4M98A

Acetyltransferase domain of pglb from neisseria gonorrhoeae fa1090
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
205
structure length
205
Chain Sequence
NRKLAVIGAGGHGKVVAELAAALGTYGEIVFLDDRTQGSVNGFPVIGTTLLLENSLSPEQFDITVAVGNNRIRRQITENAAALGFKLPVLIHPDATVSPSAIIGQGSVVMAKAVVQAGSVLKDGVIVNTAATVDHDCLLDAFVHISPGAHLSGNTRIGEESRIGTGACSRQQTTVGSGVTAGAGAVIVCDIPDGMTVAGNPAKPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Pilin glycosylation protein
publication title Biochemical analysis and structure determination of bacterial acetyltransferases responsible for the biosynthesis of UDP-N,N'-diacetylbacillosamine.
pubmed doi rcsb
source organism Neisseria gonorrhoeae
total genus 72
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2013-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17836 PglD_N PglD N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4m98A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m98A01
2YS7A 3BFPA 1MRLA 4J18A 3FOQA 2WLGA 1DV1A 3Q1KA 1G95A 3BSSA 3FSXA 1CS0A 4G3SA 3R0SA 1EYZA 4HURA 1HM9A 3GVDA 3QFFA 2V58A 3VBJA 3R5CA 3TISA 4R36A 4MA0A 3VPCA 2JF3A 2XCLA 3I12A 2ICYA 2TDTA 1THJA 2ZDGA 3IGJA 2V0KA 2W71A 3R5AA 4ZQIA 4EA8A 1KGQA 1HM8A 2DWCA 4MV1A 4E1KA 4AC3A 2R86A 4E75A 2PBZA 4HNVA 4G3QA 5DEPA 1SSQA 5AFUV 5C1PA 1YP2A 4EA9A 2VQDA 1AUXA 2CZGA 2VD4A 1KK5A 3R5FA 3DK5A 3VBIA 1PK8A 1QRGA 3SPTA 3Q1XA 4AAWA 4R7PA 1I7NA 5E3PA 4EGQA 3HBLA 4R37A 1T36A 2YYAA 3R3RA 1LXAA 4H7OA 2W6PA 1E4EA 2OEFA 1T3DA 3KWCA 2R7KA 2YS6A 1B6RA 3R2WA 2YZGA 2W6ZA 5DEMA 1KJ8A 1C30A 3G8CA 1KRUA 2I8CA 3FS8A 1UC8A 3OUUA 4N69A 4RZQA 1DV2A 3TV0A 1C3OA 3ST8A 2WLFA 2XD4A 4M9CA 2WLCA 2W6NA 3E5NA 3V4ZA 4L1KA 1FWYA 2P2OA 2R7NA 4E79A 2V5AA 3RV4A 1Z90A 4FU0A 4HUSA 3LP8A 4IWXA 3MJFA 3TQTA 3VBPA 4IHHA 4EGJA 2PN1A 1XATA 3FSYA 2YZNA 1KK4A 1XHDA 2ICXA 3KWEA 2V0IA 1GSHA 1KJ9A 4J09A 5L6SA 4KPXA 4IZOA 4M2BA 3TDTA 5F42A 3EH0A 2R84A 3OUZA 4AA7A 4IHFA 4IWYA 1IOVA 2RIJA 3WO0A 1FXJA 1GLVA 3D98A 2VPQA 2YRWA 2V0JA 3R5HA 2FKOA 4N6BA 3HO8A 1E4EB 3OUPA 3P1BA 3FSBA 4C5BA 2C00A 2V59A 4DLKA 4MV8A 3NZ2A 4KNRA 2QIAA 2W0WA 2OI6A 3CJ8A 2R7MA 3DHOA 2FB9A 4MV3A 3OTMA 4GGMX 1YP4A 1HM0A 3LWBA 4KQLA 3DJ4A 3I3XA 2VHEA 1KGTA 2QIVX 4MFGA 3R5XA 3ETJA 3JZFA 1UC9A 4HCQA 1V67A 4QSHA 1M6VA 3G8DA 2IUAA 2GGOA 5I47A 3C8VA 4M99A 5D8DA 3K5IA 3MC4A 3VBMA 3R23A 4HR7A 3R3IA 4MYOA 3SE7A 1GSOA 1QRLA 3F1XA 4EAAA 3PMOA 4G3PA 4DCLA 2PVPA 4MA5A 1KJIA 1QRMA 4ISXA 1S80A 2IU8A 2I5KA 1TDTA 2ZDHA 3RV3A 3AW8A 1IOWA 1EHIA 5E3QA 4WD3A 4MV7A 3BG5A 2VR1A 3TW6A 1JDBB 2YRXA 4HNUA 3VPBA 1KJJA 3K5HA 2QKXA 3N8DA 3TIOA 1MR7A 2R7LA 4ME6A 2I87A 4J6EA 2V0HA 3BSYA 3GOSA 3K3PA 3VBNA 4K6RA 3EG4A 3TK8A 3VBLA 1CE8A 1KEEA 2DLNA 4MV9A 4EA7A 2WLDA 2R87A 3BXYA 1GSAA 5AFUU 3BSWA 3OW5A 3N6RA 1B6SA 3ETHA 4MZUA 3FSCA 3WO1A 2OEGA 1HV9A 4KPZA 3U9TA 1VKZA 2R85A 4KNXA 4E4TA 2J9GA 4EABA 1J2ZA 2IP4A 2ZDQA 3VOTA 2IU9A 3P47A 1KQAA 4M98A 1QRFA 3VPDA 3U9SA 4DIMA 3FTTA 3ORQA 3ORRA 2W6QA 5ADXV 5K2MA 2I80A 3I3AA 3V4EA 3R1WA 4HZDA 2OI5A 1KRRA 4EG0A 3FWWA 2QF7A 3RUPA 3HB9A 1QREA 3HSQA 4N6AA 5U2KA 1SSMA 4E6TA 1KHRA 3IXCA 2W6OA 4EQYA 2YW2A 4HZCA 3D8VA 1EZ1A 3V4SA 3GUEA 5C1OA 5BPHA 2GLTA 2GPWA 1G97A 1SSTA 4M9UA 2GGQA 3RFCA 4IHGA 5JQWA 3JQYA 2DZDA 2W0VA 4N27A 1MR9A 1YP3A 1QQ0A 1KK6A 2WLEA 2Q4JA 3R5DA 3JZIA 4MAMA 3BRKX 3Q2OA 2V0LA 2IC7A 5BPFA 1A9XA 1I7LA 3VBKA 1ULZA 4C5AA 3KWDA 3MQHA 4C5CA 4G87A 4MV4A 3ECTA 3OU9A 5L6VA 3R5BA 4M28A 3HJJA 3MQGA 3EEVA 5H80A 4M2AA 2W70A 2JF2A 3T57A 3R8YA 2Z04A 1V3WA 3VMMA 1BNCA 4FCEA 5E3RA 1KRVA 2GPSA 5DMXA 2XATA 2YZMA 3VNPA 2AQ9A 3TWDA 2OI7A 4HNTA 3VA7A 1BXRA 5ADXU 5DG3A 1AUVA 2W6MA 1PX2A 1OCXA 2QK4A 2P0AA 1KJQA 3WNZA 4MV6A 3SRTA 3OTZA 3AX6A 4E6UA 2NPOA 4EGGA
chains in the Genus database with same CATH superfamily
1E1QA 1LLQA 2Q46A 4J18A 1T2UA 2FEOA 3THSA 3V8NA 4RVCA 4EFNA 1E3IA 1EQ2A 2CUNA 2E55A 3IKLA 4ENQA 1SHKA 5GVSA 1QIFA 4O4IA 4OM8A 3ESCA 2GK3A 2XMQA 2ORYA 3DZKA 4ALKA 4EBBA 1A7JA 2JFGA 3ETDA 4IQ8A 3L8MA 2OZLB 3ZQ4A 1CEQA 4RESA 1SXGA 2VRBA 2HXYA 4GC5A 3TZLA 4DQKA 1CS0A 1Y9JA 3QFRA 4HB0A 4XB1A 1JB9A 3TE6A 2HJHA 2QPOA 4NH0A 4URZR 3QFFA 1QC5B 2V58A 3OH0A 2W8BA 5L6MB 1UOEA 2B2CA 2WP0A 2PUFA 4R36A 2Z3ZA 2M6SA 4FFOA 1MFZA 3JAWB 3Q3VA 3UANA 1SJ9A 3R7SA 5JSHA 5M34A 4C0LA 1XZQA 1Z4QA 2P8SA 3FPJA 1QPGA 1GCGA 3IHLA 3NI2A 1ZWKA 2HJGA 3KQTA 2NTEA 5AIAA 2BOVA 2OD7A 1Z2EA 2GN0A 2AX3A 4ETMA 5FX2A 1DIOB 4DLVA 1Z4JA 1PJAA 1YKSA 2R6FA 3H05A 4C7JA 5K03A 3S81A 3VYSB 3R3SA 2FPIA 4MYRA 2X9GA 1H0KA 3SJCA 2FMTA 4QICA 4GAEA 3N8KA 1RBYA 4CDRA 4WK4B 2C9DA 1TCVA 3LY7A 1G291 5JNUA 2K7FA 1WSWA 1SKQA 4FYHA 1GFWA 1VE1A 1RQLA 3CWQA 5IAKA 3UB3A 3PP8A 4CF4A 4Y1RB 1MVOA 2ZJ2A 2AFVA 3WJ7A 5AVQA 4MB2A 3CZPA 4CU5A 3KV1A 1OYWA 3D7SA 4IGKA 3AWIA 2QENA 5A02A 4B9EA 2O7SA 5IK2D 4HP8A 2WUDA 1NSYA 3IP8A 5D3ZA 1BTOA 2XW6A 2IWRA 5DH9A 3WFIA 2P9ZA 3DMGA 1VI6A 1IN6A 1ULUA 3ND5A 4XWTA 2PX4A 5ETJA 2FRDA 3BMCB 3KPVA 4A8JB 2LUOA 2CSXA 2BKLA 2BEVA 2PQ2A 2TMYA 2W58A 1K6IA 4E2XA 1SKMA 1OMOA 4HGPA 4QTXA 4RS4A 3L07A 4EL0A 1CP2A 3HWX1 4FILA 5C31A 4AYTA 4EYOA 2I6TA 3MCWA 1G0OA 2WPDD 3EVTA 3RJTA 1DTWB 1IY1A 1E5DA 4KQ6A 3G59A 