4M98A

Acetyltransferase domain of pglb from neisseria gonorrhoeae fa1090
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
205
structure length
205
Chain Sequence
NRKLAVIGAGGHGKVVAELAAALGTYGEIVFLDDRTQGSVNGFPVIGTTLLLENSLSPEQFDITVAVGNNRIRRQITENAAALGFKLPVLIHPDATVSPSAIIGQGSVVMAKAVVQAGSVLKDGVIVNTAATVDHDCLLDAFVHISPGAHLSGNTRIGEESRIGTGACSRQQTTVGSGVTAGAGAVIVCDIPDGMTVAGNPAKPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pilin glycosylation protein
publication title Biochemical analysis and structure determination of bacterial acetyltransferases responsible for the biosynthesis of UDP-N,N'-diacetylbacillosamine.
pubmed doi rcsb
source organism Neisseria gonorrhoeae
molecule tags Transferase
total genus 72
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2013-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17836 PglD_N PglD N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4m98A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m98A01
4IZOA 3VOTA 3SRTA 4HNVA 2QIVX 3SPTA 1CE8A 4HZCA 1EHIA 4KNRA 1PX2A 3VBPA 1GLVA 2VQDA 4EA9A 1BNCA 5DEPA 2QF7A 1M6VA 2IP4A 2W0VA 1DV2A 5K2MA 3RUPA 4C5AA 3WNZA 3JQYA 4G3QA 4J6EA 3G8CA 2ZDQA 1GSOA 4EAAA 3I3XA 1IOWA 5L6SA 3D8VA 3Q2OA 1KJ9A 3OTMA 3R5AA 5E3PA 4MV3A 2W6PA 3N8DA 3D98A 4H7OA 2FKOA 3AW8A 3ETJA 1SSMA 2V0JA 4M2AA 2YRXA 2GLTA 3ORRA 3P47A 3WO0A 1OCXA 4MAMA 2VHEA 2R85A 2GPSA 1JDBB 2VD4A 2JF3A 3ECTA 2I80A 3BSSA 2R7MA 2XD4A 4EGQA 2ICYA 3VNPA 4AC3A 4N69A 5E3QA 3DJ4A 4DLKA 1C3OA 2RIJA 4MA5A 2W71A 4M28A 2ICXA 1YP4A 4IWXA 1KHRA 4FCEA 4M99A 3TISA 5H80A 1ULZA 3MC4A 3OW5A 2V5AA 2WLGA 1QRGA 4C5CA 4E75A 4K6RA 4MA0A 2DZDA 3BFPA 2V58A 1Z90A 4MYOA 3VBJA 1KRUA 1THJA 5E3RA 2R86A 4KPXA 3F1XA 3HO8A 1XATA 2W6ZA 3OUZA 4N6BA 3KWCA 3EEVA 3R5XA 5DMXA 2YZGA 2ZDGA 3VPDA 3FSYA 2FB9A 2PBZA 4MV4A 3VBLA 3MQHA 1SSQA 3R0SA 1AUVA 1QQ0A 4AAWA 2IU9A 1TDTA 2P2OA 3FSBA 4L1KA 1IOVA 3C8VA 3LP8A 1GSAA 2R84A 2QIAA 2IU8A 1FXJA 2W6QA 1B6RA 1XHDA 1B6SA 5AFUV 3I12A 3ETHA 4N6AA 2OEGA 2R87A 1MR7A 2QK4A 3N6RA 5AFUU 1YP2A 3V4ZA 3Q1XA 2VR1A 3E5NA 4E6UA 3JZFA 3FSXA 3NZ2A 1KGQA 3OUUA 1T3DA 5BPFA 3Q1KA 4GGMX 4EQYA 5U2KA 2WLDA 4ME6A 3FS8A 4KQLA 4ISXA 4HCQA 2J9GA 3VBMA 4M9UA 4DCLA 2I87A 4J18A 3TWDA 2YYAA 1QREA 2V0KA 3R2WA 4HURA 2GGQA 3ST8A 1HM0A 5DEMA 3QFFA 3U9SA 4R7PA 2YW2A 4G87A 3R5DA 1HM9A 3FTTA 1UC9A 1EZ1A 3R3RA 1KGTA 2NPOA 3TIOA 3VBIA 3VMMA 4HNUA 2V0HA 4R37A 2R7KA 3KWEA 4E1KA 4ZQIA 3T57A 2V0IA 1KJ8A 1QRFA 4FU0A 1KEEA 4EG0A 4MZUA 3R5CA 4HR7A 4EGGA 4WD3A 4R36A 2R7NA 1KJIA 3EH0A 2OEFA 1V67A 3I3AA 1I7LA 3EG4A 2YZNA 3SE7A 3VA7A 2WLCA 4J09A 3ORQA 5C1OA 2QKXA 1G97A 3TK8A 1G95A 4RZQA 4DIMA 3CJ8A 5L6VA 2W0WA 2OI7A 2I5KA 2YZMA 4IHGA 2Z04A 1QRLA 2W70A 3HJJA 3FWWA 4QSHA 3R5BA 2DWCA 1KQAA 5D8DA 2TDTA 3R1WA 4MV7A 3RFCA 1KRRA 3HBLA 2I8CA 3TQTA 2P0AA 4G3SA 2IC7A 1KJQA 4M98A 3OU9A 4IHHA 3VBNA 2Q4JA 4HUSA 4KNXA 3K5IA 2DLNA 1KRVA 1E4EB 1I7NA 4IHFA 3DHOA 4M2BA 3P1BA 4EABA 3TW6A 2IUAA 3V4EA 4MV8A 2W6MA 1HV9A 3MJFA 2W6NA 3GVDA 1A9XA 3WO1A 1AUXA 3K5HA 3RV3A 3BG5A 3BSWA 3GUEA 4C5BA 1EYZA 2V0LA 4MV1A 3IGJA 3LWBA 4EA8A 1V3WA 4HZDA 3AX6A 3GOSA 2YRWA 2OI5A 1MR9A 2CZGA 5DG3A 1KJJA 4EGJA 2W6OA 3PMOA 2R7LA 2JF2A 4N27A 3VPBA 1J2ZA 2WLEA 1UC8A 3IXCA 1YP3A 1KK5A 2OI6A 1SSTA 1S80A 3MQGA 3K3PA 1KK4A 3FOQA 1QRMA 3OTZA 2XCLA 2V59A 5ADXV 4E4TA 1E4EA 2GGOA 2YS7A 3R8YA 1MRLA 4EA7A 4E79A 5ADXU 4HNTA 3KWDA 3V4SA 3VPCA 3FSCA 1FWYA 4M9CA 3DK5A 1LXAA 5C1PA 3U9TA 4AA7A 1HM8A 2GPWA 4MFGA 3OUPA 3BRKX 1DV1A 2PVPA 3HB9A 4G3PA 2C00A 1T36A 3RV4A 1PK8A 4MV6A 3TDTA 3JZIA 3R5FA 2XATA 4KPZA 2VPQA 1GSHA 3VBKA 1VKZA 5I47A 5JQWA 3G8DA 2WLFA 3R3IA 3BSYA 3BXYA 1C30A 2YS6A 3HSQA 1BXRA 2ZDHA 4E6TA 3R23A 5BPHA 1CS0A 2PN1A 2AQ9A 5F42A 3R5HA 4MV9A 4IWYA 3TV0A 1KK6A
chains in the Genus database with same CATH superfamily
