I A;  4G3Q A;  4E1K A;  4KPX A;  5DEP A;  2I5K A;  3FTT A;  3R5A A;  1QRE A;  3R1W A;  3HJJ A;  3EH0 A;  3R5B A;  3BRK X;  4H7O A;  3I3A A;  1HM0 A;  4M2A A;  4R37 A;  3V4E A;  4E6T A;  4MFG A;  3FOQ A;  1MRL A;  1KRU A;  1QQ0 A;  2VD4 A;  2JF3 A;  4KNR A;  1HM9 A;  3TDT A;  3R2W A;  2QIV X;  1KRR A;  5DEM A;  4M2B A;  5ADX V;  5AFU U;  4AC3 A;  3KWD A;  4EAB A;  1SSQ A;  4IHG A;  2P2O A;  4IHF A;  1QRM A;  3R0S A;  1FXJ A;  4J18 A;  3T57 A;  3TIO A;  3VBJ A;  4EA8 A;  3D98 A;  3DHO A;  3IXC A;  4G3S A;  3VBK A;  4AA7 A;  4MZU A;  3D8V A;  3TIS A;  3BSS A;  3FS8 A;  1SSM A;  3DK5 A;  3P1B A;  4R7P A;  3SPT A;  2IUA A;  1J2Z A;  1QRF A;  3R5C A;  3I3X A;  4HZD A;  5U2K A;  2OEG A;  3OW5 A;  2IU8 A;  3VBI A;  2OEF A;  3ST8 A;  4EA9 A;  2IU9 A;  1S80 A;  1LXA A;  3C8V A;  4G3P A;  3TV0 A;  1YP3 A;  3R5D A;  4MYO A;  1QRL A;  1KRV A;  2OI7 A;  2V0H A;  5L6S A;  1HV9 A;  3KWC A;  3OTZ A;  4N6A A;  5DG3 A;  3SRT A;  3R3I A;  3FSC A;  1HM8 A;  4E6U A;  1V67 A;  1G95 A;  2WLE A;  3BXY A;  3MC4 A;  1XAT A;  3VBM A;  3MQH A;  3TWD A;  3OTM A;  4R36 A;  4M99 A;  2IC7 A;  3VBL A;  2WLD A;  4HUS A;  4J09 A;  5L6V A;  2XAT A;  4N6B A;  4HZC A;  2JF2 A;  4KQL A;  2Q4J A;  1Z90 A;  2V0J A;  1XHD A;  1KGT A;  3IGJ A;  3FSX A;  2V0L A; 
#chains in the Genus database with same CATH topology
 1KHR A;  4M9C A;  4HUR A;  3VNP A;  2W0W A;  4N69 A;  1YP4 A;  2GGO A;  4E75 A;  3MQG A;  1V3W A;  4HCQ A;  3BFP A;  2NPO A;  4KPZ A;  5AFU V;  4AAW A;  1TDT A;  2VHE A;  4FCE A;  4K6R A;  3VBP A;  3OU9 A;  2QKX A;  2ICX A;  3BSY A;  3GQ8 A;  4EGG A;  3P47 A;  3PMO A;  2WLG A;  4M98 A;  1KK6 A;  5F42 A;  4EQY A;  3CJ8 A;  3KWE A;  1MR9 A;  5E3R A;  1KK4 A;  3GUE A;  1YP2 A;  3HSQ A;  4ISX A;  3OH2 A;  3R3R A;  1MR7 A;  1KK5 A;  4IHH A;  3GVD A;  3BSW A;  5E3P A;  1THJ A;  2WLF A;  3GOS A;  4N27 A;  2RIJ A;  3F1X A;  3FSY A;  4DCL A;  1KGQ A;  4M28 A;  5E3Q A;  3EEV A;  1SST A;  5ADX U;  4G87 A;  2FKO A;  3DJ4 A;  3ECT A;  2W0V A;  3OUP A;  3VBN A;  2TDT A;  3FWW A;  1G97 A;  1FWY A;  2V0K A;  1OCX A;  3JQY A;  4EAA A;  3Q1X A;  3R8Y A;  2GGQ A;  1KQA A;  1M8N A;  2OI6 A;  4E79 A;  2QIA A;  1T3D A;  2AQ9 A;  3OGZ A;  2ICY A;  3FSB A;  3OH3 A;  3EG4 A;  2OI5 A;  3TK8 A;  2WLC A;  4KNX A;  3NZ2 A;  4EA7 A;  1QRG A;  2V0I A;  4G3Q A;  4E1K A;  4KPX A;  5DEP A;  2I5K A;  3FTT A;  3R5A A;  1QRE A;  3R1W A;  3HJJ A;  3EH0 A;  3R5B A;  3BRK X;  4H7O A;  3I3A A;  1HM0 A;  4M2A A;  3OH0 A;  4R37 A;  3V4E A;  4MFG A;  4E6T A;  3FOQ A;  1MRL A;  1KRU A;  1QQ0 A;  2JF3 A;  2VD4 A;  4KNR A;  1HM9 A;  3TDT A;  3R2W A;  2QIV X;  1KRR A;  5DEM A;  4M2B A;  5ADX V;  5AFU U;  4AC3 A;  3KWD A;  4EAB A;  1SSQ A;  4IHG A;  2P2O A;  4IHF A;  1QRM A;  3R0S A;  1FXJ A;  4J18 A;  3T57 A;  3TIO A;  3VBJ A;  4EA8 A;  3D98 A;  3DHO A;  3IXC A;  1Z2F A;  4G3S A;  3VBK A;  4AA7 A;  4MZU A;  3D8V A;  3TIS A;  3BSS A;  3FS8 A;  1SSM A;  1EWW A;  3DK5 A;  3P1B A;  4R7P A;  3GQA A;  3SPT A;  1N4I A;  3OH1 A;  