3NANA 1N0VC 2ZT5A 4JLJA 4AMVA 3HDHA 5KOYA 4YRBA 1R2QA 3H11B 1FX0B 3P2MA 3AFNA 1E6WA 1GLNA 2QLMA 1U3CA 1SQGA 5KOJA 5JAZA 3SR3A 2W6PA 2WICA 1ENPA 1ZUNB 2ANBA 1OH8A 4NCNA 1Q1AA 5D2CA 5EJEA 2H1FA 4G4GA 1T3DA 4LHYA 1FX1A 3H1EA 1Z5ZA 3NXKA 1FNBA 3RFUA 1GVHA 2YHIA 1Y8QA 3TOZA 2DQSA 2IDJA 3KVOA 2VZ0A 3EDCA 2G0AA 3GP8A 2Z83A 3FYCA 4AJ1A 4QOHA 1U8YA 2HF8A 4KE9A 3CWZA 3JD1A 3IDFA 4JQZA 4H4EA 4LNAA 4NYMR 1V47A 3OUUA 4CM7A 4ZIRB 4BMOB 2XXBA 2PQ0A 3MRSA 3GLQA 2BFMA 3DE2X 1V3TA 3HUFA 3WBFA 4D5GA 5TE9A 4IQ0A 3L1HA 4BVLA 4O2LA 5DHPA 5IEBA 3BMQA 3PHGA 4NATA 4X1YA 5K5EA 3SP1A 1GZ7A 1C14A 1WDMA 3HMKA 3DMDA 1EWYA 1XBTA 3GLRA 2WLCA 3E5NA 2JIOA 4M7OA 2VP6A 1BD3A 4M8KA 4UAJA 4Q48A 3HM9A 3V9AA 1WVIA 4J0JA 4DNXA 3OQIA 3VDQA 1RYBA 8GPBA 3BWVA 1ISSA 5HF5A 4BTLA 1OX4B 2A4MA 4G84A 5JPIA 5LB4A 4CJXA 5F2NA 5F1OA 1Z90A 3AEXA 3N53A 2ID4A 2WOJA 4J0KA 4L16A 4KMRA 1XZIA 4EMUA 4ZJUA 2NZUG 2PU7A 1RHKA 2ZR8A 1XMJA 3OCUA 4I6JA 1D4ZA 3PNYA 4XUCA 1OVMA 5AOCA 3MYRA 4FFBB 3WLTA 2AR7A 1NXWA 1MH9A 2HJVA 1HTTA 2YMPA 3E9NA 3QQPA 3KUUA 1P4JA 2H2HA 3MTIA 4GKJB 4J2HA 3Q6IA 3JARA 1RSZA 4TZ0A 1X3LA 1SXPA 5IBCA 1XXHE 4BLUA 1W5EA 3V4FA 1FZTA 2O2EA 3TWOA 1HQCA 3BKXA 2G0NA 3AGPA 4BRSA 4GNKA 2F3RA 1SBNE 4MO2A 1XJQA 1GQSA 5HTOA 1EGAA 4IG4A 2H63A 2I7DA 2OECA 3WYCA 1LRKA 4Y6QA 1GNQA 3B85A 4Q37A 4G0QA 3W7BA 4F96A 3V8BA 4LWOA 2P1RA 1MP0A 1U8FO 3C3BA 1NOJA 2F64A 2FJ0A 5DLEA 2K7ZA 2J33A 4NMWA 3B53X 3MD0A 4BNNA 4F46A 2AKEA 2CL7X 1O95D 2X3YA 4N7RA 3SYNA 2P65A 3NBXX 4KQGA 4IXMA 1G66A 1O6ZA 1L4FA 1W52X 2XDQA 4F11A 3VYRB 3FWNA 3NHMA 2YQZA 4YDQA 5KSOA 1V4VA 1FYVA 2PA3A 4PX3A 1THGA 1ZK1A 3K96A 1K8ZB 4UUQA 4EEKA 1JHZA 1E3WB 2H7VA 3WK9A 2Z9CA 2ZAGA 2PBFA 3I5XA 2ECOA 3V32A 4R83A 4RE6A 4MI6A 3ITNA 4BU1A 2R5NA 4GPTA 4WRRA 2Y1GA 4HGYA 4L4RA 5KJCA 4XGKA 3U49A 1NHGA 3UHFA 2Z5GA 1XZBA 3JYQA 5DZSA 5KJEA 4DUZB 2QIAA 1TZBA 1K8QA 2B98A 3AWDA 2ZUUA 4KGVA 1DE0A 5NULA 1YF3A 2I54A 3EFOB 4OGGA 4R3UC 2E9SA 1MRSA 2OAP1 1T1GA 2PGDA 4U2CA 4BMYA 1VE9A 4GD3Q 4LJYA 5LLSA 4Z53A 4AZTA 1P74A 1W2GA 2BFNA 3O5AA 3LUAA 4ZV4A 3U3JA 4LTMA 1QVVA 1W1IA 3ENWA 5K3EA 3PL1A 4XD7A 4MPTA 1XNHA 2V7BA 3OTMA 5BN5B 2XKKA 3HPQA 4RM3A 3LXUX 1J00A 1T5LA 4BNWA 1YO6A 1WKVA 2YVUA 4IX1A 3CLHA 1QZ3A 4FT4A 5CVCA 4BUZA 5EFZA 1O8CA 3OLYA 2CE2X 3GZTB 1P17A 2VHEA 3R5SA 5EUMA 5TMBA 4A4DA 2PX6A 3AERB 1NE7A 3MCVA 4JLMA 1H9AA 2FWJA 4LZAA 4DBZA 2QTAA 1Y4UA 4ERXA 4PSCA 5THXA 1ZFNA 1V1RA 4HNQA 2QHXA 2JLAA 3DKVA 5ARCA 5DT2A 1PGNA 4S1WA 5IM5A 3RSGA 1Q14A 2PUJA 1Z4LA 2K2WA 3KLOA 1KRHA 3HKCA 4NCJA 1Y3IA 2VYVA 1AZLA 4YC7A 3BIJA 3C7AA 7ADHA 3J80A 2JFFA 3G0OA 4O1IA 3SX4A 4CM6A 2PG3A 4FMBB 4YGXB 1CDOA 1DEKA 4OBBA 5EYPB 2J87A 3B8HA 3F2IA 2OHJA 2A78A 5CCDA 5I47A 2QQEA 3U40A 4GT1A 1OBOA 3FR8A 2BR3A 4F4JA 5ERYA 2FF5A 2GAIA 1OXUA 4JQYA 5K09A 3M2PA 2W11A 1WW2A 2QMZA 1HNWB 5I9SA 2JW5A 3VBMA 2FCRA 4YRLA 4YRNA 5KYWB 2X77A 4ZI2A 2F9FA 3LT5A 4N5HX 1A95A 1LU9A 4Y2PA 1KRXA 4S3MA 3B8EA 4OP2A 3RU2A 3B1JA 3AUTA 2POCA 3BRSA 2X4DA 3HKEB 3OE7A 1DRVA 3DWFA 3PNOA 3PQEA 4G3PA 1KARA 1NULA 2QU7A 5AESA 1DL5A 1S7CA 2W2QA 4ZC1A 1NMSA 3SBOA 3ICQB 4DMKA 3QUQA 4W8HA 4ZRNA 4JR2A 3CINA 3TIIA 3AHHA 2HFJA 4V2UA 4W5OA 4KXFB 3KKEA 3FCCA 1Y5RA 5YASA 3KK0A 1L5YA 4LQCA 1DKOA 3GEPA 4KH1A 3FAZA 1W36C 2K5UA 3DMHA 1C3XA 1Y7HA 2IUYA 4QNRA 2ZSKA 4FZVA 3R4VA 3PR2B 1HG0A 4NYJQ 1TMKA 2LP4Y 5DTEA 2HPHA 3V9PA 2QJRA 2PT5A 3WP0A 5K3CA 2ZRHA 4GMDA 1SUBA 1VHJA 4X97A 1V4NA 1DCKA 1Q7BA 2FHPA 2LWIA 4IJKA 5DOVA 1KF0A 4DLXA 2XCQA 1P6QA 5B1DA 1IB6A 1QO9A 4I55A 1PV2A 3DOCA 4EBFA 5ADUS 3FMIA 4TLLB 2PLWA 1N7GA 2R7LA 3LQ2A 4X6YA 3UWMA 3WISA 3ZWAA 1ONSA 4XIFA 4E5UA 1U90A 1BC5A 2BP7B 3K8OE 4HD8A 3GIWA 4TSFA 4PRZA 5B7PA 1Z7WA 1VJRA 3FCAA 1ZD3A 2P9FA 3ZDCA 5JU6A 1NUPA 1GNLA 2QEQA 4P3KA 1SXJE 2O3TA 2FG5A 3F8TA 3NHSA 3DC7A 2JGLA 4YMUA 5HKOA 2GF0A 1D4FA 2YMMA 3ZBUA 1XPRA 3OZXA 1YACA 4H17A 2PR7A 3I32A 2CMHA 2HCTA 1PZGA 2CUTA 3ONVA 2A57A 2JGKA 1Y6JA 4X61A 3L8DA 2C8KA 4HN9A 4XWAA 4TTVA 4Z5XA 4CM8B 4B71A 1DQYA 1E6CA 2QIPA 4DZTA 3WWPA 3FNFA 4G56A 4P83A 3RC2A 3OUTA 2C2KA 4RZIA 5F76A 2R85A 2J9GA 5JMPA 1S2MA 2QAGB 4JY7A 4OJNA 2QYHA 4DHWA 4DFDA 2H52A 1KDYA 2IU9A 1FSSA 4RVUA 1OI3A 4B17A 4WZAA 1W4BA 4JP5A 3RASA 1QRFA 2ZJ8A 1I4WA 1RWBA 4HEHA 4QUEA 3U9SA 4XJTA 3P0RA 1Z8FA 2EERA 2FA9A 3L8ZA 2HQSA 1JQEA 3WGNA 2FSVC 2GQ0A 3VH3A 4IXNA 1KY4A 3E7DA 4E07A 3SFVA 4NHOA 4J75A 4PTYA 3AL0C 1RJDA 4X8MA 4RTOA 2H17A 4Z9FA 5SYMA 3OIGA 1EFUA 1KEWA 4DG8A 4YT4A 1QUFA 2H7YA 3WSTA 4NE9A 4ETWA 2FWPA 1AG9A 1W48A 3KALA 4O1HA 2C58A 3HL0A 2BMDA 1SR8A 3KZNA 4I50F 4QOFA 5SZKB 3ZHSA 1Z0IA 1XRRA 2O2ZA 2D2FA 4UUBA 5CFRA 3M6MD 3VR2D 2D6FA 2R65A 4X84A 3RKUA 1OFTA 1L4HA 1WETA 5LDGA 4XIGS 1C3JA 3INYA 3PYLA 1PJQA 1GQFA 3ZWKA 1EVLA 4EJSC 2EIXA 3UK2A 1B8OA 5HZHA 4IVQA 5KOIA 2O8BA 1QHXA 1SB9A 1KI6A 3IXCA 4CLDA 3LQRA 1QYWA 2ZG6A 1CVRA 3SQWA 4JLPA 4I66A 3ROFA 1SVIA 4LDJA 3V4SA 2C2GA 4BIIA 4EUNA 4LV8B 1DIAA 1NTRA 5ALYA 1UBUS 5FBLB 5ESDA 5TPWA 5BNZA 5HFNA 2RE8A 3FCOA 4REMA 2V9ZA 3WGIA 4IXDA 2ASEA 4WI1A 2BFDB 1K9VF 2QGZA 4M9UA 1LPPA 1C7RA 1HE5A 2HW8A 2BSAA 2GN8A 2F3TA 3Q7RA 3FTDA 3KB2A 3TR6A 4L8LA 4AJOA 1V1MA 2C78A 1GG8A 3HCDA 5DGHA 5M04A 2IF2A 