4U2BA 4RL4A 3EMBA 3A06A 3ZDBA 3TG2A 3DFMA 4BAGA 3JWJA 3G2JA 3DO8A 4P82A 4A5SA 4CMBA 1G5QA 1KXZA 1TD9A 1CE8A 1XVAA 1R0LA 2F2TA 2WT4A 1V48A 4MNTA 4JEUA 1XWIA 1IY0A 4RGYA 1UK9A 4CUJA 1K0FA 4F4JA 1R27A 4FHEA 4JBNA 1D1PA 2QPOA 2R0QC 5DI3A 2FWRA 1O1YA 1XXHA 2Y27A 4PZLA 4ZAZA 5A5EA 1W0JA 3ZKWB 3ZJ5A 2Z8YA 2OZLB 3ZHCA 4M1TA 4HRXA 4DABA 3ZTWA 3QVGB 1UJ5A 3M5WA 4NNJA 3U4AA 3BK2A 1GPAA 4UTNA 2BHTA 5HBGA 4BXOB 3BMQA 4CDGA 4FB5A 2WSYB 2QMUA 1FFEA 4WZZA 1VBNA 4LBYA 4C22A 1NVGA 1UQUA 1WF6A 3FGPA 4MUXA 1SOAA 5JD6A 4O59O 1XPRA 1WNTA 4BPRA 2O4CA 1E1CA 1QVRA 1WRBA 2F48A 3L8DA 4IDOA 4KAXA 3IURA 2DWUA 4P4LA 5E1MA 4DDWA 1XZBA 4BO8A 1KFJB 4IQGA 5JJIA 1CQJA 4YQEA 3T4UA 5IRCD 4KIJA 1FP4B 2PYZA 3SCZA 1YQEA 1Z6GA 4L2IB 1YFZA 2Q1XA 3PU6A 5DK6A 3WHKA 5HM6A 2ZM6B 2ZIFA 1PX0A 1BKSB 3NH6A 1E0JA 4JLAA 2WG1A 1DJQA 1EBFA 4XQEA 4BO2A 5HZKA 1IH8A 4YYZA 2QRNA 4INOA 3G1UA 4A03A 2ZUCA 1C50A 1JJVA 2W4IA 3W2TA 1ZR2A 1VMDA 2X5KO 2QEQA 3P9RA 4ZAGA 3H9BA 2XB6A 1ZJ6A 2ILVA 3D2AA 3LBNA 5ENZA 4Z0PA 3FUUA 1KAEA 1YOVB 4JNKA 2E3JA 2CXOA 4M0PA 4LZPA 2VD4A 2PUWA 2Z57A 2C3YA 1A69A 1GG9A 1T5DX 4O5OA 3W9SA 5I7WA 4G97A 2BR5A 1GWNA 1PJ4A 1RCFA 1C1YA 1U5BA 3LNCA 3JAWA 3KOMA 3U7HB 3CEPB 1ZJWA 4GMFA 2XZDA 5HZHA 3ONWA 4NESA 4XCVA 3WIEA 1A1VA 2XBLA 1U3DA 1E7WA 2EQBA 1P9WA 1VLMA 2RK4A 3OBIA 4GLJA 5IC5A 3U7JA 1IQRA 1XCJA 4MWZA 2A6PA 3FCOA 5DIZA 1YJ5A 5J4LA 1Q3TA 2VHZA 2YV2A 1SULA 1IG0A 4FDLA 2YFHA 5F9MA 5IJZA 1OF1A 4UATA 2NTJA 1ZNYA 1FDRA 2ZP1A 3RIMA 3L1UA 5JH7B 1W85B 4G4GA 2YH2A 2A78A 2C2MA 1A5AB 2PYDA 1WPXA 3SYKA 2UZ4A 3AVUA 4YMLA 2D3TA 4PBTA 3DL4A 3A3NA 4GPAA 1GR0A 4NSNA 1KR2A 4O2AB 2BCJQ 2F4VB 1EX6A 2GGSA 1OKKA 1XT6A 1IULA 3ABRB 3QU2A 4NK5A 3F6EX 2CHVA 4M7RA 3ONNA 4M1SA 1KZ4A 2PO7A 2O2IA 2V9PA 1XSEA 1QHGA 3N2YA 1TQ6A 4EATA 4ZCRA 5JSZA 3KSZO 5ULLA 3X1DA 3B51X 4UUBA 1UXJA 5K0SA 2GRUA 4PBRA 4QUJA 4X8LA 5I4KA 5KYWA 1OLOA 3S6JA 3SQXA 5D1HA 1CHNA 3E9YA 4N8SA 4L78A 2R5FA 5JRJA 1C7QA 2I2BA 3P2IA 4UAJA 1VHLA 3HMQA 1X1CA 3GNLA 3Q7RA 3WJ7A 3FTCA 5CXSA 1JIIA 2W22A 3WYCA 4E7PA 2XYHA 1EJ6A 5A03A 5JLJA 1GTJ1 1V0JA 4R7ZA 4EO7A 3JS5A 5JS6A 1SBYA 4KDEA 4M6WA 1NAIA 3VDNB 2FJPA 4TVKA 2JGJA 2PBZA 3RRMA 1EVQA 3HACA 4JP2A 3DE0X 5EGNA 5LZ8A 1N2IA 3SAJA 4BZZA 3I2GA 4CCYB 1SIUA 1N2SA 2HWXA 2X3UA 4IKEA 3UMGA 1KPGA 1OV6A 3NPMA 3NWJA 5ADUS 2XKKA 3HXQA 1OPXA 2MMGA 1IRXA 2IS6A 5DGXA 3S68A 4S2UA 4KN5A 3CUSA 3T3MB 3VZSA 5D84A 1JG7A 3C8VA 5HGJA 2DFTA 4GBGA 4ZICA 4LOLA 5HUQA 3IEMA 1K7YA 1JNXX 2ZI5A 3ROPA 1U7ZA 2ATIA 2I9PA 3L1JA 5EYPA 2BBWA 4MLDA 5JSKA 4RHXA 5JAPA 1UPCA 1IJKA 4L4ZA 4LC0A 3KUCA 3AG6A 3NPAA 4DMKA 3FSGD 1X1TA 1VL2A 1URPA 3OZGA 4KPYA 3TMYA 1H1LA 5DISB 2XUJA 2NO6A 1D6SA 2P5SA 4CM8B 1UBSB 3SC2A 1BHSA 1V7PC 1TT5A 2JLCA 5BV8A 4V1CI 5KTMA 1GG8A 4UEOA 4XD7D 4ND4A 5FAXA 3UJ6A 4C4AA 2I6UA 1I01A 2ZVQX 3Q7EA 4OXRA 2PXXA 5TVKA 1BGWA 3N6RA 1DOAA 4K6CA 5D6OA 2H1HA 2CLIB 4I19A 4OPMA 4TQAA 5TS3A 5BVGB 3SZRA 1M1NA 4Z1OA 3QNWA 3AVPA 1CC1S 4K9LA 3WK4A 4NKRA 1APBA 1NE7A 9LDTA 4E6UA 3F2VA 1IOZA 1J8QA 1T9GR 3ONVA 1H2BA 1ICEA 1IHXA 1L5OA 1RAAA 4YT5A 3NZ2A 5D3MA 5ENVA 4L9SA 3RG2A 1LDNA 1W6RA 2RHOA 1M2VA 1N2XA 2W2VA 3KR1A 2HHCA 1T3DA 1FDSA 4JC8A 5DN9A 4UREA 4CEJB 3Q3EA 1TM3E 3AHFA 3ET4A 4PNZA 5FWYB 4D3ZA 3W1EA 2ECQA 1BU8A 3L4SO 5F1PA 1NBMD 4XQGA 5FTNA 5CCBA 2FW9A 2AUNA 4I5GA 4B09A 2BI7A 2XUKA 2I55A 3DP9A 3KUKA 1XQ6A 3PG5A 5FFMA 3VX4A 2W8BB 4JITA 2ACKA 5ED4A 2EQ5A 4HNAB 4PLCA 3UHFA 4CXMA 4DT1A 5IJ0B 4DA7A 2QG4A 4EEZA 2HHHB 2IPAB 4H7EA 4XCXA 4J18A 3QU9A 3FOBA 5EFZA 3PA6A 2AOWA 4BEJA 1FYFA 2XB2A 4EHKA 2H2HA 1ST3A 2EJBA 2ZJZA 4QEZA 5AW5A 4RPIA 1Z74A 2DP4E 1E0AA 1NQ5A 2FDXA 2IDZA 4FOLA 5B3KA 1RU3A 2NO7A 4KFCA 4PANA 4H35A 3D59A 3DE1X 1K4YA 3COVA 1DS6A 3OWXA 4FMCF 4R3NA 2JRCA 3N3BC 4B71A 5FQNA 4JU8A 5I48A 1C41A 5CFLA 1IM5A 2PKXA 2XNJA 4U9IS 4EHFA 4ERXA 5L40A 2WM3A 4UQLA 2DGDA 4PZ9A 1EXDA 2ZJ6A 3E5RA 4MQUA 4BBJA 2X22A 4LJSA 2E5LB 3H7AA 