4M98A

Acetyltransferase domain of pglb from neisseria gonorrhoeae fa1090
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
205
structure length
205
Chain Sequence
b'NRKLAVIGAGGHGKVVAELAAALGTYGEIVFLDDRTQGSVNGFPVIGTTLLLENSLSPEQFDITVAVGNNRIRRQITENAAALGFKLPVLIHPDATVSPSAIIGQGSVVMAKAVVQAGSVLKDGVIVNTAATVDHDCLLDAFVHISPGAHLSGNTRIGEESRIGTGACSRQQTTVGSGVTAGAGAVIVCDIPDGMTVAGNPAKPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pilin glycosylation protein
publication title Biochemical analysis and structure determination of bacterial acetyltransferases responsible for the biosynthesis of UDP-N,N'-diacetylbacillosamine.
pubmed doi rcsb
source organism Neisseria gonorrhoeae
molecule tags Transferase
total genus 72
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2013-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17836 PglD_N PglD N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4m98A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m98A01
4EABA 3OUPA 3NZ2A 1I7LA 2VPQA 1KRVA 3RFCA 2OEGA 3JZFA 1MRLA 2ZDQA 1G95A 4MV7A 1PK8A 1SSTA 5BPFA 2IC7A 2IU8A 3FTTA 4EAAA 2R7NA 2WLCA 4KQLA 2YS6A 5U2KA 1KRUA 4GGMX 2OEFA 2OI6A 3IXCA 3ECTA 1DV1A 2R86A 2W6ZA 3G8DA 1S80A 2W71A 2GGOA 2GPWA 3TIOA 1T36A 1EZ1A 3T57A 1BXRA 2C00A 2JF3A 5E3RA 3R5AA 2R7MA 3R5CA 2V59A 1CE8A 1KJQA 2W0VA 1IOWA 3AX6A 1YP3A 1HM8A 4ZQIA 2OI7A 1SSMA 4QSHA 2WLEA 3ORRA 5C1PA 3VA7A 3F1XA 3ST8A 1GLVA 4R37A 5DEPA 2R85A 3V4ZA 3IGJA 5E3QA 1QREA 4HNUA 3KWCA 1YP2A 1EHIA 3I3XA 3R2WA 2ICYA 1KRRA 3R0SA 3P1BA 4RZQA 1BNCA 2VR1A 2CZGA 4MV1A 1M6VA 2R7LA 5DEMA 3BSYA 4M2BA 3OTMA 4C5CA 2IUAA 4ISXA 3DJ4A 2V0IA 3FS8A 3OW5A 4HNVA 3WO0A 3JZIA 2I8CA 3WNZA 2IP4A 3ETHA 2ICXA 4J09A 3VPDA 3GUEA 4EGQA 4EA9A 2V0HA 4N6BA 1AUVA 3ORQA 3BRKX 3R5DA 4EQYA 2W6QA 4E6TA 4HNTA 3D8VA 1QRFA 3EEVA 3R5BA 4E4TA 3D98A 4C5BA 2OI5A 2YRXA 3N6RA 4MZUA 3HB9A 3DHOA 4EA8A 3TQTA 3P47A 3Q2OA 4FCEA 2YRWA 3VBPA 4EGGA 1FWYA 1UC8A 3VPBA 2YZNA 4HR7A 1DV2A 2V5AA 5ADXV 2QIAA 2QKXA 2VHEA 2YZGA 3VOTA 4E6UA 1PX2A 4WD3A 3R23A 1T3DA 3SRTA 1FXJA 4N27A 3Q1KA 2TDTA 3R1WA 3G8CA 4E1KA 2I80A 5DMXA 4FU0A 5L6VA 1E4EB 3GVDA 2XD4A 1Z90A 3MQGA 2P2OA 5H80A 3I12A 2QF7A 2PN1A 1XATA 3RUPA 5AFUU 3R5HA 3DK5A 4AA7A 5JQWA 2DWCA 3OUUA 1GSHA 2W6PA 3PMOA 1CS0A 3VBNA 4HZCA 3FOQA 2DZDA 3FSXA 1MR7A 1B6RA 1QRLA 1KHRA 3VBKA 3SE7A 4EGJA 1OCXA 4J6EA 3BXYA 5F42A 1ULZA 4MV9A 2QIVX 2AQ9A 1KK6A 3LWBA 4G3PA 3U9SA 3LP8A 3OTZA 4ME6A 1B6SA 1THJA 3MQHA 5AFUV 3QFFA 4IZOA 3KWDA 3C8VA 3TISA 4M98A 3MC4A 3V4SA 1A9XA 4E79A 3TDTA 1HV9A 2XATA 2V0JA 5D8DA 4G87A 3R3IA 4MAMA 3K5IA 1QRMA 3VBMA 3TV0A 2Q4JA 4IHGA 4M2AA 2VD4A 2V0KA 3VBIA 1E4EA 4MYOA 3HJJA 3E5NA 1KJJA 2PBZA 4HCQA 3N8DA 1JDBB 2RIJA 3TW6A 2GPSA 1EYZA 4KPZA 3BSWA 2WLFA 3R5XA 2J9GA 4IHFA 2W6OA 3ETJA 3RV4A 2I87A 4MV6A 3GOSA 2Z04A 4HUSA 2W70A 3SPTA 1KGTA 3MJFA 3VBJA 1V3WA 1MR9A 4IWXA 3KWEA 5I47A 2FKOA 2YYAA 3VNPA 1C30A 4MV8A 2W6NA 2YW2A 2V0LA 4N69A 1J2ZA 3FSYA 5C1OA 1V67A 2V58A 4MA5A 1AUXA 3FSBA 4M9CA 4MV3A 4EG0A 1KK5A 3EH0A 3K3PA 2FB9A 4R36A 1KJIA 3R3RA 4EA7A 3V4EA 1GSOA 1KGQA 3BSSA 2P0AA 2YS7A 1KEEA 2GLTA 4DCLA 2ZDHA 1VKZA 1GSAA 2VQDA 1QQ0A 3VPCA 3HSQA 2YZMA 3Q1XA 4M9UA 4K6RA 4J18A 2R7KA 4KPXA 3BFPA 3OU9A 2I5KA 2DLNA 3VBLA 1TDTA 5E3PA 3BG5A 4MFGA 1G97A 4N6AA 1IOVA 1QRGA 1KK4A 4IHHA 4C5AA 1XHDA 3FSCA 2WLGA 1HM0A 2IU9A 4AAWA 1C3OA 3HBLA 5K2MA 2NPOA 3R8YA 1YP4A 3AW8A 2XCLA 2GGQA 5BPHA 3TWDA 3CJ8A 3OUZA 3RV3A 1KQAA 2W0WA 3R5FA 4M28A 5L6SA 3JQYA 4G3SA 3TK8A 2ZDGA 4HZDA 4IWYA 5DG3A 3U9TA 4DLKA 1KJ8A 4KNXA 3WO1A 4G3QA 1LXAA 4MV4A 3FWWA 4HURA 3EG4A 3VMMA 4H7OA 2PVPA 5ADXU 2QK4A 4M99A 3HO8A 4R7PA 4AC3A 2W6MA 1SSQA 1UC9A 4L1KA 2JF2A 3I3AA 3K5HA 4E75A 2R87A 1KJ9A 1I7NA 4DIMA 4KNRA 1HM9A 2R84A 4MA0A 2WLDA
chains in the Genus database with same CATH superfamily
3BICA 4Q1DA 3ID6C 3NNNA 3N2KB 4Y9TA 3WGMA 3RFCA 1R0RE 1YDEA 3UA4A 2B4KA 2FUCA 2D59A 2GDJA 3D4NA 3IPRA 3NB0A 4QHSA 1MPTA 2FDCA 3NMUF 3NI2A 4MV7A 3AP3A 2R8XA 3LLMA 4QDUA 4Q4JB 4S12A 4KRXA 2HX1A 3GRUA 2REQA 3GZ4A 4KZPA 3M9LA 4A6EA 4AKTA 4FWBA 2D4AA 4F8YA 1FRNA 1O8CA 3FY4A 2PWZA 3KQNA 1XU7A 3KJGA 4DIBA 3DL7A 3QNMA 4O2BF 3MCTA 3AF4A 2AR7A 4MVYA 4EAAA 4ND8B 2V7GA 5EJ9A 4C7VA 5TQ0A 4MPDA 4B9EA 5K8IA 4FSXA 4GZ6A 1M9NA 3DGEC 3KXPA 2VJMB 4WNCA 1XJ0A 3KALA 1D0SA 2NUBA 3MS4A 3QUQA 1QG0A 4H7FA 4Y2VA 3USZA 4YC7A 1U2GA 1TM3E 2CEKA 3QHAA 3DFMA 4QNNA 1NBIA 2QP9X 1DV1A 4BXOA 2YIDA 1KWGA 3EFHA 2O07A 4UNSA 4ZEVA 4YUAA 3CJTA 4ZAFA 3RTEA 3C5VA 3V4VB 4FKMA 1FF9A 2VUSA 3QOXA 4BDSA 1Y6FA 2OCXA 3VVBA 2OM6A 1KDZA 3WY9A 4NENA 3BMNB 2VJKA 2WKQA 3IIJA 2XB2A 1OI4A 1ZCJA 1LLCA 3CRRA 4GRAA 4J91A 4ZCPA 1U0BB 1MO5A 3PXAA 1CG6A 2F6RA 4KHZA 4GF5A 1ZXLA 4HAUA 1FU7A 2HDOA 2C9ZA 2DE0X 2PY6A 2HL6A 3CGGA 4K1LA 3RAJA 4RL6A 3H18A 4FIZA 3E8SA 5GJCA 4WGGA 2FEWB 2GMWA 2D7JA 3ELBA 4TXLA 1P3Y1 4JIMA 4Z8YA 1C4KA 1TNDA 1V95A 3ORRA 3I6YA 4DJDC 4LJRA 2Z2ZA 4PLZA 4Q4HA 4GXTA 2HSGA 3DB2A 3PFWO 1GDDA 1ZSNA 3LY8A 2RBGA 2XIJA 1MP0A 1P72A 1X87A 1FXWA 2QJOA 3G7SA 4RD2A 3I01M 5AKXA 3S2SA 4DIEA 4GPAA 3A9SA 2QX6A 1N4IA 2BVNA 4QBIA 5JISA 1QYIA 3FTNA 3CCCA 5ITVA 4O4LA 1IM2A 2P9HA 1WVGA 5KI6A 