5EHGA 3QWFA 3OPYA 4MW2A 2RHWA 3CZRA 4BFZA 3TZBA 1OC4A 1YS4A 3QXHA 4JU8A 5JXHA 2DC1A 2GCPA 3NHWA 3TD6A 3UB2A 1EFHA 1I7LA 3WGLA 3O4IA 3K09C 1E94E 4QBTA 4UXJA 4GR9A 4WKGA 2FKNA 2RAVA 4BNZA 2I91A 4R1PA 5EWLA 4J2OA 2H51A 3R3UA 3K1AB 1J20A 3QTLA 1UDCA 1NZFA 4DCMA 1W2HA 3T52A 5ICGA 4OBXA 4F4CA 1ZISA 2C9CA 3R5BA 3CPJB 4U7WA 1M8JA 1YJCA 1ZN2A 2I71A 3UWPA 4M2AA 4C3UA 4JGGA 5E7MA 4C03A 4EHNA 3PC3A 1XI2A 1KJWA 1R9NA 3MWKA 2QRVB 4OFBA 3U3XA 4EI8A 1TK9A 4MQMA 1W94A 3B6ZA 3T15A 3C41J 1P7PA 1GT91 1M74A 4JVSB 3TTVA 1Z18A 3O94A 4RKRA 1B6GA 4AJEA 4HEA1 1SC6A 1SH7A 3TM4A 3B48A 1PX0A 1A3CA 1L6IA 3JQ7A 4RC9A 1NX9A 4M9RA 1F8YA 4G86A 2QQFA 1U5CA 2PYZA 1X8JA 1ZH0A 3G1WA 1BHQ1 4RANA 3M33A 3K53A 5C51B 4YRDA 1OBFO 2HLDD 1RNLA 1T0BA 5T4FA 2CYBA 4PLFA 4URUR 3ZH9B 2IHTA 4XVHA 4RPJA 1ABFA 1C1XB 2C82A 2CCJA 4V0KA 3C3JA 4C4XA 4UVEA 1LDNA 1Z17A 2JAOA 1GRQA 1BXRA 1PEKE 1U11A 2FE4A 1T10A 5J2TF 3U61B 5EWJB 1GA1A 2FMHA 4HAZA 4L6CA 2ZYGA 4Q15A 4CHGA 2CNWA 4CL3A 2ANCA 3W6NA 1F7VA 2WC1A 1GG9A 3L92A 4OATA 3KZXA 2AEFA 3AFHA 1VA4A 5HF6A 3ETNA 4EMBA 4F3KA 1PX2A 5JQGF 1O77A 5FR2A 4OAQA 3GG2A 4QATA 4TKUA 4UVIA 5TJ9A 4JD5A 4I1RA 3W4IA 4DV2B 1MJNA 4NEQA 3WGJA 5HGXA 2CYAA 2PUCA 3SRTA 5ALSA 1PJ4A 5A05A 4ROSA 3NYIA 5K0NA 3RSOA 2YJ4A 1T2CA 2WE8A 2D0DA 3QVGB 1X0XA 3R41A 8OHMA 1NVDA 2F62A 1LF5A 1GDDA 2VPTA 4Y98A 1FP1D 2A92A 4MRAA 5CB0A 4US2R 3UPUA 3D7KA 4WKNA 5EE1A 5E2BA 1NW9B 4CKYA 5EKXA 5JCZA 1Q0UA 2XMDA 2CW5A 4RPGA 4UBLA 2FR0A 4K6HA 2X0NA 4RMGA 2NZ2A 5E0KB 3U4CA 1P31A 3UJHA 1X1AA 2RHBA 3KWFA 1NQWA 1YBAA 2XYRA 3CO5A 1XLUA 3HCNA 3UMSA 4UNRA 1SG0A 2X1HA 3NRBA 3VTKA 3LYAA 2A8YA 1G8MA 2P2YA 2VJDA 4G1BA 4LWQA 5DM0A 3L0YA 1Q0SA 3PTLA 3CR8A 1G38A 3IPCA 1FMJA 3L4EA 1N9GB 4LPSA 3FFBA 5HFAA 2QRZA 1U3UA 4AY3A 1APBA 2X6QA 2VDOB 1WZIA 3QEKA 5TQJA 2XMGA 2JF3A 1M75A 2GXSA 4PCVA 4KACA 3I9FA 1IPFA 3OOEA 2AX4A 5HYVA 1M3SA 5LBIA 3V8PA 2O1SA 4E15A 3SS9X 4DUGD 1O94D 3D0OA 3MJTA 3W6UA 3KQHA 4QQFA 3Q7SA 1LS1A 4PY2A 1C0EA 3ZV4A 1W0CA 3OZGA 4WECA 4NC9A 5CJPA 3IJ5A 3G17A 3T5GA 5JOQA 1C9JA 4UHJA 2PKRA 1T5IA 1E3LA 3I8OA 1CZNA 4LOKA 4R51A 3TAXA 4O02B 2UVPB 1ZRMA 3ZVRA 2EQ5A 2EX4A 1PWHA 3M89A 3KR1A 3AYZB 5TNXA 1IQPA 4E1KA 3QITA 4C7MA 3OFSA 3CUYA 4PYNA 4B6JA 1VIAA 1UL1X 1EK0A 5FBQB 4CMIA 1VSQA 4PPQA 4QG7A 2OPHA 6REQB 1JSRA 1U6JA 1RZRD 4GXRA 2JFWA 5LZ7A 2QU8A 4Q1BA 5D3MB 3RPEA 1U9IC 4ARVA 1YP2A 2Z2KA 3LFHA 5MGNA 2QPAA 4QSMA 4QTZA 4M3NA 4ZT4A 4DA9A 1HO3A 1BX3A 2XUDA 4XR9A 3AM1A 5JAOA 4V3CA 2C5AA 4CL0A 3JZDA 1VIYA 3QKTA 1QTRA 2YICA 4QYMA 1YVUA 3PU6A 2CDBA 2P2ZA 1EM8A 2VYCA 3VH1A 1L0BA 2DTXA 2JFUA 3GJ0A 1KDZA 4NV3A 1CUSA 4OKSA 4DQVA 1QU2A 1EP1B 2HQRA 3F4BA 2XT9A 4Y9SA 1PZNA 3COSA 2C0CA 3MJRA 3Q7PA 5JJKA 3WZLA 2JPDA 2GA9A 5JNTA 2JJ2D 3VPFA 4A0QA 2IA5A 4Q9NA 4UEOA 4KSYA 1KIAA 3L7MA 2A9KA 2E4YA 1I7NA 1PJSA 1NY6A 2PA0A 4FMPA 3C8MA 4MW5A 3IP5A 2HIMA 2HK8A 1YU9A 3NDJA 4GSKA 3RRBA 2GM3A 3HJTA 5F21A 3K8YA 3JQFC 3W90A 1WPRA 2C7BA 2UZ3A 1ZGJA 3CLTD 4ASUA 2R8OA 4K28A 5FV7A 1UUFA 1TIKA 1M2HA 1NFQA 4U5QA 4NOMA 3LKZA 5CCEA 3I73A 1ADFA 4FC6A 5HX7A 1NYRA 5JWOA 3A4VA 3SR0A 3Q0EA 2LV8A 1TZKA 1KYXA 1TYCA 4I50A 1JFVA 3AEQA 1KSGA 1XQYA 1HYHA 4OLAA 4M6WA 1TLTA 1UPFA 1KK0A 5IBQA 2AJ8A 4G37A 1SCDA 3FTFA 1XHFA 1TF7A 4JR0A 1YB5A 4CTNA 2BONA 1YCFA 5K8TA 3FZYA 3FS8A 3GGCA 1GGMA 4O4IB 3UH1A 2P5UA 2Z8ZA 1XU7A 3FYHA 2FEWB 2VI5A 1QFJA 3A32A 1W4CA 1E2NA 4HL6A 4WIAA 4X6UA 3V7YA 4DJEC 4PQYA 2GNAA 3GH1A 1JVNA 1VB5A 2W43A 1CS0B 2XVXA 3GAAA 2BFCB 3IAS6 3IQGX 3Q1LA 2ONJA 3ADKA 4EHBA 3WDKA 1L5WA 1TDJA 2EKBA 2W8BB 3BBLA 3IE2A 2VQSA 2VWPA 1JLLA 1A71A 3HHPA 1Y9AA 2CHEA 2WU1A 1RADA 4KZKA 1LNZA 4OHYA 3L93A 4NEGA 1W85B 3HGTA 4KGZA 5EL0A 2WF6A 5J1TB 2O0LA 3GT3A 3RRFA 1BZYA 3W4KA 3HSSA 3F9CA 3I4LA 1GCUA 5AW7A 3OPQA 3RFFA 2JLRA 2QT1A 1X9IA 1VL8A 2GD2A 2V6IA 4MKXA 4B74A 5EFOA 4QRIA 4K2HA 2C9ZA 4H4CA 1PDOA 1A7AA 3DV9A 5IN5A 4AKHA 3FSYA 4AJNA 4TLEA 2H9IA 1VBNA 4CCYA 2JJMA 1KK4A 3IR7A 2ICXA 5KSZA 4LEIA 4NPAA 4DAOA 2GYVA 4OV6B 2BDTA 3VRHA 2I1LA 4L9WA 4I4TA 5DM4A 3ZD8A 3F6RA 1T9BA 4H7EA 1EQUA 3OT5A 4V1CB 1U5AA 4JUAA 2G9VA 1FU8A 2R2AA 2VOJA 1AX9A 2DAPA 4B2YA 1A8PA 2XBUA 1PS0A 2GB4A 1USIA 3PGLA 2PGAA 2H29A 2WJPA 1RBMA 1Z33A 3U31A 1HE3A 4FOLA 2PJRA 4XEUA 5J9FA 2A9QA 1VL6A 4Y3UA 2ZUEA 5I7EA 3ADDA 3SXJA 1ORHA 1Q3HA 4JT4A 3RSQA 4EMSA 3DBLA 1A88A 3L5OA 4RY2A 1UR5A 1II0A 1PLKA 4B8YA 1V7ZA 1W5TA 5HPYB 2H6EA 4GR4A 4KRGA 2ZQ5A 2A0UA 4NBVA 5TIIA 2PJUA 4EI9A 3T1NA 3I09A 3PQCA 1Z62A 3GZ4A 5EXXA 3WLEA 3H5RA 3DVSX 3EWIA 5TF0A 4U2KA 2AW3A 2ZR7A 2B82A 3L06A 4I1OA 4JA2A 1NJ5A 2EU8A 3BFJA 2ORWA 1Q1ZA 4GPIB 4N54A 5GJVC 1H2HA 3RHTA 2FKOA 1LQ2A 2W42A 2YY6A 1COWA 1F7UA 1M33A 4HRVA 4OAOA 1UDBA 2QUZA 3OIUA 3R3JA 3KR2A 3R7FA 3RBVA 3P52A 5JANA 5KYXB 2C4WA 3N7UA 5KOJB 2BGKA 4MOWA 3C1OA 2PH3A 2EF1A 3E2PA 3VR1A 1CW2B 3GQ9A 3HGMA 3D43A 3A6PC 4C5BA 4BQPA 4M7PA 4LYAA 1YI8A 3U39A 4FWIB 1QGOA 1HYGA 2ATEA 2HA0A 2XRFA 3TRDA 3FYDA 3ZDYB 3FOBA 2EZ4A 3C8DA 5DSXA 3TK1A 3NP7A 2ZSJA 3A9SA 1G7RA 1GPBA 5JHHB 3H9CA 2H8KA 4IVRA 5ALWA 1DKMA 1TRKA 3H5OA 4U9UA 2OCYC 4MWEA 2B7BA 3S55A 3QUAA 5L53A 4EVIA 1KAHA 4EHJA 4L7QA 3BMQB 4X1YB 4CNQA 4EI2A 2XYVA 3BRWA 1JU9A 1SCNE 