3IMGA 4JHLA 5C35A 3RYHB 4GP7A 4NAHA 4OHKA 3DOHA 2ATCA 3ZBPA 5PNTA 5EIOA 4JL8A 5EUBA 2YYSA 1SQ0A 4I3HA 4N5HX 1Y5RA 1B8PA 4JR0A 4NWIA 2WHPA 3JQ9A 1BJTA 1W93A 1O7JA 5DXFA 1H3FA 5I9NA 1LX7A 4EG0A 5B6PA 4ARCA 3I92A 2HCTA 5CHYA 3IIKA 2A3RA 1J23A 1YHZA 2YWGA 3DV0B 3KDPA 4V0ME 4RBNA 2VBCA 2G40A 4RF3A 1FUUA 2AJLI 4G5SA 3EEQA 3TQCA 2Y2VA 1XZPA 2FPPB 2V8BA 5UKDA 2Z9DA 3RRXA 4D80A 3GRYA 1ONPA 1RKBA 2PUTA 3AR5A 2AJ8A 3NWPA 4AN4A 1AA6A 2ESRA 2B4QA 3CB4A 2YXLA 2J41A 4BNNA 2Q49A 3PI7A 4L7VA 1Q2XA 4KQMA 2ZSBA 5LB4A 1N75A 1CUFA 1K5GA 4BN4A 1GARA 4YJDA 3BHNA 1ZMRA 3VR1A 3D8HA 3EGCA 1E8DA 1Q1BA 2J7PA 1FXWA 2E4VA 2WP8J 1G7SA 1PW7A 4LDQA 5CVDA 3WWZA 5KJ1A 2IPOA 2BE7A 2JCVA 2Y1DA 3D8UA 3HJHA 3OTHA 3TZLA 4MIKA 3FX2A 4MXDA 2J5QA 2GX6A 3V4OA 2J0SA 4N47A 2QL5A 1MGPA 5IT9A 2VF4X 5FA5A 5EJ4A 5KUTA 4RMHA 1JWBB 3P5BA 2Y99A 5ESWA 4ZDKA 3Q8WA 4PZDA 1YS4A 2YJ4A 3KSDO 5AM1A 3HPQA 1KS9A 2Z9BA 2R3SA 3BAFA 4IJVA 5ALXA 5IK2D 4RVSA 1LDBA 3IAM6 721PA 3MJDA 3KQTA 4LJ8A 4MTLA 1QU2A 1FTQA 5KNLA 2GZDA 4R8LA 2AZ4A 3IBYA 1LFAA 1I94B 4NZOA 4LNHA 3A6HA 4UM7A 2OQ2A 3N2KA 5LOVF 2FTKE 2VZLA 1NF3A 1LPOA 1KQAA 3FMOB 2ZYSA 2HA2A 1X1EA 1AZLA 1E4YA 1SCJA 1Y37A 1O95A 3DDZX 3WZLA 3NV7A 1YZ3A 2R60A 4BEBA 3HCAA 1PU2A 1LPBB 3DOIA 1E2GA 4ZIRA 3IT2A 1MB4A 2HRDA 1IHYA 1M1YE 2YVKA 1RWWA 3L7NA 1Y0BA 3GPBA 1L1EA 2QR5A 4LDZA 2WWGA 4ECAA 4RC9A 4D96A 2GETA 3BKWA 4ER5A 3RSSA 4EHLA 1NXVA 2IA5A 2R47A 2WM2A 1DQSA 1SIOA 1KDVA 1NA5A 4WERA 1PGNA 1VKOA 5K0ZA 2C9YA 1JZQA 1LXCA 4DCNA 4C2BA 4E21A 1BDHA 3G59A 2IZOA 5JI3E 3HA5A 4FWBA 2G9QA 3L8CA 4GLBA 4J0QA 1EXVA 3F5SA 3ZHBA 4FQ7A 1KORA 4IRXA 4YR7A 3KEQA 1M7HA 4BV3A 2H18A 4Q3AA 5C7OO 1JHAA 2ZBPA 1R66A 2BV3A 4UBMA 3R5SA 4UU7A 3UJCA 1DI0A 3GDFA 1T8WA 4W5OA 1C3OB 1ZC3A 4S2EA 4H7IA 3SBDA 2GK7A 2IY8A 1IEQA 2MSEB 5KWEA 4KB5A 1S2IA 1TL7C 1QHXA 2Q4DA 4EO4A 1HDZA 3FAKA 3STXA 4RVGA 2QUAA 3L04A 4A6PA 1MR3F 1THTA 3PUIA 1L8XA 1QDUA 3PJRA 2A58A 2VS1A 1G2QA 2YL2A 2ZIGA 3CW9A 3IUJA 4XIGS 1OASA 4YGYA 5BSWA 1CYEA 3UENA 4AMZA 1QHYA 4DNOA 5LA6F 2AJTA 4LF7B 1AUXA 4C21A 5EKXA 3PUJA 3O26A 1NRJB 1Y1PA 2BGMA 2F3TA 3EE6A 1VG9B 3KB6A 2PNJA 3F8TA 3UM9A 5HDQA 4JP3A 1JFLA 3DMYA 3JARB 1MZVA 4Y98A 2RHDA 3K0FA 5F4BA 5SYMA 2QMEA 1GD1O 1ZD5A 1U8CB 3QTLA 1RAEA 3I34X 2FOLA 5JMPA 4IYJA 1LDMA 4MVJH 1YI8A 3SJ7A 4P3OA 2QNBA 1VJ1A 1CUHA 2CZGA 3I3SR 4FT4A 4K9KA 1S1CA 3DOJA 4YAUA 3IIJA 3PNBA 4KODA 2I34A 2D06A 2XYPA 2RGNC 5IDXA 3WP1B 4YAJA 3TL3A 1JR2A 3GQBB 2ZCVA 2H3HA 5FI3A 1GCOA 3Q0TA 3C3WA 5L6LB 3VYVA 3E6AA 4HDMB 4KXWA 4DJ5X 1SSTA 5JQGA 3ZU3A 5LFAA 2HWWA 3K3PA 4E2FA 3ORYA 5EZYA 3GJRA 1GTG1 1ZYUA 2QL7A 2O0LA 1MFPA 1MJNA 3QMPA 2Q0XA 3OFJA 5GONB 4D4KA 3QOWA 3OKFA 2FF5A 3NTXA 3OSUA 4LYYA 4OXYA 5C51B 1VE5A 3QW4B 3SK0A 5INTA 1P2BA 1LGYA 3D6FA 3QJGA 4XDZA 4BNGA 1WY5A 3SWWA 1QE5A 2D0DA 3ZCTA 1NMSA 1C0EA 3FNBA 1BE0A 1BN7A 3L1VA 3UMSA 3NKVA 5IMSA 3AFIA 3F1KA 5C52B 3RT1A 2CXPA 4FLMA 4D4MA 1FFYA 1UZNA 4PCUA 2OQRA 1GXSA 4H16A 1DEAA 1MJHA 5EHGA 4ENSA 4WLVA 5JXIA 3KC2A 1REQB 2GESA 2JAOA 1O97D 4B2IA 1TYCA 4U8GA 1P29A 5K3DA 2CFIA 1KEVA 2G76A 1Q0LA 4LKRA 4YWJA 1EFDN 3VC1A 2WTAA 1NUTA 3QBEA 3R2JA 3ABQB 4ETNA 4KHPB 2PMDA 1HLFA 3UY4A 2YUTA 4MVJM 1YE3A 3CH5A 4BZWA 3MCTA 3KJNA 1Q6YA 2TMYA 1WB9A 4BJ6A 3N70A 1KI3A 4EK9A 1FLNA 3WYDA 5I8WA 1TE2A 2HPVA 3MBOA 3T5BA 4BWVA 2R8OA 4C01A 4M9RA 3CLTD 2FFBA 1NOJA 3NONA 1QRUA 5JO0A 4O33A 3T61A 4ENQA 4URZR 1PD1A 1DAEA 1X7ZA 3OM9A 2WJHA 4KPZA 4PNEA 2PSFA 3OURA 4FOOA 4GUDA 4ZZ2A 4EPRA 3B3GA 2WWVD 4ZOLF 1IXRC 4CLDA 2CB0A 1E64A 4C3ZA 2WUFA 3VYSB 2HU8A 3EF0A 1PV1A 4LJLA 5KTPA 4KH0A 2OAGA 3SDZA 3R0ZA 3W5CA 2HNKA 1KE2A 1ZLXA 1JQ3A 1PJLA 3X1KA 1PYGA 3L40A 2M6LA 3RBXA 2C2BA 1B3BA 3GUYA 4KREA 4KEAA 3JQ7A 2M98A 2VZ0A 4PRZA 4U7FA 5EA2A 3VR6H 3ZGZA 4KFSA 2PN1A 1WUHS 4G5QA 1TYBE 5FA6A 3HJAA 4MWTA 1IXZA 1N2JA 5FA8A 4NE7A 3IPYA 5THQA 2ZU6A 3RC9A 2AE1A 4GMXA 