4IQFA 3HYRA 2RI6A 3ZHYA 4IFTA 4PXAA 4UFNA 4DV4B 4NMWA 4QREA 1QKJA 1SURA 1J8FA 4HI0E 4O2AA 1MAWA 1O6BA 1BG6A 4R0NA 4MHTA 2ECKA 5SZIA 2HPHA 2Q5CA 1CERA 2IHVA 3IMEA 1V25A 1UMDA 1LUAA 2C3YA 1P9WA 4YO8A 1PVDA 3AL2A 3E70C 4XD2A 1RAGA 3TCKA 3FS8A 4HNVA 1FSZA 5H02A 3HKCB 3CTMA 4NOKA 3RPEA 3KEMA 3NONA 3ZKAA 3ECSA 2ACWA 3JQDA 1S4MA 1R2QA 2Q0SA 1NJ1A 1XQVA 3GLQA 3QVOA 3RYHB 3EEOA 2YOFA 1A8SA 1PDWA 2BJVA 4LAFA 4ZREA 2IELA 4ZDWA 1QK5A 4CMGA 3NBAA 4EWLA 1M7BA 1GA1A 1F2TA 3AUKA 3VYRB 1P5ZB 3QEKA 3L84A 3K9QO 1K9SA 4HBZA 4HLQB 4L78A 1H42A 1JIXA 1LA2A 3C3CA 1A4XA 4IOLA 4CT5A 2Q41A 4JT4A 1HNZB 2B4RO 2O2XA 4RY2A 2FRDC 1EE1A 4OHMA 4ARCA 1ZO8A 4NYMR 2GZ3A 1J06A 4ER0A 1A7JA 3Q98A 3N28A 4KXFB 1WPXA 1H6DA 2QUJA 2OECA 6YASA 5BV2P 2JFBA 2WTEA 3IAFA 4DABA 2Z8ZA 1NOKA 1L7BA 2VPPA 3JQBC 1NVVR 4N1AA 2HLDD 3AUTA 3K70D 2UZ3A 5FUXA 4D9KA 2IEAA 5ADHA 4FW8A 3B89A 4BJHB 4HVAA 1P0FA 4ARVA 2OD2A 3K0FA 1Z36A 1DQYA 2GN6A 2Y1XA 3NJ8A 4TROA 3ZWYA 1EP1B 1NJ5A 3UJBA 3PHCA 3VPAA 3L5KA 2X15A 1NQXA 4YMHA 5IZ4A 2GLUA 4H7JA 4HQOA 2FWIA 4RQAA 4FX2A 2PFGA 5BWBA 1LPBB 2UUPA 2H16A 3PFKA 5C5DA 2ZM5A 4FGUA 1P80A 1N6LA 1U7XA 1YHNA 4J2TA 1Y4SA 1Y5NA 3P9PA 5GP1A 3NC4A 5HFAA 5LUBA 2HU8A 3DGFC 3JRWA 1N75A 3F3MA 4Z4HA 1MQAA 1YT5A 1KMHA 2R8YA 4FMCF 4TYPA 5CW2A 3QWAA 1T4GA 2B35A 3D8NA 3G8YA 5BW8A 4OLBA 2JFPA 1T6BY 5DW3A 2OC9A 3MT7A 4NZNA 1L5KA 1MV5A 2DFNA 3W1WA 1CRQA 3LF2A 1OYVA 1H1LA 2G67A 2NQTA 2RKOA 5MFPA 4N18A 5JYCA 3VUFA 4RHYA 4OQDA 2BTOA 1GADO 2WSIA 2ZROA 3OCJA 3TEFA 3CMCO 2ZSEA 3Q6MA 1Y80A 2FNAA 4FFLA 4I5GA 4OB6A 1JYEA 1EM8A 3DK5A 4M0UA 3I52A 5ECYA 4G4SO 5AKYA 3R7AA 3S81A 4IFIA 4DA4A 1XNGA 4LZLA 5IT5A 3M2TA 4CKEA 2AD1A 4CLRB 1X9IA 4CUKA 5TIIA 4KDFA 3EGXA 4YBRA 5IXYA 1IN7A 3HA3A 4YJ2B 5CTAA 2IOYA 1JN0A 2AEJA 1UJBA 2D5CA 2V7PA 3FPGA 5ICMA 2IITA 2IY8A 3LWNA 1ZCBA 2ZM6B 2EIHA 2H00A 2RIPA 4KACA 2IEBA 4XJSA 3G7UA 1XMSA 3AVOA 4XB6B 3ZQUA 5JO0A 4B43A 1M2FA 4ZHQF 4H3VA 3IPCA 1J2YA 4TL7A 1ORRA 3CRQA 3IUNA 4CKZA 1X7XA 1FYVA 5KOIA 1W76A 4UZFA 1Z5OA 3OZDA 4RKWA 5EIBC 1YACA 5AW4A 4LRYA 2J31A 1SO8A 1X3LA 1X86B 2V4ZA 4DHWA 5JC8A 3EWAA 1ZESA 4WLEA 3DVQX 2BR3A 1JAZA 4DAOA 1IG3A 3T7JA 4ZRMA 1DDOA 4PG4A 3MD9A 3QKSA 4FBLA 2Q8QA 1NHWA 3NEYA 2HIHA 2NXNA 4TQUS 4W99A 3CZPA 2HAEA 5AJTA 2HIGA 3X1MA 2IXTA 1U8XX 4MVJE 5DB4A 4F5DA 1C30B 3H83A 2FCAA 2X0IA 3OCUA 3O2SB 2Z3WA 4PYKA 2CLFB 2WHEA 2ZI3A 3HUFA 4LWPA 3IKVA 1G98A 4OGGA 2PO7A 2FG7C 4LHSA 3TFWA 4PVDA 4E32A 3TLCA 1ORTA 2JW5A 1T2AA 4IH9A 3OOHA 3OPMA 3ZBTA 4A5SA 2VDWB 3FGPA 3NHJA 3VR5A 4Q7LA 4F4FA 1T1RA 3V8RA 3K92A 3CISA 4EUFA 2QN2A 4GICA 3TDTA 4YI5A 2V0JA 1YL7A 3TR5A 3PYMA 5C31A 3TZKA 4L85A 1QTRA 1YNOA 2R62A 3FTFA 1Z16A 3OIFA 5JXIA 1IH8A 4P0QB 2FEKA 4C03A 1GTL1 1QH1A 1SKBA 1K63A 1U8YA 5C53B 4TRRA 3RODA 2Q4JA 1Y1PA 3GFRA 3W77A 5IJ0B 3K0EA 1EXDA 4QATA 4WFJA 4A8JC 4IIJF 4D9JA 4V3BA 4Z7QB 1HTBA 4ILEA 5A0FA 2IP1A 3WLLA 4R51A 3KT0A 1W93A 3VR3D 3WK5A 2NO7A 1C0LA 2M6RA 2ODQA 5YASA 1YO6A 3AG5A 4MVXA 2ZT6A 3C8HA 2HJSA 2JJ8A 3T4PA 3FMIA 1J09A 1K1EA 2ZWOA 1AKRA 2JAUA 5DM4A 2FMTA 5FPQA 2P90A 3GGPA 3KSUA 3MRSA 1U0JA 2VT3A 4OM7A 4YRPA 2A57A 2C0QA 3UATA 1BGXT 4Q6BA 3VSDA 5ALRA 1PNOA 4EO7A 1JDBB 3C3EA 3FRIA 4JBWA 3UJDA 5LXTB 3H11B 3AHIA 2JC3A 1MX9A 2V7QA 4HQ6A 5E9WA 4KPZA 4QJBA 5EFOA 5KSPA 4H1WA 1ONOA 1BROA 1RRFA 2LZ0A 1ND6A 1IEQA 2G4LA 5IK2D 1NUPA 4P5EA 4EG5A 4QXRA 2Q3BA 1SUSA 2GBCA 4ENVA 3K4QA 2VJOA 2FKNA 3DT6A 5HFNA 1ZM3A 3TRDA 4GPEA 4LYHA 2IVFA 2ENUA 3GCWA 4Q6WA 2G40A 2FFBA 4OHPA 3UHPA 4OGLA 4FYYA 4I50B 4ZI3A 2NZ8A 4LWQA 1FTGA 2C2GA 2I7CA 2MU1A 4XE5A 4BMDA 1MHTA 2XMPA 1DOZA 1PAUA 2B6NA 1YVPA 2OY0A 3ZU4A 1J8QA 4TTSA 3IDZA 4IWXA 3GAFA 1WS6A 4KB5A 4DR6B 3H5IA 2BP7B 4HJXA 3BFJA 3IP8A 1XDUA 5DI3B 3QFRA 8LDHA 2Q3HA 1TFUA 1ZH6A 2HWXA 3E7PA 3FVTA 4N6NA 2PVCA 3BIJA 2B0CA 3BHJA 1ZINA 4OIMA 5JOQA 4TV8F 4EMSA 5EE9A 4HYQA 5HK8A 4OATA 3H5RA 5AI8A 5IKEA 1NUQA 2ZUCA 3NALA 4N69A 3MTDA 3H3FA 4KH0A 4HCJA 4KO3S 2JGKA 2NGRA 5JJKA 3FNIA 2JANA 3OOYA 2C4KA 3GDHA 3OZAA 5B1DA 4BO1A 3AUYA 2IBTA 5IVDA 2GAOA 4MA5A 4GPBA 2IV3A 1RWXA 1WXFA 3Q0IA 2Z2XA 5A1JA 1ESDA 4D9MA 3BMCB 3HN6A 5ADUS 3EZGA 2O0HA 1P0PA 4DMGA 2J4FA 3R0IA 4ZMRA 5A71A 4P93A 3RUFA 3AGPA 4N40A 1JHZA 2N47A 4JVLA 4KDCA 3I73A 3EH0A 1F2UA 2NUAA 4U2EA 3O2NA 3ZHVA 2GK3A 4KXXA 1OUMA 1XMPA 4DC1A 4PV7A 4RYDA 3N8KA 2HF2A 1GSOA 1IBRA 3TCXB 3PI6A 5EZYA 1AMOA 1U65A 1ZBDA 5COQA 3KQLA 3O8BA 4EITA 5JH7B 2R0QC 4WESA 3I72A 3O0TA 4II3A 2ST1A 4DIFA 4BZWA 3C4QA 4B4UA 3QPBA 3DMDA 2C1EA 2WT4A 1BS1A 5EEGA 1AXEA 1Z18A 5J4HA 1A8IA 3LCVB 1QOZA 4FQ8A 4L3OA 3P9QA 2JLCA 4Y9DA 1WA5A 4M1SA 1V11B 5KOHB 1P61B 3B7GA 3MK31 1KPHA 1KXZA 4DLWA 1E5LA 2GCOA 3A1EA 1QNLA 1XCLA 2IXEA 3CIOA 1IY9A 1ODCA 3OTHA 4JODA 2YJ5A 3FYCA 1UINA 3BQ9A 2JLQA 1X1RA 3JAKA 3L6BA 3AKDA 4MSUA 4UVEA 2FR1A 3NDJA 1MB2A 4IMJB 2QT9A 1IVYA 1PS0A 4K2HA 1X1CA 2VATA 3I09A 2IZ1A 2FG5A 3WL5A 2BBTA 2EZ4A 3H2YA 4P7JA 1UK9A 3U6BA 3RAFC 3FD8A 4NSNA 1Z82A 1OJ7A 3DEJA 4M1TA 4C89A 4EEZA 4AJOA 1ECBA 4XD7A 5IDQA 5ULLA 3SS9X 2DLDA 1CDEA 3JV7A 3SUCA 4KQMA 5EXDA 5BQXA 4MGYR 5EIBD 3P9YA 3FNEA 4K9KA 4DBVO 2OFPA 2JLBA 3RYCB 3D2CA 3D8SA 4B9AA 1W581 3E5HA 1UP6A 4KXLA 5AK6A 1EJ2A 1MFZA 