4M98A

Acetyltransferase domain of pglb from neisseria gonorrhoeae fa1090
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
205
structure length
205
Chain Sequence
NRKLAVIGAGGHGKVVAELAAALGTYGEIVFLDDRTQGSVNGFPVIGTTLLLENSLSPEQFDITVAVGNNRIRRQITENAAALGFKLPVLIHPDATVSPSAIIGQGSVVMAKAVVQAGSVLKDGVIVNTAATVDHDCLLDAFVHISPGAHLSGNTRIGEESRIGTGACSRQQTTVGSGVTAGAGAVIVCDIPDGMTVAGNPAKPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical analysis and structure determination of bacterial acetyltransferases responsible for the biosynthesis of UDP-N,N'-diacetylbacillosamine.
pubmed doi rcsb
source organism Neisseria gonorrhoeae
molecule tags Transferase
molecule keywords Pilin glycosylation protein
total genus 72
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2013-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17836 PglD_N PglD N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4m98A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m98A01
3VMMA 4M2BA 3Q2OA 3P47A 3V4ZA 3GVDA 4C5CA 5DEMA 1VKZA 2PVPA 1I7NA 4MV6A 4MA5A 2V58A 5D8DA 4EAAA 3R8YA 2W6MA 1JDBB 3JQYA 4E79A 4DIMA 3R5CA 4ZQIA 2VR1A 3Q1XA 4MZUA 4EA7A 4MV3A 1PX2A 4KNRA 3EH0A 3IGJA 3N6RA 3TW6A 4ME6A 3SPTA 2OEFA 4WD3A 2J9GA 1LXAA 1B6RA 1SSQA 2YRXA 1KQAA 1HM9A 3V4EA 3R3RA 3ETHA 4MV8A 1SSTA 2DWCA 3QFFA 4J6EA 3ST8A 1C30A 2W6ZA 2ZDQA 1KK6A 3NZ2A 3D98A 3U9TA 2I87A 2Q4JA 1QRMA 4HZCA 2I5KA 3FSYA 2V0HA 3DJ4A 2PN1A 3ETJA 1EZ1A 3EEVA 3I3AA 4N6AA 3KWEA 4M99A 3R3IA 3N8DA 2WLFA 1T36A 4HNTA 2OEGA 2W6OA 1CS0A 1C3OA 4E1KA 4E6UA 3HBLA 3TISA 5E3RA 1KJJA 3R2WA 2P2OA 3HB9A 2PBZA 1T3DA 2FB9A 4HURA 5ADXU 2JF2A 1AUVA 3MC4A 2V0JA 2P0AA 4HZDA 4G87A 2YS6A 5AFUU 2I80A 3AX6A 3ORRA 3VNPA 1E4EB 3DK5A 3VA7A 3R5DA 4MV9A 3U9SA 4G3QA 3VBJA 4QSHA 4R7PA 2QF7A 1QREA 3TWDA 2I8CA 4AC3A 5E3QA 4C5BA 1CE8A 5F42A 3FSCA 3BG5A 1YP2A 3BRKX 2OI7A 2R86A 2GGQA 3JZFA 3LP8A 3IXCA 4RZQA 2W71A 1AUXA 4R37A 3KWCA 2TDTA 3VOTA 3K3PA 2YZGA 4IZOA 4EGQA 1MRLA 1V3WA 3VBPA 1HM0A 2VQDA 3RUPA 3EG4A 4E6TA 2ZDHA 4EA9A 4HCQA 4KPZA 1BXRA 2XCLA 4H7OA 3HO8A 2V0KA 1QRGA 3K5IA 4KQLA 3FS8A 5I47A 2OI6A 1KHRA 2GPSA 3TIOA 1QQ0A 3BSWA 4EA8A 4KPXA 2YZMA 1E4EA 1KJ9A 2R84A 2RIJA 3R5HA 4EQYA 3PMOA 1EHIA 4HNUA 1A9XA 2YRWA 3C8VA 3Q1KA 1HV9A 3FOQA 3RFCA 4J09A 4MV1A 1ULZA 4C5AA 1KJIA 2W6QA 5JQWA 1MR9A 5L6VA 1DV1A 2W0VA 4GGMX 4MYOA 3MJFA 5K2MA 3WO1A 3VPDA 3CJ8A 4G3SA 4IWYA 3TQTA 3WNZA 3R5AA 1M6VA 1G97A 1QRFA 2R7LA 2QIAA 3HJJA 2ZDGA 4IHFA 3K5HA 5ADXV 3AW8A 3OUUA 1KJQA 3F1XA 2DZDA 2ICYA 1HM8A 1EYZA 2V59A 2QIVX 5DMXA 4E4TA 3R5BA 4N69A 3G8DA 3KWDA 2W70A 1GSOA 2CZGA 1KRRA 1KGTA 2JF3A 3OTZA 3ECTA 3GOSA 4DLKA 2YYAA 2VD4A 3P1BA 1MR7A 3OU9A 2GGOA 3R5FA 4AA7A 1KJ8A 2AQ9A 3OUPA 1QRLA 1IOVA 3ORQA 3OTMA 3BXYA 1BNCA 3VPBA 4J18A 2IP4A 2IU9A 3GUEA 2V0LA 3MQHA 1PK8A 2C00A 2YS7A 2W6NA 4M28A 4K6RA 3RV4A 3VBNA 2GPWA 5C1PA 3RV3A 3V4SA 3MQGA 4EG0A 3WO0A 2R7MA 3R5XA 3FSXA 4HNVA 4FU0A 4G3PA 3I12A 4M9UA 2IU8A 2WLCA 5DG3A 2GLTA 1S80A 2QK4A 4MFGA 4M9CA 5BPHA 1KRUA 1KK4A 1GLVA 3G8CA 2V0IA 4FCEA 5U2KA 1GSHA 2DLNA 2IC7A 5L6SA 1GSAA 2NPOA 2R7KA 5H80A 1YP4A 4ISXA 4MAMA 4MV4A 5BPFA 2R7NA 2FKOA 3T57A 1SSMA 3TDTA 3VBLA 3VPCA 4KNXA 3I3XA 1I7LA 4IWXA 3R1WA 1UC9A 2ICXA 2V5AA 4AAWA 1XHDA 3VBKA 1KEEA 3R23A 4IHHA 2R87A 3E5NA 1KRVA 1OCXA 3VBIA 5AFUV 3SE7A 2QKXA 1THJA 4N27A 2WLGA 5C1OA 2XATA 1XATA 3JZIA 1FWYA 4R36A 3LWBA 3HSQA 2WLDA 3SRTA 3OUZA 1IOWA 2W0WA 4N6BA 1B6SA 2VPQA 3OW5A 3BSYA 2W6PA 4HUSA 5E3PA 4EGGA 3FTTA 3DHOA 3R0SA 1Z90A 3TV0A 3FWWA 4E75A 1G95A 1KGQA 4M2AA 4IHGA 2R85A 1J2ZA 3VBMA 3BSSA 2OI5A 4DCLA 1UC8A 5DEPA 4L1KA 2YZNA 1YP3A 4M98A 2IUAA 2WLEA 3BFPA 1V67A 4MV7A 4EABA 4EGJA 3TK8A 1DV2A 2Z04A 3FSBA 1FXJA 3D8VA 4HR7A 2VHEA 2YW2A 1KK5A 2XD4A 1TDTA 4MA0A
chains in the Genus database with same CATH superfamily
5EL0A 1YJAA 4BCCA 1U5BA 5HHTA 3ZLJA 5KNLA 1W2HA 3EE6A 2FQ1A 3OKAA 1R8QA 3IV6A 5F73A 5MGBA 2QPAA 3GH3A 3OZDA 2BHNA 4RTJA 2COEA 3PEYA 5SZJA 4C5CA 4EVIA 4OJTA 1L5SA 1F2VA 3M4JA 3U0VA 3JW8A 4A92A 3AF5A 3LCJA 4Q9LA 2GLUA 2HCTA 4ALIA 5EMNA 1UP4A 5IF3A 1XZBA 1H1LB 1JQ5A 2H59A 1L4FA 2HLDD 2W6MA 4W8GA 3RWMB 4DIBA 2OCXA 1R74A 4E79A 3HDQA 4AKEA 4OK5A 3QHAA 1ZD4A 5JALA 4EIWA 3UB4A 3FSGD 3TUZC 5FUQA 1K6MA 4FOPA 1CUGA 4NCBA 2EZ9A 1H05A 4LRWA 1E1DA 4L3WA 5FHRA 2J33A 1Y5RA 3R5SA 1PQWA 1OLUA 1T43A 1IBMB 2XNKA 5E8RA 4O4JB 2CDCA 2DHQA 3GC6A 3UATA 3ONWA 3WIEA 4QPCA 1L7RA 2H1RA 4GL4A 3O21A 1ZEMA 4DIEA 2FF5A 3QXGA 3C45A 4D0SA 4RULA 3KYJB 1GL9B 1KEVA 2G63A 1ZUWA 4IHJF 4QAQA 4AYWA 4GPD1 4I9HA 3CT4A 1MABB 2H7VA 2R8XA 3VGJA 4K0RA 1NFRA 4OMCA 4C88A 3KSRA 1JHOA 1TEVA 3USZA 3VR4H 4D26A 4FOOA 5H83A 4UXHA 3GCXA 3FPKA 3DJYA 3SYLA 1SB8A 1COZA 3C1UA 4DG9A 3ZIAA 4YJ3B 2B9VA 4KX5A 3IQHX 3CM0A 3M4ZA 3KQMA 5E7IA 1LJUA 2XSZA 1MB9A 3NIDB 3MD9A 5BV8A 2ATIA 2XXJA 4W7IA 4KQHA 2V55B 1BA3A 2MMCA 1Z16A 1WBJB 2W6ZA 4F84A 5CFQA 3TOVA 3F3YA 4I81A 5AH0A 2HWKA 4LTNA 4D0GA 3KQLA 1E18A 3BFKA 1LSOA 3K0KA 4NPHA 3UK2A 2BH2A 2NTNA 1HT2E 1THMA 1KK6A 1QHHA 1XRSB 4NU0A 4A82A 1MJGM 3OPQA 4QDUA 4ONEA 2FSPA 1WV0A 3DLPX 4P34A 2AZ4A 4GYJA 1D6MA 3ZN2A 2D0PB 2VJDA 2LDBA 2VUIB 3NHWA 4FDUA 5HFNA 1QWOA 3TIIA 