5FBQB 3AUJB 1P5FA 1T9HA 3DTNA 3FSGA 4OK5A 3E15A 4AROA 4CKYA 1YR9A 2H51A 1U7PA 1Z0DA 1NN0A 4F3YA 1A7AA 4OX9Y 2ZBUA 4BNUA 4YH1A 3ZDQA 2IITA 2C54A 3EXEA 3KUXA 3KPWA 4KQWA 3OLXA 1ACMA 3ZVMA 4XD7A 4BTLA 2DUWA 5J9FA 3RQIA 1WD7A 2XYGA 5TEWA 1FQJA 1EDBA 1TQHA 1U3GA 3RRNA 4DHEA 4TKMA 3ZK8A 1PCXA 5B2ZA 5ESRA 1U2TA 1I32A 3K9HA 5BW6B 3VTKA 2DERA 1IHPA 2JFUA 3ZDFA 2H16A 1RJ9A 2XUIA 1UM9B 3L6DA 5AJHA 4B1FA 1KZYC 4D6PA 5JBNA 1R0CA 1BZYA 1Z15A 1XCGB 2EW1A 1MABB 2ANCA 1KI1A 1GU1A 3QEJA 3ICCA 1NBOA 1X94A 1VDMA 2WTBA 5FBHA 3WK6A 5E3HA 4WA7A 4OGGA 4HN9A 5HCUA 5LP6C 3SXPA 2QRKA 2VPWA 1NBMA 3V7FA 4K9NA 4P3KA 5BT9A 4ZI5A 4CFYA 3HTXA 4PC2A 4YFVA 3C8ZA 4IXDA 2VCHA 3G7UA 3AF6A 3R24A 1A9TA 1ZHHA 3GRPA 3S3TA 2F1IA 3L1HA 2Y1XA 1UOPA 3KU4A 2G67A 4JI1B 1ORVA 3TQOA 1WVMA 2B6HA 5SZJA 3C4QA 4ZYTA 2F9MA 4QUBA 1X38A 3OEWA 2W6PA 5JRZA 5LUAA 2DWOA 1GVHA 1U31A 5EJ2A 3AR3A 3UF0A 1P5HA 1SA0B 1U0FA 1YSCA 2AG5A 4GZMA 1CB7A 1M34B 2PU7A 4PXSA 3K4QA 5LN1A 1OTYA 3QYPA 4ZGGA 5DVZA 1VIMA 2C7OA 2D5BA 2NLOA 1IPHA 1JMVA 4X3PA 2AQHA 3WO0A 3U3MA 2Z5VA 3GLQA 3WWCA 3GUHA 3ESBA 1HDGO 4KHZA 1AGRA 1Z5PA 3EXG1 4PAMA 4BY9E 2O7RA 3UATA 1DXYA 3UT6A 4WBNA 4UEWA 4A8TA 2NQTA 2WIGA 4E5VA 5B3JA 1BXGA 1NLFA 1VYHA 3VNPA 1U0RA 1JDBC 3QWAA 4Z3OA 1ZOIA 1N6IA 1QO0D 5C3UA 2AXEA 4ZCIA 4O6VA 5B36A 4J49A 4DLKA 2C2ZA 5LQDA 3GLGA 2JCSA 3L6CA 4EKDA 4JI3B 1Y6ZA 4IIXA 5DNVA 1Z16A 2X86A 3MHTA 1USIA 2FWAA 1MC8A 3QUTA 4OIMA 4CM7A 1ISSA 1M3SA 3IRUA 4ZI3A 4QDKA 3E0XA 3V34A 2E4UA 1DNPA 4GBMA 3CZ4A 1UBHS 2COKA 5A05A 1I3CA 4A26A 2I6FA 4GP6A 4IIGA 5FX2A 3MTDA 4TV9B 5H80A 1KO4A 4D42A 1NVBA 5CFNA 1AKQA 3MSCA 1A5BB 4AVYA 1RACA 2CNDA 4I8DA 4KFRA 3TLBA 3VC3A 3SJCA 2J46A 2JHFA 3ETEA 3EDCA 4LTDA 4Z9BA 1SC9A 5CLLA 2OP0A 5FYQA 5B2EA 4HWRA 3CHYA 2FPKA 4ZVMA 5KAMA 5G40A 1HOTA 3R76A 4NABA 3TN7A 5I3CA 1OTHA 1WXWA 1AB5A 1BROA 2BGKA 3N74A 4UFOA 3IPCA 3G9ZA 4MJLA 4AN0A 4R1SA 2P4EA 4A16A 3QBJA 5CVVA 2EP5A 4IH1A 2D8MA 1YI1A 1G2IA 1L7OA 3U7RA 4DIDA 1QHHB 3FTEA 3B70A 3SUCA 1K8YB 3ND9A 3R5JA 2JLUA 2B37A 2DU8A 1N5MA 4BLQA 2O54A 2R86A 5LJLA 1FMFA 3LYUA 1MAUA 3MWKA 5FNVF 5F2OA 4ILEA 1CXZA 1N7GA 1VRVA 3D31A 3D8NA 5IXSA 4R3UC 1QFXA 3L0PA 4FYKA 5IK2A 5ECDA 4FNOA 3ZHQA 2UZ0A 4KO2S 3AI3A 4I4NA 3E1KA 4UNSA 4FKMA 4KR7A 4ZCTA 2ALJA 3ZWCA 2O8FB 1GZHB 2WTXA 4OBEA 3JQRA 4UXJA 3SYMA 4F4FA 2V97A 2W2KA 1DRUA 4FSDA 4JLSA 3PXBA 1B0AA 3HWRA 1PZHA 1LVUA 1DJLA 3G5UA 3T7TA 2BEUB 4B40A 1QWSA 4YRMA 4DWVA 2RE8A 3T3NA 1AF4A 2BDUA 4H3SA 3UXYA 5EUQB 2I2XB 4QXAA 4YCJA 4F56A 1ESEA 3JQ8B 2X15A 4AJJA 2H1VA 4ZPJA 4WDRA 1BVRA 3W79A 2ATVA 2H8GA 3HU3A 4R1TA 4RENA 3EAGA 2F67A 3CX4A 2FWMX 3ZZTA 4TVOA 1U98A 2B99A 2VF2A 3EY4A 3GWGA 3COJA 1JFRA 1LW7A 1R15A 3I9V1 3LL7A 5T6BA 3TQIA 1E3TA 4W8GA 3ZWOA 1VMEA 4BU1A 1L0BA 3QEMB 3A9WA 4G5OA 1FTWA 1ABFA 3C3EA 2BEKA 4JLOA 5DBFA 1KH2A 4MRPA 2CMGA 3GLFB 1OB5A 3FCUB 2W2LD 4PIMA 1HLPA 5A3VA 2NZWA 1ZOSA 1SG9A 4HRVA 4XIFA 5DLYA 4UCXA 1K89A 4OI2A 5F5LA 3SQNA 1ATIA 5LXTB 5DM4A 3RVBA 1YBHA 5TPWA 1G20A 2A4MA 1VC2A 4R2LA 1N5RA 4RW0A 3W6OA 5DN6D 2XF2A 5CXXA 1M34E 1XCPA 3JZFA 4QU8A 3GAMA 4RMNA 3TIVA 2PGAA 4CV2A 1XTQA 1BQ3A 2V4UA 3IR5A 1XQXA 5C5CA 2NV2B 2YJ5A 2WJAA 3BXFA 2Q7DA 2QM3A 1KY3A 2DT8A 4BNDA 4XWKA 3O38A 2GJKA 2V0GA 2LW7A 4PFJA 1MQ9A 3Q9UA 4JYBA 1L5GB 3UUGA 2PJDA 2PPLA 4CTMA 4ZAWA 4JOCA 3REFA 1UANA 1IWPB 4TN1A 4G3XA 3ER9A 2EFEB 4G6ZA 1PR3A 4BMZA 3FBGA 2O7NA 2R8XA 1D6MA 1GGMA 4RV4A 3S0JA 4RJJA 2GUGA 2FETA 2RI1A 3LM8A 3LTEA 3L7LA 4M55A 5I8ZA 3SXUB 1A8HA 2B8JA 2FY8A 3U31A 4Z7NB 2A88A 4JVNA 4WKPA 1ID8A 4GPEA 5K3FA 2WUVA 5B4TA 1BS1A 2UYCA 3D4IA 1B3RA 5ARBA 3PNSA 1MOSA 3BGWA 2FZWA 4FHGA 2EZTA 1FFWA 1T1JA 3FI9A 3MBKA 4URWR 4XR9A 4L8YA 1T13A 3BXXA 4RUKA 2Z09A 1HTTA 1ZCFA 4QU5A 1WPGA 2F3SA 4FS3A 4Q1AA 5BNTA 2HR1A 1NTRA 1D1SA 1MOQA 5KDOA 2WF7A 4UJ3A 2RJOA 5LQUA 1DG1G 1XAHA 1XGKA 1Z5GA 5EE1A 4QHTA 1R1DA 3FTTA 2MJLA 