1BDHA 1IXKA 2LZ0A 3JVUA 1IULA 5H5JA 4MHSA 1OX6A 5M5BA 3LKDA 1ECCA 3C4VA 3OQIB 4U7PB 3TVDA 2AJBA 4M36A 3HH8A 1U9IA 2WRZA 2ACVA 5HF8A 5KIAA 1J8YF 1QRAA 3ZLTA 1L4YA 3HUEA 1WPGA 1DJLA 4P1ZA 4P9NA 4ZOQI 2Q6OA 4PICA 2EBHX 1T1JA 2I1VB 5CNIA 1JG1A 5DCYA 3WIBA 3GDGA 2GCNA 5F9FA 2JCYA 1I2ZA 3Q8MA 3EODA 2QP9X 3Q8WA 4NV0A 4U00A 2YRFA 1G8YA 1KKMA 1K08A 2ZKIA 4FP9A 5HE9A 5BWLA 4AY2A 2VDWA 4HDAA 1POWA 4RPHA 4I3HA 1W4AA 4Q7MB 1U2EA 4D44A 1U2RA 1AB6A 1CQPA 1H2AS 1QH1A 2GWHA 3DL7A 3G5AA 4X90A 2H1OA 5TS3A 1NZDA 3JARB 3IEKA 4G5HA 4HR7A 2IP2A 3CZAA 3JQFA 1MO4A 1MB4A 3HBJA 3EXG1 2LIPA 2Q6IA 1QRLA 2YIVX 4OYHA 4K40A 1PR5A 2JRLA 2C4UA 3HCAA 4RQTA 3NG1A 4PFJA 1CUJA 1AKVA 2I4IA 2V7WA 1CF4A 4WAUA 2EWVA 3GOHA 3LNTA 4AMBA 4BVBA 1B74A 1PFUA 3Q9UA 5FPTA 2I5KA 1IJBA 4TXHA 3ESXA 4N5MA 6GPBA 1Y3BE 3PICA 5LZ8A 3HG7A 2BBSA 3B2QA 3UJ6A 4FYJA 5CA0B 5E3QA 3HNOA 4EGCB 1YUMA 4N1AA 1OYVA 2SICE 3PEVA 2XNSA 1TW3A 1JDNA 1O3YA 1PT9A 3RC8A 1ZL0A 1ZVVA 1F0KA 2IV2X 1AH2A 2WZBA 1YQQA 3DM9B 3SC2A 4CKBA 4BJ1A 4LA4A 3RHFA 1RI1A 5E9AA 1FYDA 3WK7A 2CD9A 3ZUPA 1ONBA 3RS5A 3OEHD 2OQRA 4M8SA 4G0MA 4OFZA 3V3TA 3GOSA 2NP6A 2PUVA 1G5RA 4MRVA 3W1VA 4F71A 3Q2KA 1NAIA 1F8XA 1JKIA 1VRVA 2P40A 2W37A 3P9KA 4DUYB 2OFPA 1UQTA 1KWGA 3H8VA 1SKUA 4ALJA 2ZJ0A 5IPFA 4MQBA 4HTFB 2OP1A 4XDZA 4PXSA 1EUDA 1ZS9A 4YMHA 1Q3KA 1QOQB 2JH9A 4IGEA 2Z56A 3OW5A 2Y8EA 1ECFA 4IIYA 4DQUA 1Y8ZA 1BVHA 3IVCA 1CR1A 1ZO8A 3K16A 3FSCA 2ZUTA 1L1RA 2DHQA 4E5SA 2BMFA 4FXOA 2H2AA 1OI2A 4TS9A 3EEFA 1J9ZA 5CYFA 2BEKA 5F4ZA 3KTOA 4D5EA 1GNTA 1XMPA 4E4TA 4LMBA 4BAZA 1BE0A 2ZYAA 1YH3A 1GT6A 4QYTA 3DE0X 3QKRA 1WMBA 2C92A 1L5QA 4NESA 2ZYSA 3KB1A 4MMYB 4HDNA 1IPHA 4JBYA 2HBYA 3S2UA 3WICA 1MABA 2WZQA 1PWXA 1QG4A 4BQIA 1UC4B 3SQNA 3V7WA 2IYWA 3NT2A 4TV9F 4J16C 4ZCQA 3HBNA 2KB0A 1TYDE 2P67A 4RF5A 3SXUA 2JLXA 4L57A 3F7OA 1V1RB 2H11A 3AIKA 1B16A 3TSAA 5I3CA 4BFCA 1TZJA 3ORYA 2RK6A 1YV9A 1HORA 1ZK2A 3IXQA 5ADXV 3N8NA 3O7WA 3OIDA 3DFFA 3AF4A 2JGDA 2I80A 4ZPXA 5JSYA 3HKCB 1XWIA 3DJYA 1HFJA 4U2BA 1VMEA 4WK2B 3UENA 4LX0A 2VKQA 5FO0A 2ZQZA 1AGPA 1MEEA 2H31A 3DL4A 4J0EA 3WGGA 4DR7B 3RFTA 1S2GA 2HREA 3UWOA 2P9TA 5G41A 2WBLC 3UB4A 1D8AA 3VSAA 5BQPA 4RVSA 5K0TA 4PRYA 4AI6A 1WSBA 4MUJA 4N6AA 3AVOA 4H0CA 2WMOB 1AHHA 2WJIA 5LMNB 1H93A 3LX4A 4KDCA 4BX8A 4BC0A 1N32B 1K98A 1KETA 2CVFA 3D8VA 2QN2A 3MPOA 3OF5A 3PSAA 3FDXA 3QELA 3QPCA 4Y0VA 5EJMA 1S3FA 5A4MS 5C1OA 1QMPA 1KXZA 2COUA 4QPNA 2LVBA 2ZTLA 1OWPA 2D2EA 3ANNA 3RUFA 5KQLA 1YQXA 2OMEA 3HJNA 1K4MA 3FTNA 1MG0A 2DPXA 4LMPA 1KOLA 3T99A 5JQWA 3VHRA 2WAAA 1RXWA 1AUOA 2QLNA 2WJWA 3AOGA 3BWMA 3UUFA 5CITA 4IKEA 1NKVA 1KAEA 1QR2A 2L69A 2ZU6A 3HQ4O 4ZRMA 4D9IA 2L19A 4NZ9A 4E3WA 1KE1A 4PNPA 5DLQC 3RQIA 2YXLA 2AUNA 1MQAA 4DE5A 3L0ZA 3K9CA 4I55B 2HWYA 1XEXA 2XE8A 4O2AF 1OFUA 3SSNA 1U6KA 3JY6A 3FMVA 4PSUA 2XUOA 3GA5A 3T5CA 3UF0A 5EHXA 5IKXA 4TSKA 3FM9A 3VBKA 3KEGA 3JU3A 4AZ0A 4YYZA 2PHZA 3QJGA 2CL6X 2R97A 4FQ8A 2G1PA 1GAXA 1Z6YA 2O0MA 2V6BA 3ABOB 4BCBA 2QRUA 2B8TA 2X8LA 4KSBA 3N86A 1A82A 2ZBDA 2WJYA 3T8YA 3HJJA 4D8TA 5A4IS 4JBNA 3CF6R 1MDFA 4CLRA 3K5WA 6NULA 3F73A 4Z9AA 4RNDB 1TVEA 1AO3A 1EFVB 5TQVA 1F1BA 1YZNA 5CFPA 3LBIA 1G59A 3O8LA 3PHCA 4FQ7A 3ILHA 4IRMA 4QO7A 3VMMA 4ARZA 4ZHQB 1TVMA 1NF9A 1TQ6A 4DL9A 2GTPA 5A5VA 3VJMA 1KRVA 2HJWA 5JBQA 5C37A 5EHZA 2GPSA 3RKSA 2HZ7A 5CA1F 4UASA 3HEMA 1H0HA 4WLVA 2YZMA 3IUSA 3HC7A 3FOZA 3O93A 2BLLA 2YBEA 4R0MA 4DDTA 1CKEA 3U7IA 1PO7A 2O48X 1M9NA 4CT4B 5CIYA 4A10A 2H85A 1GUBA 2IIPA 3IO3A 4L5YA 1BJKA 5KNDH 5KU1A 3UMJA 1TYZA 1FTGA 5EHQA 5DTJA 3RH0A 1HDGO 1Z5PA 4LK3A 3OCVA 1P3DA 3MF4A 3RAJA 1T5TA 3KKZA 1U0TA 4JMLA 2D59A 4L3VA 4KYTA 5DX0A 2ZVQX 5DYNA 3BULA 1XAGA 3T3PB 1RAGA 4Q6WA 4C0AC 2RG1A 5JSKA 4MX8A 4ND1A 3WP1B 4JI2B 1SUDA 3HY6A 4Z4GA 1ZP6A 4QFCA 3B1KA 2P0AA 3BC1A 3EA0A 3O38A 4AZVA 4F97A 2AG8A 5BP7A 5A62A 3GQAA 3L6CA 2DUUA 1OXMA 4XPZA 4ND6A 5E1MA 4EG3A 4EKEA 2H0QA 3TKAA 1ESCA 1ORWA 2GJ8A 2NUPB 3EASA 3WFJA 1QYVA 1IN8A 3GEBA 4WCFC 3VFDA 3N0TA 3NC4A 1FQOA 2AJCA 4LDQA 5I9TA 2O8BB 4IV8A 5AKGA 3NALA 4YJKA 4H1TA 4IVPA 1DHTA 2WPDA 4QU9A 2GEBA 2FPRA 2WIGA 1IM8A 2XNHA 3CFYA 4ZCIA 2V7QD 5JXJA 2CXNA 1QB8A 4UOQA 2CLSA 2V6MA 4NU6A 1ZKMA 1ZH4A 1KPHA 2O1WA 1F51E 3DBVO 4QYSA 3U81A 1E2FA 5TPWB 3WLIA 3GJ4A 5CT5A 1PL8A 4D9HA 3LIIA 1KI4A 2GASA 2FPPB 5BMOA 4IH4A 5JMTA 4N12A 3OZUA 1DEAA 4HWKA 2JFHA 4JJGA 4XQEA 4L28A 3HO1A 3MK31 2IYFA 4KAFA 3QA3E 4FN5A 1CZKA 5EAIA 5LXTF 2GO1A 2F4NA 4HZUA 3ZGNA 1U0OC 3TISA 1V1MB 2J59A 2JI9A 3KQPA 3Q0IA 4R54A 3QLUA 5DNWA 4P54A 2ZRLA 2CKDA 3OPYB 1BVYF 1TA9A 5CLHA 3R9XA 1JV2B 1CERA 2WYIA 1HDCA 2UUCB 3R44A 3B1ZA 3KPJA 4J16A 5CFNA 1EWTA 2ODAA 1E0JA 1Y3AA 2B1RA 4FEAA 4GYWA 3JQ9C 3HWSA 3WIUA 5K51A 3GDOA 2OB2A 3QHQA 4OI2A 3SX2A 5AW0A 1HETA 3H7AA 5LVAA 2PUEA 4DLWA 2PKQP 1XZGA 2PY6A 2QD1A 5A9SB 3OOYA 5MFPA 2DT8A 3JQCA 1BHO1 4JI5B 1TOAA 5IABA 1RJEA 1GAWA 1LLDA 4U9HS 2AIRA 1JS1X 3ZIUA 2JD0A 2LKCA 1J39A 4RW0A 4XCVA 4ZYTA 4HK4A 3NTUA 4W1QA 3C5CA 5BSTA 1MJGA 2R96A 4AFNA 4EA9A 1E61A 2X5NA 1T2VA 3JQ7B 4AS1A 4HEJA 4XFDA 4D02A 3AKYA 1ESNA 1Z56C 3OKCA 4PFQA 4FW8A 4FCVA 3O8QA 5CMLA 1FRQA 4OHZA 2V7PA 1KZ7B 1H2RS 1C0IA 1VIVA 2P6MA 1YZQA 1KK5A 