3HRKA 5M5BA 2C5LA 1FSGA 3GPBA 3NEAA 4WESB 1ZM4A 1UP7A 4N6AA 1ESCA 2RGBA 3EXFB 4RS4A 2EQ5A 3QVOA 3MOSA 2DFTA 2AHRA 3GB9A 1M2GA 1DBQA 1O3YA 1T8TA 3PHGA 4M9XA 2JARA 4YMGA 3WIDA 1XHFA 3LTNC 5I45A 3ZWDA 4YJ2F 1OOEA 2WPNA 1PT5A 4YRPA 5SYNA 4AF7A 1ZJ6A 3FJ1A 3MSCA 3G8BA 3NETA 2ACWA 4HNAA 3TEJA 1FUKA 3RJTA 3V2IA 1BMTA 2WJVA 4NENA 3U5TA 3WFZA 3GPCA 4KIUA 1EG7A 4YDRA 4OXRA 4B43A 1BAPA 4QVIA 1XZGA 3OY2A 5ALFA 2IBMA 1NGSA 4FW9A 1QVZA 1NZFA 1E3JA 2RHOA 3X2EA 2SCUB 4BJ3A 3PQCA 9ABPA 2D2VA 4LZNA 4BVLA 4E13A 1AUVA 4N3GA 3MC4A 2VHXA 3G2KA 1JFTA 5JCZA 4Z7OB 2CNKA 2W2XA 3SOPA 1SUDA 1D1PA 2JJ2A 1UOEA 2FSGA 2JH8A 1OKKD 3I0ZA 1ISGA 2X6TA 5LZ7A 3AV0B 2BFBA 3IBGA 4KVGA 3TFQA 4BGEA 2FK8A 3BREA 3OP1A 3IQGX 3S70A 2Y1EA 4QBGB 1Q7BA 2CE7A 3ZV3A 2C78A 4X7PA 4X7BA 3QV2A 2QQ0A 1KL7A 3OD1A 4JLMA 5FBZA 4EG4A 4GPIB 2H17A 1XZEA 4OXQA 1J2TA 4ZO7A 4BKRA 3H1PA 4GOKA 4JJAA 4ZN6A 2XGJA 3W2IA 2IUYA 2VJAA 3F5FA 3VHXB 5G1NA 1EDBA 1UJMA 3AC0A 3T15A 5D3KA 1GCAA 4NBSA 1ECGA 2HK8A 5CLIA 3SX4A 4B17A 4CFZA 1AMOA 1E9EA 3MM4A 4IJ5A 4JY7A 5F42A 5DWVA 4HTFB 4MRPA 4X85A 3KQKA 1YP2A 4YCDA 2V0CA 4RZXA 1I1OA 5IX8A 3SD7A 3ANNA 1B15A 3IXCA 1JX6A 1OBOA 1HK7A 3QBJA 3BX1A 3G1UA 5D87A 5EY5B 5K20A 4HPJB 3PA8A 2ZYTX 2C98A 4UMVA 3UOWA 3IP5A 1FYVA 2GEKA 4EGCB 5DNVA 5M29A 1I2CA 3ZE7A 3ICWA 3OZTA 1PEYA 4LSWA 2W6ID 2HHCA 1M8GA 3NUZA 3OWXA 2TMKA 3WGNA 3L05A 3WK5A 3EWAA 3P9CA 3TCXB 4FYHA 2J3EA 4UPVA 1AGYA 1U2DC 3QNMA 1Z13A 1GNSA 5JNRA 4CEJB 3V1YA 3EG4A 4TXHA 2RHLA 2FZ5A 1AKYA 2IYFA 4ZI2A 1GNVA 1LK7A 2I65A 1X39A 4NV1A 4RPIA 2QD5A 1J00A 1SR8A 1S3FA 3MW8A 2BEWA 3WYEA 1L6RA 5KHLB 3UT0A 4WJZA 2HU7A 3FPGA 1FMCA 1E64A 3BHIA 3OA0A 1Y9ZA 3B3AA 3BXOA 4KPYA 1PBTA 1PR4A 3LUAA 2OHHA 3Q3VA 1KHRA 4PHGA 3DO5A 1T0JB 3AF4A 3DO8A 1QQ0A 2IZ7A 4I9NA 4B9EA 2IFTA 1ZUNB 1W4CA 3QW2A 5BV0A 3NW9A 5FNVA 4ZQHA 1Z5VA 1E4EA 2W2PA 2YFHA 1OCEA 4X90A 5CW1A 5K4GA 2W7TA 1ONPA 1RHKA 4CQLB 5ECYA 2J32A 2R84A 5CEFA 4BC1A 3RANA 3Q3HA 1NX6A 1FL9A 1NI5A 3C7TA 1I6KA 3QFHA 4HAYA 3V7YA 3C6QA 1IY0A 1R8SA 1UZMA 2XHZA 1VJRA 1VE6A 1P1IA 2XUIA 4EATA 3IR7A 2IDMA 4HQOA 1SPBS 5D3MB 4JGGA 1BE0A 1IJKA 1Q3HA 1YR1A 1XTZA 2BUAA 3PFNA 4QHTA 3WK7A 3R6DA 4LHEA 1E3LA 1V3QE 4JJ7A 3S0JA 4BTEA 1ST2A 4JZKA 3UWMA 1F17A 3X43A 4RHEA 4EGFA 4FEGA 3C8HA 4PIPA 1BMQA 2AV6A 4ASUD 1RABA 3IAXA 3OM0A 3ANMA 5HZMA 2BFEA 5YASA 4KIFA 3S2EA 1NX9A 3QE3A 1U1DA 5CHYA 3IEPA 2Q5JA 4YH1A 3RS7A 1OYWA 4GAEA 3PX3A 3WNZA 1KY2A 2V65A 1F20A 2XT0A 2FKNA 3FDZB 3D8BA 4MPRA 4YHHB 1U3FA 2BSXA 5FWYA 4JL5A 4REQA 2ZUTA 2HF2A 2QLJA 2JG3A 3HYNA 4BMYA 2UU9B 2VEOA 1WMFA 4AJNA 1JSCA 2QY9A 3D8SA 2YTZA 2ZYUX 3CRQA 5B3KA 4IHFA 2DG2A 3UTDA 2YCBA 4R8MA 3NHPA 3IVXA 4B80A 4AMVA 3WMFA 4BNYA 3EGWA 3L0PA 5D01A 4DUGD 1E7RA 4BQNA 1V16B 4D2IA 1TU0A 1RMTA 3H16A 3M82A 2GJSA 4S05A 2Q3FA 3JQPA 1A9RA 1R8JA 2GSWA 5JYEA 5GVSA 4AJ9A 4MOWA 1YS4A 1K3UB 3AMVA 2PT6A 3G0HA 1UKBA 2GO7A 2VH2A 1IUPA 1HMYA 1G21A 1Q11A 2WTUA 1VFPA 2OBBA 2LCFA 2E37A 2Q9CA 4K6KA 5L6LB 2UUAB 4B8WA 5FOVA 3ECTA 3I04A 1ZY2A 2ZAYA 3OY7A 1ZI8A 3DXXA 1QO0A 4XQ9A 3V8BA 1GCGA 3FPJA 3GP8A 4KI7A 1BVYF 3CO5A 2J9XB 2J67A 2V6MA 3DYIA 4JEHA 5FPSA 4OHZA 4AZ0B 1LPPA 5JRZA 1IEQA 3DGFC 3DYVA 5C3UA 3KT3A 4FS8A 4I5FA 4ISBA 4A5SA 2VO1A 3D3EA 3C5HA 1SCQA 2JH9A 4M55A 5LDDC 4KO1S 3N0RA 3OZAA 4AA7A 3UUFA 1WR8A 4MHSA 2Z2IA 3ONVA 2JLWA 1JXQA 1SU6A 4Q15A 1TTTA 1IOVA 1N9GB 4JKIA 3SM9A 3PUIA 1X94A 1DKQA 1OLSA 1N0HA 4B6PA 3BT7A 3K20A 4P4SB 2RBKA 4JAVC 5BWNA 4RM2A 1KP2A 1UP6A 3E3OA 4B31A 2P9JA 2CL5A 2G4VA 2KX7A 1CEXA 2QTGA 4M8NE 4EQZA 1MZPA 3D1VA 4QPJC 4TV8A 3BMOB 1U90A 2GVNA 2VJMB 2PKRA 2WOOA 3DE6X 1QVVA 5TXGA 1W1UA 1AXEA 2YVQA 3HL0A 4HH4A 3WAKA 3OEWA 4Z4CA 1WSWA 6GPBA 2MYUA 3P9ZA 1T35A 3PVSA 1R50A 4AM8A 1G8HA 3ZCQA 4XPIA 3NKVA 2OZPA 4KZKA 4ZARA 2E5LB 3R40A 1KOFA 2CV0A 2D1SA 4OQNA 2V6FA 3MJSA 1D5WA 2ZBUA 2JIQA 2VZ0A 4Z49A 4UTNA 2WWIA 3OX3A 1XC7A 4JA2A 4W6QA 1O94D 3SC6A 3EC2A 3K32A 2ZE7A 1FJHA 1GPKA 1OPRA 4DA4A 2F9LA 2QXYA 5ENZA 5CA0F 1DPGA 2WIKA 4KVAA 4U9IS 1IONA 3FSXA 5EP4A 4IM7A 1SD2A 4EO4A 4QBHA 2MSCB 1GQOA 2QJTA 3HP7A 1OY1A 2DBVO 4WNAB 2A78A 1ANKA 3CW8X 1MV8A 2FUG6 3H7AA 4WNCA 3HRHA 5PNTA 4BJ1A 3D1LA 4LRTB 1KO5A 3BB3A 1QJ4A 1W8DA 4UBOA 3M9XA 5EJMA 5FKJA 2Y1XA 4JBNA 1H5NA 5L4SA 3C15C 1CR4A 4S1PA 1LQTA 2R6AA 3W8RA 4BJHB 5I4KA 1CR1A 2J6HA 4L95C 4YJFA 4EFNA 3AEXA 3DDWA 3GRCA 1VP3A 5EWLB 1UK9A 4M1KA 4EG6A 1F7UA 1JTFA 2VK8A 1JIXA 2BF4A 1M8JA 3AI2A 5BW8A 3IHWA 4TLMB 3PJRA 1Y8QA 3K35A 4ZVSA 3OQJA 3TQCA 6YASA 4I1PA 1OASA 2L18A 3SC2B 5H80A 1HLPA 4AP5A 1KAMA 1Z88A 4PXYA 5DIZA 3PVZA 2C92A 3EVFA 1CNMA 1SUFA 4FZRA 4B79A 1N33B 2V4UA 2DTEA 1QIMA 2ZUEA 3CSUA 4L8FA 3NH9A 4FI3F 5E6RB 3V00A 3IXLA 3JAWB 1QAQA 4ZJYA 1DC3A 3V1NA 4F97A 1GRRA 1RQPA 5AICA 3JQ8A 2VDRB 3K53A 5EJGA 5HSGA 1QHSA 2CJXA 1EX6A 1FDRA 2RARA 3IUQA 2J45A 1BH6A 1OWNA 3E8MA 4LZJA 1Z9BA 4NPAA 3NATA 4GM4A 5BQXA 1SBIA 3FKQA 3R1WA 3K0AB 4JJIA 2X4GA 1GQSA 3L7NA 1QYIA 1B4DA 1G0NA 2J3HA 3JQ8B 3VBKA 4I1SA 4IHJB 3ZQ4A 4MHTA 1STOA 1NQVA 1DUVG 3BFVA 3L8MA 4J4BA 4NQRA 3W2EA 5BQPA 3ZVNA 1SB9A 3HBAA 3EZLA 2CC2A 1UBLS 3AHHA 4Z9AA 4HS9A 3H99A 3PC3A 2I6FA 3R3ZA 4E2WA 4RVHA 2JF0A 2ZR8A 4PANA 1N2ZA 5K01A 