4GX2A 1VPEA 4TRNA 5CJ2A 4CF7A 5J43A 3LQQA 3U26A 5D2CA 1VOTA 4WOCA 5DKFA 2GTIA 3QRWA 3U4DA 3B6EA 3GRFA 1F17A 4UE6A 3AUYA 3IEUA 4YT4A 1QDEA 1W2GA 1RI3A 3CKKA 5F3WB 2VTEA 3CV3A 3ZD7A 1PJSA 1W4BA 3AQ4A 3CEHA 2C7GA 3RS0A 3A6LA 3HB0A 3TTYA 2ZIWB 2WIKA 3EZ9A 2CT8A 4F3KA 3LH5A 3GMDA 3T57A 2XIQA 1JFFB 2IQ5A 3A2NA 3TSAA 5LZ9A 3JD0A 2BUCA 3T7EA 5GIOE 1ZL2A 4Q16A 3EFEA 3EVEA 3CNQS 4MZUA 5M04A 1QB8A 1NJGA 2HLPA 2YNMD 1BTOA 2X6RA 2C7VA 2CXSA 4TKLA 5T4EA 4MCAA 5K0NA 1CVIA 3LP6A 3NIWA 5MN6A 1KJIA 1W25A 5ALFA 1PEAA 2HWKA 4Q15A 1U0NA 4PF1A 5FCDA 1RLJA 3FYCA 5CG2A 2Z2KA 2IHBA 3PE4A 4B9AA 5AW8A 1EFCA 3TDMA 3N05A 4EYGA 2F3PA 4JSYA 3WNQA 4PGHA 4KMSA 4EG8A 1QS0B 1SUCA 5DBIA 3KSBC 2LE0A 5CB4F 2EG9A 1BCRA 1KARA 4Q19A 1CY0A 3U4MA 3FKQA 2PKEA 2OXEA 3LDFA 5A9SB 4YP7A 3RYIA 1NYQA 4N12A 3CLRC 4RK5A 3I5XA 4YAEA 4JD5A 4QFBA 4YT8A 3TLGA 1IVNA 4HWKA 4MR7B 3WICA 2EYUA 4TYMA 3I4FA 4BNLA 3CX6A 4Y6GB 2E5FA 2VXOA 3QVLA 1CY8A 5JISA 1BWPA 5L3RA 1ODJA 2H2DA 1R7RA 3HEAA 1KTVA 3UFBA 4YRKA 2WWFA 1H9CA 4WXYB 4LTNA 3IP5A 5BSTA 3HUTA 4H27A 5DGHA 2G63A 3LRPA 3UA4A 1EP1B 5AESA 1G8PA 3IX7A 2ZULA 1MEEA 2KX7A 4UUAA 5CP8A 4MULA 3AXTA 4GI7A 2WFZA 1GZVA 2JI9A 3GEMA 3KJQA 1DX9A 3K9GA 3A31A 4S24A 5CX4A 2BTOA 4Y67A 1MG5A 1P1FA 3V7YA 3WRXC 1IU9A 2YHIA 2VZ8A 3OIGA 3O8RA 2FP4B 2XE4A 3NIGB 4Y1EA 4IJKA 4KVZA 1O8BA 2WI8A 4BNHA 2J9YB 1M0SA 1XJ0A 1M6HA 1FK8A 2G5GX 4RHCA 1CRPA 2PWYA 4UUMA 1UPUA 5LQNA 3NVMB 3WTBA 2TYSB 4KMOA 1QG6A 3TAXA 4J3NA 3OIVA 2HU2A 5EMHA 3FR8A 4O8ZA 4UULA 1LBIA 2EAUA 3UK2A 4B0PA 2ZRHA 2AIRA 1TX4B 2LUOA 1PO7A 2P11A 3CZQA 2WG2A 3CY6A 3DEZA 1DVRA 3M89A 3P2OA 3VVBA 4CUZA 4HUSA 2PS1A 1AC5A 3GFRA 1P39A 4U9HS 3AUUA 3DT6A 4WFQA 3VKWA 1SXGA 4KNVA 2L19A 4LGVA 4DEYA 1DIOB 2IUAA 1T3TA 3ESZA 4KG7A 2JGRA 3LE8A 5TPZD 2GZ3A 3GWZA 3QY0A 2OD7A 2IHTA 5J63A 3GG9A 1E1MA 2NO0A 3I73A 4L0DA 3T6KA 3V7NA 3JYLA 1K3TA 3X2SA 4G9BA 5ENDA 4HAIA 1EAMA 1NURA 1SHZA 1CEQA 2IEIA 3AETB 3BFXA 3HB1A 1DXOA 1FC0A 3KZCA 1F9AA 1T5OA 2QW0X 4KPGA 4QXOA 4RTOA 2WQ6A 5C2JB 5LSAA 2HM7A 1A9XA 1ZD1A 2JCGA 3GEEA 5EWJA 4B7CA 2C7PA 1LNSA 3RUDA 1OCEA 3OZAA 5KYUA 1GGKA 1UT5A 1TAHA 5HF5A 3TQFA 3MLAA 2WWHA 3BWCA 3ONDA 1P3JA 1PTJC 2I7VA 2QTAA 3DFZA 3GEIA 4RJKA 4ES6A 2QMOA 1X7GA 3PL5A 1A0OA 2JGLA 4LPSA 1V3WA 4TSRA 4ZV7A 4Q9AA 1JHOA 2IYSA 1E60A 2VDLB 4OBXA 4QBTA 4BB6A 5IYZB 5JNRA 3DCNA 2IYAA 3C8HA 3UWDA 3ASVA 1AQYA 5LNK1 5F76A 2V6MA 4D82A 2IIQA 1DWOA 4I3FA 6AT1A 4W8OA 4DSTA 2EZ8A 3AZPA 4RCZA 4FNMA 3TOSA 4M87A 1I36A 3EGVA 1XD8A 2SICE 1QO0A 5E1OA 1KK4A 4H9GA 1AXGA 1QRMA 1JR3D 4EY7A 5B7PA 4N7BA 2XEXA 4H2DA 3SSOA 5E4YA 1VHQA 1VJCA 3F9IA 4MPTA 3TSWA 2WF8A 4DCVA 4YFYA 2IW3A 3CMMA 3E7WA 3IPLA 4O29A 3R8YA 1ISJA 4P7KA 4IDNA 2OO3A 1GQQA 3KS9A 1VZ3A 1YL7A 2OB2A 2PKYX 3FPEA 2YJ6A 3IILA 3G2OA 2NSYA 1EJ0A 3LCJA 4I6JA 4U6SA 4TS9A 3W04A 3W5HA 3WL4A 2VQEB 4BMCA 1MX1A 2QD3A 1Z3CA 3GLVA 4GX1A 1F20A 4BRZA 4ZU6X 2PNFA 5BSFA 1OH5A 4DQUA 1JW9B 3BXPA 3FSCA 1D6JA 1DDOA 4RFSB 4ZT2A 3Q2IA 4OYYA 1UQTA 1W5AA 2GPNA 2YMPA 4Q1VA 1JVSA 3H5LA 1ZN2A 2DWPA 7YASA 2GUWA 1QH8A 4BO1A 3JAKA 3RUIA 1IRIA 3ZV3A 3U9TA 2XDYA 3AB3A 1OLUA 2O8NA 3NQ41 2W2XA 1PNQA 2VAMA 4CF5A 4ZZ3A 3UPUA 4NMXB 2G0TA 2PLRA 3GHHA 4HJRA 4LG1A 3ZWXA 2KHZA 4LSMA 1SC1A 1NOIA 1VFNA 2PO5A 2CNBA 2VT6A 3BIOA 4ITUA 4IR7A 3S2SA 3T9EA 5JJCA 3SHTA 1X1SA 4FGUA 5J59A 5LUBA 3STUA 3K0SA 1IUNA 2HA0A 1EWTA 4B44A 1N2BA 1PUIA 3NHYA 3OZTA 5T6MA 1HQCA 4ER0A 1G17A 2UUBB 3OJXA 4WQMA 2HN9A 2JGFA 2LR0A 1KZGB 1Q7EA 3BRWA 3M9LA 2R1TB 4EYKA 3QVWA 1O94C 4MUJA 4FW8A 4ZEOA 3VKFA 4JJIA 4R0VA 3FZEA 1NVDA 1EE1A 2D7CA 1LSSA 2Q0SA 5EERA 2LXNA 3CR7A 4ENRA 5A4DA 5C7YA 3HSQA 4CT5A 1BO6A 4D6XA 3GBPA 5ARDA 4JFRA 3K0AB 2B4YA 3K09A 4Q18A 3C6BA 3FFBA 1U99A 1X92A 3PXXA 4OP3A 4QTZA 1Y5LA 2IODA 3ANMA 3B3AA 1I51A 5EKTA 5AVZA 2GKOA 1X3LA 4MGYR 4EB3A 4OXQA 2H65A 1K6XA 5E6UA 1TRKA 3HFRA 2VL7A 4IZOA 4NYJR 4Y2QA 