2P2OA

Crystal structure of maltose transacetylase from geobacillus kaustophilus p2(1) crystal form
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
184
structure length
184
Chain Sequence
KSEKEKMLAGHLYNPADLELVKERERARRLVRLYNETLETEYDKRTGLLKELFGSTGERLFIEPNFRCDYGYNIHVGENFFMNFDGVILDVCEVRIGDHCFIGPGVHIYTATHPLDPHERNSGLEYGKPVVIGHNVWIGGRAVINPGVTIGDNAVIASGAVVTKDVPANAVVGGNPAKVIKWLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Maltose transacetylase
publication title Crystal Structure of Maltose Transacetylase from Geobacillus Kaustophilus at 1.8 Angstrom Resolution
rcsb
source organism Geobacillus kaustophilus
total genus 63
structure length 184
sequence length 184
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.79: Maltose O-acetyltransferase.
pdb deposition date 2007-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12464 Mac Maltose acetyltransferase
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 2p2oA00
2ICXA 1G97A 1KQAA 4M28A 4E75A 3R5AA 1S80A 2WLDA 1YP3A 2WLEA 3DJ4A 1SSQA 2WLGA 3V4EA 3I3AA 3MQHA 4R7PA 2W0VA 5ADXU 2Q4JA 3IXCA 3P1BA 4HZDA 4J18A 3BFPA 4M99A 3I3XA 4N6AA 3BSYA 4M2AA 1QRMA 2GGOA 1Z90A 5DEPA 4EA8A 4E1KA 1V3WA 1FXJA 4R36A 3EEVA 1KK6A 3IGJA 3VBLA 4E6UA 1G95A 1YP2A 2VHEA 4KQLA 1TDTA 3R0SA 3R5CA 1KGQA 3BXYA 4J09A 4N27A 3ECTA 2P2OA 3D8VA 2QKXA 3R8YA 3VBJA 4KPZA 3Q1XA 2IC7A 4DCLA 4EQYA 4FCEA 3DHOA 1KK4A 3FWWA 3FTTA 2V0IA 4G3QA 1HM0A 3D98A 3SRTA 5U2KA 3KWEA 2OEFA 2I5KA 3GVDA 3R2WA 1QRFA 1LXAA 1KRRA 1KHRA 2AQ9A 1HM9A 3EG4A 4AAWA 1MR9A 2IUAA 2JF3A 4G87A 4N69A 3KWCA 1XHDA 2OI6A 1KRUA 3DK5A 3TK8A 1KGTA 2WLFA 3OU9A 4G3SA 5L6SA 1OCXA 2RIJA 4G3PA 4E79A 5AFUU 4EA9A 3PMOA 1QQ0A 4IHFA 5E3QA 3VBMA 1QRLA 2OI5A 4HZCA 4MYOA 5E3RA 3VBNA 3FSXA 3OTZA 3R5BA 4AC3A 3GOSA 4EA7A 3TV0A 2W0WA 3TIOA 1KK5A 3SPTA 3P47A 4MZUA 1QRGA 3FSYA 4HUSA 4EABA 3FOQA 5ADXV 4IHGA 2FKOA 2XATA 3EH0A 3GUEA 3R5DA 3HJJA 4KPXA 4MFGA 3F1XA 1SSMA 1MRLA 3R1WA 4K6RA 3NZ2A 3HSQA 2WLCA 3TWDA 3BRKX 3FSBA 1HV9A 4KNRA 4M2BA 1XATA 4EAAA 2OI7A 3VNPA 5E3PA 2V0KA 4AA7A 1QREA 2IU9A 2V0JA 3TDTA 3KWDA 1MR7A 1THJA 3OUPA 