3OTZA

Crystal structure of gamma-carbonic anhydrase w19a mutant from metanosarcina thermophila
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
205
structure length
205
Chain Sequence
SNIRENPVTPANPEPSAPVIDPTAYIDPQASVIGEVTIGANVMVSPMASIRSDEGMPIFVGDRSNVQDGVVLHALETINEEGEPIEDNIVEVDGKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFKSKVGNNCVLEPRSAAIGVTIPDGRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYVNVHLAEGYKETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Carbonic anhydrase
publication title Crystal structure of gamma-carbonic anhydrase W19A mutant from Metanosarcina thermophila
rcsb
source organism Methanosarcina thermophila
total genus 70
structure length 205
sequence length 205
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3otzA00
3JQYA 1XHDA 3OTMA 1KRVA 4M28A 3ST8A 4ISXA 1QRMA 2JF3A 1HM0A 2P2OA 3FWWA 3TISA 3FTTA 1MRLA 2V0IA 4HCQA 4MZUA 2TDTA 4N27A 2QIVX 4KNRA 3FS8A 4HUSA 1KK4A 3HJJA 2IC7A 1KRRA 4EA8A 3VBMA 1KQAA 3MQHA 3KWCA 4M2AA 3DJ4A 4K6RA 3I3XA 2IUAA 2OEFA 4M2BA 2V0HA 2WLDA 4EGGA 2OI5A 2GGOA 2ICXA 4AC3A 3CJ8A 3R8YA 3F1XA 4EA9A 4G87A 4IHHA 4E75A 2XATA 4HZCA 4KPZA 4R37A 1T3DA 4R36A 4N6AA 4EABA 1QRFA 4DCLA 3FSCA 2JF2A 3MQGA 1MR9A 1V3WA 1SSTA 3DK5A 2OI6A 3SRTA 4N6BA 5DEPA 3VNPA 3EG4A 3FSXA 5L6SA 3OUPA 4FCEA 1SSQA 5DEMA 3KWEA 3IGJA 2OI7A 3GVDA 1KRUA 2V0JA 3FOQA 4AAWA 1KK6A 3R3RA 4G3PA 3HSQA 3EEVA 3C8VA 3MC4A 3OU9A 4KNXA 3VBNA 4KPXA 5ADXV 2V0LA 4M99A 4R7PA 1J2ZA 2WLCA 3BRKX 2Q4JA 2WLFA 3D98A 1S80A 2VD4A 3R5DA 3TDTA 1YP3A 3TK8A 5L6VA 3R5BA 5DG3A 3I3AA 4G3QA 4M98A 1KHRA 3PMOA 4IHGA 1MR7A 4AA7A 4EQYA 3BFPA 4EAAA 4IHFA 3VBJA 3T57A 1QREA 3R1WA 1G95A 1KK5A 1SSMA 2ICYA 3BSYA 5AFUV 1HM9A 2NPOA 3SPTA 4J18A 5E3PA 1XATA 3DHOA 4MFGA 2W0WA 3GOSA 3R5CA 3R3IA 4H7OA 4N69A 4E1KA 3P47A 3VBPA 5F42A 3P1BA 5E3QA 1KGTA 2I5KA 3OTZA 3FSYA 2RIJA 1Z90A 3BXYA 4J09A 4E6UA 3BSSA 4M9CA 2IU9A 2IU8A 4EA7A 3ECTA 3NZ2A 3VBIA 5E3RA 3TV0A 1YP2A 2VHEA 1OCXA 1QQ0A 3Q1XA 4KQLA 3D8VA 4E79A 3BSWA 2W0VA 1QRGA 1FXJA 1KGQA 1YP4A 1HV9A 1QRLA 1V67A 3EH0A 3R0SA 3R2WA 3R5AA 2OEGA 2QIAA 2WLEA 5AFUU 2FKOA 4E6TA 3IXCA 2QKXA 3GUEA 4HZDA 3OW5A 3TWDA 2WLGA 2GGQA 3VBKA 1FWYA 5ADXU 4G3SA 3TIOA 1LXAA 4MYOA 2V0KA 1G97A 5U2KA 3VBLA 1THJA 3FSBA 4HURA 3V4EA 1HM8A 3KWDA 2AQ9A 1TDTA