1R4ZA 1WW8A 2H1CA 4US0R 5JO9A 2L82A 2ZRQA 3VKHA 4TLAA 1TYEB 1H1LA 3MTJA 5ITVA 1MAVA 1BXRB 2DU8A 3QNMA 4K1XA 1NI4B 4O2RA 3UQYS 4F72A 1VIMA 3HXMA 4TV9A 1DFIA 1PCXA 1L4GA 1T6XA 2GJKA 4UBJA 3I6ZA 1E0KA 1HEUA 1RXEA 3N8HA 1AM4D 2C31A 2XDWA 5FWXB 1OI7A 1ZUHA 4W5QA 1R8QA 3M5WA 4CEJA 1T36A 3LLMA 4TKUB 1FSFA 3GIDA 1E4EA 1XTRA 2HCBA 1U98A 1XHLA 1FYWA 2OEFA 1YJBA 3YASA 2QRKA 3ZDDA 1ZPDA 4XDHA 5FT9A 2ZAOA 2PXCA 1P2SA 1O95A 3ELBA 2IF0A 1QV7A 3DEJA 1U0SY 5C4MA 4FDAA 3TRFA 3VOBA 1WD5A 4DDVA 3D54D 2W6ZA 2BHTA 1XX6A 4F91B 1G1MA 2Q5IA 3BRCA 1HI9A 1C30A 4EEZA 4LZNA 1ULTA 4YECA 4KQIA 2AOWA 4B48A 2VHVA 4EZBA 1FFSA 1UMBB 5KINB 1EVZA 5BR8B 4ZI7F 1E7WA 3FDIA 3W5HA 1U28C 2YJ5A 4A26A 4G0VA 1V8PA 2ZYDA 4XQCA 3TG8A 3CN7A 1ZR4A 1C0PA 2RGWA 3KOZA 4QPJC 1N2JA 2ABWA 2XD4A 5JS8A 4RZ3A 5JR3A 1XEWX 2YWGA 4QGHA 2HJSA 2C5FA 2CLIB 3G9XA 3QFSA 2JAHA 1SXJD 3LFUA 4G4JA 4H59A 4NCHA 4DLRA 1KGDA 4KN6A 4EF5A 1DGQA 2YMQA 1LPAB 3STUA 3A3OA 4IOJA 2YDXA 1NN5A 1BU8A 4HWTA 1DO0A 1CUBA 3HN7A 4R81A 4Y2GA 4A73A 2VJAA 1A2OA 3MG9A 1HXHA 4RTLA 2FTKE 3OO0A 1M34B 5CCBA 5LQDA 5DRTA 1DAFA 3K92A 3A14A 4MW0A 5LQJA 5F3WB 3D4NA 3LRXA 1K7YA 1KDOA 3DFZA 1N0WA 2HEGA 5DI3A 1E0DA 1TU0A 3EIHA 3DD1A 3EFEA 2VXCA 3IP7A 3C85A 3GLSA 4AZWA 4L72A 1XMVA 3ROZA 4JLVA 4RKFA 1WXFA 1NQOA 1E9CA 2BLNA 4RA6A 5EEGA 5EUCA 3B2NA 4XX0A 1GQYA 3R9KA 2W90A 4LRSB 3IAXA 4W1PA 1IMJA 2VDMB 1LBTA 1PD0A 1RPTA 2RH4A 3AG6A 1L8LA 4JC4A 3R7NA 4I1SA 3TAUA 1GZVA 4N7BA 4BQFA 1M2GA 4PG7A 2Z2JA 3DDWA 2FMKA 3QV1A 4CMIB 2Y9MB 3MB5A 3TDTA 4NIMA 5FTMA 1RXVA 3BILA 1VI2A 2OO5A 4OVKA 2IZ7A 2W2LD 1HZJA 4JUDX 4O4LF 1XQ9A 3UA3A 2DFKB 4BNHA 1N75A 4G81A 5CPFA 3D2AA 1Y5MA 4YJGA 4MXDA 3FSJX 3ENQA 3NNDA 4QFBA 4FHDA 2VH5R 4MS4B 2J5BA 1NE2A 2RHLA 3DLTA 3GFBA 2KM1A 2C94A 4V3BA 4YQFA 2VPQA 2I22A 5THKA 4PXAA 4YI5A 4DSZA 3EXHC 2AVDA 1GRNA 4GBJA 5B3LA 2AN9A 3AJRA 4WN9B 3A58B 5JSUA 1P3JA 4PZDA 3HYRA 1K7EB 4J03A 5LIPA 1K66A 4G2NA 3UJBA 1YRHA 2AUMA 3VBCA 1GAJA 4C0QC 4EIWA 3LA6A 2NYUA 2CYCA 1Y7TA 2VJCA 2VSNA 1MFPA 3NT5A 3BWBA 4OHBA 1NOKA 2ZTSA 3FLAA 4BOYA 4B3JA 5BWCA 2YXEA 3NBKA 5F7ZA 1FUYB 2YIJA 5CURA 1N2CA 4TQ9A 3ZIDA 3DE4X 4YACA 4L0QA 5T6MA 5LWHA 1DAIA 3QBTA 2RD2A 5IC5A 4R0VA 1I3CA 1WOMA 4B3CA 1UZAA 3KYBA 4IDGA 1UQUA 3K0HA 2QG9A 3QVLA 1KDVA 1TEVA 1VMDA 3AEQB 3HZOA 3KWJA 1A9TA 3ZKWA 1WPXA 2DWPA 3SZUA 3QFCA 2J8ZA 3RU9A 2CSUA 4Y9UA 2XBMA 3WI7A 1OZGA 2A2ZA 2GK6A 2OCGA 4OB7A 3ZHBA 3NWBA 5JDCC 1DI0A 4FFSA 3FNBA 1TM1E 2PFGA 4GQIA 3W4JA 1P0CA 3IV6A 2GEVA 3UAOA 5KKNB 1B00A 2I99A 2IYPA 3DZIA 4A6EA 4MV3A 2X3UA 2XOKD 2VTVA 2XB8A 3DCYA 1Z0KA 1D0IA 3D4BA 3K0BA 5U1PA 3SFZA 2Z95A 3DDUA 2AR9A 3CLKA 3GRZA 3GRAA 3LWBA 1NL3A 3LY8A 2PIAA 4UDNA 2P0YA 3U3DA 3A6JA 1JZSA 1JLLB 3ZGVA 2B6HA 4EDHA 3M6IA 1OA1A 1QIMA 5EE9A 1YS2X 2WJ4A 2V96A 3IIJA 3IOCA 5D86A 2XVMA 3C0KA 3P2YA 4X6LA 3VJKA 4TUYA 1CIPA 4F8JA 1DO2A 2X2FA 4EUSA 2HU2A 3F9IA 1ACMA 2HSEA 5EERA 3DMNA 1BS9A 1Q50A 1Z5VA 3FYUA 2JD1A 4QSHA 1VE3A 1XDGA 2FFHA 2VJMA 4W5TA 1I0IA 1M2VA 3I2FA 3U60B 2B83A 3DO5A 1AKRA 1XE3A 1CUGA 1D2CA 1FTNA 1J1IA 2GEJA 3EY4A 3IKMB 4CCYB 3MIZA 1GCOA 1CWUA 2DYKA 3HKBA 3UATA 4UTRA 2UXCB 1ZD2P 1DC8A 1R0XA 1Q0HA 1N9ZA 2RAPA 4I4TB 3KC2A 3R4CA 1U65A 3HJGA 3B6MA 3EA5A 4W63A 4E4RA 3SQXA 2WWYA 3HYCA 1PL0A 3MGGA 1GRRA 1NDUA 1WSAA 2RBEA 1RAFA 4JVOA 1FLNA 2XKAA 2Q9CA 2O9JA 3GVPA 3PMOA 2A3RA 2CJWB 3ZJVA 3AO0B 1YJ8A 4B40A 3FROA 3K4QA 3GX1A 3QTBA 1NUQA 2FOXA 2FSSA 1XL1A 1VC2A 3KE9A 2PEZA 4Z0PA 3RJMA 3PPVA 1LVUA 1ZICA 5AVWA 3W5JA 1QRMA 1FVFA 3KL4A 1F0YA 3EPJA 1S80A 2FUEA 3DDHA 4BV2A 2R0QC 7MHTA 4GHWA 1OXBB 1MF7A 1TDTA 2JFQA 2Q7XA 3VR2A 3VTFA 1UK9A 5EWMA 3LU1A 4G36A 1N0HA 3NKVA 1OE0A 1QVAA 2GEDA 2YOGA 3LT4A 3ZE6A 5KBYA 4GBGA 2BCEA 4BEJA 5K01A 3ZCSA 4JB8A 3U09A 4B5LA 4K3UA 3I9LA 4TMVA 2O2DA 4TL8A 4DV1B 5GVRA 4ZALA 3TIOA 5AOAA 3NYWA 4Y9RA 4B2IA 5IKOA 5HZGA 1PF7E 2J0UA 3L4BA 4D46A 3GEMA 3TFOA 4V0ME 3QOXA 4RIIA 5A3VA 3BRQA 3TCKA 2F1JA 4PVCA 1GYQA 3AETB 4ZVNA 1M6NA 3EGEA 2PX3A 4MLPA 4EL5A 4M7RA 1KOJA 4DARA 2SCUA 1D2GA 1P7ZA 2WV9A 1T4MA 2DFDA 5LQRA 4KUEA 4F2HA 1AK9A 1Q1BA 1SWVA 1XRLA 3EIUA 4FOSA 1G0NA 3RS3A 4CQLB 2Q49A 3ZGZA 3ECAA 4KPZA 1C41A 1P7VA 1XTBA 1ZUD1 3U9TA 3OPXA 4Q3KA 1GZ3A 1X19A 1YJXA 1JPUA 3BH6A 3OM1A 1LK5A 3VPSA 1N5DA 1M0SA 4ZGWA 4AJ9A 5CIWA 3E05A 4YCMA 4M0UA 4RVOA 2GBCA 1L5HA 4ZZ2A 1GLGA 3VOTA 4PW0A 1WNTA 4Y0AA 4D2IA 3PNKA 4ZI7A 1RHUA 3U9LA 1L2TA 1LV8A 3KSRA 2Q3JA 5HZKA 1CCWA 1CR2A 1L5VA 2IJGX 2IOYA 2J32A 4RQBA 3ZG6A 2OK7A 3OKPA 1HMPA 3CJTA 2FUNB 1IG0A 2DOKA 5T6BA 3V42A 4BMNA 5LQNA 3L6OO 3OTHA 2H5JA 3WB2A 2QT9A 3OA0A 4F45A 1XC7A 1RZVA 2GPJA 4BZQA 1EJBA 4C04A 3DXYA 5K2MA 3K9FC 1JDVA 3X1JA 2E4UA 4IJVA 2HYDA 1CQXA 1ENYA 1YVRA 4BP3A 4YAUA 2L42A 3R1WA 1NONA 3PRKE 4YH1A 4ZCPA 5JD4A 2FN7A 3OESA 1OF1A 1OIWA 3E0QA 2BEUA 1CNFA 2CB9A 2JGFA 2VG8A 1BKSB 3RSCA 1II8B 2VDWB 3KZCA 4I19A 2H4WA 3ZQ6A 1BDIA 1MOQA 2HLDA 3CZ5A 1DC5A 1QH1B 2XVYA 3P4UA 4R9SA 1BW9A 5CGZA 4IIUA 2QRGA 4A1FA 4BBPA 3NUGA 5HMLA 2YBDA 3I8XA 3UKDA 1RIIA 2E1PA 1O8BA 1GUYA 2W6OA 3ILYA 4D3DA 3ZWWA 3LG2A 2WJ6A 2G25A 1IK6A 1ELOA 2I2AA 3KSZO 2LIVA 3BSFA 3HMQA 4Y18A 3LT1A 4YPFA 3KLMX 4ND2A 3OX2A 2XH8A 3EJWA 1GZ5A 3KXIA 