4IHHA 4H7OA 1HM8A 3TISA 3VBKA 2ICYA 1V67A 2JF2A 2GGQA 3OTMA 4HCQA 5DG3A 3ST8A 2TDTA 4ISXA 3FS8A 3T57A 1YP4A 5DEMA 5F42A 3R3IA 3BSWA 1KRVA 3OW5A 4M9CA 2QIAA 3MQGA 1FWYA 1SSTA 4N6BA 2V0LA 3FSCA 1T3DA 2V0HA 3CJ8A 3C8VA 2NPOA 4R37A 3R3RA 2IU8A 3BSSA 5AFUV 5L6VA 4EGGA 3MC4A 4M98A 3JQYA 3VBIA 3VBPA 2OEGA 4E6TA 1J2ZA 2VD4A 4HURA 2QIVX 4KNXA
chains in the Genus database with same CATH superfamily
2ICXA 1G97A 1KQAA 4M28A 4E75A 3R5AA 1S80A 2WLDA 1YP3A 2WLEA 3OH0A 3DJ4A 1SSQA 2WLGA 3V4EA 3I3AA 3MQHA 4R7PA 2W0VA 5ADXU 2Q4JA 3IXCA 3P1BA 1Z2FA 4HZDA 4J18A 3BFPA 4M99A 3GQAA 3I3XA 3BSYA 4N6AA 4M2AA 1QRMA 2GGOA 1Z90A 3GQ9A 5DEPA 4EA8A 4E1KA 1V3WA 1FXJA 4R36A 1L0SA 1KK6A 3EEVA 3IGJA 3VBLA 1G95A 1YP2A 2VHEA 4KQLA 1TDTA 3R0SA 3R5CA 1KGQA 3BXYA 4J09A 4N27A 3ECTA 2P2OA 3D8VA 2QKXA 3R8YA 3VBJA 4KPZA 3Q1XA 2IC7A 4DCLA 4EQYA 3OH2A 4FCEA 4E6UA 3DHOA 1KK4A 3FWWA 3FTTA 2V0IA 4G3QA 1EWWA 1HM0A 3D98A 3SRTA 5U2KA 3KWEA 2OEFA 2I5KA 3GVDA 3R2WA 1QRFA 1KRRA 1LXAA 1KHRA 2AQ9A 1HM9A 1M8NA 3EG4A 4AAWA 1MR9A 2IUAA 2JF3A 4G87A 4N69A 3KWCA 1XHDA 2OI6A 1KRUA 3DK5A 3OH4A 3TK8A 3OGZA 1KGTA 2WLFA 3GQ7A 3OU9A 4G3SA 1OCXA 2RIJA 4G3PA 4E79A 5AFUU 5L6SA 4EA9A 3OH3A 3PMOA 1QQ0A 4IHFA 5E3QA 3VBMA 1QRLA 2OI5A 4HZCA 4MYOA 5E3RA 3VBNA 3FSXA 3OTZA 3R5BA 4AC3A 3GOSA 4EA7A 3TV0A 2W0WA 3TIOA 1KK5A 3SPTA 3P47A 4MZUA 1QRGA 3FSYA 4HUSA 4EABA 3FOQA 5ADXV 4IHGA 2FKOA 2XATA 3EH0A 3GUEA 3R5DA 3HJJA 4KPXA 4MFGA 3F1XA 1SSMA 1MRLA 3R1WA 4K6RA 3NZ2A 3HSQA 2WLCA 3TWDA 3BRKX 3FSBA 1HV9A 4KNRA 4M2BA 1XATA 4EAAA 2OI7A 3VNPA 5E3PA 2V0KA 4AA7A 1QREA 2IU9A 2V0JA 3TDTA 3KWDA 1MR7A 1THJA 3OUPA 4IHHA 4H7OA 1HM8A 3TISA 3VBKA 2ICYA 1V67A 2JF2A 2GGQA 3OTMA 4HCQA 5DG3A 3ST8A 2TDTA 4ISXA 3FS8A 3T57A 1YP4A 5DEMA 5F42A 1N4IA 3R3IA 3BSWA 1KRVA 3OW5A 4M9CA 2QIAA 3MQGA 1FWYA 1SSTA 4N6BA 2V0LA 3FSCA 1T3DA 2V0HA 3CJ8A 3C8VA 2NPOA 4R37A 3R3RA 2IU8A 3BSSA 3OH1A 5AFUV 5L6VA 4EGGA 3MC4A 4M98A 3JQYA 3VBIA 3VBPA 2OEGA 4E6TA 1J2ZA 3GQ8A 3SUCA 2VD4A 4HURA 2QIVX 4KNXA
chains in the Genus database with same CATH topology