1T9GS 4J16A 3Q98A 5ALXA 4WLVA 1NMSA 2X42A 1C41A 1PJZA 1ZXXA 3LDUA 2JLQA 4G07A 5CX4A 4ZHQB 4O3MA 2Q8PA 2C5BA 2P11A 1E1MA 1A71A 1SXIA 3L8HA 3EZ9A 1E8NA 2B8TA 3KPWA 1F06A 3CRW1 2ZSEA 4MH0R 3LQQA 1Z75A 2IPXA 2DOKA 4F21A 2JRLA 3ER9A 1HWYA 4BO6A 2VDQB 4M0UA 2PSHA 1TCCA 4ND7A 1A9TA 4YACA 2QJFA 4KN8A 1YULA 4A0HA 1N57A 2V7VA 4ZDKA 3FH0A 4LZOA 1CSEE 3IOMA 1ZUD1 2IIVA 2RGXA 1T6XA 2FOLA 3O38A 1PZMA 3COWA 4IZ6A 3RHZA 3Q11A 3T12A 3UXEA 2R2GA 3K6KA 4BVEA 3PITA 9MHTA 3ER6A 4LRQA 1RRMA 4QT0A 4WACA 4QXAA 1ESZA 3S2UA 4XX0B 5IC6A 1VI6A 3SBXA 4DGSA 4FZVA 3JTEA 2HNKA 4HDMA 4LJRA 2OI5A 4NS4A 1G20E 4I8IA 4RD6A 3VI4B 3Q12A 4FGSA 3ZJVA 2KW5A 2CF6A 3KV3O 1JBKA 4IV8A 3H7IA 1NTOA 4E5UA 1U8CB 3LECA 2IL1A 3BYZA 4J0DA 5HIAA 4CFSA 4GPEA 1VLHA 2AE1A 4JBXA 5CJPA 4KBYA 4EO7A 1X38A 2WYVA 5LP6F 3P0JA 1RRVA 5CA1A 1QR2A 3K6SA 3NZEA 1RIFA 1MGPA 2DT8A 3HVJA 4WEOA 1ORTA 5TQJA 2FZVA 3A3PA 4BO0A 1CY0A 4CLRB 1GRNA 3HMQA 3KE9A 2X77A 4BLOA 2JATA 4JODA 4TX1A 1O9HA 3ROFA 5DNWA 4KYUA 4K3UA 3I9MA 5EKXA 1BKSB 1Z38A 5KNBA 4BVFA 4QGGA 2UUCB 5HK9A 1W35A 2XB6A 1L4NA 5A4DA 1CK4A 2NU9B 3ZE8A 5CTJA 5JT1A 3NWEA 4WGGA 5IXSA 4P2GA 4W5RA 4V2IA 1N4DA 4G3XA 3CLUC 3VXKA 3WNBA 1N32B 3EC7A 1P2FA 2VIIA 3EDMA 5DEMA 4TWZA 3FBGA 2PVPA 5DB4A 1E5XA 1TLFA 3ZDYB 5CT5A 5BMVF 3BK7A 2I66A 1Z74A 2Y1LA 5I7WA 1KRXA 4LRXA 2AMYA 3R8YA 3COPA 3DYBA 3EXHB 3OICA 4UUAA 2C97A 5D00A 1YC2A 4EG7A 2X4IA 1SNYA 1K7FB 4GLBA 4C3VA 5GZ1A 4HDRA 1AQLA 4QUGA 3A36A 1SVMA 4NFYA 3VPFA 4JLSA 4PN3A 1FE8A 5IKEA 1CUZA 3HRIA 2OFXA 4LXGA 4D4HA 1G21B 5JSYA 3RADC 2O48X 3EXFA 1I7QB 4F5WA 3A31A 4M86A 5CM8B 4C4PA 1BX1A 1Q44A 2B0CA 3O8OB 1IN8A 2ZXEA 4D9JA 2GBFA 3M3PA 1FQJA 4OQYA 3U31A 5C0OE 1P72A 2XDQA 4TV9A 4CV3A 1F2TA 1P7YA 1QVRA 2P75A 3CG4A 3EZ2A 3EH0A 4NJOA 3L4BC 4BLVA 4C0HA 2VZ9A 2BZ1A 1N6HA 2ZI4A 2DWOA 4BNUA 2OM6A 1ZXBA 3BDAA 3DLCA 2QSYA 5KAPA 4B84A 2FFJA 4RFVA 4TSFD 4BFUA 4MWCA 1DI0A 4OD0A 4PCAA 4TQAA 5AW2A 3JQGB 1W4BA 3DOFA 1X7WB 2FW6A 3G1TA 3KZXA 1X6VA 4MWGA 3VU1A 3MCUA 1TC1A 3LUPA 3DLIA 1Z2AA 1TMOA 1Z7GA 4RV5A 4S2UA 4R69A 1ES9A 3G59A 2AQKA 1UJNA 2GYYA 5FOUA 3WLFA 1L2TA 2HTEA 5EIBC 4RHCA 3TFWA 2IYEA 2FWNA 2AF3C 4GPBA 4NATA 3D8HA 2X9VA 2MTBA 1KE2A 3LHKA 2ZDQA 1X1SA 5A2QA 4EKGA 2H11A 4QUHA 3R8CA 3KHUA 2FLVA 3IDZA 3DKKA 1P1HA 5A2GA 3GRRA 5D7NA 4HTAA 2R4QA 2NUPB 3WE7A 3H13A 4PCUA 1GA6A 3GD5A 3QPCA 1DO8A 1E6LA 1JT2A 2P5YA 4G8BA 4KKXB 1XXHB 1NBMA 5THQA 3WWYA 5FPPA 5JYBA 4J0HA 1FLVA 1N3LA 2PAFA 4UFOA 3O2SB 2IQ5A 5FIUA 2VHJA 3O8NA 1N0IA 3O8CA 5J9FA 1CPYA 1BQ3A 5BN5A 3R3SA 2G88A 3QHQA 1X2BA 3WYNA 1MOQA 4CQLA 4EHNA 4MWBA 1KI7A 4AI6A 3EIHA 1N0VC 2OV4A 4PLYA 1OZFA 2CHEA 1NDUA 2RG7A 3TD9A 5IC4A 5FNVB 4X97A 1T8YA 2GTIA 3P0FA 3FG9A 1B6TA 4QASA 4TTTS 2C4MA 3QLEA 3QFSA 1JHMA 1OVGA 1MX3A 3FYDA 1ZD8A 4JSRA 1TVCA 1C4XA 3KAQA 3O3OB 4PHHA 2EKZA 4J7XA 1XYVA 4C29A 1XZAA 2MHCA 3EUWA 1RRKA 2XYHA 2ENWA 1U3VA 2R65A 1JIQA 2O3SA 2P9TA 3HKBA 4J2TA 4YDQA 1DRJA 2BGRA 4C3UA 4BX9A 3D6UA 2HU5A 3ZVKA 16PKA 3PDCA 4OV6B 4G84A 1DT5A 1RI4A 4KLNA 5TE9A 2P6RA 2M2IA 4Y6QA 3WGZA 2JGNA 1E3WA 2GCOA 5P8WA 4PX3A 3V80A 3IODA 2LIPA 4KGXA 4EKIA 3AVWA 1PZFA 3WICA 4IEIA 4LUCA 1CQIA 3E84A 3L6UA 2NZYA 3RVNA 1GUZA 5E0OA 1VFNA 1ZDMA 5LC1A 1P1FA 2PMKA 3LP6A 4QL3A 2Q6OA 3TUJC 3JVEA 3DT9A 2NP6A 5JCXA 2BE9A 3VA7A 2BMEA 3UCEA 1UPUA 2D2FA 3EC1A 1L4UA 3KU4A 7MHTA 4ZFNA 1MO5A 3QSYA 2FFHA 1U3CA 3HVHA 4DV0B 1F7VA 5IYZF 3T0IA 5EZYF 4OHCA 4U8GA 2M32A 4C7VA 2A59A 1WWKA 2BEJA 4DYHA 5BUZA 5KQGA 4QYWA 4Z4EA 2OZEA 1TL7C 3VX3A 2I8CA 2ECOA 3F7OA 2C8JA 4O2BA 1O94C 4DLTA 3SBEA 4E51A 5LP1A 3FNQA 1GTJ1 4HFMA 2WU0A 3L4BA 2WHYA 1KDTA 3HCDA 5DHQA 3BRKX 5A1JA 2GGQA 1GV0A 1F8YA 2H4WA 3PF9A 1NJ1A 4D8TA 2W71A 4XQCA 3HL4A 4MHOA 4GL2A 2ZZMA 2VBFA 2QX9A 2WVAA 5F4ZA 1O03A 5BVGB 2KBFA 1S4MA 3RM3A 3HP4A 1EBUA 2AUTA 2UZIR 2JJ1D 3ZVLA 2O2SA 2O19A 1Z8DA 3B1FA 3ZDEA 2PUAA 1XK7A 1VE9A 2I3DA 1FX1A 3JATA 3N3AC 2SHKA 1UT6A 2CK3A 1OXUA 5FUMA 1J2JA 4P4LA 4K6FA 4G81A 5HF9A 3VFDA 2GB4A 1VCNA 2B82A 3RRYA 4BO9A 1YUMA 4FB4A 3VR5D 3CN9A 3PFHA 2RHTA 2GBPA 3CVJA 2FYTA 1PR1A 1DT3A 3FDIA 3FZYA 4NE7A 1E9SA 1QLWA 3ITKA 5AP9A 3VKFA 5CG1A 1ZISA 3INNA 5JH7F 1ZJWA 1Y98A 4RGBA 4M38A 3GR6A 4E46A 1LZLA 1PWXA 1QS0A 3HDHA 1E2KA 1NJ6A 3R74A 5CCEA 3EEOA 5BUQA 1U6KA 2AJLI 2D6FA 4L22A 5D51S 2C1EA 4UUOA 3OLCX 2VXYA 4N47A 3GEGA 2W2MA 4FYYA 2B5VA 4EA8A 5C37A 4OJQA 1VIMA 3UGTA 4JASB 5FBHA 4YFVA 1OIWA 2QENA 3DNPA 3W1WA 4BNWA 3GP5A 4CKCA 4M88A 4NIMA 5EN4A 4EJFA 3FPEA 1JDSA 1UOQA 4I4CA 4LV8B 4AQYB 5JYCA 5DASA 3SPXA 5CR9A 4QGFA 3ZBPA 1E9BA 2O20A 5K8JB 5KTYA 1L7AA 3KWMA 5KVSA 3R75A 1RWNA 2W0SA 3GDHA 1Q20A 4IV5A 3WLJA 3O8OA 4GOOD 1VL1A 2MSWA 5DBEX 3SHWA 1EGHA 3MOGA 3CF4G 3B85A 5FUVA 4OJMX 2QT9A 4PF1A 3ECAA 3LLSA 4XB1A 3DA8A 2R6GA 1J5XA 2DBQA 2JD2A 2N0SA 5FTNA 1K66A 3VNAA 2OSBA 3NV9A 2C8KA 4TLCA 4WOPA 4BOYA 4N5LA 1Z2FA 2H54A 3TRDA 1RWBA 4IOKA 1SQ6A 2VJPA 5HZHA 4TZKA 3MWEA 3VNVA 1U04A 3A1EA 2QVZX 3WYGA 1TKAA 2OCBA 2XMPA 2XUAA 4M1QA 3V2UA 1R0KA 2H2FA 2W6CX 3CKYA 4FXOA 4K9PA 1W47A 5DH9A 3V32A 1OV4A 2QX8A 3K5PA 1PSZA 3JQ9C 1L8AA 3VISA 2IYWA 1V3TA 3D3JA 3HBNA 3RS2A 4B3XA 4KIJA 5D2CA 1HNZB 4HVTA 1HYBA 3T5PA 3STVA 1AH2A 1VSUA 2XTMA 