2G70A 3U7QA 1CJKC 1ZPDA 2VUHB 2GF0A 4ITVA 1Y7IA 3T7SA 5KWIA 1FW6A 2PMCA 1VG8A 4HNVA 2W4QA 2PUFA 1P4RA 1Z29A 3CGGA 3MTBA 2UYOA 3OHPA 5HF6A 5TQ2A 5I7UA 1VPDA 2EATA 2XCRB 4HRYA 1KPHA 4MHTA 4UEJA 1VYUA 1XTRA 3DHWC 5G4KB 3EIWA 1E2FA 2W2LA 2YJZA 3IESA 1P7CA 4OHRA 3IALA 1S2DA 3FCSB 4D9FA 2HF7A 4R6WA 1GLNA 3LHFA 4K9DA 4BJHB 4Q37A 2C98A 1TM7E 4UTOA 5F7OA 3MOSA 4GAEA 4GD3Q 5DN6A 5HHTA 3D1JA 2O5CA 3ENNA 2WTUA 1KQPA 3J81k 2W0VA 4JZYA 5ALKA 2DQSA 1ZH6A 2FFQA 1LK0A 2C9ZA 3CBGA 3K96A 4H6VA 2BM8A 3RUPA 1O5IA 2NU9A 3DWGA 1X7HA 4BEVA 3CZCA 2Y68A 5EXPA 4N5IX 4QJIA 3ZCXA 4NV0A 1ZH8A 5BUZA 2IOYA 4IDDA 3BL5A 4JL5A 4NRDA 1R0RE 3UIEA 1MRZA 1N6KA 2H63A 3I3XA 4HEA6 2ZYWX 2K7ZA 2OGTA 5CH5A 2RKWA 4M1KA 2XNKA 4IP0A 3A1UA 2HQSA 4X65B 3UAWA 3T1YB 3IERA 5EMMA 1ITZA 1KOFA 4RV9A 3O3NB 4J76A 4V0NA 3ABSB 2HC9A 2PZLA 3DBHB 5JS1A 2NP7A 3ILYA 4RV5A 4UPDA 1R6UA 3IDSA 5A7GA 4N65A 3GK3A 1D7AA 2R68A 1ZRSA 1HG1A 3MIZA 3IMFA 1W30A 1I6KA 1L7BA 2HDNB 1BDMA 3GFOA 4TMTA 1L5KA 4GSKA 2Q3HA 4Q05A 4LCEA 3QXHA 1CUIA 4TXHA 3P0FA 4DSUA 1WU8A 2ZRBA 3TI7A 4G81A 1FQKA 2QUJA 3JWPA 4N0QA 3TZBA 3WKCA 4CM5A 5KYXB 1MU0A 3HXKA 1TU4A 2J0UB 3FOWA 3GMTA 1EX9A 1NQTA 4RMGA 2OECA 2WPNA 3DMRA 3T15A 4R5MA 1FFSA 1MKYA 3JQGA 5BMOA 3VR5D 4DG5A 2V03A 4I55B 4WLUA 2ZI9A 4LBZA 2SNIE 1JSCA 4Q4AB 4TV8B 3B3FA 4J0IA 1E92A 5EWMB 5EWLB 4ZQGA 5B58C 4L6IA 1UZAA 5AHKA 1YQTA 1QQAA 4GPZA 4Y0VA 5JROA 1P6QA 3AEKB 2GEBA 4NI5A 2VJBA 2JK0A 1KHRA 4FCEA 3GVCA 4D02A 1DFHA 2R8EA 2LIVA 2RCNA 1E5LA 4QDUA 3V2GA 2YNMA 1CFJA 2Y0BA 3AEQB 3PX3A 4IJ6A 4PO9A 4XX0A 2HMVA 3GU3A 3SI7A 1QGUA 2J9FB 4DR2B 3SJZA 4N18A 5BQ3A 4CV3A 1N3LA 3PUVA 4ZJZA 5AKZA 3FF4A 2WK1A 1IDN1 4LQDA 4EKGA 3GR6A 3SR3A 1IXYA 1OWNA 2Q6LA 1R6AA 2HK6A 3I52A 4UXHA 4TRMA 4MIOA 3T4EA 4WE3A 3LUFA 4QJ5A 1WCV1 4M46A 1L7QA 2IL1A 4QBKA 3V4VB 1K8RA 1YWGO 3D3JA 4MYOA 2VP6A 4M0CA 2C4VA 4BWYA 1I4DD 1OJLA 3KWLA 3K16A 3NC1C 3N6VA 3RTAA 4AZ0A 3L46A 1GKUB 1VL8A 2GYUA 2C5LA 1GZ6A 3KFLA 3OQPA 5KBYA 3K6SB 1J1UA 1YHYA 2OHIA 3I2IA 3I6IA 3PHGA 4OGKA 2RBGA 3H5OA 3EPLA 2C4KA 2WWYA 2A0XA 1CQZA 1H4VB 1QIGA 4IV5A 3MRSA 1OXBB 2MYNA 4II3A 5IVIA 3SGLA 1P60A 3H86A 3ZI4A 4NH4A 2JEYA 1GOTA 2OLKA 3L8FA 3MMSA 3O4VA 1FQOA 1V47A 3B3JA 1JEYB 1MH1A 1YBMA 3MTEA 2PFSA 3ZI0A 1TCVA 2WVHA 3OESA 4QDZA 1O2DA 2OV8A 4PSCA 3L6EA 1KJNA 5AVQA 3EASA 1CR1A 1T2NA 4NICA 4PICA 3T5TA 3R0SA 4LI3X 2AJCA 4ZQCB 2FWNA 1OWPA 2CVZA 4A10A 1BWQA 3S2IA 2B4RO 1GSAA 4O02B 2WB2A 2WWXA 3M4ZA 1TO1E 5JJKA 2QLMA 4CT4B 4ZYVA 3P45A 2X2PA 5ILQA 1AURA 1EXNA 1OIWA 2OWDA 5AFUV 3OTWA 1DP4A 3PKJA 3R6LA 5JS2A 4DM3A 3BJIC 1IB0A 2XKBA 4H4DA 3GARA 4CKZA 4RTJA 2INGX 1SZPA 2DBYA 2PD4A 4OJTA 3EPHA 2DHCA 1IXKA 1DRWA 3G85A 3LPLA 7REQA 4GH5A 1JIUA 1E0DA 5DTQA 5TPZA 4DDKA 1CJMA 3WLJA 2AOUB 3CCFA 1R3DA 5FHQA 5AFUU 3WWDA 4AJNA 4K81B 4BFYA 3V4ZA 2HJWA 3SBOA 3ZWKA 1Q0TA 3OF2A 2BOVA 5EXXA 1QGED 2XMPA 1DZIA 3H65A 3TW8A 2ZIZA 2OXFA 3C7AA 3SR0A 4EHIA 1N6LA 1Y8CA 4ZO8A 2Q3FA 5AKJA 4YJFB 3TLMA 4BP1A 1PT6A 3ZIDA 4JXXA 3VM6A 3VUEA 5JR3A 1DX6A 2FW7A 3FFWA 4J0DA 3KAPA 1ZNZA 1Z47A 1H2WA 4DNPA 2A0YA 4GXQA 2IK8A 2QRGA 3OI7A 3REGA 5K8IA 5KNDD 3NEJA 4QTTB 2P9QA 1KP3A 3HUUA 4PX5A 4RNCA 2Q5LA 4ZAVA 3HYTA 4F92B 1R8SA 1UKCA 3H2SA 5JATA 3IIIA 1H6BA 3JVUA 2OE2A 4H1UA 4UXIA 2OVFA 2VQ3A 4ZRMA 2AG0A 2IUEA 4TTTS 2CCJA 2ENWA 2FMHA 1NKTA 4RVUA 3KHTA 3D7SA 1I7SB 5FADA 2PZFA 2X0FA 1KZHA 1N7HA 5HK9A 2NU6B 1Z6AA 5AQEA 1C9MA 4OJNA 3BPSA 1O5OA 3WBKA 3CLKA 1IC6A 2NXWA 1RBQA 3PT9A 5DEMA 3WWPA 1OXUA 1Y8ZA 1EM8A 3Q0IA 2WAOA 3ENVA 1P44A 2I7CA 5CGQB 4ZU3A 4MR9A 2PR2A 2ZBDA 2I99A 1UBCA 1JR3A 3N8KA 4XEUA 2JGAA 3CNLA 5E6RB 4GR4A 1E7QA 2IHUA 3TQSA 4EFDA 4EI2A 4F2GA 3OOJA 3L4JA 1C1DA 4LXTA 3OY2A 2BHSA 2G0AA 4DJDC 5CA1F 3KZNA 3T9AA 1RQ2A 4S0XA 2IGBA 5CT4A 3TQHA 4BP8A 1RXEA 2CE7A 4BO7A 1I5EA 4ICIA 3U40A 3KWFA 3NB0A 3DOFA 2P90A 3CSSA 3HM9A 4ZQIA 4Z6KA 5CB6A 1NXSA 4J6FA 