2ICXA 1G97A 1KQAA 4M28A 4E75A 3R5AA 1S80A 2WLDA 1YP3A 2WLEA 3DJ4A 1SSQA 2WLGA 3V4EA 3I3AA 3MQHA 4R7PA 2W0VA 5ADXU 2Q4JA 3IXCA 3P1BA 4HZDA 4J18A 3BFPA 4M99A 3I3XA 4N6AA 3BSYA 4M2AA 1QRMA 2GGOA 1Z90A 5DEPA 4EA8A 4E1KA 1V3WA 1FXJA 4R36A 3EEVA 1KK6A 3IGJA 3VBLA 4E6UA 1G95A 1YP2A 2VHEA 4KQLA 1TDTA 3R0SA 3R5CA 1KGQA 3BXYA 4J09A 4N27A 3ECTA 2P2OA 3D8VA 2QKXA 3R8YA 3VBJA 4KPZA 3Q1XA 2IC7A 4DCLA 4EQYA 4FCEA 3DHOA 1KK4A 3FWWA 3FTTA 2V0IA 4G3QA 1HM0A 3D98A 3SRTA 5U2KA 3KWEA 2OEFA 2I5KA 3GVDA 3R2WA 1QRFA 1LXAA 1KRRA 1KHRA 2AQ9A 1HM9A 3EG4A 4AAWA 1MR9A 2IUAA 2JF3A 4G87A 4N69A 3KWCA 1XHDA 2OI6A 1KRUA 3DK5A 3TK8A 1KGTA 2WLFA 3OU9A 4G3SA 5L6SA 1OCXA 2RIJA 4G3PA 4E79A 5AFUU 4EA9A 3PMOA 1QQ0A 4IHFA 5E3QA 3VBMA 1QRLA 2OI5A 4HZCA 4MYOA 5E3RA 3VBNA 3FSXA 3OTZA 3R5BA 4AC3A 3GOSA 4EA7A 3TV0A 2W0WA 3TIOA 1KK5A 3SPTA 3P47A 4MZUA 1QRGA 3FSYA 4HUSA 4EABA 3FOQA 5ADXV 4IHGA 2FKOA 2XATA 3EH0A 3GUEA 3R5DA 3HJJA 4KPXA 4MFGA 3F1XA 1SSMA 1MRLA 3R1WA 4K6RA 3NZ2A 3HSQA 2WLCA 3TWDA 3BRKX 3FSBA 1HV9A 4KNRA 4M2BA 1XATA 4EAAA 2OI7A 3VNPA 5E3PA 2V0KA 4AA7A 1QREA 2IU9A 2V0JA 3TDTA 3KWDA 1MR7A 1THJA 3OUPA 4IHHA 4H7OA 1HM8A 3TISA 3VBKA 2ICYA 1V67A 2JF2A 2GGQA 3OTMA 4HCQA 5DG3A 3ST8A 2TDTA 4ISXA 3FS8A 3T57A 1YP4A 5DEMA 5F42A 3R3IA 3BSWA 1KRVA 3OW5A 4M9CA 2QIAA 3MQGA 1FWYA 1SSTA 4N6BA 2V0LA 3FSCA 1T3DA 2V0HA 3CJ8A 3C8VA 2NPOA 4R37A 3R3RA 2IU8A 3BSSA 5AFUV 5L6VA 4EGGA 3MC4A 4M98A 3JQYA 3VBIA 3VBPA 2OEGA 4E6TA 1J2ZA 2VD4A 4HURA 2QIVX 4KNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ICX A;  1G97 A;  1KQA A;  4M28 A;  4E75 A;  3R5A A;  1S80 A;  2WLD A;  1YP3 A;  2WLE A;  3DJ4 A;  1SSQ A;  2WLG A;  3V4E A;  3I3A A;  3MQH A;  4R7P A;  2W0V A;  5ADX U;  2Q4J A;  3IXC A;  3P1B A;  4HZD A;  4J18 A;  3BFP A;  4M99 A;  3I3X A;  4N6A A;  3BSY A;  4M2A A;  1QRM A;  2GGO A;  1Z90 A;  5DEP A;  4EA8 A;  4E1K A;  1V3W A;  1FXJ A;  4R36 A;  3EEV A;  1KK6 A;  3IGJ A;  3VBL A;  4E6U A;  1G95 A;  1YP2 A;  2VHE A;  4KQL A;  1TDT A;  3R0S A;  3R5C A;  1KGQ A;  3BXY A;  4J09 A;  4N27 A;  3ECT A;  2P2O A;  3D8V A;  2QKX A;  3R8Y A;  3VBJ A;  4KPZ A;  3Q1X A;  2IC7 A;  4DCL A;  4EQY A;  4FCE A;  3DHO A;  1KK4 