1BJKA 3AINA 4EARA 1G4HA 5ICGA 3A2KA 1S2IA 1E0SA 1M2KA 1OBHA 2FDXA 2PZBA 2XF8A 3QBEA 4PHFA 3ZC3A 1WXIA 1NL3A 1NBOA 2HU8A 2H2IA 1TXGA 3F3KA 3PGXA 4ZAVA 3LXUX 3I39X 4PU0A 1NUUA 3OMXA 5KYXB 4BJ6A 3F47A 2NZUG 4KZPA 1EM8A 2BM8A 4JI6B 1XEXB 3TVYA 3ZZ1A 1KR5A 1ZM2A 4Q01A 1YZHA 4GWKA 1N75A 2H4XA 3GOSA 2H1WA 2O6HA 3F7TA 4RKWA 3G02A 2E6UX 4FMCF 2O1SA 2QD1A 3WL6A 2DWPA 2OXIA 4EFKA 1PKEA 3ELDA 2YJ5A 1D7OA 4KDEA 1K5DA 1ZM3A 2H9YA 3O1IC 4HDMB 3HCBA 1A7UA 1VLJA 1DRUA 4XDYA 3O82A 1KP9A 1I3KA 5AKEA 4LA4A 4QLOA 1FTSA 5KSPA 2FMFA 1RWOA 3R5FA 4B3DA 1Z8HA 1XQXA 2QTCA 4ZTZB 2J0SA 3JARA 3LO8A 2E21A 2QUJA 1X9GA 4H1WA 3OGZA 1NQOA 1AU9A 2IW1A 2O1XA 2ZI7A 4IO1A 3U7FB 4KFUA 4UOEA 1SBZA 1YGPA 3U4GA 1P0QA 3O83A 4BAUA 1UDRA 1IBSA 4BFLA 3K9NA 3Q6IA 1EH5A 2AN4A 1HSZA 1YCDA 2EWMA 3A4MA 1WEHA 3INYA 3HR4A 4JV5B 4HGQA 4NCXA 2D4HA 3CLVA 2V0LA 5DYIA 2IUFA 1JTVA 2BBOA 4U8HA 2Y0PA 4B2PA 5BURA 5FI0B 3KQUA 3D2BA 2MT9A 2AI3A 3F90A 4R0VA 5BVHA 4C2AA 4M28A 4YAFA 4W5OA 3LL4A 1K86A 3LRXA 4FWTA 2NX2A 3HC7A 1PR5A 4D57A 2ZIAA 4XM2A 1BWSA 4YP9A 4Z9XA 2Q27A 4CV2A 1YZLA 2OO5C 3AR2A 3CNQS 2FH5B 3SR0A 3ZWOA 4BLSA 4QQKA 2V0GA 2AH5A 2P3OA 1D04A 4KK4A 1M76A 5FO0A 5ADVA 2AJBA 1JMVA 2DE0X 5L3ZA 4QLBA 2FWIA 3TPCA 1JG3A 1QYVA 1U6IA 3PHLA 5TGZA 5CH3A 1GCOA 1BS9A 4AJEA 2UXDB 3HDJA 3TGLA 2P5UA 2VI5A 3DG9A 4Y1RA 1Z4LA 2IZ1A 1SXJB 2H9AA 2E5FA 2PL9A 4YGYA 4MYTA 4HDOB 3CZCA 4ZRMA 2BAGA 2VC2B 3CZ4A 4H9GA 3GFVA 3UB2A 1CDZA 3OA2A 1RZ3A 3T1VA 4CKCB 1TAHA 1TKRA 2WSBA 2CBZA 3LUHA 3FMVA 3PZRA 4MUJA 5E95A 3TDNA 4LBZA 5SY6A 1GLVA 4WN3A 1TVKB 2LTAA 1CV2A 1E69A 1F2DA 1P2VA 1SJ9A 3C5EA 2MMGA 2DY0A 2HLDA 3FZQA 1FK8A 2FN9A 3HLKA 4TV8F 3E7XA 2A0UA 3GGJA 3S2IA 1O95A 1GSHA 1O8BA 4C20A 1D4AA 2QY6A 3JQAA 3QSGA 3WYAA 3AESB 3JQAD 1ACJA 3LO5A 2VDKB 2H1HA 1UIMA 1ZHHA 2H57A 3OQIB 4OQQA 3H2IA 5JQGB 5KNCA 3EVTA 2O0HA 3D6HA 2FOXA 1VE1A 3HQ4O 1YF3A 1VOTA 3WR5A 5GGXA 1PP4A 4ZPXA 3OPXA 1CQWA 3MN1A 2C61A 3AM3A 1EDZA 1QHEA 4LJSA 2J6BA 2NZXA 1LRKA 2IHKA 3HEAA 3ZHUA 4LXUA 1J0BA 3DT8A 1MJ5A 3Q3CA 4MEJA 2C7GA 3TDTA 4N01A 2H16A 3VPCA 4ENTA 3L0YA 4F3YA 1V37A 4HAOA 4WDRA 3J7AC 3BRQA 5FOQA 3BWCA 3AFGA 2E7ZA 3I8OA 3O3CA 1V9CA 3FFTA 1ULBA 3ORFA 3EAQA 2YIJA 4HRYA 4NH4A 4ARUA 3PKZA 4KMRA 1KZ6A 4LKOA 1QKKA 5JZBA 3Q40A 2CFTA 2B6NA 4KVFA 5E0KB 2EL7A 4U3JB 4ZVLA 1GG8A 2Q1UA 5CP8A 5BRJA 4M0DA 2EGUA 1JG6A 3VHXA 1VYVA 4XEUA 4DF3A 1EIZA 1BEZA 2XMSA 3F5QA 3K8ZA 4BP3A 5JE8A 3GZJA 3SAJA 3T41A 1OGYA 3ROEA 1X7YA 2R79A 3IQDB 1P1JA 1VBKA 2QYHA 4E5VA 3ZXXA 3X1JA 3TE7A 2IOHA 2FEMA 2VJMA 3UK0A 3IT0A 4N9WA 4OGGA 2Q2VA 1MPTA 4H7EA 2R5FA 2XUQA 5H70A 1GWNA 4LJ7A 1TTPB 2CF5A 4Z51A 5C32A 2FPGA 1USKA 2PYZA 3IBSA 3EVAA 2VPQA 3PHBE 4DCVA 3RS4A 2EP5A 1ZH2A 2ZYAA 3K0BA 2R1VB 1Y6QA 3PZBA 4LDJA 3BCRA 1I0IA 1UXKA 3QBDA 1CHDA 4DVGA 5IM4A 1TUEA 1T2NA 1ZBDA 1XNGA 3D0KA 5F51A 1H8EA 1N9ZA 1ND5A 3DV2A 3EGXB 3IURA 4RKRA 1HY3A 3V6MA 3MXTA 2XYQA 5BWBA 2RHRA 1ZOPA 2XEXA 2JGAA 3BQMB 1VLMA 4RO0A 3B52X 1TIKA 3Q6MA 3KL4A 1RKUA 1T4BA 5ITVA 2IHYA 2FJPA 3C7AA 3DOIA 4G5FA 5IN4A 1AURA 1UC8A 2FEWB 5DEPA 2AG1A 2PWZA 2ZUCA 1KO1A 1XG5A 5JW6A 2F4VB 2VWHA 2DAPA 4AMGA 2ZVQX 4Q3DA 1UF9A 4AKTA 2PU7A 5LIPA 1U63A 1G8MA 1N5LA 4PYOA 1CUIA 2ATEA 1N5MA 4R1PA 1V67A 2FG6C 2HDWA 1L5WA 2JD1A 1VA4A 1U3UA 2XLBA 3LC2O 3OTQA 1DG9A 3UMGA 4DV4B 1J56A 3BQ9A 4B7XA 4XVHA 4AKSA 1FDVA 2Q5CA 3S29A 4WUVA 3RGGA 4BQSA 4UFPA 4FFNA 4PZ0A 4DLNA 4OFZA 2OMKA 4GG1A 3E3NA 4GOND 4D3YA 1I7SB 1FFYA 3FJOA 4BVHA 4CWAA 1E6WA 4CUKA 5ELXA 1SHKA 3LGSA 1FXJA 3D8VA 2H0QA 2HRCA 1E6UA 1LQ2A 4QC2A 4BNLA 1V5EA 3Q4GA 1U0OC 2RGDA 2ZWAA 1HQKA 4QKQA 5KKNB 2EBFX 4G4IA 3FMIA 3P0RA 2VP3A 4GOJA 1Z5WA 3L4EA 4GUDA 2TECE 4GI7A 2CEAA 2VQEB 1E94E 4P33A 3JAWA 4GP7A 2ZIEA 3I9FA 1GZVA 3C48A 5BT9A 2AOVA 3N7AA 4MYSA 2XF2A 1ZU5A 5SYMA 3S8YA 4BO1A 3JYQA 3K9FC 1GPMA 621PA 3WWEA 2ZJYA 1E2UA 2L2QA 5CGZA 1XTJA 2P9HA 5BYKA 1PGQA 4GNRA 4DCCA 1V71A 4BFYA 2YHSA 4HH0A 5HZGA 2C4NA 1IHDA 4KNVA 4UVEA 4JOQA 4BVGA 3O75A 4G5HA 5H4HA 3RC1A 3MXOA 5DYGA 3PD0A 4GW3A 4OYLA 3CNLA 5AM1A 1XZ8A 5TMEA 1MAAA 2CVOA 2P2DA 4J3FA 1BOFA 7MDHA 1Z5PA 3KOMA 3L1HA 2PX6A 4EA7A 1X7WA 3FWPA 3TMKA 4LHSA 2IYYA 1XE3A 1W46A 4EENA 4FPXA 5AXCA 3JVDA 3AVQA 2BHRA 4PICA 5EMKA 4R2LA 4BJ5A 4JLJA 1LLCA 4A6PA 3Q7QA 2FRXA 3UNXA 2D00A 1PYDA 4XB2A 1IY2A 4MPTA 1EFVB 1KWKA 1Y3CE 1XDGA 3RSLA 1SSQA 1W9MA 3IEMA 2FMHA 2GXAA 1POWA 1ECJA 3NRJA 5SICE 4NBWA 2WHPA 2MWMA 3ITDA 2HMAA 2VSOA 4ZVKA 2ZWIA 1AV7A 2D2IA 5TPZD 5B3JC 4F93B 4O4HF 2DSNA 2BEVB 2AEFA 2HEIA 2WFZA 3QMMA 5TQ2A 2PRZA 2P27A 3NXSA 3IH5A 4WQMA 1BMFD 4GKKB 1I33A 3DL0A 3UG7A 2N1BA 3A1VA 4QDOA 2Q9BA 5FA6A 1DOAA 1HDOA 1MA0A 2C7BA 4IOMA 1YMVA 3QI2A 3FHCB 2FG7C 1XFAA 1L7MA 2NXNA 2QAGB 1EQUA 2DUJA 2Q9UA 4KPUA 4UM8B 1BEUB 2GBLC 2LKDA 4QQRA 4Z86A 4O6VA 3ESAA 4C03A 4P53A 5J58A 2I87A 4EB0A 1E2BA 3HBJA 4AJPA 3ADPA 4DDKA 3CNHA 3KYCB 3WMWA 1GA4A 1Q19A 5E2AA 3SLKA 1KDPA 4JEIA 5D7BA 4OF4A 2XYRA 4HPWA 1FOEB 4RSMA 3STYA 2DQKA 4Y6PA 2QJWA 3DCNA 5GJCA 1TX4B 2R1VA 1P7CA 1XEWX 3NASA 4FYWA 4NYMQ 5DPMA 1JR3E 4DMKA 1SUIA 2C59A 3VPGA 3F6CA 4M37A 3OH8A 2REBA 4CVNA 2QU8A 2CNBA 5JISA 2H4FA 1GXSB 3RTCA 1ZINA 3G79A 4L78A 2XGOA 2YY6A 4TQ9A 3BWYA 