chains in the Genus database with same CATH superfamily
3JQYA 1XHDA 3OTMA 1KRVA 4M28A 3ST8A 4ISXA 1QRMA 2JF3A 1HM0A 2P2OA 3FWWA 3TISA 1EWWA 3FTTA 1MRLA 2V0IA 4HCQA 4MZUA 2TDTA 4N27A 2QIVX 4KNRA 3GQ8A 3FS8A 4HUSA 1KK4A 3HJJA 2IC7A 1KRRA 4EA8A 3VBMA 1KQAA 3MQHA 3KWCA 4M2AA 3DJ4A 4K6RA 3GQAA 3I3XA 2IUAA 2OEFA 4M2BA 2V0HA 2WLDA 4EGGA 2OI5A 2GGOA 2ICXA 4AC3A 3CJ8A 3R8YA 3F1XA 4EA9A 4G87A 4IHHA 4E75A 2XATA 4HZCA 4KPZA 4R37A 1T3DA 4R36A 1L0SA 4N6AA 4EABA 1QRFA 4DCLA 3FSCA 2JF2A 3MQGA 1MR9A 1V3WA 1SSTA 3DK5A 2OI6A 3SRTA 4N6BA 5DEPA 3VNPA 3EG4A 3FSXA 5L6SA 3OUPA 3OH1A 1SSQA 4FCEA 5DEMA 3KWEA 3IGJA 3SUCA 2OI7A 3GVDA 1KRUA 2V0JA 3FOQA 4AAWA 1KK6A 3R3RA 4G3PA 3HSQA 3EEVA 3C8VA 3MC4A 3OU9A 4KNXA 3VBNA 4KPXA 5ADXV 2V0LA 4M99A 1M8NA 1J2ZA 4R7PA 2WLCA 3BRKX 2Q4JA 2WLFA 3D98A 1S80A 2VD4A 3R5DA 3TDTA 1YP3A 3TK8A 5L6VA 3R5BA 5DG3A 3I3AA 4G3QA 4M98A 1KHRA 3PMOA 4IHGA 1MR7A 4AA7A 4EQYA 3BFPA 4EAAA 1Z2FA 4IHFA 3VBJA 3T57A 3OH4A 1QREA 3R1WA 3OH3A 1G95A 1KK5A 1SSMA 2ICYA 3BSYA 5AFUV 1HM9A 2NPOA 3GQ7A 3SPTA 4J18A 5E3PA 1XATA 3DHOA 4MFGA 2W0WA 3GOSA 3R5CA 3R3IA 4H7OA 4N69A 4E1KA 3P47A 3VBPA 5F42A 3P1BA 3OGZA 5E3QA 1KGTA 2I5KA 3OTZA 3FSYA 2RIJA 1Z90A 3BXYA 4J09A 4E6UA 3BSSA 4M9CA 2IU9A 2IU8A 4EA7A 3ECTA 3NZ2A 3VBIA 5E3RA 3TV0A 1YP2A 2VHEA 1OCXA 1QQ0A 3Q1XA 4KQLA 3D8VA 4E79A 3BSWA 2W0VA 1QRGA 1FXJA 1KGQA 1YP4A 3OH2A 1HV9A 1N4IA 1QRLA 1V67A 3EH0A 3R0SA 3R2WA 3R5AA 2OEGA 2QIAA 2WLEA 5AFUU 2FKOA 4E6TA 3IXCA 2QKXA 3GUEA 4HZDA 3OW5A 3TWDA 2WLGA 2GGQA 3OH0A 3VBKA 1FWYA 5ADXU 4G3SA 3TIOA 1LXAA 4MYOA 2V0KA 1G97A 5U2KA 3VBLA 3GQ9A 1THJA 3FSBA 4HURA 3V4EA 1HM8A 3KWDA 2AQ9A 1TDTA
chains in the Genus database with same CATH topology