A;  3FWW A;  3FTT A;  2V0I A;  4G3Q A;  1HM0 A;  3D98 A;  3SRT A;  5U2K A;  3KWE A;  2OEF A;  2I5K A;  3GVD A;  3R2W A;  1QRF A;  1LXA A;  1KRR A;  1KHR A;  2AQ9 A;  1HM9 A;  3EG4 A;  4AAW A;  1MR9 A;  2IUA A;  2JF3 A;  4G87 A;  4N69 A;  3KWC A;  1XHD A;  2OI6 A;  1KRU A;  3DK5 A;  3TK8 A;  1KGT A;  2WLF A;  3OU9 A;  4G3S A;  5L6S A;  1OCX A;  2RIJ A;  4G3P A;  4E79 A;  5AFU U;  4EA9 A;  3PMO A;  1QQ0 A;  4IHF A;  5E3Q A;  3VBM A;  1QRL A;  2OI5 A;  4HZC A;  4MYO A;  5E3R A;  3VBN A;  3FSX A;  3OTZ A;  3R5B A;  4AC3 A;  3GOS A;  4EA7 A;  3TV0 A;  2W0W A;  3TIO A;  1KK5 A;  3SPT A;  3P47 A;  4MZU A;  1QRG A;  3FSY A;  4HUS A;  4EAB A;  3FOQ A;  5ADX V;  4IHG A;  2FKO A;  2XAT A;  3EH0 A;  3GUE A;  3R5D A;  3HJJ A;  4KPX A;  4MFG A;  3F1X A;  1SSM A;  1MRL A;  3R1W A;  4K6R A;  3NZ2 A;  3HSQ A;  2WLC A;  3TWD A;  3BRK X;  3FSB A;  1HV9 A;  4KNR A;  4M2B A;  1XAT A;  4EAA A;  2OI7 A;  3VNP A;  5E3P A;  2V0K A;  4AA7 A;  1QRE A;  2IU9 A;  2V0J A;  3TDT A;  3KWD A;  1MR7 A;  1THJ A;  3OUP A;  4IHH A;  4H7O A;  1HM8 A;  3TIS A;  3VBK A;  2ICY A;  1V67 A;  2JF2 A;  2GGQ A;  3OTM A;  4HCQ A;  5DG3 A;  3ST8 A;  2TDT A;  4ISX A;  3FS8 A;  3T57 A;  1YP4 A;  5DEM A;  5F42 A;  3R3I A;  3BSW A;  1KRV A;  3OW5 A;  4M9C A;  2QIA A;  3MQG A;  1FWY A;  1SST A;  4N6B A;  2V0L A;  3FSC A;  1T3D A;  2V0H A;  3CJ8 A;  3C8V A;  2NPO A;  4R37 A;  3R3R A;  2IU8 A;  3BSS A;  5AFU V;  5L6V A;  4EGG A;  3MC4 A;  4M98 A;  3JQY A;  3VBI A;  3VBP A;  2OEG A;  4E6T A;  1J2Z A;  2VD4 A;  4HUR A;  2QIV X;  4KNX A; 
#chains in the Genus database with same CATH topology
 2ICX A;  1G97 A;  1KQA A;  4M28 A;  4E75 A;  3R5A A;  1S80 A;  2WLD A;  1YP3 A;  2WLE A;  3OH0 A;  3DJ4 A;  1SSQ A;  2WLG A;  3V4E A;  3I3A A;  3MQH A;  4R7P A;  2W0V A;  5ADX U;  2Q4J A;  3IXC A;  3P1B A;  1Z2F A;  4HZD A;  4J18 A;  3BFP A;  4M99 A;  3GQA A;  3I3X A;  3BSY A;  4N6A A;  4M2A A;  1QRM A;  2GGO A;  1Z90 A;  3GQ9 A;  5DEP A;  4EA8 A;  4E1K A;  1V3W A;  1FXJ A;  4R36 A;  1L0S A;  1KK6 A;  3EEV A;  3IGJ A;  3VBL A;  1G95 A;  1YP2 A;  2VHE A;  