2ZYDA 4JB0A 1B8NA 1SQ0A 4WXHA 3PNLA 4NI5A 3GEIA 5KZMB 4U63A 3ZK8A 3A9CA 4OQXA 4PG5A 4F46A 3V8RA 1EGQA 2ARKA 3AEYA 1KJJA 1NONA 1NKSA 2GETA 1RWWA 2HX1A 2SNIE 3HJRA 1G63A 4V0QA 3U3XA 5JDCA 4FQ5A 3PQ8A 1KEKA 1T5OA 1XDSA 3HB9A 5EXXA 1ZD1A 1UZUA 4U3JA 4HYQA 1E5QA 1VHDA 1DZIA 4PYKA 3RTAA 3WYFA 4ETWA 2XYVA 5ALSA 5I4BA 1FMFA 1NWHA 5AQEA 4YRNA 3P9YA 2FWAA 2PKQP 2HBYA 2VTVA 3MWLA 3GUZA 4LS3A 4PFJA 5AJYA 2GBLA 2P9QA 2WUVA 4CKZA 3RYCA 1JH9A 1QRDA 2CLSA 2G4CA 1MEJA 4IIHA 3G85A 3ZXYA 2HR1A 5LL6P 1CFJA 1X13A 3GGDA 4G09A 1NASA 1T6ZA 2QLBA 1UPCA 4IDNA 4OHOA 1I2BA 5HQJA 3SQNA 1P9WA 4NH0A 5ALHA 5I5GA 3E23A 1G0OA 4V24A 1XVUA 1GRCA 1E2JA 1WZEA 1NF2A 1ZM9A 2HUNA 2ZKIA 3A27A 3COSA 2BC9A 3P9PA 2I4MA 3IA2A 5BYJA 2BM9A 5HOQA 1AT1A 1ZNWA 2F3UA 2KLBA 2AZDA 5IANA 4DMRA 2B1QA 1G8AA 3FPHA 4A6XA 4UVGA 3V1TC 3EPHA 3T5MA 3B89A 2M1ZA 1IM2A 1J8YF 1W8IA 2HMYB 1OZ0A 3H5IA 4J7CA 2NYRA 1R2QA 2C2GA 2CVPA 2OBMA 4FBMA 3I6BA 5ALYA 2P3SA 1TVMA 3LDFA 2UYCA 2A57A 5IT9A 1HNWB 2F64A 3AXTA 1KNQA 1KC3A 1PL0A 3F1KA 3IULA 2CFSA 4GBJA 3KWCA 4J07A 2NO0A 2VA8A 4HWGA 1LXCA 2W8ZA 4JS0A 4LQ4A 4C6RA 1I7DA 3SVLA 5B1YA 1L5VA 2PUGA 4DBVO 2V8OA 4RTQA 1Y33E 5BV7A 5F7OA 2XB4A 3J81k 2VHYA 3ZTYA 2YWEA 1GTZA 3QWAA 3VMFA 1W96A 1H3FA 3FMGA 4DR3B 3KWFA 5COQA 1MJHA 2W4MA 3U09A 3L7MA 1Y5LA 1XRRA 1Z2CA 4WINA 5K51A 4D6XA 3WGVA 1XSEA 3RUPA 2GAOA 1OZGA 3F9IA 1SHZA 4N40A 4X6UA 5I3ZA 4XGQA 1BIFA 4CDNA 4TT8A 1THGA 1T3GA 3LM8A 4LY6A 4N6OA 2Q4DA 3C1AA 2WK1A 3RB8A 5GJWC 3RE1A 1UJBA 2F9MA 1V4NA 4OSOA 1OQAA 1LTKA 1Y5MA 4A2WA 3N53A 5C2JB 3ZG6A 4WV3A 4YALA 3EK2A 4OH1A 3IXQA 1RQNA 2QVCA 4D3DA 2JEYA 4K6CA 1FDSA 1NTRA 2GBGA 3L8DA 3TIOA 2YV5A 4NAVA 2J5BA 1Y34E 5L45A 5AVYA 1ORVA 4NNPA 4YP5A 1QHGA 2IYXA 4LZPA 3TW4A 1DSSG 4L74A 2BGKA 5EFOA 4G6ZA 3W7VA 2I76A 2X22A 3HCEA 5LYJA 5A03A 5EJ2A 5I7SA 1XGKA 5IDWA 1NJGA 1YIDA 3WLNA 5IPFA 5IM4F 3HY3A 4BP9A 3P32A 1VYHA 5CVUA 4MAAA 4PZAA 3KR9A 1MH1A 4EZIA 1TTQB 3TD6A 3E05A 2V7QD 1E3WB 2F90A 2GCOB 2XTNA 3M6VA 5J2TF 2K4MA 4IVPA 1XDUA 3U3KA 1J1ZA 4E4RA 4J09A 1L5LA 4X6LA 5ESRA 3BDVA 3FA2A 3DZ8A 3HU2A 1UPTA 1PJSA 5HPYB 4JJ6A 1MHTA 5AYVA 1VL5A 3LXXA 2ZETA 4OO3A 4RD0A 1UL1X 5AJTA 1P7PA 2Z2JA 3O6VA 9LDTA 5F9FA 1E0AA 4ZK2A 1RAGA 2W9XA 2AI2A 1YIAA 2PL5A 2HKIA 3AKCA 3LC1O 5KYYA 4C6TB 5IN5A 3V3TA 2XXAB 3R5AA 3VOAA 2XTJA 3EULA 4LJAA 1RQLA 3BHNA 1G97A 3JAKB 2DJIA 2Q8QA 2R7LA 3QW4B 3WOVA 4I4LA 3U4DA 5HILA 1E1NA 2X6RA 721PA 4RZ3A 3DV9A 5E4TA 4DS3A 5CIQA 3BF8A 1G7TA 3AF2A 3SDZA 1JHYA 1C9KA 1K98A 2PX0A 4N7RA 1I9CA 3KKPA 2ZPAA 2XODA 1NMZA 1BGWA 2A9JA 2WF7A 3M4XA 3JD0A 4DIDA 1U8FO 5DYWA 2R5NA 3Q85A 2XVZA 1M1YA 2Z6VA 2JFFA 3QU4A 1QSGA 3SEFA 1RLTA 5JI3E 2V59A 2LKCA 2B69A 4OBWA 3NNDA 5DMXA 5EHIA 5KX5F 1Q1NA 5JJLA 4D8VA 4R9VA 4JNCA 2IYPA 4B9AA 1GPJA 2CZGA 1GSOA 4PPQA 1W48A 2PZAA 1WDTA 3CY6A 4QDXA 1S89A 3FCOA 5G2OA 4ZGWA 5I6DA 1NW5A 2QSUA 4I4TB 5K0ZA 3OZEA 1XJ0A 3QY9A 1SPXA 5F7XA 3MHTA 4AYTA 3S99A 1KBZA 3TXAA 3QELA 2Y1FA 4YJGA 1NQUA 3AV3A 4JITA 3RRMA 3CJRA 1N92A 4G67A 4Y1FA 4FBGA 1L5ZA 4ZYYA 1ZEJA 4JEMA 3TJMA 5EZYA 3B82A 5ILOA 1LW6E 3R3YA 4Q18A 4Y2YA 1YFZA 3I3OA 4RJIA 4I50B 2GF2A 2CJYA 2HK9A 3KELA 3MCVA 3PDJA 5THKA 4TMFA 2XDQB 2GH1A 4TV9B 1DU4A 2W2OA 4D9IA 4EFLA 3M83A 4JX9A 1KKLA 1MU0A 3O92A 1I1NA 1LPNA 2DB3A 3LF2A 1BNCA 1HZZA 2PWAA 4L6AA 4QEDA 3THSA 1YR2A 4COKA 2B37A 1H9AA 1JDBC 1GFIA 2J6CA 4IX1A 4F1JA 1T2VA 4TUYF 1NUSA 4GMFA 4ZU3A 3QI7A 5LPNA 4J29A 3HCWA 4CLEA 3MQHA 1XN1A 3QVSA 5AJVB 5FWYB 5AIBA 4E4YA 1R00A 1QGED 4KXFB 4FSXA 3VSCA 1R0LA 3VO9A 3KZOA 5DRYA 3BWMA 1VBMA 1KH2A 3HZHA 3TDMA 4D96A 3RV4A 1CZHA 1IIBA 3HKCB 5EJ4A 2JJ2D 1SCAA 1YA6A 2W22A 4HATA 5JVDF 1JEEA 2Y67A 1PRYA 4WX2B 3TSOA 3AR6A 1YR8A 3ND5A 3DB2A 3QGMA 1P5HA 2LDXA 2X13A 1JQAA 3H3XA 3RVSA 3TSZA 4BMPB 5CDGA 3H84A 4L28A 2PZMA 2ONYA 2XNCA 3RRXA 3HU1A 5TJHA 1ZK4A 2JBWA 3N8HA 2HLHA 5A4MS 1Y5IA 1GRVA 4X1YA 4O2RA 3PQ4A 1M8FA 1YS7A 3HN7A 4GM1A 3L7BA 3GLFA 5ITZA 4YRAA 2O7RA 1KETA 2C0QA 3DE5X 5DLPA 1XF1A 3D4OA 4ML3A 3SHQA 4X3OA 1TAUA 1E79A 2EARA 4B4OA 1EP1B 4NCHA 2OP0A 1PNVA 2LWIA 3NWPA 5HCUA 4PG7A 2EKBA 4ARSA 5KWVA 1OI3A 3MBKA 3C3CA 3L49A 1PWHA 2E4VA 2OPHA 5K3FB 3FYUA 3MVEA 1XRNA 1TA4A 3NB0A 3RK4A 4C4OA 3K70C 4J3JA 1AZWA 1E2NA 1FUYB 2V0IA 1TQ8A 2QPTA 4N9QA 2YQ4A 1ISMA 3CN7A 3P2IA 3W2GA 5J4HA 4C04A 3OTWA 4J4TA 4BNIA 1P81A 2R7KA 3OZSA 2HSWA 3L0BA 1RZUA 3OE7A 4FILA 4IIJB 5JAHA 3TI9A 3R76A 1NUQA 1WDKA 3WP1B 4LN1A 5H3HA 4A2QA 2QRPA 4EH1A 2DBZA 1I01A 3ELWA 5JOQA 1ZSVA 3IO3A 4HZUA 5CVEA 5CAEB 4HT3B 4Z1OA 1ZNYA 1F2UB 3WWDA 1ELOA 2AOUB 4L3OA 1L5HB 2QOEA 1IUOA 1OLXA 2GAJA 5ES3A 3KLPX 4KO8A 4JLKA 5IAJA 2C7OA 1QV6A 2QYOA 1YU9A 3EQ6A 1A5SB 3QE9Y 5A71A 5JFGA 2OECA 2ZS7A 4EYOA 2J41A 3GLSA 1B43A 4Q16A 2FP3A 4WY8A 1Q21A 4OAQA 2ZBDA 3WRXA 5ALUA 2IX3A 1XRQA 4RHXA 1U7OA 4ND1A 1L5HA 1ESNA 4EECA 1JJIA 5EMLA 1OVMA 5ELLA 3OUTA 3KSAC 2WIDA 2YQZA 4BZZA 5FWXB 1RZRA 4NULA 1PQUA 4K26A 1CE8B 1FDUA 5FL7D 1EWVA 1HYQA 2JEOA 2L42A 2OBYA 1MV5A 3IAM6 4A36A 3H86A 4UW9A 4MEBA 1SQ5A 3SE7A 3DZFA 4HWOA 3S5UA 1NRXA 3MTDA 1FQKA 1OH8A 3LA8A 4FHEA 4L51A 3KOUA 1NQ5A 2OXCA 3OJLA 4D74A 3LT1A 1RM4A 2NYAA 5HRCA 1NULA 1ULUA 3OU6A 4Q47A 4LOHA 3KYDA 3H9GA 3T1YB 