3JQYA 1XHDA 3OTMA 1KRVA 4M28A 3ST8A 4ISXA 1QRMA 2JF3A 1HM0A 2P2OA 3FWWA 3TISA 3FTTA 1MRLA 2V0IA 4HCQA 4MZUA 2TDTA 4N27A 2QIVX 4KNRA 3FS8A 4HUSA 1KK4A 3HJJA 2IC7A 1KRRA 4EA8A 3VBMA 1KQAA 3MQHA 3KWCA 4M2AA 3DJ4A 4K6RA 3I3XA 2IUAA 2OEFA 4M2BA 2V0HA 2WLDA 4EGGA 2OI5A 2GGOA 2ICXA 4AC3A 3CJ8A 3R8YA 3F1XA 4EA9A 4G87A 4IHHA 4E75A 2XATA 4HZCA 4KPZA 4R37A 1T3DA 4R36A 4N6AA 4EABA 1QRFA 4DCLA 3FSCA 2JF2A 3MQGA 1MR9A 1V3WA 1SSTA 3DK5A 2OI6A 3SRTA 4N6BA 5DEPA 3VNPA 3EG4A 3FSXA 5L6SA 3OUPA 4FCEA 1SSQA 5DEMA 3KWEA 3IGJA 2OI7A 3GVDA 1KRUA 2V0JA 3FOQA 4AAWA 1KK6A 3R3RA 4G3PA 3HSQA 3EEVA 3C8VA 3MC4A 3OU9A 4KNXA 3VBNA 4KPXA 5ADXV 2V0LA 4M99A 4R7PA 1J2ZA 2WLCA 3BRKX 2Q4JA 2WLFA 3D98A 1S80A 2VD4A 3R5DA 3TDTA 1YP3A 3TK8A 5L6VA 3R5BA 5DG3A 3I3AA 4G3QA 4M98A 1KHRA 3PMOA 4IHGA 1MR7A 4AA7A 4EQYA 3BFPA 4EAAA 4IHFA 3VBJA 3T57A 1QREA 3R1WA 1G95A 1KK5A 1SSMA 2ICYA 3BSYA 5AFUV 1HM9A 2NPOA 3SPTA 4J18A 5E3PA 1XATA 3DHOA 4MFGA 2W0WA 3GOSA 3R5CA 3R3IA 4H7OA 4N69A 4E1KA 3P47A 3VBPA 5F42A 3P1BA 5E3QA 1KGTA 2I5KA 3OTZA 3FSYA 2RIJA 1Z90A 3BXYA 4J09A 4E6UA 3BSSA 4M9CA 2IU9A 2IU8A 4EA7A 3ECTA 3NZ2A 3VBIA 5E3RA 3TV0A 1YP2A 2VHEA 1OCXA 1QQ0A 3Q1XA 4KQLA 3D8VA 4E79A 3BSWA 2W0VA 1QRGA 1FXJA 1KGQA 1YP4A 1HV9A 1QRLA 1V67A 3EH0A 3R0SA 3R2WA 3R5AA 2OEGA 2QIAA 2WLEA 5AFUU 2FKOA 4E6TA 3IXCA 2QKXA 3GUEA 4HZDA 3OW5A 3TWDA 2WLGA 2GGQA 3VBKA 1FWYA 5ADXU 4G3SA 3TIOA 1LXAA 4MYOA 2V0KA 1G97A 5U2KA 3VBLA 1THJA 3FSBA 4HURA 3V4EA 1HM8A 3KWDA 2AQ9A 1TDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JQY A;  1XHD A;  3OTM A;  1KRV A;  4M28 A;  3ST8 A;  4ISX A;  1QRM A;  2JF3 A;  1HM0 A;  2P2O A;  3FWW A;  3TIS A;  3FTT A;  1MRL A;  2V0I A;  4HCQ A;  4MZU A;  2TDT A;  4N27 A;  2QIV X;  4KNR A;  3FS8 A;  4HUS A;  1KK4 A;  3HJJ A;  2IC7 A;  1KRR A;  4EA8 A;  3VBM A;  1KQA A;  3MQH A;  3KWC A;  4M2A A;  3DJ4 A;  4K6R A;  3I3X A;  2IUA A;  2OEF A;  4M2B A;  2V0H A;  2WLD A;  4EGG A;  2OI5 A;  2GGO A;  2ICX A;  4AC3 A;  3CJ8 A;  3R8Y A;  3F1X A;  4EA9 A;  4G87 A;  4IHH A;  4E75 A;  2XAT A;  4HZC A;  4KPZ A;  4R37 A;  1T3D A;  4R36 A;  4N6A A;  4EAB A;  1QRF A;  4DCL A;  3FSC A;  2JF2 A;  3MQG A;  1MR9 A;  1V3W A;  1SST A;  3DK5 A;  2OI6 A;  3SRT A;  4N6B A;  5DEP A;  3VNP A;  3EG4 A;  3FSX