4IJMA 4UE6A 3ZHCA 3ZJ5A 4LF6B 1MVLA 4HOYA 4RD6A 3AF6A 4JGIA 4DPLA 1JJ7A 3QVWA 3I1YA 2CF5A 1K9SA 2QGNA 2JHAA 3ZE7A 3WTBA 3JQYA 4B4UA 4ESHA 1N6LA 2Q21A 2VDUE 3P71T 5LL6P 5DXJA 4BQSA 4QOJA 2BUBA 3R74A 5E0OA 4L78A 4MDHA 2XCOA 4MO9A 4QLBA 2C8VA 3VPGA 4EH1A 3ZLVA 1NKTA 2EFGA 1O58A 2VUUA 3PGVA 4IHAA 4OHVA 3EC7A 3SC2B 1S9DA 1XROA 3ZU2A 3LFTA 4C7VA 4FNAA 4OU5A 1MOPA 3X2FA 4YUVA 4YLGA 3PDJA 1UBTS 3ETGA 1U7HA 1NLMA 4OHUA 3EOAI 4GVPA 2YUTA 2IX3A 1NW4A 4ZODA 1XT6A 2PYDA 1GPAA 2X5XA 3MUOA 2HBQA 2V6FA 3L6UA 5GY7A 4QDJA 4BNVA 5FA8A 1AQNA 2GILA 1U7OA 1XVVA 2C4TA 1DNPA 1T13A 3LCRA 1HOTA 1U80A 2IY8A 4KN9S 2R1TA 2FEPA 3LLVA 3PXXA 2QW0X 3CVOA 2JZNA 3T57A 4RTSA 1JHVA 4K87A 2DFNA 4MI3A 3KSUA 2J1LA 3U2QA 5ECYA 3UHJA 5DHUA 2ZWIA 4LBWA 4ZVSA 3UICA 4DUGA 3FX2A 4KK4A 1OXVA 1XG5A 4OI0A 1UDXA 3B3AA 1JH8A 1ECJA 4FVTA 4R7ZA 3OY7A 2AOUB 5DWVA 3G9QA 4CI0B 1MGPA 3WYEA 1C4WA 1YZKA 4DSTA 1PT5A 5FHQA 2IU4A 1PK7A 1UZNA 2P2SA 2PZMA 3BXXA 4WV3A 2VHJA 4HDNB 1ISHA 5G1OA 5B5SA 4BFTA 3B1FA 2WTXA 3BCSA 5DB4A 4I14A 3EN0A 1Z2DA 3T3MB 5JRDS 4BKPA 1IYZA 3SXUB 1Q2UA 4OI1A 4FYIA 1YHNA 4JJAA 3QX3A 4PGMA 4W9RA 3FHTA 2WF9A 2IYLD 1K68A 4BL5A 3ND6A 1QOPB 2GTHA 4GPAA 3CSSA 4IDOA 1RM0A 4ZDIA 2JGDB 1YL5A 4AJIA 3L41A 1JX6A 2GTIA 2QK4A 2BRUC 5K8JB 4G4IA 4ZEOA 3DZJA 3B51X 1CC1S 2AMVA 4Z51A 5JWRA 5GZ6A 1AGNA 3IUJA 4QTUB 5REQA 1AJEA 1QX4A 2NT3A 3OOHA 2QOEA 3FLMA 3GP3A 2QX9A 1VSTA 4PIMA 4RGVA 4OQZA 2H1VA 5JJIA 5EGNA 5IVIA 3LVBA 5C7YA 3AR9A 1I3MA 3A26A 1UPXA 2I4MA 4GRIA 1J97A 3RVKA 2CLEB 2JJ2A 4Y2JA 3FOQA 1R15A 3RSSA 4UM9B 1AN0A 1HT2E 3DDOA 3Q3IA 2C5HA 4R2WA 1QIJA 3RJ5A 3O9ZA 3NIBA 1YIDA 2BFBA 3RS0A 3OZ7A 1ZJ6A 1IZ9A 3OKAA 1JQBA 3LBAA 3DEYX 2P5TB 1X1QA 4HRYA 4UEJA 3O47A 4MPDA 4UXHA 1MO5A 2Z5LA 3HSYA 5CAEB 5GTDA 4Y9TA 1PWYE 4IJ6A 4JBXA 4QODA 3UK7A 2XZDA 3EQ7A 3IERA 5IM4F 4HURA 3HJBA 3MLEA 5KMGA 1DBWA 2OKGA 1ZOLA 1NBEA 1XZAA 1Z4KA 3OX4A 4Y6RA 5BN4A 1DBPA 3O26A 1YOBA 2XGGA 3WMGA 3OI7A 3BD8A 4K88A 3M83A 3NXSA 2Q4TA 2R1VA 2H92A 3R3WA 2CGEA 2FZ5A 5LNK6 5F9HA 2QMYA 4Z3OA 2BY4A 2TDTA 3DB1A 1IU9A 2PZGA 3IPAA 1FBNA 4B9AA 4AZ0B 3DV0A 2ZRKA 2CUKA 1KGSA 1G3QA 1T9AA 2I4OA 3AEZA 4MR8B 3WMWA 3QNUA 4YP5A 2P77A 1T0JB 2EDCA 1DJPA 3HJHA 1U2SA 4U7HA 1UWKA 3WQRA 2AI2A 3M9LA 5D5QA 4UTPA 6AT1A 2J3KA 1GPUA 1KKLA 2H4YA 1QH8A 1QIGA 2EFCB 2G9QA 3JWGA 4MMZB 4NNPA 1LK0A 4AC3A 1VE5A 2HTEA 3CISA 1QVZA 1F4PA 5EMJA 5B37A 4JMPA 4E75A 1L7DA 4UU0A 3WYBA 1KY5A 2IYOA 2G9RA 3FPFA 221PA 3PTZA 3B13B 1AS3A 4ARZB 1UINA 3HDQA 1WW3A 4EY7A 1KO8A 3EXAA 3S7ZA 2MYNA 1GYRA 1OYYA 3HVJA 4LHEA 1WXHA 1PT8A 1OLXA 4DT1A 5B1EA 2IXGA 2W6ID 4NS4A 2C5EA 3DWGA 1YDWA 1P91A 4X63A 5BOSA 3FFWA 4TXMA 3SS8A 5AJHA 2G71A 3WWDA 3WYAA 4BN4A 4EW2A 3EVBA 3RVLA 4WOPA 1B2RA 3DDSA 1WUHS 5TMEA 4LCBA 2AC2A 2AFIB 2CMDA 2QTCA 1VKNA 3F46A 3FPGA 2PRKA 3KV3O 5L3QB 3A05A 1OBHA 2XQJA 2R00A 4LQDA 4GX1A 1O57A 3DH0A 2IU6A 1TJ4A 3QE2A 4X7MA 1CT9A 1YMUA 3A9RA 3IELA 3LHSA 1QG2A 4NNJA 5IAEA 5CDSA 1T43A 4RJIA 8ADHA 2PH7A 2YYAA 2OSVA 4BFXA 3PDIB 3U6KA 4JEUA 1D2NA 1GTVA 1C9DB 2DCMA 1N5KA 2OGTA 4GPD1 5AJXA 4IDCA 5FULA 1Y8CA 2R7KA 4FCTA 4AO8A 5JW6A 2VZEA 2HC9A 4BGIA 1FUUA 2W6CX 1BA3A 1KJ8A 1T9KA 2DULA 3G8CA 3R8FA 4AJHA 3COJA 1MXHA 2KHZA 3IHTA 1LC3A 4ALIA 3A1VA 3HUUA 1XKQA 3I53A 4PHCA 1E3JA 2QMQA 3WGOA 1NRXA 4BTEA 2AOVA 3GCWA 5KYKA 3H6KA 2WLFA 1P18A 2E85A 3WV4A 2CMKA 2YJTD 3ND8A 4Q93A 5ALGA 4EFLA 2B1JA 4MGZR 4WWHA 5GGXA 1NT4A 3EZXA 3HL4A 4NBUA 4OX9B 5DHTA 3V4ZA 1QP4A 3V4PB 2AFHA 2IH4A 4KKXB 4ZTZB 3D5EA 4WUVA 2ZXFA 5JCJD 5JSZA 2ZM6B 2A5YB 2HDNB 4F1KA 2REXB 4HXFB 3UKOA 4FBMA 3JXEA 4R8SA 2JEZA 4NZPA 4UAGA 1EH5A 4DQLA 5KYGA 2IZZA 5JFGA 4XA8A 5ER6A 1R6AA 3OETA 2BBOA 4L9RA 5K0ZA 5AKLA 3R9XB 3RK0A 2Y3IA 3B3QA 1JHYA 1U1IA 2QPTA 4DY4A 3ZTWA 2PX8A 1TD9A 1YJ5A 2W4IA 5C52B 1M6WA 1NXQA 2YZNA 4R1LA 4Q24A 1JG2A 3Q7IA 4EY6A 1FTSA 3O7MA 3ZHYA 4C9BA 3TTXA 4IGFA 3GMTA 3OJFA 3BWEA 4GO1A 5FAKA 2DWQA 2QBYA 1C7EA 4QHYA 3TL6A 1JSZA 1ZGCA 1GSHA 2IEDA 3DPIA 4JYCA 3WHKA 2BRUA 5BSGA 1KAOA 1FJXA 1VZ3A 3PUVA 2FPOA 2ZIXA 3H17A 4R2MA 5AM0A 3WJ1A 4QQNA 1WB9A 1CYDA 3GJ8A 1GCIA 1Y5NA 4XH9B 1S89A 1DG1G 4M2BA 4GLJA 5BXQC 1TPZA 3K1ZA 4X24A 4I08A 5K0GA 2I3BA 4AA7A 1ULBA 2AD5A 3N75A 2PZBA 3GJQA 3WXBA 1OH5A 2CLFB 1GR0A 4AROA 1KAMA 3GJRA 4KXMA 3QXXA 2WTUA 4P5EA 4J6FA 3L6EA 3MNFA 1U63A 2VEDA 1EAMA 3CUKA 3PX7A 4UDOA 2EW8A 1F60A 4AQDA 1Q77A 4FYWA 4R6WA 3HTXA 1JGTA 1IRXA 4M0LA 4NBNA 4RAQA 4YA6A 3ZTYA 3D3NA 4RTPA 3H42B 3OP1A 2GM4A 1AHNA 4P35A 1X7XA 1MAWA 1J22A 2ODWA 2G77B 2TSYB 1KQOA 1RM5A 3BWYA 3DXFA 4Q1CA 3TFQA 2GA8A 4D56A 1YI0A 2B8EA 3EIFA 4DA6A 1T36B 3BHIA 1RYHA 4LDNA 5DGIA 2Q8PA 5E38A 4G63A 5BOVA 4A9AA 1E4EB 5FR1A 1MAAA 1R88A 2O2HA 1N6NA 3GMDA 1Z22A 2ZU0C 3KKLA 2G4CA 1JQ5A 3DO6A 5SZJA 4EB6A 4MV8A 4HUTA 4OYLA 3SS7X 1I33A 2G06A 2AJDA 1X15A 3OZVA 4M9ZA 1C30B 2C97A 3EZ2A 4ARUA 3JQGA 4B3BA 4Q9KA 3KUXA 4LRYA 4F8YA 4E11A 4EX7A 5I4IA 4D98A 1VPWA 4EY5A 4CFYA 5AKJA 5EJIA 1VL2A 4CETA 3CURA 4CCWA 2I7CA 4FGLA 3U56A 5DPMA 3VUEA 2Y71A 4F92B 1TTTA 2QB5A 4QA9A 2YWDA 3AUJB 5ELXA 2PWPA 2IX9A 1LI7A 1K2VN 2IVFA 2NPFA 2JRCA 4HH3C 2QIVX 1T3LA 3TYXA 1SZPA 2JK1A 1Z6XA 4EPXA 4KV7A 1ISGA 1SNYA 3UUWA 2ZXEA 