2IUA A;  1J2Z A;  1QRF A;  3R5C A;  3I3X A;  4HZD A;  5U2K A;  2OEG A;  3OW5 A;  2IU8 A;  3VBI A;  2OEF A;  3ST8 A;  4EA9 A;  2IU9 A;  1S80 A;  1LXA A;  3C8V A;  4G3P A;  3SUC A;  3TV0 A;  1YP3 A;  3R5D A;  4MYO A;  3OH4 A;  1QRL A;  1KRV A;  2OI7 A;  2V0H A;  5L6S A;  1HV9 A;  3KWC A;  3OTZ A;  4N6A A;  5DG3 A;  3SRT A;  3R3I A;  3FSC A;  1HM8 A;  4E6U A;  1V67 A;  1G95 A;  2WLE A;  3BXY A;  3MC4 A;  1XAT A;  3VBM A;  1L0S A;  3MQH A;  3TWD A;  3GQ9 A;  3OTM A;  4R36 A;  4M99 A;  2IC7 A;  3VBL A;  2WLD A;  4HUS A;  4J09 A;  3GQ7 A;  5L6V A;  2XAT A;  4N6B A;  4HZC A;  2JF2 A;  4KQL A;  2Q4J A;  1Z90 A;  2V0J A;  1XHD A;  1KGT A;  3IGJ A;  3FSX A;  2V0L A; 
#chains in the Genus database with same CATH homology
 1KHR A;  4M9C A;  4HUR A;  3VNP A;  2W0W A;  4N69 A;  1YP4 A;  2GGO A;  4E75 A;  3MQG A;  1V3W A;  4HCQ A;  3BFP A;  2NPO A;  4KPZ A;  5AFU V;  4AAW A;  1TDT A;  2VHE A;  4FCE A;  4K6R A;  3VBP A;  3OU9 A;  2QKX A;  2ICX A;  3BSY A;  4EGG A;  3P47 A;  3PMO A;  2WLG A;  4M98 A;  1KK6 A;  5F42 A;  4EQY A;  3CJ8 A;  3KWE A;  1MR9 A;  5E3R A;  1KK4 A;  3GUE A;  1YP2 A;  3HSQ A;  4ISX A;  3R3R A;  1MR7 A;  1KK5 A;  4IHH A;  3GVD A;  3BSW A;  5E3P A;  1THJ A;  2WLF A;  3GOS A;  4N27 A;  2RIJ A;  3F1X A;  3FSY A;  4DCL A;  1KGQ A;  4M28 A;  5E3Q A;  3EEV A;  1SST A;  5ADX U;  4G87 A;  2FKO A;  3DJ4 A;  3ECT A;  2W0V A;  3OUP A;  3VBN A;  2TDT A;  3FWW A;  1G97 A;  1FWY A;  2V0K A;  1OCX A;  3JQY A;  4EAA A;  3Q1X A;  3R8Y A;  2GGQ A;  1KQA A;  2OI6 A;  4E79 A;  2QIA A;  1T3D A;  2AQ9 A;  2ICY A;  3FSB A;  3EG4 A;  2OI5 A;  3TK8 A;  2WLC A;  4KNX A;  3NZ2 A;  4EA7 A;  1QRG A;  2V0I A;  4G3Q A;  4E1K A;  4KPX A;  5DEP A;  2I5K A;  3FTT A;  3R5A A;  1QRE A;  3R1W A;  3HJJ A;  3EH0 A;  3R5B A;  3BRK X;  4H7O A;  3I3A A;  1HM0 A;  4M2A A;  4R37 A;  3V4E A;  4E6T A;  4MFG A;  3FOQ A;  1MRL A;  1KRU A;  1QQ0 A;  2VD4 A;  2JF3 A;  4KNR A;  1HM9 A;  3TDT A;  3R2W A;  2QIV X;  1KRR A;  5DEM A;  4M2B A;  5ADX V;  5AFU U;  4AC3 A;  3KWD A;  4EAB A;  1SSQ A;  4IHG A;  2P2O A;  4IHF A;  1QRM A;  3R0S A;  1FXJ A;  4J18 A;  3T57 A;  3TIO A;  3VBJ A;  4EA8 A;  3D98 A;  3DHO A;  3IXC A;  4G3S A;  3VBK A;  4AA7 A;  4MZU A;  3D8V A;  3TIS A;  3BSS A;  3FS8 A;  1SSM A;  3DK5 A;  3P1B A;  4R7P A;  3SPT A;  2IUA A;  1J2Z A;  1QRF A;  3R5C A;  3I3X A;  4HZD A;  5U2K A;  2OEG A;  3OW5 A;  2IU8 A;  3VBI A;  2OEF A;  3ST8 A;  4EA9 A;  2IU9 A;  1S80 A;  1LXA A;  3C8V A;  4G3P A;  3TV0 A;  1YP3 A;  3R5D A;  4MYO A;  1QRL A;  1KRV A;  2OI7 A;  2V0H A;  5L6S A;  1HV9 A;  3KWC A;  3OTZ A;  4N6A A;  5DG3 A;  3SRT A;  3R3I A;  3FSC A;  1HM8 A;  4E6U A;  1V67 A;  1G95 A;  2WLE A;  3BXY A;  3MC4 A;  1XAT A;  3VBM A;  3MQH A;  3TWD A;  3OTM A;  4R36 A;  4M99 A;  2IC7 A;  3VBL A;  2WLD A;  4HUS A;  4J09 A;  5L6V A;  2XAT A;  4N6B A;  4HZC A;  2JF2 A;  4KQL A;  2Q4J A;  1Z90 A;  2V0J A;  1XHD A;  1KGT A;  3IGJ A;  3FSX A;  2V0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...