A;  5L6S A;  3OUP A;  4FCE A;  1SSQ A;  5DEM A;  3KWE A;  3IGJ A;  2OI7 A;  3GVD A;  1KRU A;  2V0J A;  3FOQ A;  4AAW A;  1KK6 A;  3R3R A;  4G3P A;  3HSQ A;  3EEV A;  3C8V A;  3MC4 A;  3OU9 A;  4KNX A;  3VBN A;  4KPX A;  5ADX V;  2V0L A;  4M99 A;  4R7P A;  1J2Z A;  2WLC A;  3BRK X;  2Q4J A;  2WLF A;  3D98 A;  1S80 A;  2VD4 A;  3R5D A;  3TDT A;  1YP3 A;  3TK8 A;  5L6V A;  3R5B A;  5DG3 A;  3I3A A;  4G3Q A;  4M98 A;  1KHR A;  3PMO A;  4IHG A;  1MR7 A;  4AA7 A;  4EQY A;  3BFP A;  4EAA A;  4IHF A;  3VBJ A;  3T57 A;  1QRE A;  3R1W A;  1G95 A;  1KK5 A;  1SSM A;  2ICY A;  3BSY A;  5AFU V;  1HM9 A;  2NPO A;  3SPT A;  4J18 A;  5E3P A;  1XAT A;  3DHO A;  4MFG A;  2W0W A;  3GOS A;  3R5C A;  3R3I A;  4H7O A;  4N69 A;  4E1K A;  3P47 A;  3VBP A;  5F42 A;  3P1B A;  5E3Q A;  1KGT A;  2I5K A;  3OTZ A;  3FSY A;  2RIJ A;  1Z90 A;  3BXY A;  4J09 A;  4E6U A;  3BSS A;  4M9C A;  2IU9 A;  2IU8 A;  4EA7 A;  3ECT A;  3NZ2 A;  3VBI A;  5E3R A;  3TV0 A;  1YP2 A;  2VHE A;  1OCX A;  1QQ0 A;  3Q1X A;  4KQL A;  3D8V A;  4E79 A;  3BSW A;  2W0V A;  1QRG A;  1FXJ A;  1KGQ A;  1YP4 A;  1HV9 A;  1QRL A;  1V67 A;  3EH0 A;  3R0S A;  3R2W A;  3R5A A;  2OEG A;  2QIA A;  2WLE A;  5AFU U;  2FKO A;  4E6T A;  3IXC A;  2QKX A;  3GUE A;  4HZD A;  3OW5 A;  3TWD A;  2WLG A;  2GGQ A;  3VBK A;  1FWY A;  5ADX U;  4G3S A;  3TIO A;  1LXA A;  4MYO A;  2V0K A;  1G97 A;  5U2K A;  3VBL A;  1THJ A;  3FSB A;  4HUR A;  3V4E A;  1HM8 A;  3KWD A;  2AQ9 A;  1TDT A; 
#chains in the Genus database with same CATH topology
 3JQY A;  1XHD A;  3OTM A;  1KRV A;  4M28 A;  3ST8 A;  4ISX A;  1QRM A;  2JF3 A;  1HM0 A;  2P2O A;  3FWW A;  3TIS A;  1EWW A;  3FTT A;  1MRL A;  2V0I A;  4HCQ A;  4MZU A;  2TDT A;  4N27 A;  2QIV X;  4KNR A;  3GQ8 A;  3FS8 A;  4HUS A;  1KK4 A;  3HJJ A;  2IC7 A;  1KRR A;  4EA8 A;  3VBM A;  1KQA A;  3MQH A;  3KWC A;  4M2A A;  3DJ4 A;  4K6R A;  3GQA A;  3I3X A;  2IUA A;  2OEF A;  4M2B A;  2V0H A;  2WLD A;  4EGG A;  2OI5 A;  2GGO A;  2ICX A;  4AC3 A;  3CJ8 A;  3R8Y A;  3F1X A;  4EA9 A;  4G87 A;  4IHH A;  4E75 A;  