3QOWA 4BX9A 5CA1F 4K9RA 1T3GA 3OPQA 2XCTB 4P3XA 2H1IA 2I76A 1YQGA 3PF8A 2WK1A 4HGZA 3WLEA 2BLLA 4BTVA 5I3CA 5IC4A 4CL0A 3UAOA 3DAOA 2PXXA 2DHRA 1OBVA 4TN5A 2CN1A 1IB0A 2RGYA 2H85A 1NVXQ 4HURA 2X22A 4M0FA 3ILVA 1YSCA 5ADXU 2VPTA 3DHEA 2V9CA 2G1KA 2QK4A 4MUNA 1TYEB 4J0GA 4LRUA 2GERA 4Q9KA 1XLTA 4IVQA 2KPOA 2V7QD 2QRUA 3CZRA 3NAZA 3PGVA 4JBHA 2OXFA 3VJRA 3OY2A 1LS6A 4LY3A 3FYUB 1GNRA 3CBGA 2ZSHA 3FXAA 3IQZA 3SZRA 3KE9A 3ZDZB 2IPAB 4KFCA 2I6QA 3OH3A 5EQDA 1C9JA 1DEXA 3ZWQA 3E0QA 5L4SA 1NRWA 3G2PA 1XVIA 5FI5A 2PSJA 1L5HB 3L8HA 4ZRDA 5F1PA 1JQAA 2HPAA 3C0KA 1G0OA 2CWWA 3H9BA 2HSWA 2TMDA 4RHFA 3UICA 3ZS9A 4PE5B 2Y76A 3AXSA 3KKQA 5FOVA 3RWOA 5EUMA 2PKYX 2G0AA 1JU9A 1V16A 3M33A 3ZWAA 4L5JA 4MQLA 4DE5A 5FI3A 4TZ0A 2OHHA 3U31A 2FZ4A 5EMHA 1E3MA 2QAIA 3KR9A 4RIIA 3V3TA 3S2FA 2BY4A 3NEAA 3LUCA 1Q20A 3C5EA 4RSRA 1K27A 1IZZA 3G2QA 5BQFA 3MHPA 1MXFA 3VU1A 1T5TA 2HSJA 1EFHA 2YINC 3HNOA 5KB3A 2X9NA 2DJIA 3O7MA 2W0MA 3P19A 1LDGA 3VZBA 4BVGA 4CQJA 9ATCA 3EUWA 3M1IA 4IJ6A 4GSYA 3WGUA 1QLHA 4LFAB 3E2MA 1DC8A 1SOAA 1HBJA 1VHLA 3O8DA 1TK2A 4H31A 3UKJA 1T43A 2IH2A 5HBGA 2CY0A 2XNJA 4DB2A 3UFBA 4W5OA 3COYA 4IJVA 1FQOA 2V7XA 2ZPUA 2QV7A 4NBWA 2CNBA 3EXAA 4F5ZA 5LQUA 1QC5A 3ZEAA 3GLIE 3THYB 1W52X 4CF5A 3DMHA 4HX2A 5B3LA 3UOGA 1Q0LA 3WMRA 1Z34A 3UO8B 2OEFA 3FPLA 3D5EA 1ECJA 2OPHA 3INNA 3RHTA 4TL6A 5IUJC 2AF3C 4P8RA 4XYGA 4F45A 4K8OA 4ETMA 4MQ6A 4M2LA 2GQ0A 2XVZA 3FOAA 2BF4A 3AFMA 2DM6A 3BBPA 2QTZA 3JWJA 3MMZA 4XX0A 4CIYA 1YDFA 1XTQA 2A94A 5DCWA 3O8OA 1GEGA 4KPUB 4UHBA 1L4LA 1M83A 1NHGA 2CDRA 2PKRA 1Q21A 4PG7A 2G06A 2IOHA 4M0PA 5TEVA 4NS4A 2R48A 1GG5A 3CX4A 1KJQA 4KO2S 4PYJA 5A04A 2Q3MA 4H1VA 4OFXA 1DADA 1IOWA 1LNZA 3R9XA 3JWIA 2ZCUA 4ZCRA 3KSAC 4KIGA 4R4JA 4IDEA 3R6WA 5J2UF 1J8MF 3L0IB 1N92A 2WLEA 1Q17A 3QGMA 4R41A 1YDHA 4NZ9A 3R75A 4R9SA 3RRJA 3O94A 5C1PA 2ID7A 1RQGA 4HADA 3O3CA 2O59A 1RE1A 1WX1A 3T7CA 3I61A 1ZYUA 2PKWA 1M10A 1XLUA 2RC5A 1HOTA 1I4OA 2GNOA 4KCGA 2QVGA 3RGWS 3ER6A 1NXVA 6ABPA 1DC4A 1A5BB 3EFEA 2GB4A 5LOVF 1KGDA 1XZGA 4DCOA 2V7WA 4WDQA 3KEOA 3R0SA 4HP8A 4XVRA 5I6DA 1H0SA 1VSVA 2CXPA 2EYUA 5ETJA 3TLYA 4CQLA 1O95A 1DBPA 4BO3A 1I0ZA 1QVWA 4JCOA 1DO8A 7ADHA 4G0OA 4AG3A 2P6NA 2A1IA 3NW9A 3ZWDA 1E2IA 4LFCB 1QHGA 3G0OA 4I4CA 3GARA 2YW9A 4MRPA 3AR6A 2CE2X 3QBEA 3QVMA 4Q5IA 1RFGE 2ZI6A 4GQBA 1GQFA 3O82A 3R3YA 3U61B 4ISXA 1H5NA 4WH0A 2C7GA 4XD7D 1XCMA 1CUVA 4Z0PA 1KEPA 2XRFA 4AS3A 3U0BA 3MGGA 4DDKA 3X3HA 3DC2A 4OO3A 1R6UA 3HS3A 4YRZA 5DXAA 3SIRA 1W4AA 1ZM9A 2FR0A 3RIXA 5JBIA 2Q99A 4Y7CA 4G1BA 4DQLA 2X8WA 1KRXA 2YMQA 5AWFC 1L8OA 2R6R1 1T0HB 2GBFA 4Q66C 1ZBQA 5CLHA 3U4QB 4HSGA 1OB2A 4W8GA 1U3CA 2G5GX 1P1BA 5BUQA 4MCIA 4OMCA 3K1JA 3DSRA 3AW9A 3SKVA 3KVVA 3PSAA 2QBYB 4O1MA 5KKAA 1II9A 4Q4AA 4RZIA 4BFYA 1I5EA 3O8LA 5IABA 3L7CA 3QVXA 3R41A 1MOPA 5DYIA 2VC2B 4FGKA 4B76A 1F4VA 4NAUA 1U2TA 2AW3A 2EAUA 2X2EA 4G6ZA 1FMJA 1U3UA 1VIMA 2OHOA 1RQLA 4HUJA 4OSOA 4UNNA 1KO1A 5AKIA 2NUTA 4JQSA 2IS2A 1J2JA 3UMVA 2WWVD 4PLCA 1O2DA 2LCQA 3G59A 2CJXA 2D6FA 1HQKA 1KEVA 1C7RA 4FLEA 3ASYA 4JC4A 2J41A 2ZFUA 2VJBA 1K5HA 2XRYA 1MBZA 4JXXA 3RHFA 3ICCA 1ZNQO 1L2TA 3RNLA 1V47A 3I8XA 5FX2A 2Y1WA 3JYQA 1AS2A 4B3GA 4B0OA 1DG3A 3RVJA 3CVYA 1W7AA 4KQFA 1GUBA 1IFXA 4G25A 4I0WB 2HMVA 5HPYB 1GN8A 1KIAA 3ITDA 1BE6A 2G5PA 2I8LA 4G84A 4N5MA 4LQDA 4RVSA 3I9LA 4HR7A 1OXXK 2O5VA 3GFPA 4GYKA 5E2IA 1R7RA 4GNKA 3SBOA 4NZYA 4ZVMA 4CW7A 4AULA 1Y8QA 1FYFA 3LBIA 4NOLA 3T61A 1IZ7A 4AJKA 1LZLA 5JU6A 2DKNA 2O06A 3WHLA 1Y5RA 2I4IA 2R8RA 1KEKA 4Q1VA 5DM60 1E9SA 2O50A 1CF9A 4IGIA 5BVGB 2YKGA 3USES 1W1UA 4WZAA 2ZT8A 3AB8A 4MEJA 1E6WA 2RK3A 1TO1E 2WVGA 3V2IA 4DV5B 3LUPA 1S7CA 2XE7A 3WAGA 3PEFA 3FUVA 4MCJA 1CJKC 4N54A 4C04A 1K86A 2FJPA 3ZXYA 1X15A 1XR3A 3COPA 1VL5A 4BMXA 5H80A 4CM1A 2NG1A 2QTTA 3D6VA 4GGPA 1QGUB 4EUNA 5AFUU 1BN6A 1VXRA 2LE0A 4J4TA 2QRPA 4K2AA 5GV8A 3TBFA 1KI7A 1DAOA 3R8FA 4PFSA 5DISB 5BURA 1WXGA 1SC9A 2YIMA 1S01A 2ETXA 1CY6A 4DCCA 1U2PA 4Z53A 1EE2A 2AGVA 4DNXA 3DMGA 1C3XA 1V39A 5AVOA 1YUBA 3KZMA 4Y2RA 1L5NA 1B6RA 1EFAA 4HMQA 1RYHA 2E6UX 5LLTA 5KDOA 3MWGA 4TL8A 3D0KA 4DJAA 4EL0A 2QAGC 2VUTA 3EXHC 5BOSA 5JHGB 3U44A 4J6EA 4LDPA 4V3CA 1FRQA 3AJRA 1T2FA 4FT4A 2PANA 5E4FA 1R8YA 3KEFA 3T9FA 4EA6A 3B8EA 4Q47A 3KR0A 2FSVC 5B12A 3KL4A 3BCHA 3KOWA 1RRKA 2DSTA 4NQRA 4U3JA 1RADA 2X5OA 1R5NA 1TZJA 3IV6A 3LP8A 4IV5A 3WMXA 2AD5A 5IFKA 1QZXA 2ZRFA 2M2IA 1CZLA 1KBOA 1T0UA 1TIPA 2ASVA 1G291 3H9QA 5IW8A 4ZICA 3U4AA 2FETA 4ZI7F 2ONZA 3IQGX 4E13A 2NQ8A 2DWUA 3T1QA 3MLBA 2H0AA 4G0YA 1M2NA 2FG6C 5IMBA 4UJ5A 4ZIRB 3TISA 2DKOA 2EWVA 2QU7A 3M9XA 1BCSB 2P67A 4KQCA 2NO6A 2VUUA 3NM4A 4MZXA 4UFOA 4AO7A 4DCNA 4DXAA 3T5BA 3E35A 2YHSA 4L72A 3T7SA 3LBHA 1R12A 2H5JA 3GLSA 3MQFA 2CZQA 4LVOA 4RK6A 4C21A 2IPLA 4D6PA 2QAGA 3GZNA 5ALJA 4UAVA 3GQBB 1ZL2A 2RGRA 1H22A 2B4YA 2YJZA 1N1GA 5WRFA 2ETVA 2J4CA 4U6SA 1NL3A 2ZIZA 5COAA 2WVHA 2G76A 2FSVA 2I4RA 3MB5A 1TJ3A 3R7WA 5IF9A 4P81A 3H5OA 4EQ6B 5A5EA 1T9AA 2FK8A 5KYXA 2W2KB 1P2FA 1MVOA 1U1DA 1WVMA 1KR5A 1MNAA 2I4TA 1XE3A 2JH8A 3GPBA 3KOOA 3PD0A 3JQAD 3K16A 4IRXA 4MV5A 1S7GA 2YBEA 3ZHRA 1WMBA 4RQBA 4MKRA 5ALGA 3W04A 1N1DA 2GGSA 3BRQA 3VBIA 3MFQA 