1AN9A 4B6GA 3E1KA 1GXSA 2PXXA 4FX5A 5IEJA 3LL4A 4JS0A 2VF8A 1O0CA 4ANFA 2JI7A 2R8RA 4F9EA 4YJFB 5HUJA 5AHRA 3M7IA 4QLAA 3TRKA 2IKQA 1R0BA 3A36A 4GP7A 2JIBA 4I0WB 2NXJA 4UPEA 1X87A 3CNNA 3QMMA 1WVMA 2PMWB 5DI3B 2WJAA 1JJAA 1OPXA 4J0FA 1LF0A 2WI8A 3B5EA 3P7MA 3PF9A 5DLPA 3UJDA 4CCSA 4RA6B 4F4IA 1GUAA 2Y77A 1L6RA 3NETA 4DMCA 2QXTA 1SKBA 4XX0B 1XKLA 2UVDA 2Y67A 3CF0A 4QYIA 4O2BF 3OMWA 2Z08A 1FMCA 5C3MA 2PKWA 5FL7A 1X80A 3GC6A 3QLVA 3R09A 1KFKB 1WKBA 2E87A 1Z35A 1H65A 3FDZA 3LUKA 1KZ4A 1VHWA 3MC1A 3GVIA 3Q7EA 4L8YA 3K94A 3PT5A 4M1KA 4DLLA 4GL2A 4ATNA 4RYDA 3LDUA 5IDQA 4ZQBA 2XAUA 3FDJA 1D9XA 3OIVA 5EQDA 4YJGB 1R8YA 3V2HA 4WBNF 3VNVA 4G5FA 4B85A 3TR5A 3RIHA 2VATA 3WKCA 4DV0B 2O8EA 4UMVA 5I4CA 3KQNA 3DUFB 3ZYCA 5JVDB 1XTQA 3H84A 4PHFA 3WRVA 2CDRA 1CNMA 1QWOA 1UDAA 2IQIA 2C5SA 2CMFA 2GUWA 3FPCA 1D07A 3GZJA 4OSPA 3QXSA 1HLDA 1Z13A 2WU8A 3NAGA 1FJHA 5HHTA 5D7BA 3RG8A 1RJ9A 2BHLA 1ZNQO 4PNHA 2VNJA 5SYNA 1Q74A 4E08A 2N1MA 2VDJA 3C87A 4MAFA 4H31A 1M66A 1KHTA 5CM8B 2ZIFA 2WIBA 4YREA 3SYKA 5CVJA 1YZUA 3AR7A 5I7RA 4I5GA 5IJWA 3MT7A 3WIOA 4L4ZA 3I9MA 5C5CA 1N2CB 2EJCA 4Z4IA 1U9CA 1Q3TA 1EDZA 3UG7A 3PNSA 5J2UA 1SXIA 4XYGA 5BW6B 1DCFA 3QXCA 3PKJA 3A1UA 2JGIA 2BJHA 4HAVA 2QY6A 3BSWA 4B76A 2F8SA 3D4OA 2XMRA 3N6RA 4C7KA 2BFFB 1RFGE 4DR4B 4DABA 5EP4A 1E63A 5EJ5A 2X8JA 3MWJA 1K8RA 4KUGA 3FOEC 1SIUA 821PA 2PMBA 2BF7A 2Q4OA 3DF9A 3JVEA 3AUKA 5TEWA 1BX0A 4RHXA 4DQDA 2OEGA 1HV9A 3VX4A 2VHZA 4CMHA 1L1QA 3M2TA 1I3OA 2WJJA 3WHPA 2QYSA 1V5WA 1UM8A 1JKXA 1U6IA 2P75A 2XQIA 3BXZA 3G2HA 3MMPA 3PT9A 1C8VB 1KI7A 4OQEA 4UBIA 5BSRA 1NW7A 4EQZA 1NLUA 2QZSA 3IDOA 5CGQB 3I92A 5CXSA 4MVJE 2OOKA 3DKPA 4DQXA 4MI9A 3I5MA 2Z57A 4BATA 1KP9A 4OLBA 3K70D 6ADHA 1JQ3A 2UYYA 2QD3A 4TUYB 4Z7NB 1QRTA 1ZINA 4LVCA 3R3HA 3FMGA 1SXJC 3RRZA 1K4KA 1U94A 2QXUA 1EAYA 2QROA 3MFYA 4BDSA 1Y7LA 5THQA 1JEYB 5JBNA 3FYUB 1EFDN 1VLJA 3FG9A 2VJMB 3FWZA 4MGYR 3VKFA 4KQJA 1M2VB 3C1AA 4DLSA 4DYDA 3MUNA 5C18A 4D9NA 3PFBA 3NCHA 4QUAA 1MXFA 3M82A 2QF7A 3HKBB 1T8UA 1CEYA 1KVSA 1ZM2A 2C3OA 3I6QA 3HSQA 2PAAA 3WYDA 5H0IA 4HZIA 4TQGA 3G2OA 3RVDA 4PGHA 1SSMA 2V9CA 4R16A 2VYND 2C1XA 5BVHA 1KQGA 5ED4A 1B23P 1XXHA 4MVXA 1X7YA 3H1GA 1NQ5A 2ZETA 4K9QA 5M29A 3BL6A 4AJLA 1OFVA 1U8AA 1Y1QA 3A1SA 4TKLA 3R76A 4IXWA 4OFXA 2PRYA 1CY6A 3QMWA 3JQDA 2JCXA 3KHKA 1FUEA 4H0NA 4UTXA 4WKOA 4YNBA 1Q6YA 1U1CA 2BM8A 2FN4A 1F14A 3K5PA 3LPCA 3VKUA 4ER0A 3UAYA 1MX9A 5FXMA 3HDTA 3NORA 5CUQA 4X9XA 1PKEA 2BI8A 4FFDA 2DCUA 1E1DA 3KLNA 4KVZA 4J43A 4W5JA 1QHSA 1QMGA 3CX4A 3Q15C 4LC1A 5CRIA 5JNVA 2I78A 2RI6A 3NHRA 4QG3A 5SY4A 1UMCA 2QAJA 3FDFA 5TGTA 1FOEB 3O4GA 1U7ZA 1NLZA 4F3RA 2V7QA 3COYA 1R50A 2EG5A 3HBAA 3K2EA 1DZ3A 4H7PA 1YR6A 2PV0A 2PZJA 2HAEA 2O2XA 4RVFA 3VU0A 4EB0A 1Z6QA 1GZ4A 5HA5A 1I7PA 3K72B 2B9EA 2OA0A 1AMUA 2GRAA 4BLTA 4TS3A 4Q47A 3RREA 3L5KA 3NJ4A 1NRWA 4IWNA 2E1RA 2JLQA 4MUKA 2I7TA 3IE0A 3FOAA 4CG3A 4Q7EA 2JK0A 3M6FA 2FYTA 4BNFA 5FBVB 3IT0A 2B5VA 3NIFB 4YQYA 3QX9A 4X92A 4WUTA 1JSCA 2HK7A 1CXZA 1QYRA 3TJRA 2SCUB 3TTUA 1XF1A 3OM8A 4R41A 5EWLB 2OD2A 3KX2A 4JZKA 4O4HA 3OQVA 3ZLUA 4MICA 3R75A 1H8EA 4JC8A 3WB9A 2XWJI 3H18A 3PRYA 4Y1FA 3GDFA 4JB0A 1J42A 1CJVC 1G3RA 1H4TA 1TTPB 2YMLA 4W7SA 5EKUA 4DLAA 3CQ9A 1EDBA 1JQAA 3QWAA 4HDMA 3U4HA 4BP1A 5IZCA 5L3SB 2VJBA 4UZFA 4M1ZA 1ZN9A 4WKBA 5AJUA 1L7AA 3KEFA 2PO5A 3STYA 4FINA 3UT6A 3WYNA 4AICA 5C1BA 1ZGGA 1R0CA 1L5HB 2ZK7A 3VNPA 2AQ9A 1NJSA 4M1SA 1W5AA 5AUQA 1EEXB 4Y67A 2NSLA 3GFTA 2MSWA 5IAGA 5DW3A 4RTQA 2R8EA 1ISMA 2D0PB 1GA6A 1KEUA 3EE6A 1V6SA 1IBKB 2D5BA 1G2QA 4FFRA 4K03A 3SJAA 3VDNB 2CXRA 4CV1A 2DKFA 1C8KA 3ZWBA 2ZRAA 2C9BA 3QI2A 3T95A 1PEYA 1TCCA 4ENWA 3NVAA 3QPBA 1UFRA 2O2GA 3PCTA 2JIMA 3CT4A 3TLBA 1CIJA 1EJ6A 1PYOA 2J3QA 3G13A 4INPA 5CK4A 5CB4A 3T1HB 5E6RA 3RVMA 1YJQA 4TV8F 3E0XA 5DEOA 2A30A 1IQRA 2IVZA 2IXBA 3IRUA 4CGYA 1ZNXA 1M2NA 2VK4A 1PNVA 1Q57A 2GEKA 4R1TA 3TMYA 4LY6A 2RGRA 3VI3B 1ISIA 3A8TA 3OBBA 2DTEA 1BW9B 1KFEB 1XZFA 2LDBA 3D7LA 2CUZA 1DMSA 4G09A 4PX2A 3OBIA 4D9BA 2HBRA 1FUIA 1R37A 4KQCA 2BMEA 3Q7TA 1GFIA 2JHPA 3OU6A 4JELA 5J63A 5IZ4A 3QW4B 5HCUA 2EZTA 3CUVA 2WU4A 2JGRA 2QQ0A 3WLJA 4HBZA 4DS3A 2FUCA 3LYLA 1VLVA 3GO4A 4C07A 3HXLA 4HQOA 1CY2A 3N39C 2M2IA 2XDYA 1G95A 5J4VA 1KVTA 3JZAA 4AJKA 5FUWA 3FWHA 2HHHB 3BGDA 1WCV1 2IY9A 4TYQA 4G07A 2PYIA 2EKDA 2WILA 4ZVUA 2C9YA 1OT3A 3GVDA 2YJZA 3FNHA 3P5BA 3Q3JB 4FJ2A 4M22A 4NZOA 1SHLA 4KU4A 4G0UA 3VBJA 5DM2A 3TDMA 3DEHA 1XRMA 1SUCA 3CWCA 1T1IA 2CZCA 4EI7A 2WHYA 3HY4A 5L7YA 4HF7A 4CBVA 5INTA 5KZMB 4D9EA 1GPLA 2QW1A 1QO0D 1YB7A 4MDFA 3PG5A 3T7CA 3FMFA 2P6NA 2PO7A 4KXUA 5FOWA 5IVPA 5LD2C 3KZMA 1K5HA 1H9BA 4JWKA 5A6VA 4KGDA 3GA0A 1G5QA 1V4BA 3HJRA 3ICOA 4B3HA 2O8DB 3UK6A 5D87A 3V1MA 5C5IA 4H7IA 5FQOA 2G1JA 2Z3VA 3PF8A 1EK2A 5DHSA 2GARA 1ZH8A 1J25A 3H9JA 3OZWA 4MVJP 4RKYA 5KUTA 3AT1A 4BJ3A 1E0AA 1SXJA 3GNSA 4RFVA 3UMMA 3B60A 2GNOA 2GEFA 4B6EA 2R1TB 1ISPA 3AIOA 1SUEA 2J07A 3NKFA 4HNVA 1N2IA 5B3JC 4JIMA 1SSQA 1LC0A 3LPMA 4K0RA 3EAFA 2GRJA 3HN2A 1P1FA 4KFUA 3PUHA 2MYPA 3NHYA 3ZWPA 3M4NA 3AJ8A 3NQ41 2H8GA 3WLNA 5EZ5A 1RAHA 3GL9A 4WNCA 4G65A 4TMTA 1EVKA 5ENZA 4YUZA 2F1KA 5B3AA 1DX4A 4D9GA 1X1BA 