1TLTA 1WOYA 5AOAA 4EMSA 3IE0A 3CH7A 5F52A 3D0QA 1KAGA 3H84A 2QJWA 1ZIYA 3JV7A 1N25A 2KBFA 3TNLA 2J59A 2ZSKA 1FA9A 4ZEXA 1PR0A 3A4NA 3HKBB 3HCDA 4KXQA 4MS4B 5C1DA 3P1JA 3R3VA 5IH3A 4E5KA 1FZTA 3L06A 4PYQA 4R8VA 1CVRA 3Q8MA 1U7HA 1U0EA 2NZJA 1IXSB 2PL3A 2CMDA 4KQEA 3F8WA 1XEAA 3T1TA 5EXTA 1L5ZA 1GAWA 2QKYA 3SVTA 2FN7A 1EFPB 2ZVPX 1UJCA 3BA6A 4JJGA 5AUPB 5KVSA 2DUMA 1RIIA 2QRZA 2XNSA 1E5DA 1HZZA 2OTCA 2YFQA 3GFTA 4NCXA 4EY5A 1XYGA 5BOVA 5LQRA 3UAYA 3BXHA 3UGKA 4D97A 2WLCA 4J09A 2CHGA 2Q1WA 5EZQA 1RYFA 1G8YA 3AF1A 5JZBA 2HT1A 1Q91A 4EUSA 4HL6A 2JFVA 3Q7QA 3WJAA 1B4DA 2EERA 2O5VA 2WBLC 3I5MA 4EF5A 4Z7OB 2VOJA 4WZBB 4B82A 2ATEA 1NX9A 1KIAA 4R6XA 5ALEA 2VH1A 4D9NA 2XZTA 1PP4A 4E12A 1AMUA 1QH9A 1MXHA 4R84A 4ZOCA 1YACA 2HNAA 5G2OA 1L4HA 2ZRKA 2QXUA 3GZTB 5FUBA 2QG9A 3PZBA 3F3YA 2CYCA 3NDPA 3S1AA 4C4OA 3S70A 3IKMB 4ILKA 1H1DA 1V9SA 4JJEA 2Q4RA 2Z04A 4B6EA 1TEHA 3MD9A 3A9SA 4TYQA 1ZRNA 3HXLA 3THYA 1TCBA 1JWLA 4YP0A 1B14A 1ISFA 2XTNA 4GC9A 5ERYA 4B79A 1W94A 2LCIA 2IPLA 3D5QA 1CUDA 4OREX 4PNHA 5I7OA 1OR8A 4R1NA 1WG8A 5BYBA 3PUWA 1S8OA 2B30A 2QMQA 4MV7A 5J47A 1SUBA 3T1OA 5K0GA 2R6FA 3K8ZA 5LQAA 4KR0A 4DVJA 1KSHA 1LLFA 2W0MA 3QF4A 4TTSA 1KRRA 3HNPA 1CJUC 1ECBA 2F4NA 2FLKA 2I8CA 1RRGA 2BL4A 2PS9A 2SBTA 2H08A 1WULS 2WHXA 5GGYA 1MB0A 1S96A 2FZGA 3BCHA 2P0AA 1NKSA 2Z8XA 2F1KA 3HJTA 3UT5B 3AKDA 3CUTA 4D9IA 1E9DA 1WZCA 2X4LA 3A11A 4ZZIA 5KVVA 5IAEA 3T5DA 1EHCA 1SRQA 3T95A 3ZY2A 1PV4A 1EUYA 2QV0A 3BL8A 3N2ZB 1GCGA 4RDHA 3Q72A 1F60A 3SBXA 3ISJA 3RAJA 1R8XA 2ODQA 4LGYA 3OUTA 4MYSA 1PJ2A 1DAHA 4DPKA 5LBTA 3TW6A 2ORVA 3QLVA 2CVPA 1EIZA 2ZSAA 3G0BA 1PDWA 1ZOOA 1RHQA 3BJEA 4WWHA 4UHKA 1O54A 3BWYA 4YX9A 2BYTA 1FNNA 1G9XA 1UFRA 3ZX5A 3TQRA 1JQJC 4UPEA 5KYGA 2GPBA 2ERYA 9MHTA 2NNLD 1FP7A 1Z2FA 4EJ0A 4RTSA 4HAOA 3RWOA 2UKDA 1D0IA 1HV9A 4MEAA 3WZ2A 1KNXA 1IONA 2H5IA 3T0GA 4NYMQ 2A5JA 2IOFK 3WGIA 1W581 1Z9BA 1RPTA 3NWEA 3A4LA 1DBWA 3UJ8A 3W6ZA 4ISBA 5A4AA 3MYRA 5FOWA 1UKBA 1W44A 4ARVA 1GQ2A 1J0DA 1QVVA 4LFBB 3RUAA 2C0CA 2QD1A 2WIDA 1CDEA 1MC5A 4OUDB 1ZSVA 4DV5B 3I72A 4XB1A 1C3LA 4QOJA 5FR2A 1CNEA 1LDGA 3D0KA 3MG9A 1NR1A 4B5LA 4EW3A 5KI6A 5IKEA 1F8GA 2HMUA 1ILEA 3I0MA 4WRRA 4AKSA 4ARIA 5HOQA 3CR3C 1DC3A 1US8B 1XNRB 2R7LA 1DEKA 4X64B 4N27A 2RHGB 4OQNA 3AXSA 4X1YA 2GJ4A 1SU7A 5IXJA 5CLIA 5J4YA 1KY5A 1UC8A 5T57A 3ML1A 5COAA 2OV2A 1NNEA 1S80A 1KVSA 3OLCX 3VR5A 2EIXA 3I5YA 2CHQA 2NAFA 2GHTA 3GCGA 4Q66C 4TKVB 3VOSA 1H9AA 2BI4A 3D9QX 4F6LA 3FOQA 3RWBA 4X1KB 2R8PA 3HJFA 3AKYA 3BFJA 4UTXA 3KB8A 3WL5A 4GX5A 2WSLA 3H11A 4EIWA 2FW0A 3AF2A 1UWKA 1KE1A 3GQ7A 4GWKA 4KDFA 1Z22A 2GGOA 2LV8A 1LLQA 4IJ5A 1ISHA 2OBXA 3KQVA 1PNOA 3EQ9A 2Q2WA 4GKKB 1X9IA 3RSOA 2E4XA 1DBQA 1KMHB 2VYVD 3G3EA 3KR2A 3DEKA 3Q7PA 3PCTA 2YIVX 4G67A 4E31A 2Y92A 1YZGA 3UJHA 1HE2A 2YWEA 5H59A 2IEBA 1Y9AA 1VECA 1CDDA 3KWDA 1FVHA 2V7UA 4WZBE 2ZGVA 2PZ8A 3D8RA 3LO5A 4H7KA 2WSSD 4KQHA 4MKFA 4I6GA 4I9GA 1RJEA 1VYTA 4IFIA 2CL5A 3NTVA 4QHSA 3WLRA 5BUSA 5DHRA 1SCNE 5FORA 5K6TA 2FCAA 1E9FA 9ATCA 4RL6A 1RMYA 4WZAE 4YWHA 5G0SA 4PBSA 2I67A 4PSDA 2XQIA 1N2ZA 3QV2A 1E3WA 1HM8A 4QXRA 1JAZA 4HF7A 1TMKA 3QUBA 3BQ9A 1TJ3A 1QE3A 1XTBA 2HB6A 3CURA 3DLPX 4KIWA 4OHVA 4MW0A 3TTVA 1RTKA 1SVKA 3OGZA 2PVPA 1XKXA 2B35A 4LJAA 2LRHA 4J0KA 3OJWA 1VG1A 3KEOA 1MEOA 3CLUD 4MW6A 2YC4C 3ZR4B 2XKJE 3NOQA 2AZTA 1AN9A 8ATCA 1OH6A 2P7HA 2W2PA 3L7OA 3HEBA 4KQXA 4NZZA 1N0UA 3IQGX 4Z0NA 4RHTA 4H1HA 1QZTA 4DBLC 3C1UA 5IHPA 3KV3O 3TSYA 3UTDA 5KC8A 3BXYA 3F7TA 4PX2A 2I2FA 2XWPA 1YTLA 4HGYA 2I4OA 5CFMA 4OAQA 1PGPA 2OAQ1 1LI4A 3HY6A 5F73A 5GPBA 4FOSA 3A36A 2GXQA 1Q17A 3FPAA 1WKCA 4P7BA 5DBOA 3RSQA 1HEIA 4A2WA 4BKMA 3PLAE 3C85A 1MX5A 5CDTA 4ENPA 1FJ2A 2BJHA 3V6LA 1YULA 2WJJA 4LJ7A 5IN5A 4QOEA 4OKNA 1W49A 4RXTA 2ZWVA 3JRNA 3NNSA 4G1MB 1KYQA 1XZJA 4QNMA 4O4LB 3EVGA 2P4HX 4QOFA 3DUFB 3L4BA 5GWXA 4H0NA 5IBPA 4F5ZA 