4WV3A 2VK8A 4F2DA 2PA0A 4OHWA 3OEHA 3GLRA 5DX1A 2GAIA 2ZW9A 5LZ8A 3RRMA 3RQIA 4LVUA 2NU7A 4Y1RB 5K0FA 2PBZA 3T8YA 4OA5A 3VSCA 5JEDA 2HRZA 1C8BA 2XT6A 1IWPB 1NJGA 2UUBB 1OTHA 4AKIA 4HCQA 2YCBA 4M0MA 1ESZA 1EWYA 3WBKA 1KQPA 1CQXA 2KW5A 3AP1A 4HH3C 2FUNB 2GN4A 1YF3A 1FBNA 1MJGM 3MIIA 4OI2A 5LA6B 3R6LA 4BNTA 1JHPA 4KQJA 3G2LA 5T4BA 2HMAA 1EUCB 4KR7A 3B1FA 2AVNA 2ZCVA 2CDNA 3EVEA 4I46A 1ONSA 1YFZA 2PR2A 2W6OA 3HU1A 3A70A 3NASA 3R3ZA 4IS2A 1RLJA 2VPZA 5C1BA 3TQHA 5FUVA 2G4CA 2OBMA 2WB4A 2ZLBA 4ZT7A 1SIWA 1W2GA 2MYUA 4I9HA 5I7FA 2VT7A 1N6IA 1OHHA 4L3WA 2CV0A 5T6BA 1UBFA 2R2GA 2D0DA 2FVXA 4IUCS 3UMGA 1E7MA 2BGRA 2DRIA 2VAPA 1W4LA 2COEA 4Q3LA 3HZHA 2VNAA 1Y6ZA 1XZDA 4X95A 5D1NA 1MH9A 4UVIA 4MWTA 3KJHA 4D8YA 1OD6A 2J3LA 5CYGA 5AW8A 2E4YA 3GRFA 3MPUA 2TRSB 4OAOA 5EYPA 5J4KA 3KWEA 3VQTA 4KN9S 4DZRA 5I47A 4N9WA 5EEHA 2LNDA 2XXAA 2C5EA 2ZT5A 3I6BA 5CFLA 2OQRA 1WETA 3W5HA 3V1UA 3R3HA 4AD8A 4IOJA 1NMYA 4RV5A 5CVDA 5E1BA 4HZIA 3BJMA 5AOVA 3Q3EA 2QRMA 2GYUA 1DHTA 2ZWMA 4TKLA 3ZW7A 4LFBB 1BA2A 1LDMA 4MHSA 4AJ2A 3QE9Y 5JSYA 4KXUA 3EDRA 4RHEA 4CFSA 4MWBA 4D0LB 2Z2YA 3ETGA 4URWR 2XHEA 5CK4A 3DJFA 3ISVA 1GRNA 3DWFA 4K28A 3ZZNA 3EG5A 4AMUA 4B74A 4C01A 2Y8EA 4RVGA 1KARA 3ZNQA 1TPZA 5CLQA 2D1SA 2LVBA 1ZA1A 1EP3B 1PF7E 1EHCA 3D4OA 4F6CA 1W29A 4RIFA 2HEIA 3HCAA 5DHUA 1R0CA 3N2IA 4JNKA 4LX8A 4BEVA 5BW4A 3VYUB 1J2RA 4NCBA 3MWEB 1KAOA 1N7IA 1ODLA 2B8WA 2E87A 2ZUSA 3UT5A 1OX4B 4CKCA 4Y0VA 3FNHA 5AI6A 4M0CA 3ZQJA 1H1DA 5G0WA 5FWNA 1WQ4A 2AJCA 3BILA 3DE0X 3GZJA 3OJXA 1F4LA 2QZ9A 5I7SA 4GVPA 1J9ZA 1XJQA 5DNCA 3ZPXA 2P9FA 5KC9A 4QTUB 1V8BA 3DEHA 2GLTA 2ZDHA 2Y0BA 3SHWA 5JCXA 4GT1A 5E2AA 2L69A 3UJCA 4M7RA 4UATA 5I48A 4JD5A 4IJKA 1OLSB 2E4WA 1M2EA 1YZVA 2NO1A 2WAYA 1QO0A 1QHNA 3CW2A 3ZV7A 4ABTA 4JY7A 4BB9A 2RI1A 4NVRA 5ALIA 5ITZA 3MD0A 3E7XA 1WMDA 1IHPA 2OA0A 1KTIA 5B58T 3BFPA 2WHXA 2DGDA 3PXEA 4DUPA 3A36A 1M72A 4ZVTA 5TF0A 3KXDA 2SKEA 3GAAA 2JFHA 3H5WA 1HF3A 1YR2A 2XNDA 3KUUA 4QYTA 2W37A 3I2JA 1MXHA 4GWLA 4WINA 3E15A 3JXEA 1YMUA 3H2JA 2IHZA 5EKSA 4RKQA 5CIYA 3F98A 2R65A 3P7MA 4KXWA 5AHOA 4MQMA 2JLZA 4IIUA 1HYGA 2IOFK 4YMUA 4RACA 4QGBA 4RH0A 4H35A 3WOHA 3T3DA 1ORHA 1SMKA 5A7HA 5LM3A 1NZDA 2CMKA 3R5TA 4X7RA 5JG7A 4Z51A 1O6CA 3GCXA 4A03A 2Z30A 3TR0A 4E2XA 1RWBA 3REQB 3FIUA 5U4XA 2OQ2A 3HKEB 3AW8A 1DX6A 3UM9A 3BORA 1QKIA 4PX2A 3SMQA 4G3XA 3ESQA 5B1YA 3JSAA 3LUAA 3RB8A 4MDYA 3C5CA 3MCVA 2QE7A 3P5BA 1X70A 1NPDA 3N76A 3PUVA 2EX1A 4M8NE 5C5CA 1XNQB 2QMEA 4Q3BA 5BUSA 1XWFA 1Z2EA 2OCYC 3H4MA 4E5VA 3QLJA 1HYBA 1USKA 1AF4A 4ZCQA 4Y9SA 4DRYA 1HFJA 3EF3A 4FCVA 1DEHA 2P2SA 3H05A 4I99A 5A7FA 3ZE9A 3KSRA 4AYWA 2CFIA 2MOKA 3IKJA 1JA9A 1HRDA 4KTVE 4HQNA 4L08A 1RJ9B 3UJ9A 1BW9A 4WA8A 1QAQA 3VR0A 3DTNA 1F17A 1J8DA 3SY8A 4AY5A 3WJ7A 3UT0A 1A9SA 3WYFA 1CE8B 1CUXA 2A7XA 4CMBA 5EWMB 1XJWA 1LXAA 2QP4A 4MS4A 5AI5A 1IN4A 1CD5A 2QRNA 3GRCA 3PIIA 3EG4A 4EY8A 5HQ3B 4H7OA 2IEYA 2UVPB 1X3SA 2FWMX 3RVLA 1VI6A 3GN2A 1WHSA 3FNRA 3GAZA 1ZRHA 4JEHA 3T1NA 1Z2FA 3W5JA 4BAGA 4ZI5A 2FMHA 5HQTA 2ZRKA 2JD0A 4R7PA 3QYJA 1NTRA 4G41A 3BWXA 4Z2YA 5CA0A 3N0WA 5BNWA 4PNEA 3A10A 1NZFA 1E92A 1SSQA 2PIAA 3WTBA 1JXMA 2HO5A 2VCEA 3OESA 3CRVA 1ZVQA 4NNJA 3W6OA 1SXGA 4IINA 2JVIA 5L95A 1C9YA 1H8ED 3I37X 4LVCA 4QPZA 1ZJWA 3BGWA 1OHHD 3S1AB 4O08A 2CT8A 3TDKA 3D7SA 3WGIA 3PNMA 4QDZA 1JFFB 4FJ0A 3AUXA 4DRXA 2WF8A 1Z4KA 5T7BA 4PTLA 4IDBA 1GPBA 2RHMA 4K81B 2H7VA 1PW5A 2BOVA 3QYFA 5KJFA 3U4IA 2C0CA 5KTRA 3OSZA 2WLDA 2PUGA 3NRCA 3EVGA 3KWLA 3Q0EA 2VNSA 3LK7A 5F12A 2VSXA 1XWIA 2IHKA 1EFRA 1VDZA 1YA8A 3AEUA 3BIFA 1RBYA 1IY0A 2HBZA 2PGLA 4MRVA 4B35A 3V1LA 1ENZA 3V7FA 5J4YA 5K45A 1ZJ4A 3LKZA 1MO2A 1XRLA 3JRNA 2YV1A 4I4TF 4LRWA 5ESDA 4I5DA 5GVRA 1Z35A 3WGHA 1G95A 3WB1A 3MLAA 5FHQA 3I6MA 3SCZA 1PK8A 1JIJA 3FVVA 4RVNA 3EVNA 3V33A 4J1NA 1DI0A 3PR3A 4DJTA 1V9LA 5BPFA 5I4KA 1CC1S 4KMOA 1Z83A 2IC7A 2Q2NA 1QTIA 2J0VA 4JBIA 2FR8C 3LY9A 1JHXA 3DE6X 4R2LA 3STVA 3TMKA 5ITSA 5G41A 4EQZA 4BGUA 4C29A 3TLBA 4PN7A 2WU3A 1S8AA 1GGNA 5BOVA 1TUBA 1T34A 1TA4A 1GO2A 4UNQA 4AN1A 4R7TA 1M33A 2CVOA 3FWPA 1KRUA 2NMVA 1M0WA 2IJGX 1T3ZA 5JSUA 3ECTA 1WHTB 5EKUA 1CX9B 1Z0KA 4GNRA 3RF7A 1SUEA 3WMEA 1GZHB 4D74A 3PZBA 1CQIB 1IIRA 3B3FA 3KLPX 4YJ2F 3ST7A 4D79A 3UK1A 2PH7A 2Y1GA 1RBQA 3CR3C 4TKZA 1SD2A 2AXPA 2WJAA 1ISHA 1W75A 4H0FA 3MS7A 1PFGA 3U62A 4EI7A 1JSZA 3RASA 4OXXA 3OY7A 5IBPA 4GZLA 1KI9A 5FP0A 1PWYE 1VSQA 3L4BC 3SYMA 4O2BA 2WYIA 4JCCA 4OQFA 1A7UA 1VBMA 3OX3A 4X54A 5CFZA 2Z08A 3FYHA 3FTCA 2QX9A 3DEFA 3OQNA 4QVGA 3MXOA 1D5CA 1YP3A 1HM8A 1Y3AA 1YH3A 4U6NA 1LC3A 5SYMA 4ANFA 4ER6A 2HW8A 1TTQB 4RTQA 4BAZA 4FDAA 2JGEA 1T9KA 5L7WA 2OAGA 3HLTA 4KX3A 1FUEA 4HDCA 1TQ4A 4TLBA 1NRJB 3ZJ5A 3AESB 4C07A 3A06A 1KYYA 3PG5A 5CCDA 3JVIA 1S2LA 2QL6A 5CGZA 1ENOA 1JA1A 1CQJA 5CXUA 4J07A 4G1FA 1FW8A 5E3QA 2MINA 4WBXC 5FTNA 5CAEA 3U3ZA 2DULA 1JWLA 3CM0A 2ICYA 3U3DA 4G0QA 4ED9A 3LVQE 4GI2A 3TLKA 5CLJA 1ZN2A 3VDNB 1KI6A 1RYDA 4YWHA 4XSVA 2BL4A 2Q62A 5DEOA 2HTEA 4U8HA 3RIYA 3AJ9A 5EXTA 2XB9A 5CNIA 4LA4A 1VE5A 3HWWA 4UBMA 4F12A 4GIBA 3TLZA 1RPTA 4UCWA 2F3QA 3FOFC 3TRFA 2OK7A 2QE7D 1HFWA 3GZTB 3NS7A 4H59A 1Z5UA 3DJ4A 5BP7A 3JZAA 2PT6A 