2XAT A;  4HZC A;  4KPZ A;  4R37 A;  1T3D A;  4R36 A;  1L0S A;  4N6A A;  4EAB A;  1QRF A;  4DCL A;  3FSC A;  2JF2 A;  3MQG A;  1MR9 A;  1V3W A;  1SST A;  3DK5 A;  2OI6 A;  3SRT A;  4N6B A;  5DEP A;  3VNP A;  3EG4 A;  3FSX A;  5L6S A;  3OUP A;  3OH1 A;  1SSQ A;  4FCE A;  5DEM A;  3KWE A;  3IGJ A;  3SUC A;  2OI7 A;  3GVD A;  1KRU A;  2V0J A;  3FOQ A;  4AAW A;  1KK6 A;  3R3R A;  4G3P A;  3HSQ A;  3EEV A;  3C8V A;  3MC4 A;  3OU9 A;  4KNX A;  3VBN A;  4KPX A;  5ADX V;  2V0L A;  4M99 A;  1M8N A;  1J2Z A;  4R7P A;  2WLC A;  3BRK X;  2Q4J A;  2WLF A;  3D98 A;  1S80 A;  2VD4 A;  3R5D A;  3TDT A;  1YP3 A;  3TK8 A;  5L6V A;  3R5B A;  5DG3 A;  3I3A A;  4G3Q A;  4M98 A;  1KHR A;  3PMO A;  4IHG A;  1MR7 A;  4AA7 A;  4EQY A;  3BFP A;  4EAA A;  1Z2F A;  4IHF A;  3VBJ A;  3T57 A;  3OH4 A;  1QRE A;  3R1W A;  3OH3 A;  1G95 A;  1KK5 A;  1SSM A;  2ICY A;  3BSY A;  5AFU V;  1HM9 A;  2NPO A;  3GQ7 A;  3SPT A;  4J18 A;  5E3P A;  1XAT A;  3DHO A;  4MFG A;  2W0W A;  3GOS A;  3R5C A;  3R3I A;  4H7O A;  4N69 A;  4E1K A;  3P47 A;  3VBP A;  5F42 A;  3P1B A;  3OGZ A;  5E3Q A;  1KGT A;  2I5K A;  3OTZ A;  3FSY A;  2RIJ A;  1Z90 A;  3BXY A;  4J09 A;  4E6U A;  3BSS A;  4M9C A;  2IU9 A;  2IU8 A;  4EA7 A;  3ECT A;  3NZ2 A;  3VBI A;  5E3R A;  3TV0 A;  1YP2 A;  2VHE A;  1OCX A;  1QQ0 A;  3Q1X A;  4KQL A;  3D8V A;  4E79 A;  3BSW A;  2W0V A;  1QRG A;  1FXJ A;  1KGQ A;  1YP4 A;  3OH2 A;  1HV9 A;  1N4I A;  1QRL A;  1V67 A;  3EH0 A;  3R0S A;  3R2W A;  3R5A A;  2OEG A;  2QIA A;  2WLE A;  5AFU U;  2FKO A;  4E6T A;  3IXC A;  2QKX A;  3GUE A;  4HZD A;  3OW5 A;  3TWD A;  2WLG A;  2GGQ A;  3OH0 A;  3VBK A;  1FWY A;  5ADX U;  4G3S A;  3TIO A;  1LXA A;  4MYO A;  2V0K A;  1G97 A;  5U2K A;  3VBL A;  3GQ9 A;  1THJ A;  3FSB A;  4HUR A;  3V4E A;  1HM8 A;  3KWD A;  2AQ9 A;  1TDT A; 
#chains in the Genus database with same CATH homology