3PNBA 5JI2E 3EQ8A 4GZLA 3DC7A 5DHRA 3R3XA 4MQEA 1FLAA 2PZJA 3PGJA 4WOBA 5DULA 5H68A 1L1FA 1W36D 2QTFA 3RS8A 4QBIA 3OTIA 3QPWA 3OM1A 3L8CA 3KUUA 4KQEA 4EG5A 1T13A 3N6XA 3TF5A 1DIHA 3ZGYA 2P2LA 1FIUA 1GQQA 4Q7LA 1DNPA 3VOSA 3MTEA 4DNFA 2HSDA 3OPVA 2E3JA 2ZB4A 3OOYA 4B6JA 3L8YA 4QQFA 3VPHA 4CDMA 1W5SA 3K15A 4ZI5A 4J49A 2VPIA 5E6RA 1T26A 4K9MA 1DC4A 1R4NA 4K7JA 1G95A 4TLLB 2P2YA 2I67A 4FKZA 4CCWA 1WDWB 1A72A 4FMPA 1K9SA 4RLQA 3IEIA 1PT6A 1R0XA 2UZ0A 3QLUA 5HM6A 1E9DA 4GQBA 4RGQA 4W99A 1P74A 2TMGA 4HG2A 5K0LA 2QE7A 1WL8A 2NU6B 4K8RB 2RDMA 1W6UA 3SEQA 4AS3A 5CLJA 1DXOA 4MUYA 1G6HA 5FL7A 4ETMA 3GDWA 5K0SA 5A3SA 2YUIA 1BHSA 2FP4B 1SQSA 3M4YA 2O8VA 1TF7A 3KPVA 1CUAA 4LSMA 4L8YA 3ZW8A 3BC1A 4GR5A 3DVLA 1JQ3A 1R6TA 3WDMA 4MGIR 3VVBA 2I2FA 3Q5GA 1W1WA 2W2LD 4Q1EA 4KQFA 3TK8A 5EIWA 3TTVA 5BRNA 3M2PA 2N46A 2YY7A 3RCBA 1JDJA 1HT3A 1S2LA 1U02A 3A05A 1FBTA 3U4AA 1RW4A 1F60A 2PLAA 3WKEA 3SDBA 6PFKA 1PWZA 3ZU2A 3HUUA 4GSKA 2G76A 1VRVA 3PL1A 2HK7A 4EB3A 1KK5A 1TJNA 3BE6A 3FFBA 4G9BA 3EHEA 1F2TB 1ZH8A 3TLYA 2JIZD 2A1TR 2ADOA 1CUHA 2G5CA 2SECE 5JS7A 2AQ8A 1UQUA 3QFCA 3QYFA 5G3ZA 5KMGA 1A5TA 3LFHA 2A14A 1JPVA 3EZ6A 3AEKA 3QWIA 4K8OA 3RG8A 3WSTA 4Q5IA 2ZPUA 2VRCD 4YB8A 3RF7A 1PSWA 4HQKA 5JDIA 3ILVA 2FEKA 3V1UA 4X9XA 1I51A 4MV6A 5AI6A 3OIFA 1C4OA 4F12A 1V5IA 1Y42X 2XNSA 2K5UA 5IDXA 1DUIA 3DVSX 2Z43A 3F5MA 3KOWA 4HDRB 5GONF 3ROTA 4FW8A 2JIZA 1C7QA 1KPHA 2PQ2A 5EE5B 4A23A 3EVEA 2NO4A 3GGOA 2JCXA 5JSZB 5IH3A 5JROA 5HWSA 1QDUA 1ORDA 4IS2A 2R11A 2JRCA 1XDWA 3HJHA 1RXCA 3KVVA 5CU7A 4WBNF 5B12A 1RLMA 4P83A 3P7MA 3QK7A 4UHBA 5DFAA 2PZLA 3BTSA 1U9IC 2I2WA 2A2ZA 2GXUA 4JVLA 1TUBA 5EXDA 5FH9A 1CUJA 4KYIB 2WKWA 3ZHTA 2I7DA 4D41A 3JU3A 4IVQA 2ZP1A 3H1AA 4FHCA 4A4DA 3F6BX 2X8LA 1FB5A 1KVTA 1O97D 3E1GA 1DAGA 4IIBA 5FBWB 2M6LA 4ZI7B 2C7PA 2P9BA 4WA7A 1WP9A 1SCNE 1C8LA 4YCNA 4CEHA 1ETHA 5K8TA 3A4LA 1RR6A 1T5DX 4DEXA 2OEFA 1BS2A 4ZA2A 4IH9A 1U9JA 2P2GA 1PWEA 4NZ9A 2H2AA 2COKA 4Q6BA 3AL2A 4E03A 4YX9A 2MINA 2OLEA 2QM8A 1UIRA 2ZI3A 3ZZ0A 5J1SB 4RSHA 3U7EB 3UOAB 4V1CI 4EA6A 3GJYA 5DNAA 3KHKA 4N41A 1EWWA 2R1UA 3WL3A 2EHJA 3ETHA 4DR6B 1N2BA 1M2VB 4NR0A 3I2IA 3JVIA 4GZMA 2YHIA 4MV8A 5ICEA 3OIWA 3SJAA 1G41A 1TO1E 1N1GA 1JFRA 1G7RA 1THZA 1XBTA 1ZONA 1ZVQA 2XVXA 3LDGA 4HXFB 1SA0A 1MQSA 4MCAA 4DMHA 3EGVA 2C2KA 2D62A 2X3UA 1T3LA 4FHZA 4P5DA 4WBXC 6AT1A 4JP1A 1VPLA 4GX1A 4UASA 3VDMA 1ZN8A 3FYTA 2V3CC 2CYBA 1O89A 5K6AC 3IKJA 4HVAA 5B1IA 5A5DA 4DLRA 1ZITA 1GAXA 2RGEA 1ORIA 5F33A 2OV1A 4JK3A 1U9ZA 3CEHA 3HB1A 3KZ1E 4AJJA 4DZZA 4RABA 4HVLA 1BX3A 3D2CA 3PCRB 2H5IA 2QHXA 4DQ0A 1DE0A 3AVXA 4M0LA 1K6IA 4WCFA 5AM5A 1LC0A 4RH1A 1U8UA 3B13B 1ZW1A 5B36A 4EITA 1B0PA 1E3SA 1PDOA 1ZVJA 2RGGA 1U5CA 3H42B 3E9MA 3QKTA 4GXTA 4Q37A 3UTCA 1F3LA 1YVEI 1P5RA 5DOVA 1Z37A 2R751 5CVJA 4QLAA 1YKSA 4TS3A 2QYTA 3C3JA 4XYEA 3CVOA 1HL7A 4MLDA 3SCZA 3R3IA 3VYVA 3E3LA 4CR8A 3W5UA 4F1WA 3RRZA 5JJBA 5EHNA 1Y9EA 4XKJA 1L7PA 2PGOA 3KD3A 2BFEB 4U7GA 2XXAA 2ZBRA 3F5SA 2QRZA 4LF7B 2ZB8A 1N3IA 1XCOA 2J0UB 2WI8A 3G2NA 4EDHA 4BLPA 4E70A 5HS4A 1Q6YA 1JDTA 4K9RA 2GWHA 1IULA 3GIDA 4WKBA 4TRRA 1FS4A 1MG0A 2HXSA 5AK6A 1RI2A 5KX5A 1T3DA 2JAHA 2ONZA 4HURA 4MPDA 2GTPA 5FR2A 2NTVA 3EIFA 3GEEA 5EPOA 3TOCA 5EIEA 3NHFA 1CF2O 1C14A 1DCMA 1GPH1 3IJRA 3Q87B 2WAYA 3RODA 4L5YA 4JXKA 4QPZA 3ENWA 3ZEIA 2IXFA 3EG9A 2BFNA 4GECA 1X0VA 1ZBQA 2BUBA 1EA7A 3AHFA 2PX5A 2FUEA 4IDBA 4KN5A 1P2GA 2I80A 3S5JA 4CUJA 2HDOA 5H9WA 1IN5A 3ORRA 4UCFA 3R4VA 5K0CA 3QEBZ 5JAQA 2REQB 5BY2A 2AYYA 4RK5A 3U7HB 3PWSA 1HG1A 3GJ0A 2FMIA 3BD9A 4W1QA 2AW5A 4LNUA 4OX9Y 5DOZA 1A9PA 2O3JA 2XRMA 3OFND 1GN9A 2Q0HA 4LPKA 4DSNA 5KX5B 3NPAA 4CTJA 1K2WA 4B6GA 4X1KA 3CLSD 4YAKA 1EFAA 3NT5A 1N2IA 3DTVA 3QU5A 3TSWA 5JAPA 1W85B 3F74A 1FRVA 5KREA 1MC5A 4QFMA 2IU3A 3VR3A 5DNUA 2JCBA 1SIUA 3C6YA 4NL4H 1T25A 2P79A 3DL2A 1MEOA 2WKQA 3D43A 3ZHBA 4R1UA 1U7HA 1NJSA 2BZSA 4JLAA 4R37A 2IZ5A 1CF4A 1QP7A 1KK1A 3I4LA 3NP7A 5K3DA 4E5DA 3NTXA 3LLVA 2QIPA 3SLRA 1JYSA 3A8TA 2B1RA 3QA3E 4GWGA 4KXWA 2D3TA 1IHUA 1U98A 3SIXA 4IZIA 1V6SA 2R1TB 4C0KA 1GNQA 3KPYA 5A0VA 1H3EA 3DLBA 5CX1A 2GYVA 4N5DA 2OHOA 1W52X 2BFPA 1FRNA 5AM0A 2QPLA 4BC0A 3QX7A 3U1TA 2CV1A 3TGWA 4LF8B 2WSYB 4EA9A 1BXRA 2R0QC 1QBKC 2OP1A 3V46A 4TSRA 4HS4A 1N8KA 2QRNA 4LHZA 4NCAA 4KQLA 4B46A 3F9RA 1X1RA 1D4OA 2ZYWX 4Z3DA 4C4TA 1P45A 3IB3A 4DLWA 5E4FA 3Q8MA 1DCTA 1E2DA 2PNJA 1J07A 1JYEA 1K6EA 4D9CA 2HQ1A 1D09A 1Y1RA 1E1QD 1Y9JA 4Z6KA 1RM3A 2WHQA 4BQRA 5HG0A 1QQAA 3TCKA 3R7WB 1UUFA 2ACVA 4YIKA 3F67A 1D9ZA 3L5OA 1M5RA 1O96B 1URPA 2RHCA 3B1KA 3EA5A 5DM0A 4DLYA 4F4UA 1ZC4A 2RHWA 2WKPA 2ZIGA 3PRHA 1Y8ZA 3PRJA 1EHIA 1CJUC 1O6ZA 2ODQA 3I0NA 3N1UA 5AKJA 2AZXA 4ER3A 2PO5A 1FYWA 1JPNA 4MCJA 1PGNA 1S8FA 3B5EA 4X6YA 3TI7A 1U3TA 5DWQA 3AFOA 1YR3A 2XMGA 5FOSA 4MXDA 3H5OA 2VCHA 2BFFA 4BNKA 2GAFA 2I29A 4DR1B 1LWOA 2BHLA 3PC8C 4KQ9A 3DFUA 5I9BA 5B37A 1PK7A 2R96A 2O54A 2X0JA 1LI5A 4Q66C 4BZQA 5GPBA 2WM8A 2Q6KA 3UJCA 3BAZA 2QN1A 3NUQA 1YL7A 3DMRA 3WA7A 1H94A 2HB6A 5FUYA 2MU1A 1XZIA 2WYWA 3H4IA 4AU1A 3PEFA 4BASA 3AR5A 2VFAA 3K16A 3WGMA 4B3TB 2P62A 3VR5A 3HSSA 4H3HB 4X92A 4B71A 2HMUA 1U3GA 4AZ3B 1FP2A 3L5KA 4JT9A 