3COSA 4I5EA 1OMOA 2W0SA 4C4AA 5KJ6A 2FTKE 3CURA 1XTIA 1X7GA 1U0EA 1BKSB 3JQ7A 1H65A 2DHEA 2WWYA 2HNAA 4ZYZA 2JRLA 3NKFA 3P71T 2SHKA 1GLNA 1R4NA 4QFDA 4A6DA 1VFPA 2A9QA 1J24A 2P6MA 3HJCA 5EE3A 4BNYA 4S1NA 4G1CA 2R751 1A9QA 5JSHA 1J1IA 2PEYA 4X64B 1VRVA 2ZIGA 2R4QA 7ABPA 1IJKA 3EOBI 5D3KA 1GUDA 1AA6A 4PSCA 4AECA 4IX9A 1RLMA 4RU1A 3DUFB 3AFNA 5FPPA 5KYWB 1IN8A 4D96A 1GNTA 4E6TA 1TU4A 2PO5A 3TR6A 1G21E 3UK6A 3SHOA 2VQ3A 3RCBA 1X7YB 2FOIA 3EIHA 1L7OA 1RHKA 2EDAA 3JWGA 2O0LA 4OHZA 3GUHA 1JSLA 2BGTA 4BIMA 1KAQA 3MRXA 3DR3A 4RO0A 1L7MA 2FFHA 3GT4A 5AW6A 1SCIA 4WOJA 1E6CA 2J08A 2YXLA 5BN5B 1C0KA 4QDTA 2YV3A 1RXCA 121PA 1GNQA 1LLDA 3E9CA 3H6GA 4HEA6 4OJKA 4MIOA 1ORWA 5HMLA 2IV2X 5LQNA 1GJRA 3OQMA 4QGSA 3LTNC 1NW4A 2MYTA 2ZUWA 3AUAA 3L01A 1R27A 3PDIB 3QA3E 3RC7A 1VHJA 1SQ5A 2GTIA 4TV9F 4ZK6A 1L5ZA 3BTVA 4MWEA 2R68A 4RF5A 1XCJA 2EU8A 5ENVA 3M1AA 3KQOA 1NU8A 4RD6A 1IXKA 1A2QA 1A2OA 5HZMA 2VCHA 3R0VA 4LJLA 3V00A 5ABPA 5EP1A 4DCMA 4E70A 4R9UC 1TM1E 2G0TA 1PK9A 3AFIA 3KYJB 3IEIA 3MUEA 5K8TA 2OSVA 3MTEA 1CY2A 2IS6A 3ZUGA 1JIKA 3KD2A 1OT3A 3GEPA 4IOMA 4CL2A 2W8BB 4HAVA 3ET5A 3GRPA 2X8BA 3WBBA 4C76A 5AVXA 2QIAA 3L6EA 1UAAA 4AX4A 1EXMA 4GLJA 4E6UA 1PX2A 1NJFA 1QZUA 4UDXX 3SM9A 2K5UA 3H4VA 4TUYF 2B5VA 3ZK7A 4JH0A 5L7YA 1UPUA 2P4UA 3CZ4A 2JGJA 4PNPA 1Y1LA 3F5MA 5GV7A 3TW8B 5FWXA 1XVVA 3WV4A 2Z6UA 1HNNA 4BN0A 4D0RA 3OOSA 1N8NA 3SOZA 1ADCA 1KQ3A 3F4KA 4W7IA 3PHIA 4Z1OA 5L6VA 3NWOA 1XQ9A 4OLJA 5H70A 1XF9A 4X24A 3BWMA 4D3YA 2XVAA 3MIZA 3EXEA 2XKJE 2G3YA 1QHHB 2OORA 5EQJB 3Q5EA 4GM4A 3VTFA 4LDZA 1L8LA 1Q7RA 1C3LA 1R6XA 2P0YA 2R1VB 2W2PA 4MPTA 1BHQ1 1CDDA 1KL7A 1WWKA 3KZCA 4N0MA 4RS3A 3VAAA 3KPJA 5M2QA 3R5HA 3GRAA 3D8RA 1XVAA 2VRCA 1TZ2A 1H85A 3CLSC 1QRUA 1NVBA 1UK6A 2ZVPX 4L95C 3PMOA 3SSOA 3VBNA 4FHCA 1LGYA 1OI3A 2AQHA 2ACVA 3FOQA 2XUFA 2E4VA 3PU6A 4UEOA 4BB5A 5GAJA 3SZ3A 4I4LA 2B1GA 2JJ1D 3HV0A 3KYIB 3BS4A 1LDBA 3ND5A 2WMYA 3QUSA 4YO7A 2XODA 5EHIA 2CVZA 4DA6A 3WAJA 3EPLA 4N76A 2A0UA 4JR1A 1RFLA 3SZUA 3FGOA 3ZWNA 3HR8A 1OTYA 3LO5A 4PQEA 1SQGA 2GESA 1G63A 2QLTA 1N0IA 1N9GB 2XMZA 4Z1MA 4I3HA 3W7AA 1E98A 1FP7A 3B2NA 3SZGA 1CRZA 1PZHA 1PFVA 1KHTA 2Q7OE 3H16A 4NV0A 4INZA 4DLVA 2HU7A 4ZC8A 1DWUA 4YT2A 1XKTA 4Z9BA 1G9TA 1U3DA 1Z0ZA 3NZEA 2WJ4A 4FD2A 4ME6A 4NHOA 3PRHA 3VHRA 3OLXA 2LKDA 3A6PC 1XHFA 4LDJA 4XASA 4CFZA 2WM9B 1XRQA 5DYTA 3Q3GE 3VNAA 2RJNA 3QFFA 2O9JA 2V6IA 2ZVQX 4KR9A 3KKZA 3IHTA 4UEKA 3T3PB 4N0QA 4N5HX 1VCOA 2J3MA 2JFUA 3LYLA 4TS9A 1WCIA 3GDGA 4LC0A 4C05A 3VAZA 3A9TA 3C43A 1IJBA 3EVTA 2EKBA 3FFAA 3X1KA 1U7OA 3ZEIA 1QR6A 1OX6A 1YJXA 5BSWA 3QOFA 3QKIA 1BCRB 2XE4A 3HC7A 1PJBA 3DPUA 4X3OA 2C59A 3D1LA 2JBHA 2RH5A 3UFXA 4P4LA 4ALIA 3IJPA 1PHPA 2YJGA 4BC1A 4I6EA 1GL7A 3AOGA 3DTVA 2UXBB 4D45A 4DUGA 1TO2E 1EWRA 1U1CA 4EP1A 1CR1A 1Z2CA 2A1TR 2C2WA 4WADA 3EZYA 4CZ2A 5EFZA 1GR1A 1XEAA 2ZYIA 1BMQA 2VD4A 4N39A 1N2JA 1OT5A 1FU4A 1IM5A 2O2SA 2FFQA 3F6EX 4L0DA 3ULKA 1SH7A 2WJVA 4ZOAA 2PAFA 4C7XA 3Q9UA 4H6WA 3SS7X 3OFKA 1KEEB 1ISGA 4B7AA 3WK4A 4C3ZA 1GKKA 1J0AA 1KP3A 4M49A 3RBXA 3ZGXA 1JVBA 4QUAA 3IR6A 4HTFB 3RSHA 4ZAGA 1KJJA 1MT0A 2HXGA 2OAEA 4NLLA 3MINA 5DNDA 4HSEA 3NBZC 5CB4B 3U5TA 3W4IA 4KLRA 4A6PA 2DHCA 2FYTA 2EVWX 4IP0A 5DRTA 3RK4A 3UAXA 2FN8A 4I08A 3WKAA 3ZIAD 4EHJA 4UHFA 3Q5DA 5HS6A 5DWQA 5B55A 1XP5A 1GHTA 5ALZA 1I3KA 3HYSA 2YZ2A 4DANA 2RG1A 4LYYA 2Q46A 4NDZA 2P3SA 2ODBA 2PZAA 3NT4A 1GGVA 2OCLA 1D2NA 1K6MA 2Q29A 4IIJA 2BZ0A 3QG5A 1PWXA 4QOSA 5JW6A 2JAPA 4S3MA 1GITA 3FUWA 4GE3A 2O8DA 2NO0A 2WE7A 3C3KA 3RS7A 1TECE 1TF2A 3MGCA 1P4RA 3J7AC 3WICA 1W4RA 5DO9A 3RUIA 5LP6F 2W70A 3GQVA 1T0JB 5G3ZA 5A9SB 3DZ8A 4R0VA 2VCYA 2QENA 4ZODA 5DGCA 3F7TA 3K05A 2AN5A 4GI7A 4QUKA 4R2MA 4AZTA 4JBLA 4PPQA 4XJVA 4D8VA 3Q8WA 2BCGY 2BM0A 1USGA 2FJ0A 2XZOA 2OPBA 4KR6A 1GIAA 2VSNA 1DIBA 3GVCA 4M1EA 4RJJA 1MR3F 4PG5A 4FQ7A 3WGOA 2WWRA 2C8VA 2JEYA 3PEUA 1U2RA 4NCIA 2PGJA 4K9PA 2PX5A 1ZWLA 2YL2A 2YYZA 4PSAA 4XCQA 4L5IA 2NIPA 4TN1A 2O1XA 4US0R 5D85A 5F1OA 4ENWA 1BJKA 1Y1RA 1PT5A 3IUJA 2J9RA 4C14A 3M1YA 4FGWA 4CR8A 1A50B 2BFWA 2IYSA 3SG0A 3HM2A 3I2YX 4M1WA 4DBZA 4B7ZA 4EY4A 5HX7A 1A5SB 2GEUA 2IH5A 5L3ZA 1BU8A 1TA9A 3ZGVA 4MVJA 4IW3B 1N6PA 3C87A 4KYVA 4OUDA 3DFKA 4H4EA 4PYNA 4IIBA 2HCBA 3PBKA 3HB7A 4D9BA 2CXNA 3LH5A 1DO2A 4HNSA 2YDYA 1QHFA 5EPOA 2ISSD 3FDIA 3NNSA 1VL0A 4WSOA 3UZUA 2X0DA 3ABOB 3VBCA 3FPJA 2Z6AA 3PC8C 2OESA 2HNKA 4Q9IA 3ESAA 2C8JA 2PSFA 6REQA 2O57A 1T1EA 4N4AA 1VZ3A 2DFLA 3R3XA 5ALYA 2WMOB 4TV8A 4U8GA 3L0DA 3SBDA 2RARA 2DT8A 1ACMA 3KAJA 1Z4OA 3B70A 4DDWA 3R74A 1Z17A 4G2TA 1H4TA 4G5RA 2FOLA 4CIWA 2VTBB 4RPLA 4UQPA 1EPUA 3DO6A 3OIVA 3OO0A 1K66A 1B0AA 1UFKA 3U0VA 1MDBA 4HS4A 5DTQA 6ADHA 4ES6A 4FDMA 4LPSA 4FDVA 4AJLA 1J21A 3OM0A 1T6YA 3UPTA 2JIBA 4N0DA 2CFCA 1O4WA 1YGPA 2FRVA 2PEZA 2PTGA 3EGOA 2N0SA 4RKRA 3O3OB 1UOOA 4YUVA 3K2BA 1VP9A 3BDVA 4U7HA 2C82A 2NYUA 4G1UC 3F3YA 3U3KA 3NPMA 1CV2A 4O63O 2ZB8A 1J99A 5FIUA 5KTMA 3NBUA 4X0EA 3STTA 1EUDA 4IHHA 4MI6A 1W1IA 3V2GA 2A2ZA 3JARA 5BQPA 2GZHA 3QNUA 1I14A 1PWHA 3GJ7A 1GUFA 1FW6A 1IY1A 3PC8A 3HE3A 2VDUE 2C1XA 3PIRA 4ZQHA 2ADMA 3GN1A 3ZBQA 2D1RA 1CUJA 3E9YA 2FN4A 1OB5A 3ANTA 1B8NA 1E61A 4KKXB 