 3JQY A;  1XHD A;  3OTM A;  1KRV A;  4M28 A;  3ST8 A;  4ISX A;  1QRM A;  2JF3 A;  1HM0 A;  2P2O A;  3FWW A;  3TIS A;  3FTT A;  1MRL A;  2V0I A;  4HCQ A;  4MZU A;  2TDT A;  4N27 A;  2QIV X;  4KNR A;  3FS8 A;  4HUS A;  1KK4 A;  3HJJ A;  2IC7 A;  1KRR A;  4EA8 A;  3VBM A;  1KQA A;  3MQH A;  3KWC A;  4M2A A;  3DJ4 A;  4K6R A;  3I3X A;  2IUA A;  2OEF A;  4M2B A;  2V0H A;  2WLD A;  4EGG A;  2OI5 A;  2GGO A;  2ICX A;  4AC3 A;  3CJ8 A;  3R8Y A;  3F1X A;  4EA9 A;  4G87 A;  4IHH A;  4E75 A;  2XAT A;  4HZC A;  4KPZ A;  4R37 A;  1T3D A;  4R36 A;  4N6A A;  4EAB A;  1QRF A;  4DCL A;  3FSC A;  2JF2 A;  3MQG A;  1MR9 A;  1V3W A;  1SST A;  3DK5 A;  2OI6 A;  3SRT A;  4N6B A;  5DEP A;  3VNP A;  3EG4 A;  3FSX A;  5L6S A;  3OUP A;  4FCE A;  1SSQ A;  5DEM A;  3KWE A;  3IGJ A;  2OI7 A;  3GVD A;  1KRU A;  2V0J A;  3FOQ A;  4AAW A;  1KK6 A;  3R3R A;  4G3P A;  3HSQ A;  3EEV A;  3C8V A;  3MC4 A;  3OU9 A;  4KNX A;  3VBN A;  4KPX A;  5ADX V;  2V0L A;  4M99 A;  4R7P A;  1J2Z A;  2WLC A;  3BRK X;  2Q4J A;  2WLF A;  3D98 A;  1S80 A;  2VD4 A;  3R5D A;  3TDT A;  1YP3 A;  3TK8 A;  5L6V A;  3R5B A;  5DG3 A;  3I3A A;  4G3Q A;  4M98 A;  1KHR A;  3PMO A;  4IHG A;  1MR7 A;  4AA7 A;  4EQY A;  3BFP A;  4EAA A;  4IHF A;  3VBJ A;  3T57 A;  1QRE A;  3R1W A;  1G95 A;  1KK5 A;  1SSM A;  2ICY A;  3BSY A;  5AFU V;  1HM9 A;  2NPO A;  3SPT A;  4J18 A;  5E3P A;  1XAT A;  3DHO A;  4MFG A;  2W0W A;  3GOS A;  3R5C A;  3R3I A;  4H7O A;  4N69 A;  4E1K A;  3P47 A;  3VBP A;  5F42 A;  3P1B A;  5E3Q A;  1KGT A;  2I5K A;  3OTZ A;  3FSY A;  2RIJ A;  1Z90 A;  3BXY A;  4J09 A;  4E6U A;  3BSS A;  4M9C A;  2IU9 A;  2IU8 A;  4EA7 A;  3ECT A;  3NZ2 A;  3VBI A;  5E3R A;  3TV0 A;  1YP2 A;  2VHE A;  1OCX A;  1QQ0 A;  3Q1X A;  4KQL A;  3D8V A;  4E79 A;  3BSW A;  2W0V A;  1QRG A;  1FXJ A;  1KGQ A;  1YP4 A;  1HV9 A;  1QRL A;  1V67 A;  3EH0 A;  3R0S A;  3R2W A;  3R5A A;  2OEG A;  2QIA A;  2WLE A;  5AFU U;  2FKO A;  4E6T A;  3IXC A;  2QKX A;  3GUE A;  4HZD A;  3OW5 A;  3TWD A;  2WLG A;  2GGQ A;  3VBK A;  1FWY A;  5ADX U;  4G3S A;  3TIO A;  1LXA A;  4MYO A;  2V0K A;  1G97 A;  5U2K A;  3VBL A;  1THJ A;  3FSB A;  4HUR A;  3V4E A;  1HM8 A;  3KWD A;  2AQ9 A;  1TDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...