2CLCX 3HVIA 3HYSA 4ODIA 4DB4A 3HB7A 4RQBA 3HJJA 4NP6A 1XRPA 2QZJA 2VAWA 4KWIA 3JZAA 4HUQB 2GZHA 3D7RA 1KPIA 3SFVA 3I6ZA 3EPLA 3ETGA 1NM5A 4HNHA 4O4IB 3RAPR 3ZLBA 2ZQYA 4GIBA 1RPJA 4NTZA 5FXMA 3RLFA 4CMHA 1T6BY 2HIHA 4KH1A 4TKUB 2FG5A 3R7BA 2YR0A 4W9MC 3EPPA 2P67A 2WJYA 3EX7C 3OIUA 3AM4A 1GYPA 2O2IA 4XCXA 3LPDA 2VJKA 4MVJF 5FBVB 3WL7A 5BW5A 5EMHA 3THWB 2P9CA 3B9PA 13PKA 3ANYB 1VRWA 4XJSA 4Y3UA 2P9EA 2EQAA 4E4TA 1T5BA 3PUJA 4J9VA 2JASA 2V7XA 2X0FA 1Y81A 5ES4B 5IJWA 2WEKA 1WZIA 4IZHA 1CY8A 1WPXA 2NT4A 4LHXA 3DFFA 4I4TA 2X0NA 2NV6A 1GARA 2DFVA 2QW1A 3C8MA 2B61A 3N0VA 2WHEA 5ALVA 1FFXB 3DUFA 2QQFA 1KKUA 4O33A 4Y2JA 3NOVA 4OQ4A 4YRDA 2JB9A 1M34E 2Y93A 3BE4A 3UOGA 2OTCA 3IHLA 3TNLA 2J9YB 2VKTA 1YDEA 3IUBA 4JLUA 4MS3A 2EW8A 2GD0A 1TZBA 4QYTA 4EJ6A 4YT4A 4MRAA 2QI9C 4OB7A 5BQ3A 3K70B 2JI6A 4LWPA 4KO4S 3SIWA 4HV4A 3N7TA 4L57A 3B53X 8MHTA 1PT7A 3ORQA 4H16A 2O2CA 3NBFA 4S12A 4IH4A 3M7IA 4WVLA 4JI4B 3BXYA 3UF0A 4BVJA 4HB0A 4NCIA 4BUZA 1U1IA 1PV1A 2A0XA 3FUUA 1S01A 1R4MA 2JFGA 3THRA 2LCIA 1Q7GA 3ZYZA 4QGHA 4M0MA 3O93A 3EIXA 2WP0A 1FRQA 1QH9A 5HDBB 4BXOB 1KY4A 1Y3AA 2ODWA 3PJGA 4B3IA 5K03A 1AF7A 2H1LA 4GVPA 3PE4A 3QXCA 1YHNA 1UCFA 2RAUA 3L7CA 3N2GB 1IBRA 2GPWA 3OQ6A 5AHOA 4XLLA 3C85A 2NO5A 4KGDA 2XKBA 4EW2A 3KQOA 2BGUA 3NALA 3DOCA 1DXHA 3BWBA 5E3IA 4WOCA 1Z35A 5ICFA 5CEEA 4AAYA 5IDVA 1OD6A 1EESA 2AXNA 1M34B 1U2TA 1TYZA 3WGIA 4KLRA 2D5IA 1M54A 1NR7A 2IGBA 2PMEA 1E3MA 1DC7A 1T0PA 3GN1A 1I10A 1PFQA 4EPYA 2ZRAA 3NQ41 3SS8A 4JJEA 4OHRA 4H1TA 1F4LA 5DBFA 1SCDA 4YLGA 1YBHA 3A2MA 4ZI7A 5U4QA 4OOFA 3E0QA 2CB9A 4C7MA 1WUKS 1NOKA 4CIBA 1H2RS 1RADA 3DXYA 1M0EA 3EQZA 5BN4A 4R2IA 3ZKWB 3N8IA 1XKLA 4YROA 4OHMA 4PLWA 1K75A 2RK4A 2X9QA 2AKAB 4GP9A 1KK4A 5CXXA 7YASA 1BHO1 5AW9A 2GDJA 4FOLA 5A9TA 2H31A 2ZYGA 4R40A 2GKOA 3CPSA 3OETA 4DCPA 4IJWA 3R7NA 3PC2A 2VUSA 2B0JA 1OT3A 5L6SA 1SBCA 2ZAIA 2LUOA 3B3FA 5GQSA 3ISVA 1SQFA 3N9IA 3R8XA 1WBBA 3PRKE 4YUWA 5J2UB 1JI3A 2GR9A 3ND9A 5IBCA 3VR6A 4BNJA 3TDKA 1FXWF 4G0PA 1BXGA 5JV5A 4B3MB 2IHTA 4RJTA 2AUNA 1QOZA 4WN9A 3R6TA 1ZIXA 5KQLA 3CJTA 3S44A 3G68A 1WSAA 4DV1B 2VAVA 1VA5A 2V5UA 1UMCA 5BPFA 4XZ3A 1ZAKA 3OCYA 2CJWB 4W63A 2Y1WA 4U1RA 5ITZB 2FDCA 1H6DA 1PWYE 2JVJA 2WSLA 4I1IA 5HE9A 4ZI7F 4TKLA 2AOTB 3THYA 1JFVA 4UFNA 4MK4A 3EBLA 3AERA 3CMCO 4X20A 1QG6A 1PS9A 3IAAA 5TX7A 5CB0A 2GEJA 1JI0A 4RHUA 1IUNA 1FUEA 2GX6A 2OHJA 3PNVA 3H6HA 4IHHA 4Z9FA 5E7JA 1Y5NA 4C4RA 4E2YA 4EMBA 1Z47A 2JBHA 2MSKA 2Y76A 5DK4A 4QJ3A 3WX0A 1VB5A 2JFVA 4PGGA 2FJ0A 4LC0A 3X2FA 4A8JB 1CEEA 3HXQA 1DX9A 2CLEB 3QPAA 4TMZA 2FK7A 2FSUA 1QP0A 2Z5VA 3DOHA 5KWEA 5KC8A 2Z6UA 3EZNA 1THJA 4N27A 3OFSA 1REQB 3RJ9A 2JS7A 5CFPA 3Q5EA 1UMDB 3NGLA 2DPYA 3M34A 4R36A 3C39A 2QP3A 1PVOA 4RK7A 1BCSA 2WIAA 3EVGA 5DI3B 4E6EA 2CFIA 1ZGJA 2HDNB 3H6KA 7GPBA 1QHIA 3OZFA 1SVSA 4FR0A 1GNTA 3GDOA 3TCNA 4QDJA 1FS5A 2YKGA 1Z3IX 3PGVA 1CZNA 1DEKA 1H9CA 2A1UA 1Q95A 4D9HA 3MRVA 3UFXA 3RYCB 2OYRA 2VJCA 1RYHA 4PPNA 3A4IA 5ICMA 1EUDA 2IZ6A 3PSAA 1SXPA 4RKEA 1I3OA 1JQLB 4FFLA 3FWWA 2Q3EA 2J9ZB 3U37A 4OSPA 1PR2A 1UWCA 4TRJA 4C2UA 4MQ5A 1G3IA 1ZFNA 4YPFA 3LNTA 2BH9A 5CDSA 2ZT8A 3PXDA 5DF1A 2OQ2A 3BSSA 3K05A 3QELB 3OQHA 2LXNA 1MR3F 1WF6A 5KTKA 5DTQA 5DBHX 5IS2A 4B2IA 4UAUA 3EFBA 4KQIA 1OWPA 2ST1A 3CXRA 3FBTA 1PSDA 3NHRA 4L0MA 4L1KA 4G4SO 4GR9A 4JP8A 4PC1A 4PZLA 3ZJUA 2JLAA 3FTQA 3PBKA 1OU0A 1U3WA 2DKOA 5KQRA 4DIOA 5KC9A 3HCRA 5TGDA 1HLDA 3QA9A 1XTTA 1G4UR 4GGPA 5F4BA 4EJ2A 2QX4A 3UAZA 3AKDA 3BXZA 1IOLA 4FS3A 3FSBA 4GDFA 3B7GA 4S1VA 3M5WA 5DGIA 1GTG1 2VOJA 3PPYA 1L7BA 2X15A 1KI1A 3RYFB 1SELA 3OFNA 3G2JA 1TDTA 1AOXA 2P68A 1I1HA 4M2BA 3GX1A 3PXAA 3VMMA 1R9GA 1Y3BE 2OLKA 4GKVA 3BGVA 5E38A 1XMJA 4HZUB 4B83A 5KTOA 1BS1A 2FMTA 3ZJTA 2HMWA 2M1XA 2NT3A 4KMOA 6REQA 3CQ9A 2F2TA 3DQZA 1MGOA 3AH8A 2IU4A 4M2LA 5L53A 3GFPA 3NDRA 1M66A 4PBTA 2QBYA 2OORA 2PMBA 2V58A 4R0NA 1YB4A 1T9HA 1NVTA 4ZKEA 4JXXA 4C0LA 2GZMA 5TQ2B 1M1XB 3G6WA 4Z3OA 1OAOC 1V1MA 3AJEA 1BG6A 2Q0SA 3OTGA 2PZFA 5GTDA 4K3VA 2GRAA 5KSOA 1U8EA 3U56A 3Q41A 1RC8A 4CMEA 3UV3A 1XRMA 5DLDA 4PRKA 3BXXA 1Y1QA 3CF2A 2FQQA 1JEAA 1XZPA 3DEKA 3QVWA 4XPZA 1OFTA 4WK6A 2OZKA 5AVZA 5GWXA 1NNEA 4YRJA 4P3XA 5CBPA 1QJCA 4CU2A 2EC5A 3HPQA 4OCZA 2WMDA 3HUFA 1Z7EA 1WMDA 4CKWA 5F9HA 3NWBA 2AG0A 1SH7A 3EFOA 3OQPA 5F1PA 1LLDA 4MW2A 3JR7A 4PYMA 5JFTA 2F1KA 2PD4A 3IUPA 2AMFA 4AXXA 3TRFA 3EODA 4FYPA 3ZDCA 1SXGA 3M6UA 3FCUB 2B8WA 2IITA 1W44A 4W82A 5I3CA 1HM9A 2ODNA 3AY7A 1NMYA 4PZZA 5FTLA 4C22A 4G1BA 1IEWA 2VF2A 2AKEA 1E1QA 4B3JA 2HMVA 2C4HA 2V9ZA 4WZAB 3DBVO 3UGQA 5LQNA 1DWPA 1EK2A 1Z6XA 4CM9A 1N34B 1DEAA 2ZWMA 3PTLA 3CEJA 4P3YA 3BBLA 4TTRA 3HWSA 4RIFA 4ER7A 5JSZA 4EW3A 2VAXA 4EGAA 3DAPA 4XFJA 3VVCA 1JTEA 1C29B 1UK6A 2EL9A 3BWVA 2FEXA 4PZCA 2NG1A 3RUIA 4B4VA 3JQ7B 4D6PA 1R6XA 2GF9A 5FDFA 5JY1A 4BGDA 1XVIA 3L18A 1WRBA 2E4UA 2GCGA 2ZIXB 3EEFA 4H7IA 5JO0A 3G82C 3BORA 2BFDB 2OCPA 1DBPA 3DAHA 4CI0B 3TBKA 1V4BA 1PHRA 1ZLXA 1TYAE 2AKYA 2IPOA 3A7EA 3BK1A 1BVHA 3QOFA 5J2TB 3FSYA 3EZ7A 5CNKA 4RAQA 3R7LA 4AG6A 4DR4B 2PG3A 3WGUA 2CVHA 3DJ4A 4PZPA 4G0ZA 1R0BA 5CUQA 1YVDA 5K2OA 3LYHA 5GJBA 3OH4A 1C2TA 1T8PA 3PGKA 1KH1A 2RFLA 3VBEA 2Y3IA 