3RYTC 2VSFA 3PGJA 4F3CA 1MEOA 2W48A 3I9V6 1F38A 1GYPA 3A2MA 3OOEA 1L7VC 1L0BA 2AZTA 2GHIA 5LBIA 5T67A 5I9LA 3LPNA 4WOPA 3SE0A 4GBED 2WNSA 5AICA 1XB2A 2FPPA 2AN4A 1M2HA 3DLCA 3DTVD 4G1VA 5C9ZA 4DUGD 1R3DA 1XTZA 3TSWA 3OUZA 4BNJA 4FHDA 5ICGA 2NXJA 2WFZA 5A4JA 1JNYA 5AOAA 3N8NA 3JU3A 1GR0A 3GPDG 1DPGA 4GAEA 3AUSA 3R5FA 5FYDA 4RK4A 5CM9C 1YVEI 4M28A 4UPDA 1AV7A 4M88A 4BJ1A 4C43A 5LMZA 3DBRA 5JDIC 2HWWA 3QEAZ 3WWZA 1EM8B 1KZ9A 1WV0A 3F74A 3RC2A 2NUPB 2V9PA 3F9RA 2I4LA 2JI6A 2R44A 2WDPA 4XM0A 1UJMA 5K3FA 1I6LA 2WW8A 4JMLA 1LBTA 1UPFA 1GFZA 1CY8A 2PKQO 5IUKC 4CQMD 4Z0HO 2PHZA 1CUCA 3ADKA 1D1PA 4O8ZA 4XWAA 1D5WA 3FJ1A 3Q0TA 1O1YA 1UJNA 3OTGA 5ENZA 3PNVA 4CLOB 2ZQZA 4BZPA 3AM1A 3ZE6A 1O9GA 2QD2A 4OBWA 3HB5X 4OGWA 1JPNA 2Z5GA 2IYXA 1IHUA 2DUJA 3Q1LA 4ZVNA 4YAUA 5K0EA 2P69A 1U80A 4LCBA 2ZSFA 4YS6A 1W5EA 3WJAA 2CEAA 4QDOA 1TVCA 1OPXA 2VT6A 4KREA 3EJWA 5CA1A 4UKDA 5I9MA 4KQIA 1XF1A 5E4JA 1ZH4A 2FWPA 4GVLA 4C6TA 4E75A 1IBKB 1J56A 5E6UB 1CB0A 4ZDKA 1BD3A 1HURA 4NFSA 5JDIA 3OEYA 4KLZA 4V0QA 2FPLA 4UM9D 5T6MA 3ZK9A 5IFLA 1VE3A 4EHIA 3FTQA 3NNDA 3LUHA 1WDMA 3P52A 2WBLC 3AV3A 3IUSA 4W9RA 3RIEA 4EW6A 1RIIA 3LQFA 4UC0A 1ORIA 1KH3A 1XN4A 3BL5A 2HIAA 3OA0A 4P3NA 3UCFA 3WIBA 2OBBA 1W88B 2C2BA 1DXOA 4YGYA 3NVKI 2XGJA 2CLEB 3ZX5A 3AZPA 5HP4A 3LXUX 1ECCA 2PZLA 3H3JA 3TTVA 1ZUIA 1D2HA 1JXQA 1UPXA 3O90A 4LQCA 3ZWPA 1T4MA 4MI3A 1L7AA 2FPOA 1Z9BA 1M67A 2Y9PB 3O2JA 3ZCXA 2YWGA 1GA4A 1BDJA 1NVKA 1O0BA 3MWFA 1VJGA 5JTTA 2JCSA 4G5HA 1H6AA 4BZXA 4CIXA 2QS9A 5CNJA 1M3SA 4DSZA 4BNKA 3TBKA 3MWKA 2P1RA 2WLCA 2YYYA 4MJLA 3VKHA 2CNDA 1QFJA 1T6ZA 1TADA 1I1QB 4EMTA 4B8WA 1QZTA 2HV9A 4MVJD 4BKQA 4C2TA 3T7IA 1Y9DA 2XWSA 3BE5A 3SC2B 3UMCA 3K9HA 1UM9A 2W7TA 4Q7MB 4YJHA 4P0PB 2R86A 1GTVA 3BIXA 2YMPA 3OC0A 2R97A 5AW9A 3TKLA 4MUKA 1XTUA 5EGNA 1XK6A 1QP4A 2GBPA 4QJ3A 1ZVMA 3JQQA 3EC2A 3MF4A 4K8RB 3HABA 3M7IA 2QTMA 2IGTA 4BJ6A 2ZRLA 2ZAMA 3IUBA 2FSFA 4Q7KA 4Z86A 5BUZA 4WK0B 4BKOA 1OH8A 3MJSA 2RHOA 1F8YA 1EJ6A 1ZH8A 2O8FB 4FWIB 3H9UA 2P0EA 3SPXA 4EG6A 5I51A 1NI4A 4PO9A 1K8ZB 4BX0A 1DBQA 5BSEA 5C8VA 5KNBA 1AY0A 2ECPA 2IKSA 2QUHA 4HUQA 2IP2A 4FI3C 3GFGA 1T8SA 3IAXA 4OPMA 4U5QA 4ZQIA 5HSGA 4N01A 2BUAA 5D3MA 1P4JA 1EB8A 1QMPA 2NQ2C 3VA7A 1NG1A 1OLXA 3HHPA 1MC5A 1NVDA 1Q2XA 3R5SA 4R84A 1T5OA 5FPKA 1M6YA 5EJ5A 1F9EA 2C94A 1C1XA 1D2MA 1HV8A 4AIRA 4IY1A 4WKNA 3JYHA 2MMCA 5IKXA 1TKCA 3BEOA 3SICE 1PLLA 4IKEA 4RD1A 4BMCA 4F9TA 2A5JA 1JPUA 2XA2A 3C6QA 4FINA 2CXRA 4K6OA 4MQEA 1F8GA 1LRJA 2IX9A 3JD1A 3OICA 4URZR 4BNLA 5A6SB 4WBNB 2BFFB 4W6ZA 4WNAA 2C7VA 4ILKA 1CWUA 4J7UA 3LBYA 3EA4A 2ZVJA 4JT8A 5J2UA 3EEFA 2FWBA 1S2OA 4L02A 4BN4A 3V7UA 3F7OA 4E6PA 1E96A 1K6JA 1PT6A 2OC4A 3HMQA 5HUQA 3ICOA 4GM0A 4NMHA 1K9VF 2HPZA 3Q7EA 4LDQA 2J3HA 4QU8A 4YGXB 1QIJA 3TBHA 1Y98A 1GG9A 4KR3A 1NJ6A 4C6HA 4QO7A 4G5YA 1NSTA 3RVQA 3UCXA 3ZHZA 2BKXA 4RFSB 2I1VB 4QUHA 2IP4A 5DTRA 3EDYA 4C22A 5LOVA 1OLUA 1ZY2A 2OXEA 3G88A 2ZAOA 3PQ6A 2G8LA 1QIIA 3FYSA 4ARBA 1XZBA 4JUDX 3WLTA 4CMIB 1BU5A 4MNTA 5TV2A 2GA9A 5LP1A 3A1WA 3L43A 4A0GA 1QG2A 3T1YB 1V4BA 3ADOA 4PPYA 3VNVA 1D8TA 1GSIA 2DFTA 3V32A 3W4KA 1JR6A 4B6QA 2IYAA 4YRFA 2MYPA 2XBLA 5DTIA 5JPCA 3J81A 2VHWA 3KDSE 1SN7A 3D5QA 4D4KA 1GD1O 2V8BA 2C9BA 1M1YA 2FPIA 1T4CB 3N9IA 5G0TA 3RJ5A 2PT9A 5ICCA 2GF2A 1I2AA 2RC6A 1O96B 2ECFA 4DF3A 5M5BA 4MZUA 1AGPA 3T5GA 1DC5A 2J9FB 4H18A 3H1FA 4EK9A 1NYRA 3C3DA 3ICEA 2C9MA 1MO3A 2PPLA 4JI3B 2RHBA 3P0JA 3SEZA 1U5AA 3L0PA 3GLIA 2WIKA 2H8KA 5DK4A 2B92A 5CRIA 4JBYA 2ONKA 2AN1A 4X63A 5FAKA 1WKVA 2XH8A 2WTXA 1T9ZA 3GIDA 1P29A 3O3NB 4R5HA 3VZRA 3WK6A 1EXNA 1R16A 1Y4UA 3T7KA 1C9MA 4KH1A 1W0JA 2WHPB 4AY2A 2O8BB 1K8RA 3FYDA 3U6KA 2E89A 4GD3Q 5U4QA 3RJTA 2IIQA 1DG9A 1ANKA 1YS9A 2AR9A 1K08A 1OXUA 3A3PA 1DV2A 2P1DA 3AONB 2OQIA 2N42A 2ZQ5A 4I36A 3G2HA 2OYSA 5JD3A 1A9XB 2V5AA 2YX1A 3VZPA 5C7LO 5JALA 4PLVA 2BGJA 3BL8A 3TFQA 4F38A 1YFLA 3KQWA 2X2FA 2K87A 4XTRA 1T8UA 3GEBA 1CJBA 4XQGA 1TM7E 3LVRE 2JFFA 5BXQC 3L1KA 1W30A 3AJ8A 3UQYS 2Q2WA 4OEHA 4RPKA 2P65A 5BR4A 1NLUA 3ROZA 3E9ZA 4E3ZA 3ELDA 3NH6A 3R1WA 2DETA 1G3RA 2H4XA 2FEMA 1R9JA 3QU7A 4D8WA 4WFKA 1EK2A 1HC7A 2IHJA 2IE8A 3P0EA 4TXNA 3MT9A 5CMLA 1TKAA 1LPSA 3RJ9A 3HRKA 4Y98A 2XD4A 3M0EA 2VZ8A 4RJ2A 1N8KA 4B6RA 1EFCA 1YI1A 1B23P 4RANA 2P2OA 2QM3A 3O26A 3TUIC 1IMOA 2OZEA 3EPHA 3CXUA 4QGGA 1FIUA 4GMKA 4R1QA 1G4AE 3GW8A 1UEXC 1K7EB 3OIUA 3LD9A 1A88A 1P7WA 1VJ0A 1U90A 3IP1A 2ZBQA 5A2QA 2BGMA 3RSOA 1XJ5A 3A1VA 3FPBA 4AZ3A 1FDVA 1TLLA 2FMKA 1TGVA 4CM9A 3H2IA 1ZM7A 2QQ5A 2CFRA 3TLAA 2RJOA 1AKNA 4NH0A 4R8MA 4OP1A 4TXHA 3ENZA 5AUPB 5LYJB 5A0TA 3L1UA 2OR3A 1JEQA 1NVAA 2O3UA 2YV5A 1U11A 4Y2UA 3RS0A 3T1TA 1XU9A 3AILA 2BMEA 3C6BA 3G79A 3AR9A 4NARA 1F51E 2DQYA 4R8KA 3DLIA 1VL8A 3K1ZA 2X0FA 1D2AA 4P84A 4ZP1A 5HTOA 2NZYA 1NT2A 3EA0A 3TL3A 3B9RA 4BO4A 1QRRA 1X6VA 2BFAA 1MOQA 1X1TA 2XNCA 4IVPA 4OREX 1XNRB 1G2OA 3DL0A 3BKXA 5DTJA 3I1IA 4TQ9A 4QLBA 4RE6A 4DMMA 4GMGA 1JHQA 1Y89A 2XOXA 4GPD1 4XAQA 3FPCA 5K0CA 2H1LA 4E30A 2PGNA 3T9EA 5B4TA 4YRKA 1ZUHA 3NHKA 4ZQGA 2C98A 3LXMA 2QLLA 4E4YA 5CDTA 5JAMA 4DNOA 5AVZA 3PDUA 4OHYA 5LB4A 1UT5A 1WSBA 1BKDR 2I55A 4PSUA 3LQ1A 4NYJQ 3D02A 4QFMA 3LQ2A 