4HEQA 4P3NA 2O8NA 4GOOD 2GS9A 2HDOA 2DERA 3N2ZB 1Y3FE 3PVCA 1X13A 2PMCA 1Z6TA 4FSDA 1ZYUA 4HNAA 1H3EA 2QN7A 3CLRD 3GEHA 4JL5A 5EEHA 3G2PA 4TL7A 5FWNA 2JDID 4UHDA 2WWGA 1OH7A 2OSBA 5LKRA 1A5BB 5CBPB 3DULA 2W2LA 1QOZA 1KNXA 3DPUA 3LA8A 3ACBA 1UOOA 5K0CA 1OXTA 4JP2A 3WADA 3AP1A 3PFIA 4DIKA 4AVYA 4UCWA 3WJ2A 5C5DA 1LZLA 1U4SA 3HSKA 3LYUA 2IUEA 2YH2A 4FE4A 3WNVA 3KWCA 4CTMA 3FNQA 5C81A 4IDQA 2PRZA 4BO8A 1VL5A 2IW3A 1ZY2A 3BEOA 4J7XA 3O0TA 2CXHA 2H4JA 5IHXA 1G4HA 1Z5GA 1OWNA 3ZVMA 1ZMRA 1WUIS 2UVQA 3EVCA 2QJWA 3VPHA 1XELA 2FW0A 1M6EX 3MMZA 4IIJF 4ZAZA 1P77A 3SKXA 1UCFA 1VB3A 3WDLA 3MB8A 3DNFA 1MDBA 2EX0A 1AA9A 3G5MA 1J8FA 1P2DA 1DV2A 2BFBB 7ABPA 3OT1A 1JIVA 1Q12A 3FY4A 4PQFA 2JAXA 4IDEA 3HFJA 2P9EA 5D84A 3F67A 1JJIA 3AVVA 5I7HA 2HM7A 3AUAA 2ON6A 3L6BA 4NYMQ 4J4TA 3SZMA 4HSGA 5LN1A 3L1VA 1QKIA 1QUEA 3I45A 5BN4B 2ZOSA 4Q02A 4MRSA 5BORA 1QK3A 2HBZA 4L1KA 3CR7A 3LUHA 4JJ4A 5G4KA 4TYNA 2PZEA 4UHFA 5T3YA 1SHZA 4IR7A 4Z7OB 3SHWA 3JTMA 1NBIA 2FPGB 2R7NA 3O95A 1KDRA 1Y1KE 3ENNA 3QF4B 3COZA 5ER9A 4E21A 3UJPA 2FPUA 3ITKA 1HL7A 2NVBA 3DV0B 4P0TA 2I2WA 3IUPA 2NN3C 3N9IA 2PMEA 1JE0A 1M34E 3IVXA 1CQIA 1UPBA 2A3NA 2O1XA 4Q39A 3SM9A 1UJMA 2IP1A 3IB6A 3BJMA 3NTQA 3UT0A 3ED1A 1RS0A 1SKYB 4LSGA 1ZN7A 2NU8A 3AP3A 1DHRA 3LPAA 4QUHA 4ZCRA 5K0EA 1L7NA 1X7GA 2WD7B 5LLDA 4P0PB 4XJVA 3RC1A 1E1CA 1ZW6A 2XRYA 2GCIA 3PRJA 1YC2A 3DFIA 2ADMA 3KSDO 1SCAA 2Y1CA 1KQFA 3H5LA 3DYIA 5E4JA 4Z4CA 5DNAA 3SLGA 1C7JA 3HJFA 1PAUA 3E84A 3N2IA 2QLLA 5LSAA 2CXQA 2Z2YA 1B0ZA 5DI9A 4MVYA 4J7CA 4IHFA 4QXQA 3QVSA 2QRQA 1GTZA 2QX7A 1A1SA 3DLBA 4AULA 2IPAB 3AVXA 1GU7A 4XAQA 5KWSA 3I2JA 1OLXB 1I4EB 1RAEA 1RKVA 4DT1B 2NMVA 2PJDA 4CL2A 2I4NA 2J7KA 3SYTA 1AOXA 3I2IA 4Q1VA 3DT8A 5BOSB 1HOXA 3NM6B 4C08A 2AV6A 1O9HA 3H2YA 5DYIA 2FN9A 3PSHA 1NVEA 2Z1MA 4KL8S 1FZQA 1H0SA 4E32A 1BIFA 1U2PA 1ZCZA 4DGSA 4XVUA 1YQ9A 2D5IA 2WYOA 2PH1A 1EINA 3RUHA 3Q10A 3IOEA 5F77A 4MGIR 1TJYA 2VIIA 3ER9A 5JATA 5T8KA 4P4NA 1JP7A 1R5OA 4FGSA 4MKGA 4R9UC 1GTRA 1B15A 3OCXA 3FUVA 3C6MA 3NDIA 4X45A 3PR1A 1VLQA 5C4GB 2XZOA 1N5RA 3RIEA 4I3GA 2R5FA 1GY8A 1P45A 2WYUA 1GTSA 3P1BA 5JRJA 1RW4A 2OOSA 1YAJA 3AF5A 2QKYA 5I9BA 1FXWF 5PGMA 3ZWXA 4ZN6A 2WDZA 3K9NA 4IZHA 1P7CA 2Q29A 2JAQA 4HH1A 3V8QA 4NMHA 3U19A 3G0HA 1WUKS 2PWYA 1WEHA 3N2KA 3OQNA 1T3GA 4HXEB 4IIVA 2HF2A 1W5FA 4ZRDA 3WGTA 2JI4A 3WDSA 1RRCA 5CVVA 3KWLA 3HDGA 4MKRA 1ICEA 2ZIVB 3URMA 5AI0A 4ZAYA 1C8BA 1KMQA 3T7AA 5BWBA 3RVQA 4GKKB 4IGAA 1MW8X 2I6XA 2Q6KA 3HZHA 4G1MB 4WXPA 5BUSA 4GI7A 2REQB 3OCZA 3DJ4A 4I9UA 3S2IA 4DBVO 1DKRA 4IDHA 4OOEA 3FTPA 1KGTA 4G9BA 2D5CA 3AZOA 1XSEA 3ZCVA 1NNI1 4I6EA 4GFDA 4YRMA 5JSZB 1NFFA 1PLJA 2H4HA 3VMFA 3JAMA 2EQAA 1EVEA 4L4UA 1F6BA 2IODA 3HFSA 1FYEA 2DJIA 1VYTA 3ZHZA 1YIOA 1VLZA 2HKIA 3JYNA 3KSMA 1LK7A 2PM8A 4JFAA 4YO7A 3WZ2A 5SY6A 3VC2A 5GJBA 1WP9A 2D8AA 4PO3X 5J47A 4KXNA 2NSHA 1QRUA 2CXSA 1JG3A 3I9JA 4JROA 2WFAA 1ESMA 1NC3A 4TKZA 3THYA 5ICMA 3K15A 1E1LA 3AKCA 3CCFA 4BV9A 2PQMA 2PUBA 1ZX1A 3A3YA 1U8TA 4ED9A 3DOFA 1REQA 1XPJA 1N78A 2VSYA 2YXPX 5E3JA 2DP4E 1LJLA 2R8XA 4BX9A 4OXRA 4UOZA 3LC1O 3N3BC 3NHJA 2ZIXB 4B6FA 1SBZA 4BGVA 1A9QA 4LFCB 3GU3A 1DXQA 2IUSA 4GSLA 1YZYA 2F90A 1A5AB 1WB6A 4WE3A 4E1BA 1KMHA 4RTKA 4KRFA 1ABEA 2OZPA 3RYTC 1W1UA 2VK8A 3DKRA 4OXKA 4AZSA 1ONNA 2QVGA 4S24A 6ABPA 1PJ3A 3BYZA 1E9BA 3JX9A 3JYOA 3GLKA 3PHHA 3KAQA 1LY1A 2HWXA 1ILWA 1E5VA 4UBKA 4YCAA 4ND4A 3CF4A 4B3XA 1FRFS 2FF7A 4YXFA 3T3NA 4XIYA 1FC0A 1FP2A 5LBTA 1IM5A 1E2DA 2YVQA 2WHXA 3INNA 5H16A 2VO1A 1O5TA 4OJQA 4YXWD 1QQBA 4OMFG 3HYTA 4XYEA 5BYBA 1U3TA 2V0HA 2P9QA 3K3PA 3CLUD 2O6HA 3W9BA 1Z16A 3OJWA 2VT2A 1GNPA 1BVUA 3USES 3VH2A 2FJUA 1VMIA 5JD3A 1DOHA 2YN0A 3KTFA 5EQTA 2X23A 5IC6A 3F2VA 5TRTA 4ZMRA 5CLGA 1NU8A 3ZGOA 4MV9A 3B1YA 4EA7A 3AHFA 1NBMD 4ZQFA 1YSCA 2G70A 4JODA 4QUJA 4KYIB 1CETA 3AC0A 1QGED 1AXRA 3GR6A 2PZFA 4FT2A 4YUWA 2BMJA 1JHPA 2WSSD 3L7CA 4U2GA 4I4IA 3KEMA 1VKOA 3A4MA 3E8XA 4EDFA 3GVHA 4PIVA 4YPVA 4UQLA 2IH5A 3GRVA 3EH1A 2ZSAA 2I67A 1HGXA 3QKSA 4X94A 3P0HA 3CNLA 2B4AA 3FYSA 5SYAA 2A86A 4YLEA 3UG6A 5JRZA 5KPDA 5JZOA 2ODEA 4WVFA 2X4IA 5ADHA 5MDHA 2IP4A 3LWNA 1WR8A 3AR2A 4UEWA 2VS1A 3H0EA 2Q5LA 1OVGA 2IZ5A 3MTGA 1KQAA 1B1CA 2PUAA 4GRAA 5I51A 3CW8X 3HB0A 4WZBE 3VPDA 4WHMA 3FNEA 3AR3A 1M2JA 3ZY3A 4BTVA 2J3LA 1DFGA 4DIMA 3ILXA 1F4LA 3WGUA 3ADCA 3WHLA 3GLTA 2NYVA 1NY5A 1LTKA 3VJLA 5K45A 3KIPA 1JAXA 5F3RA 1DAPA 3F6SA 1UPTA 5H9WA 4XWWA 1CDDA 2GXQA 4HLNA 2JL1A 1XZLA 4JOSA 4UAUA 4XSVA 4YK7A 1TU3A 4C89A 4ZEMA 5B58C 1JEEA 1FRVA 1FJGB 3AOEC 2B9VA 1ZI9A 1HR0B 3KKKA 1BJRE 4U6SA 4I8XA 2VPIA 2P3SA 1VLMA 1WS6A 3KZVA 3LI2A 3TJZA 4KI0A 3NRCA 2HMTA 4FLMA 3IBTA 2WPNA 3UVEA 1UZUA 3CCBA 4AF7A 3MPUA 4Q3EA 2FEMA 2PGXA 4UVDA 2AXNA 3P2KA 1G4AE 1OCEA 3N7TA 2X4GA 2ZBQA 4QREA 5KYVA 3KSBC 3LCJA 1EVIA 2SNIE 1U3FA 3W6ZA 4HZCA 4ZWNA 1EE1A 1Z38A 5KDDA 3TGLA 1X80B 2RBKA 1MV8A 3L7JA 3FDZB 1EBBA 2OFOA 4G5YA 1U2ZA 2QRMA 4E94A 4BS9A 4D6PA 2H08A 4IH1A 1ULHA 2Q0QA 1N5JA 3LXMA 4RVDA 2HU5A 4S1TA 2JAUA 4AUNA 1RCTE 4CMKA 5WRFA 3SHTA 3KO8A 3I9NA 2ZS9A 3IESA 3HCCA 3VR4A 3PYMA 2OUKA 4ZT5A 3PC7A 3PJFA 4PYKA 5BMVA 4Q4LA 4E2FA 3JATA 3UT5A 1XTPA 4WVLA 3W5DA