2J48A 1U4OA 1XWWA 4LQDA 3ZBTA 1V45E 4IIEA 3BIOA 3WTBA 1PBNA 4YDSA 1Y0BA 1XCGB 2A9KA 3CX4A 2BGLA 4PPFA 3U3JA 4INZA 3IDAA 1ZN2A 1L6IA 2G5PA 3FSEA 4ZVUA 2VJLA 3T9BA 1SMKA 3DVRX 3B6KA 3RIHA 3A3YA 1J2YA 4CN9A 3DTVD 1LA2A 3FAKA 2P2OA 3AO0B 3LXRA 4HGNA 3AT1A 2OXFA 3A4NA 1XLWA 1D2CA 4L5AA 1DMRA 4D97A 1HR0B 4HWSA 1JHUA 1PZXA 3B12A 3QYPA 4O08A 4TT3A 2YWRA 5HCNA 5BNZA 1BO6A 3F49S 1E6EA 4DQVA 3G13A 4HZGA 3H18A 2P8SA 2QNBA 4QJ4A 5C53B 3HK2A 3PWKA 5K6AA 4L0QA 2P65A 1NRIA 4JKOA 1OXBB 4A8JC 3R09A 5FX2A 1SKAA 1O96A 2YVUA 4CKYA 3K72B 1Y80A 3FFXA 2H7XA 4IJVA 2QPOA 3N39C 1K3FA 1AK1A 1N1MA 3RW9A 3WB1A 3QOYA 3OO1A 1XMSA 2FPPB 3E35A 4OP2A 1HT1E 2Q1YA 5L6MB 1JHVA 1CY6A 1JVBA 4IOLA 4C6TA 6CHYA 2VNAA 3K9HA 4DB2A 3T4XA 3BJZA 1QIDA 3AETA 3RTGA 3BJRA 3V4FA 2IH4A 4EYKA 2HRRA 3KTAB 4DJTA 5J59A 2ROQA 2IYRA 1KYIA 3AG5A 1E96A 1Y1TA 3QE4A 4B4WA 3QX3A 4RVOA 1AVTA 2I6GA 4W9RA 3NBZC 5ENVA 5EXTA 3FSCA 4XX0A 4RD3A 5EZQA 4RZSA 3B1ZA 3OOWA 2OYCA 3O4JA 2FZCA 4FDVA 3RREA 2XDYA 4ZXFA 1LPOA 5CX1B 4I50F 2ZUVA 4P9NA 4FP9A 1GFZA 1JKIA 1FVHA 3FDFA 1JQDA 1K5HA 1CW2B 3CEAA 2ZJ1A 4JSTA 1WY5A 4KAFA 3W4JA 5JTUA 4HOYA 1YMQA 2ZQ5A 1G1AA 3BULA 3NBYC 1GZSA 1FFAA 4MV0A 1IQPA 1FEZA 4GXNA 4AY2A 2XMRA 1USWA 3GRVA 2PRIA 3NAMA 1A95A 2G36A 2HPVA 1RKBA 5TQ0A 3TOXA 1Q74A 3LHFA 5ALTA 1QQBA 2PUVA 1OA1A 5JRJA 1ZOLA 2H07A 5ALIA 4DQXA 4X44A 1C0LA 4M9ZA 4CG0A 2BI8A 2CMHA 4TLEA 3I6MA 4A6EA 3VZDA 2D5BA 2Q4TA 2Q9AA 4DJFC 2FZGA 4F4CA 3D6TB 3IMFA 1WSBA 1N1DA 3B8HA 2V0KA 5JH7A 4Q7JB 1QRGA 2VKQA 4J7UA 1T0HB 1RI1A 2HWXA 4U6NA 1ZLYA 4FJ1A 4DOMA 1ATIA 2D1RA 5KDOA 5T64A 2AN5A 3PDUA 1M2OB 1ZL0A 3Q8LA 1AD2A 2C96A 4LV5B 4XE5A 4H6PA 4REOA 3FUCA 4OMFG 3ZUGA 1DQRA 2G5GX 3BSWA 4ZGBA 3GPLA 3E7FA 1GG2A 1JWAB 1YH3A 2BDTA 1YZYA 4K9KA 5A5FA 4N0EA 4OHPA 2IIPA 4GI2A 3N58A 2CMKA 1RTKA 1EB8A 3O31A 5JDCC 3UK6A 3V2HA 1IM8A 3K0AA 4B0PA 4KDCA 4F06A 1V5GA 3L7OA 1V5WA 1N6LA 2ICAA 3GQBB 3SEAA 4IRUB 4IDCA 1EA5A 5DN6D 5LVAA 2VK1A 4Q9DA 2YV4A 1C1DA 5C5DA 4QUAA 3FGNA 4BKUA 2ZJFA 1OTYA 1HV9A 1U1GA 4N4AA 2A94A 4BRWA 4XXHA 1WHSA 2H3HA 2RGNC 2X5XA 3OH0A 5D84A 3DBRB 3EARA 2CXHA 2RKWA 1H8ED 4RF4A 4CMBA 1GZUA 1W4LA 1I32A 4L5IA 5BR7A 5JQWA 3SS7X 2H2WA 2OB1A 4MMXB 1ZNZA 4RMGA 3PX2A 2A6PA 4PV7A 4KFSA 2B35A 3T3EA 3TW8B 4I5DA 3AB7A 5BVHB 4KWTA 5JWRA 1F6DA 2X4DA 3BB4A 3GLHA 3WFIA 1V4VA 3JVVA 4KREA 1GPUA 4LHVA 3WLEA 2VOEA 3WK9A 1SXJC 2DFPA 2GHTA 4M53A 2V0NA 3W3AH 4X41A 4XIFA 1RKQA 3KUXA 5CM9C 2BISA 3LQ1A 4JJ8A 1N2GA 1GTVA 3DE7X 4C7XA 2RIPA 1J8DA 2I2CA 1PQ4A 2PSEA 1M6HA 4PYIA 5AKXA 3RVMA 3BOSA 4GI5A 5JADA 2OA0A 1OWLA 3K73O 4JLDA 1J5EB 4IF4A 5HDQA 3O9ZA 4RVNA 1YZFA 1M1YE 3LBFA 3BIFA 4OBBA 3W9YA 5K3BA 3ACBA 4EG1A 4OJKA 3KAKA 1G6KA 5T4EA 4G36A 4C0AC 3GO4A 1MHPA 5LIRA 4MQMA 1EB9A 4FYKA 2XWJI 3BMCA 1FDOA 3NFRA 4L7QA 2W93A 2BI7A 4P31A 2RAPA 2EXXA 3CX3A 3K2IA 2F3PA 4L4XA 5TDHA 4ZMRA 5CB6A 2WAAA 1FSFA 2B94A 2G28A 1BCRB 2Q3JA 4WT7A 3ULKA 5IYZB 4QYIA 2AIRA 3MCWA 3B2EA 1KBQA 4MMYB 3E8XA 2X6QA 3KWDA 3KSDO 4KQ1A 4UBMA 2R6ZA 4ZJPA 1NVDA 2C1XA 2AJ8A 2JF3A 2NIPA 2WM2A 1J99A 3DUWA 1Z63A 1P33A 1TFRA 4EHDA 3LCVB 4WGFA 1Y7IA 4WASA 2YYAA 5D5QA 4YQFA 5A1TA 2ZYHA 4COOA 5IFLA 3ZZUA 2PRKA 4KWHA 3VR0A 4C0XA 4ECAA 4FT2A 1MVOA 3P0HA 1NZJA 3SSMA 4BNMA 4LI0A 4DILA 1FFWA 4R84A 4II7A 2FOIA 3VV2A 1W30A 5KTSA 5ER9A 4LMRA 1XNRB 4Y9DA 3LV8A 2OGSA 1LPAB 4B40A 1Z4QA 1QE0A 1EHYA 2XKJE 3KJNA 3YASA 1S2OA 3ILSA 4RBNA 5LDGA 1O1YA 1VYTA 3C0KA 2ECPA 2PLNA 1GT6A 3C8ZA 3TSYA 4L4SA 5F7JA 4B6QA 3SZRA 1A1VA 1XNQB 2L0XA 3VR5H 1QRUA 2QN2A 2CY0A 4E3WA 1P9OA 4TUYA 3T9AA 1P7WA 3C1OA 3ASVA 4KR7A 3IX7A 5B1DA 1J1UA 3HYTA 5A9SA 1USIA 1H6CA 4GVLA 4IQ0A 4DLLA 4UHFA 1K06A 3K6RA 2CNNA 4YRCA 4KQCA 1JA1A 2XZPA 2WTBA 3WA6A 4BEVA 1HUQA 2XZLA 2ECQA 4IJUA 1SBTA 5C4MA 4EKDA 4MRRA 1MT3A 3ITNA 1DAPA 1RPAA 1DCFA 2Y4NA 3A9TA 3GPIA 4UUNA 3ZWYA 2WBLC 1M33A 4XYGA 1ST3A 4P92A 1B23P 4FN5A 2RBGA 3S1AA 1A98A 2DUWA 3UMBA 1NW3A 2GERA 3WO0A 4O3FA 1K7YA 4QUKA 4D46A 2R7MA 3E48A 3IHTA 1XPRA 2FPIA 3KKKA 3EQ7A 3L1VA 3SI7A 2W42A 3UCFA 3E9QA 2F3SA 2VYVD 4BHTA 5DHTA 4RCYA 5FFMA 5JO9A 5IWAB 4QDTA 2DLCX 2QDXA 3BMXA 4RPJA 2WLCA 1UFVA 4ZAGA 4CV1A 1ONSA 3P2JA 4RFSA 2PJRA 1E62A 2YWFA 4RANA 5CH8A 1E0DA 3P97A 3SXPA 1W88A 2LR0A 3AUSA 3KEGA 4INPA 3SLGA 5AM3A 1WPQA 1T8WA 3JR3A 1EP2B 1QF7A 3QMVA 4LGYA 1DL5A 3UO8B 1I5OA 1PFVA 2X0KA 3DHYA 4GOXA 5KKCA 2D74A 2C9ZA 2N3ZA 3ABSB 5HGJA 1YIOA 4BE7B 2DETA 3G8CA 4Q03A 1SHUX 2EP8A 1AMUA 3CPJB 1Y1SA 2WT9A 1W85A 5B53A 3KKOA 2NPOA 1OXSC 3FVWA 4CM7A 1FTNA 3KSZO 4IIDA 1JG1A 4C6SA 1QFYA 1PNQA 3KPUA 2Q5FA 3VKHA 2CDRA 5CG2A 1P1RA 3BFJA 1MIOB 4JP5A 1JMYA 1CD5A 2CUNA 4KSCA 5JECA 5JS8A 1EUZA 5IT4A 4JYCA 4E5KA 3CLKA 2GFHA 2Y4OA 1HORA 3ZY4A 2WT8A 1ODTC 2WWXA 4I5EA 5KTNA 2F8TA 4MQBA 2FKOA 2ZT6A 1BD4A 1SHJA 4QQNA 4Y0NA 3VBLA 1XA0A 2FR8A 2J0VA 3BEOA 3GUVA 2O07A 5BSEA 3KYIB 5FADA 2XTAA 5L51A 2WQ7A 4BLWA 2E82A 3PLAE 1YQEA 3CBGA 3T7TA 1C0KA 1XCLA 3VGPA 3OX1A 3IELA 1Z18A 5FWDA 5JU6A 3V9AA 3A6DA 2ABWA 2G1UA 5H0IA 3PQ3A 3ESQA 5EVCA 3MD0A 1FPMA 2E9SA 2X86A 4D7AA 3NCHA 4PZYA 4QRIA 3DMHA 2QUBA 3OZUA 2C9OA 1GVNB 2ZBVA 5CYPA 4A27A 5F1YA 3V3KA 2OD9A 3ILHA 1EFRD 4I55A 2A3RA 3P9NA 4AULA 4BX8A 3QQ5A