1RJFA 1FL9A 3I53A 4XUDA 5C7OO 4YXFA 3TECE 3QF4B 3V55A 1T5BA 1XYGA 3DXFA 1YTLA 1HUQA 4BGIA 2H3EA 4MUYA 3E22B 2ZS8A 1FUKA 1KF0A 1BQEA 2CFOA 3DWGA 5G4KA 1R0ZA 3OBBA 1ICIA 1MEJA 1R9NA 5HDQA 1PFWA 3L0OA 4ZJYA 4ND7A 1ISPA 2FP4B 1IHYA 3PHHA 4CGZA 2B9EA 1IY8A 1AMNA 1KGSA 4L9AA 1CZRA 4U2BA 2P9CA 3GQAA 4ZI7A 4MDFA 3LW7A 2APJA 2LWIA 1FBTA 1EB9A 3NDIA 5LSAA 5EE0A 2ISCA 5JIBA 1PZFA 1UPCA 3EFOB 3LLSA 1I4DD 3BOSA 2B1RA 3QENA 1YXMA 2VF8A 4JXKA 4C4RA 1Z63A 3A7EA 4YY3B 2ZS9A 3KFXA 3AKZA 1S3IA 3CX8A 2FPSA 5MN5A 4W1SA 4FFOA 4W8OA 1YR6A 2B3DA 2ZIWB 3I5AA 3FMVA 2CNLA 4AURA 1WF6A 3HV2A 1X80B 5L8VA 3N5KA 1ZNZA 1CUAA 1R50A 1I10A 2WAOA 3MQ2A 1VBKA 1K5PA 4GDMA 5JAOA 4YRBA 3VR4A 3BF8A 3OFNA 2H1FA 3IIEA 1U0LA 4CR6A 5C8XA 3RC9A 1Z2OX 4N7BA 4TYNA 4I3GA 2IYTA 4BNHA 1RT9A 2HUPA 1QVAA 1OI7A 3O8QA 4CRWB 4YV2A 1NXWA 1SXJB 3UANA 1E94E 1BGWA 3FBWA 3U1BA 1JAHA 5FUBA 1S0UA 1JIQA 5FTWA 2AC7A 1W0JD 2XUKA 2J3IA 4NFLA 1N7HA 1KGTA 2JIZA 4GE0A 5DLYA 5AUNB 1E32A 3E9QA 3DE2X 1OU4A 3LCMA 2VN8A 1FFXA 1AGRA 4H7DA 4WN9B 4YP6A 5HCUA 3P0FA 1JKJA 3LHSA 4GS5A 4TKMA 4L73A 4Z4CA 1FUUA 1V3WA 3NANA 4HGRA 5AHKA 2WQZA 1TT5A 1XVTA 3O4JA 3F6SA 1I1OA 2Q6IA 2JAHA 4EW2A 3RKUA 4B3DA 1RIFA 3IV9A 1SQ6A 4REQB 5THXA 2QNBA 1BRTA 3T5TA 3MCAA 1DUIA 2BHLA 3EISA 2QR3A 4HEQA 4L9WA 2ZYVX 2RHGB 4MV8A 2G1PA 3KNZA 2NVBA 4QGHA 4WEOA 1B1AA 2AJTA 4NH4A 1MJ5A 4Y67A 4ZEMA 4KGXA 2FPMA 4R2HA 3RVMA 1EX1A 1O94C 2COKA 3FRHA 1ZD4A 3O31A 3BREA 3H2HA 1J0XO 2C20A 2PL1A 3W5DA 1OIVA 1YHZA 1X38A 4DCUA 1P1KA 3Q8LA 4ECEA 2V6JA 5MHTA 3KQVA 4LJ5A 1K6EA 3ONDA 2C77A 5LA6F 4LI3X 2YFKA 3E81A 5ED0A 2VTDA 5GPBA 4DMKA 1CVRA 3O92A 1FP1D 1IEWA 5JSKA 3SQNA 4BZQA 1S9HA 1UIMA 4Q16A 2QTAA 4CM9D 1D1SA 3FKQA 1Y42X 3VTAA 3PT5A 1LI4A 2A4KA 4G4JA 4DCVA 4WHMA 4D44A 1W47A 4E5UA 1OW3B 3M5DA 3WYGA 1NI5A 2ZR8A 4ZPXA 5CXQA 1OOEA 3C3JA 3ND6A 1O58A 1WDKA 4HWOA 1BWRA 1U0HC 3L92A 4BV9A 1XXHB 4IHJB 4OB8A 5C4GB 3UENA 5L9AA 5E2BA 2OCGA 1NY5A 4LG1A 2MHCA 4MMZB 4RVFA 4I9NA 1NV9A 1Q2UA 5AIBA 3V8NA 2R9VA 3VYVA 4D81A 4EB3A 1O94A 2HK7A 3KQUA 5JS1A 4DLPA 5KPDA 3B6MA 2E1PA 1RNLA 1RWNA 4DZZA 4JV5B 3ZE1B 2ID9A 3H9EO 4OHBA 1CFZA 3SJZA 2QP3A 4YEDA 5KTOA 1V8PA 5IVPA 1NLFA 1VB3A 2H2HA 1QRGA 3SI7A 5JD6A 4ZCSA 2BE7A 2JNWA 2Z5LA 2HA4A 5JNWA 3U16A 2AE1A 5FPYA 3KSBC 3E3LA 3JW8A 4I1YA 2WI8A 5FPHA 3VC7A 3DAHA 1UXGA 2CSUA 4WPGA 1N2XA 3I76A 1YAHA 1ES9A 2DFVA 1JQEA 2J85A 3RBAA 2NPOA 3LHFA 4EKIA 1NWCA 3QLEA 4ENQA 5CFRA 5JY1A 4IEFB 2F9FA 1PI3A 1QQ5A 1P5JA 1TM2A 1Z7YA 3PC7A 2E2WA 3K1AB 4UEWA 3UBTA 1UIRA 2RGBA 3ZWCA 5DULA 5EIFA 1W2HA 2FGKA 1AB5A 1DTSA 1FYEA 1H2ZA 1ZKMA 1T1GA 1ZI8A 2CHEA 3IE2A 5DTEA 5FB3A 5BV0A 1B7GO 4PGHA 4L8YA 1EVQA 2BC9A 5EWJB 4R71A 1G3IA 2QI9F 3D3QA 4QOHA 1HH4A 2W0WA 2HCRA 4NI5A 2D74A 4EECA 4NEGA 2IY9A 4ZYLA 2DPGA 4CM8B 2HMYB 4GKJB 2Y6UA 4DA9A 5ADVA 3AJAA 1CYEA 2J5BA 5ILQA 3GU3A 5HF5A 2EWMA 3BXHA 3QELB 3X44A 2BWJA 4M22A 4J29A 3C3WA 4OU4A 4TTVA 4D7AA 1P18A 1SHZA 2EX0A 3SM3A 2X9GA 3AM4A 4JL6A 3O1HB 4IYRA 4MVJH 1KP9A 2HOQA 2W6JD 1LRKA 3M49A 4XQ9A 3PQDA 1Y6GA 2ATXA 1TZMA 2FI1A 3EIEA 3H75A 3VR4D 4EFDA 5BYKA 3HACA 2XAAA 2YZKA 3H9CA 4HJRA 1NMQA 3EYWA 3O0DA 4PO3X 3KXLA 3WJ2A 5IXJA 3GLFB 1XDGA 2R25B 5AXBA 2J0UA 1B14A 3L6DA 2PG3A 5D87A 1YB6A 1EFUA 4Y2PA 1A69A 2PWBA 3DULA 5CW1A 1AUQA 1E6MA 4YYEA 1JLRA 2B36A 2XPCA 3QMWA 4QX6A 4D3ZA 1PFKA 5EINA 2O7SA 3QQ5A 4X41A 4TSFA 4W82A 3JYLA 5EJ2A 4YVFA 1DC6A 1X1QA 1D4ZA 1OF1A 2HRDA 1RRMA 3WIUA 4NJMA 5DP2A 5TT1A 2V98A 1O7JA 1VB5A 5H8WA 5LQDA 1NV8A 2JFZA 2AG1A 2JDID 2GYYA 4QPJC 2AOTA 1V6AA 2BEVB 1YE5A 1C14A 1QIKA 1CUSA 1Z22A 4W8HA 3SC3A 5IWCA 1CUFA 3UNXA 3T7EA 3C97A 1K0UA 3CRW1 4EDFA 2DR3A 5IU6A 4GMDA 1ZR2A 2HGSA 3A0RB 2A1UB 4TXJA 4U9IS 5A4AA 3D7RA 3PQ4A 3UB3A 1I7LA 3CVOA 5BN1A 3AL3A 3ECCA 2CKDA 3HP4A 2P75A 4NICA 5G0SA 3W3ZB 3RRXA 3EWIA 2KJQA 3GZNB 2OB1A 4RGBA 4YN3A 3R20A 4EEKA 2ZDQA 1DBWA 1U2EA 1BX3A 2FEOA 1A3CA 3RYIA 2FPRA 3OTQA 1WXEA 2BGLA 3EJ6A 4Q48A 3ZDAA 5E3HA 3OH8A 3RUCA 1ZIXA 3VPFA 1H2AS 4FZ5A 5AJHA 2Y2VA 3A9UA 2B7CA 4WGFA 5LLSA 4XDYA 1JFSA 1CF4A 2BE9A 5I7UA 1TQHA 2EKPA 4FYWA 3HXOA 4O8CA 4C7JA 1KBQA 3SJ7A 2GF9A 2UUOA 3ZJUA 5IKMA 1UT8A 2F90A 2JIRA 3QVGB 1NRIA 3CKLA 4YECA 2CVFA 3D81A 3G8DA 3P27A 1GQRA 5CP8A 5CFOA 1UZAA 3LUJA 3T3NA 421PA 1DARA 2HKIA 1ATIA 3INRA 5E8RA 1E2HA 2ZZKA 2MWMA 4LE0A 3IBSA 4PONA 3EA5A 4KNVA 5EWLB 2FFRA 3VC1A 1EZ1A 1DIGA 3T57A 3A31A 4OCZA 3UQZA 2AA3A 3DOIA 4I19A 4BMNA 1JV2B 4CI9A 1YKSA 3WYCA 3VSAA 5B1SA 1XJCA 4EB0A 2XF2A 4NU6A 2CDBA 2C3PA 1BSVA 1QYRA 3BIWA 4EEXA 3TINA 2F9LA 1DTWA 3T9DA 2CYCA 3AX6A 2ZSDA 1NWHA 3WYEA 5J2TB 2FGJA 1O94D 3OT1A 3GVPA 5K0LA 4DEVA 4R40A 4N3AA 3QEMB 1IBMB 1SSMA 1JLLA 3DEAA 1E4VA 4LE2A 4RAQA 5FAXA 2JBAB 2LP4Y 4DCGA 1QE3A 5ED4A 2BHNA 2C78A 3K09A 4HNAB 1JEYA 2MSWA 3KD3A 2F7SA 5JROA 2J09A 2J0SA 1WPGA 3H3XA 3GFSA 3TOXA 4A0QA 4LZPA 4PZEA 3L8EA 4YUWA 3Q9LA 1YOVA 3QBVA 2NOAA 4RUKA 3IMFA 3TTTA 1CKEA 1Z38A 2XLBA 1PDOA 4BHTA 2VDVE 3B1WA 3B9PA 3DAFA 1A1SA 3K9NA 3PX3A 4PC1A 4F3NA 5JC1A 4LZNA 4MQFA 4LJ6A 1FFAA 2RAPA 1JAXA 4KQWA 4UNPA 1F8XA 1XX6A 2CZGA 4LV5B 1MTOA 1PHRA 2VYVD 4IDQA 1JQ3A 3RS2A 3BBLA 1EI9A 3N8HA 1YJ8A 4C06A 4W5NA 5DEMA 3NVMB 5JVDB 1QO7A 