4KQL A;  1TDT A;  3R0S A;  3R5C A;  1KGQ A;  3BXY A;  4J09 A;  4N27 A;  3ECT A;  2P2O A;  3D8V A;  2QKX A;  3R8Y A;  3VBJ A;  4KPZ A;  3Q1X A;  2IC7 A;  4DCL A;  4EQY A;  3OH2 A;  4FCE A;  4E6U A;  3DHO A;  1KK4 A;  3FWW A;  3FTT A;  2V0I A;  4G3Q A;  1EWW A;  1HM0 A;  3D98 A;  3SRT A;  5U2K A;  3KWE A;  2OEF A;  2I5K A;  3GVD A;  3R2W A;  1QRF A;  1KRR A;  1LXA A;  1KHR A;  2AQ9 A;  1HM9 A;  1M8N A;  3EG4 A;  4AAW A;  1MR9 A;  2IUA A;  2JF3 A;  4G87 A;  4N69 A;  3KWC A;  1XHD A;  2OI6 A;  1KRU A;  3DK5 A;  3OH4 A;  3TK8 A;  3OGZ A;  1KGT A;  2WLF A;  3GQ7 A;  3OU9 A;  4G3S A;  1OCX A;  2RIJ A;  4G3P A;  4E79 A;  5AFU U;  5L6S A;  4EA9 A;  3OH3 A;  3PMO A;  1QQ0 A;  4IHF A;  5E3Q A;  3VBM A;  1QRL A;  2OI5 A;  4HZC A;  4MYO A;  5E3R A;  3VBN A;  3FSX A;  3OTZ A;  3R5B A;  4AC3 A;  3GOS A;  4EA7 A;  3TV0 A;  2W0W A;  3TIO A;  1KK5 A;  3SPT A;  3P47 A;  4MZU A;  1QRG A;  3FSY A;  4HUS A;  4EAB A;  3FOQ A;  5ADX V;  4IHG A;  2FKO A;  2XAT A;  3EH0 A;  3GUE A;  3R5D A;  3HJJ A;  4KPX A;  4MFG A;  3F1X A;  1SSM A;  1MRL A;  3R1W A;  4K6R A;  3NZ2 A;  3HSQ A;  2WLC A;  3TWD A;  3BRK X;  3FSB A;  1HV9 A;  4KNR A;  4M2B A;  1XAT A;  4EAA A;  2OI7 A;  3VNP A;  5E3P A;  2V0K A;  4AA7 A;  1QRE A;  2IU9 A;  2V0J A;  3TDT A;  3KWD A;  1MR7 A;  1THJ A;  3OUP A;  4IHH A;  4H7O A;  1HM8 A;  3TIS A;  3VBK A;  2ICY A;  1V67 A;  2JF2 A;  2GGQ A;  3OTM A;  4HCQ A;  5DG3 A;  3ST8 A;  2TDT A;  4ISX A;  3FS8 A;  3T57 A;  1YP4 A;  5DEM A;  5F42 A;  1N4I A;  3R3I A;  3BSW A;  1KRV A;  3OW5 A;  4M9C A;  2QIA A;  3MQG A;  1FWY A;  1SST A;  4N6B A;  2V0L A;  3FSC A;  1T3D A;  2V0H A;  3CJ8 A;  3C8V A;  2NPO A;  4R37 A;  3R3R A;  2IU8 A;  3BSS A;  3OH1 A;  5AFU V;  5L6V A;  4EGG A;  3MC4 A;  4M98 A;  3JQY A;  3VBI A;  3VBP A;  2OEG A;  4E6T A;  1J2Z A;  3GQ8 A;  3SUC A;  2VD4 A;  4HUR A;  2QIV X;  4KNX A; 
#chains in the Genus database with same CATH homology
 2ICX A;  1G97 A;  1KQA A;  4M28 A;  4E75 A;  3R5A A;  1S80 A;  2WLD A;  1YP3 A;  2WLE A;  3DJ4 A;  1SSQ A;  2WLG A;  3V4E A;  3I3A A;  3MQH A;  4R7P A;  2W0V A;  5ADX U;  2Q4J A;  3IXC A;  3P1B A;  4HZD A;  4J18 A;  3BFP A;  4M99 A;  3I3X A;  4N6A A;  3BSY A;  4M2A A;  1QRM A;  2GGO A;  1Z90 A;  5DEP A;  4EA8 A;  4E1K A;  1V3W A;  1FXJ A;  4R36 A;  3EEV A;  1KK6 A;  3IGJ A;  3VBL A;  4E6U A;  1G95 A;  1YP2 A;  2VHE A;  4KQL A;  1TDT A;  3R0S A;  3R5C A;  1KGQ A;  3BXY A;  4J09 A;  4N27 A;  3ECT A;  2P2O A;  3D8V A;  2QKX A;  3R8Y A;  3VBJ A;  4KPZ A;  3Q1X A;  2IC7 A;  4DCL A;  4EQY A;  4FCE A;  3DHO A;  1KK4 A;  3FWW A;  3FTT A;  2V0I A;  4G3Q A;  1HM0 A;  3D98 A;  3SRT A;  5U2K A;  3KWE A;  2OEF A;  2I5K A;  3GVD A;  3R2W A;  1QRF A;  1LXA A;  1KRR A;  1KHR A;  2AQ9 A;  1HM9 A;  3EG4 A;  4AAW A;  1MR9 A;  2IUA A;  2JF3 A;  4G87 A;  4N69 A;  3KWC A;  1XHD A;  2OI6 A;  1KRU A;  3DK5 A;  3TK8 A;  1KGT A;  2WLF A;  3OU9 A;  4G3S A;  5L6S A;  1OCX A;  2RIJ A;  4G3P A;  4E79 A;  5AFU U;  4EA9 A;  3PMO A;  1QQ0 A;  4IHF A;  5E3Q A;  3VBM A;  1QRL A;  2OI5 A;  4HZC A;  4MYO A;  5E3R A;  3VBN A;  3FSX A;  3OTZ A;  3R5B A;  4AC3 A;  3GOS A;  4EA7 A;  3TV0 A;  2W0W A;  3TIO A;  1KK5 A;  3SPT A;  3P47 A;  4MZU A;  1QRG A;  3FSY A;  4HUS A;  4EAB A;  3FOQ A;  5ADX V;  4IHG A;  2FKO A;  2XAT A;  3EH0 A;  3GUE A;  3R5D A;  3HJJ A;  4KPX A;  4MFG A;  3F1X A;  1SSM A;  1MRL A;  3R1W A;  4K6R A;  3NZ2 A;  3HSQ A;  2WLC A;  3TWD A;  3BRK X;  3FSB A;  1HV9 A;  4KNR A;  4M2B A;  1XAT A;  4EAA A;  2OI7 A;  3VNP A;  5E3P A;  2V0K A;  4AA7 A;  1QRE A;  2IU9 A;  2V0J A;  3TDT A;  3KWD A;  1MR7 A;  1THJ A;  3OUP A;  4IHH A;  4H7O A;  1HM8 A;  3TIS A;  3VBK A;  2ICY A;  1V67 A;  2JF2 A;  2GGQ A;  3OTM A;  4HCQ A;  5DG3 A;  3ST8 A;  2TDT A;  4ISX A;  3FS8 A;  3T57 A;  1YP4 A;  5DEM A;  5F42 A;  3R3I A;  3BSW A;  1KRV A;  3OW5 A;  4M9C A;  2QIA A;  3MQG A;  1FWY A;  1SST A;  4N6B A;  2V0L A;  3FSC A;  1T3D A;  2V0H A;  3CJ8 A;  3C8V A;  2NPO A;  4R37 A;  3R3R A;  2IU8 A;  3BSS A;  5AFU V;  5L6V A;  4EGG A;  3MC4 A;  4M98 A;  3JQY A;  3VBI A;  3VBP A;  2OEG A;  4E6T A;  1J2Z A;  2VD4 A;  4HUR A;  2QIV X;  4KNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...