5BWMA 1X7WB 3PPWA 1IBLB 2AEMA 5FUWA 1V3TA 4D9GA 2PUBA 1GQQA 3KJIA 2ZPTX 3OI7A 5JLJA 3N70A 4WBSA 3AF0A 1E6EA 1QYDA 3GA7A 1EG2A 3QXGA 3UC9A 1EWQA 3R1IA 4KRFA 1KPIA 3JD3A 1NMXA 1TMGE 2IU3A 1H23A 3HKBB 3N2KA 3NXKA 3Q4GA 4E94A 5KQRA 3LDUA 1BFDA 4FPXA 1SK9A 1J22A 3OW5A 1EDOA 1SR8A 2NNLD 3HY3A 4RHCA 4OI1A 2JEZA 5F7JA 1BOFA 3C15C 4GU5A 4RSGA 3C24A 4YAKA 1LW6E 3WGYA 1K92A 5EKTA 4DW8A 5SY6A 5K2OA 2XXBA 2ACEA 2I1LA 5JCOA 1AKUA 1AGYA 2XYVA 3BULA 3DOCA 2V6GA 3BHIA 1DEOA 2NO4A 3DKIA 3OP4A 4Q3CA 3GUEA 5FYQA 4F71A 4XFDA 2F3UA 5DDIP 1K98A 4ND8A 1QCDA 5E7IA 2PX8A 3DEKA 3QPWA 4FGJA 4L9RA 1BDHA 3N0RA 4O6VA 2I03A 2VJMA 1V8OA 3DE5X 1DBVO 2RGUA 4P2BA 5HGJA 2A0XA 3U7RA 1RYZA 5C32A 4NBNA 1PT8A 3K2QA 4A92A 4HLNA 5AM2A 3D8VA 3HU3A 1OXBB 1PWZA 3NHBA 3R7FA 2HYIC 3HCDA 1QFSA 1U2SA 4P3YA 3U7JA 2AQIA 3AWDA 5IANA 2OI5A 1CY4A 1DFGA 3H0EA 3OHPA 1Z62A 4ZO6A 4E5MA 2PMDA 1RP1A 1YJAA 1QORA 1TCCA 2ZTLA 3BMNA 3NH9A 2BKAA 4JUFA 5CPFA 1EFKA 1KDVA 2YN2A 4BP8A 1U7WA 4BX8A 1JS1X 2PGIA 3ENQA 4O2RA 4RJTA 4TSFD 2GFQA 4I55B 1E3IA 3TZCA 4BLWA 1IBCA 4MW6A 1CETA 4ARZB 4BO8A 4EGGA 4BNGA 4IXDA 5HJ7A 1I2CA 1SXIA 1CPYA 2Q9BA 4ZTBA 4CDNA 3KLNA 1GZ3A 3VPBA 2VO1A 1WPRA 1C29B 1QB8A 2PXAA 4JLJA 1L4FA 5TVKA 2JKYA 1C2TA 4WUVA 4YAWA 5KTYA 4KUEA 1N6OA 3C7CB 1L4UA 4WY2A 3GUZA 3GNTA 1HZZA 5ECGC 5KQLA 4HWSA 1MDFA 1RRGA 1YQXA 2GAFA 3KFVA 4W1PA 3RG2A 3SQDA 3WYAA 3OKCA 3GF4A 3SSAA 3SRTA 3JQGB 4N03A 4MLCA 5AP9A 1E2PA 3I04A 2IK8A 3OAAA 4J0IA 4TV9A 4PG8A 3HY6A 1IQRA 1Z0JA 1CJVC 2F8LA 1TRKA 2O7NA 1F48A 3GJ8A 1NW6A 4CV1A 5EESA 1JR4A 4MLDA 3M3HA 1EVKA 3EVCA 3PFBA 4AY6A 3EVBA 3T3IA 2QIPA 2ZRIA 1SCBA 4X71A 1SGWA 2IGBA 2PIDA 3LV8A 1AO3A 3FR7A 1Z4JA 3MQ4A 2WSSA 4DV3B 1OZAA 5EI5A 4CN9A 3HKCA 1ISIA 1BW9B 4AROA 2X77A 3BUSA 3L7DA 4BATA 1BQ4A 1SXPA 1ZCZA 2OO3A 3IP5A 1NQOA 3UWPA 2H1CA 5HJ2A 2X1LA 3OQPA 3B6ZA 3E0XA 3OUUA 3PQEA 3RYHA 4KAAA 3LA6A 1G66A 1OR8A 4INOA 2B34A 4MW7A 3R4CA 1R0KA 1SKUA 4R6XA 4JJZA 3T4EA 4Z99A 2JLYA 1JBKA 1NW5A 1OWPA 2I67A 3I2GA 2VPWA 5NULA 4G56A 4NCNA 4NU0A 1KHRA 2AHOA 1O5TA 1UMCB 1T5LA 2CF6A 3R8CA 3SE7A 4ZTUB 4YALA 3EQ9A 1UFOA 2ODNA 3ILHA 4O0MA 1V6SA 4B4KA 3L07A 3U39A 1OFHA 3GXOA 3VDRA 1DZ3A 1MTZA 4QD3A 2AG6A 2H9YA 3D6UA 5K0JA 1Z25A 4EGCB 2ZRGA 3H97A 4JELA 5U1PA 2WOJA 2ZB4A 1JR2A 3L8FA 1GPDG 2H48A 5BY2A 5BYAA 3U9SA 1KS9A 4XR4A 1E7RA 5E0KB 1Y3HA 3AHDA 3D6NB 3GA0A 4FB4A 2CYAA 2NTYC 2A59A 2IYWA 1NY6A 2F43B 2OFOA 3P9KA 1SB8A 1L4NA 1QQTA 1B6SA 3NTRA 2HF7A 4J8PA 4LZWA 1NBME 1FLAA 1K7YA 2CK3A 3KVYA 4AG6A 2EZTA 4L8GA 3PFGA 4ND6A 4B44A 4ZV9A 3FA2A 1ZIPA 2AJLI 4O25A 4PQYA 4EVQA 4TTQA 1IY2A 1IDOA 3IXQA 3HGTA 2HDHA 4Z9FA 4L4YA 1NVEA 4M98A 1TF7A 1EM6A 5CG2A 4J49A 3TK1A 1E8DA 3VU9B 3CB4A 3DO5A 3EG9B 5BN3B 2LD4A 1OH7A 1NKTA 3B60A 2JZNA 4P83A 5FNVB 3LX6A 3QMMA 1EZZA 2RH4A 2W2LA 4P5DA 4G87A 4P4GA 5TRTA 4JVNA 4B73A 2KYRA 2Z8YA 1TEHA 5BYBA 1F9AA 2QTNA 4WL0A 1JSCA 2B6HA 1PL0A 3FOBA 4KWEA 4EATA 4UE3S 2AMYA 3W6NA 1P7PA 4QGAA 1RXUA 4UARA 5LVAA 1AUOA 1X7HA 1P73A 1Q3KA 2BI4A 1M2KA 3KC2A 4IJ5A 5F33A 4HT3B 4ZYVA 2GAAA 1RJDA 1PQYA 2PKEA 3G49A 3SLRA 4JJIA 5JZBA 5LC1A 1S3GA 3EMVA 2AV6A 1JRLA 1ZKDA 1BRMA 4RSHA 1I6WA 1FMTA 3WNCA 4BNXA 4XM2A 5AH0A 1GTMA 2A9VA 3HSSA 1RI1A 2GN2A 1DTEA 1R0YA 3NT5A 5GGYA 4KNWA 5FBQB 1XGKA 4Q82A 4ZPJA 3THXB 2NPIA 5CXXA 1XEWX 4JP3A 1QB7A 3PXXA 2PX4A 3DMTC 3S2YA 2RIJA 1GZDA 2ZBEA 3D2AA 4F97A 1NONA 2GPSA 1EYZA 3NYWA 2HFJA 1PR9A 4MA4A 1QGZA 1SPXA 3IB6A 3PXCX 4HVTA 4MRAA 4S0ZA 1J1UA 3C39A 1JLHA 1XALA 3B9QA 3DNPA 4DN6A 1BVRA 2H1OA 1P74A 1IE3A 3OQ1A 3HB0A 3VKVA 4H77A 2XGSA 1E1QD 4DNPA 2PU5A 2I6UA 4RIHA 5EHNA 2PX3A 3KO8A 5J1TB 2QN7A 1J90A 2YJ3A 2H2DA 2Q3LA 3PX7A 4QLOA 3SZMA 1PD1A 5GM1A 2Y1FA 1RMTA 3O7WA 1FNSA 4L9SA 2WLTA 1EZ4A 1SHUX 3HGQA 3U26A 4TT8A 4FFSA 3ZN2A 4HUSA 1CUUA 2FVYA 2H4ZA 3T0GA 5LMUB 4LXTA 1R4MB 1C3OB 3HB4X 3OEEA 1Z7WA 2H1HA 3NTQA 1PFUA 1NXQA 4K6CA 4B5LA 5JCJA 1K06A 1W44A 3D0OA 4GEGA 2BZSA 3ACCA 1JSXA 1XKQA 2WM3A 1UDAA 1FMLA 5CBPA 4U1RA 5JDCA 1JHVA 3B3GA 4XGRA 1U99A 4KV7A 4OY3A 3NBMA 3HEBA 3AEQA 1C30A 1EJBA 1HE3A 2VJYA 4P54A 4PTYA 1SCUB 2GILA 3NHLA 1Z45A 3TFOA 4KPGA 4XB1A 3Q9NA 4CF3A 2Q3FA 3D6JA 3FKSA 3GP5A 3NUGA 4HMOA 3BE8A 4C20A 2F3TA 3LPDA 4DEYA 1P44A 2AQ8A 3H6KA 2JHAA 1RPAA 1KFCB 2VDWA 2B2NA 3EQ6A 3NU1A 3QPVA 3UXYA 5CB4F 4PGAA 1LS1A 1JTVA 3K8ZA 3RLFA 2PMBA 3W9BA 4LSMA 2AG8A 4I6GA 3ENNA 4CEIB 2CW5A 3BTOA 4QTTB 5FKJA 5EE5B 5HEKA 2I34A 2QRVB 1DHRA 2W9XA 2WHYA 5ALVA 2V0NA 1CR4A 5T3UA 3WK7A 3WZLA 1C3JA 1VCNA 3E4CA 3DDSA 1KRHA 4AS2A 3OH0A 1JLMA 1E9EA 4HGOA 3SX2A 1QGED 5EP4A 1YBMA 1UC4B 4GLBA 5HQJA 4YLYA 5DM70 4ALNA 5KTKA 1OASA 2P0AA 4DLYA 4BAUA 1GN9A 2RGNC 4RV4A 2VQDA 1UM8A 1QAOA 1Z39A 4GYJA 4NZOA 3ERCA 3K94A 3LAWA 3FVQA 1D04A 2QRJA 4HLDA 1ZGJA 4N8DA 3TAHA 1FS6A 2V54A 1VE6A 4UHEA 4M9UA 3SJBA 1M34B 3VR4H 1R8JA 1I80A 1HT3A 1JWBB 1K4MA 2ILVA 3AF2A 4V0KA 2ANBA 4EBBA 4UCQA 1WD7A 1ZSVA 4W9NC 3H11A 3UT6A 5LXTA 4DM7A 2DUNA 3DDUA 4L75A 1P0IA 2EC5A 4COOA 1EGAA 5L45A 5DHPA 4XRGA 3FZQA 2F4VB 2N75A 3K96A 4QDKA 1H2WA 2CMHA 2N3ZA 4H60A 4X7BA 3QEOA 4PO8A 3ZH9B 3DD1A 1AA9A 1VE1A 3K20A 3LBAA 4BFTA 1DBIA 2JIOA 3A26A 1A8QA 4I50A 3LX8A 2GM3A 2WSMA 3PENA 3OT4A 3D54D