4PNPA 1JQDA 5TMDA 2F43B 1NYRA 3RANA 4WDQA 4LRUA 2UXBB 2BF7A 4K1XA 1I6LA 1R4MA 4DPMA 4DMMA 3P20A 1T10A 1DEHA 2PR7A 4D46A 4DA9A 4D26A 1OA0A 1SR8A 3H9GA 1M33A 2R8YA 3LUGA 1N4IA 4A92A 1XD2B 3A9CA 2JCXA 4IJWA 4RSRA 5TT1A 1WF3A 1X42A 1RBYA 1YKGA 1AM4D 1FEZA 1XJQA 4ZV4A 5LJIA 4C5AA 1POWA 2JLVA 4GZ6A 5I4CA 4J6EA 1VI5A 2EBWA 5HKLA 2A9FA 2IKQA 3E05A 2OHGA 1EBBA 4KPFC 4HBZA 1AQJA 2GYVA 3U16A 5CLQA 1ZNXA 2ZR9A 1YCGA 2BBTA 2J85A 4Y9RA 3VV3A 3QM1A 3RJ5A 4I08A 4N5LA 4NOLA 2KLHA 2ZI6A 5AKGA 4HWPA 1J09A 3HGMA 2F3RA 3KXLA 3MM4A 1M0EA 3MJRA 2JA2A 2VHJA 3H4IA 1B93A 2FRVA 2XUFA 4B32A 1LF5A 4RWZA 4QG7A 5HQTA 2I5PO 1GPBA 4FW9A 3TXYA 1IY9A 4DJJA 5CFRA 3X1MA 5AH0A 4M8IA 5JS7A 1Y33E 4M21A 4K9SA 4M83A 4O2BB 3PS9A 3Q9SA 1BQEA 4NJMA 1RKUA 3Q5DA 3WSVA 4A2PA 4EQZA 1FVXA 4M1YA 4Y2TA 4M1QA 1R50A 3QMWA 3RT9A 5C3MA 2JW5A 1FNDA 4FYYA 1P19A 5LLDA 3QSGA 1JU9A 2G25A 2H1SA 1UMBA 3OM8A 4GMKA 4ML3A 4BYGA 3IPAA 4O4HB 1J5PA 3CJRA 1CQWA 4HAYA 6Q21A 3OZBA 2I80A 4RHFA 4LC1A 3NBYC 4H4CA 5C8YA 4NQRA 1Q0SA 3BHMA 4J75A 3GROA 4N4AA 4XJSA 2QBYA 3TIIA 3B36A 2KQUA 4F9EA 2QSJA 4EELA 1RZUA 3EW9A 1YJ8A 4L5IA 4R1QA 1B73A 1QTNA 4B81A 4REOA 2Z2JA 1E63A 3B38A 2O2XA 1ULHA 5CNJA 5ILOA 2A1TR 3AL0C 2FR8C 4GSYA 1ZOLA 1F2TA 4WNYA 3BE6A 1HT0A 3A32A 4C7BA 4MGHA 4AXXA 3HJCA 3U4IA 4KWTA 5B7QA 3KKKA 3BFVA 4RGQA 3BSFA 3ZU6A 4MUFA 5LYJB 1VI6A 3PCXA 1EESA 2GEUA 4G24A 1J07A 1UK6A 2FG7C 3QKRB 4E2WA 3TFOA 1QCYA 1SXJD 5H9VA 4YAFA 2QD2A 3AFHA 1E4VA 3EQ6A 4ZZ0A 3AYXB 1Y3BE 3RU3A 1QK4A 2G17A 4K6OA 2CV1A 1J33A 1EK0A 2Q5FA 1V26A 1XIVA 2H1IA 5CVUA 3FZGA 1XV5A 4K6RA 2FMXA 4FVTA 4PGFA 1KKMA 4YJGB 4Z5XA 1G6Q1 1BJKA 4DV2B 4EVSA 1QFJA 3FKJA 2BFAA 5AW4A 1ZX1A 4Y2UA 4WLNA 1KI6B 5FAKA 3TCKA 4RS4A 1LLCA 1X77A 3L0OA 3U80A 1TF5A 3U37A 4P86A 2AK3A 3PUYA 4B74A 5CDSA 4TWBA 1GA1A 1N6OA 3UO8B 5JH7F 1GNQA 2ZCUA 4A82A 4E5NA 1UEXC 2QRLA 2Q5JA 3UK6A 5H9WA 1GUBA 2FPWA 1BS2A 4CQMD 3IP9A 5EJ8A 4NU6A 1K8ZB 1RDFA 4ZA2A 1IZ0A 3TL6A 1GYQA 3NHPA 4YMIA 1ABBA 2R65A 4QYWA 2P9YA 4A4DA 1DC4A 4AKGA 2DTXA 1KU0A 2UVQA 2VHVA 2D1FA 1AKEA 2GEFA 2FEXA 3HDGA 3JSAA 1VMKA 4J2OA 4DQKA 4US2R 2NT4A 1LDEA 2B8TA 5KOJB 5IJAA 2LPMA 3RADC 4ZVVA 5A6SA 3LQFA 1E2EA 2I2WA 1P4GA 1RRKA 1Y3IA 3KQPA 2HA4A 2OCAA 2JGDB 3PRJA 4PYIA 3FB1A 4LJ4A 3W34A 2Z6AA 3ECCA 4C07A 2W98A 1X86B 4XVUA 4ROTA 1W88A 2HK7A 4NJEA 1DG9A 3MPOA 4FZVA 4Z4CA 2FSPA 1X7WA 4IHJF 3D6TB 2ONCA 4KFUA 4LY9A 4EITA 3DVAA 3O8LA 2EHJA 2PUVA 4G2NA 4O4IB 2HJHA 5KTNA 2O0HA 4LW8A 3O6VA 4BB9A 1IHDA 1RWOA 4XGQA 3AR8A 5AT1A 4CI0B 2Y1GA 3HCPA 1SCDA 1GL6A 4I7EA 1E1RD 1EP3B 1OV4A 2O5RA 3G5AA 4K9PA 3UMVA 2EARA 1EEXB 1V3UA 2XTMA 4GZ3A 2J5BA 3WBJA 2C4WA 4MWOA 2PAFA 1WPQA 1ZH4A 4P34A 4ZJYA 3NEYA 4TWJA 3W5BA 1NSTA 1AT1A 4U6NA 3AG5A 3E22B 2EL7A 1SAYA 2CEAA 3HO1A 4OHYA 2X3YA 2HDOA 1TZCA 1CJVC 4C0BA 1R00A 3WGZA 1SM4A 1XQVA 4D0GA 2JFHA 4QREA 3AHHA 2O52A 4M49A 1GFWA 2ZAGA 3V8BA 3IC5A 4YCCA 1RYMA 3Q3CA 3S1LA 5AVWA 3I9FA 4PGAA 4B4UA 4CLXA 3GCWA 3N3AC 4LOKA 3B1JA 3QX8A 4TVBA 1D2CA 1KFBB 4LXIA 1ZEJA 5CYPA 1ZW1A 1QR6A 1TMYA 4BO4A 5C32A 5LKAA 4M0LA 2BJVA 3I62A 3WHIA 5TX7A 3PXDA 1XN4A 2JKYA 2JIOA 3MFYA 1KQFA 5LPNA 3IQWA 3IE1A 2IBTA 1NBHA 4AS3A 3A14A 4YRFA 5CNIA 1IY1A 1OU0A 4YP6A 3TJZA 3UJ9A 1YB2A 2JCYA 4WXHA 5EC8A 5KOIA 4MICA 4YRPA 5CFZA 1CIJA 1TCAA 4NOKA 1UBJS 2HU5A 4MS3B 1N2GA 4R7TA 2QZSA 3CRMA 4B87A 2HH9A 3BC1A 3TJRA 4KX3A 4MRMB 5C34B 5FIUA 2Z8YM 5BNIA 5AK5A 4PHTA 1TGYA 4J9VA 1WUKS 3R5DA 1N5JA 5CM9C 4BYMA 3I1FA 2J3EA 3SZUA 4KP7A 1TVMA 4BOYA 1QH0A 4JVMA 3UH0A 2PRYA 4V3CA 4BMDA 2HCRA 3R3HA 1YDEA 2BM9A 4Y2JA 5KX5B 4PG4A 2HHAA 1TQ2A 5SYNA 2NPOA 2ZJ4A 4HQNA 2B9EA 3H13A 3HA2A 2VYVA 3U4GA 3BFKA 4X91A 4C0QC 3CEJA 3T7CA 3WISA 4GBJA 3IH5A 3HYNA 3T3DA 1RLIA 1J39A 2ACEA 3BTUA 4RY2A 4D9BA 1XRMA 5AIAA 5BQFA 1D0VA 3L05A 2VATA 3B1FA 2EG5A 2WSSA 3Q5GA 4R2MA 5IC4A 1TPZA 1XCLA 3R5CA 2DKNA 3ZBQA 1P5ZB 5FQOA 3ZHTA 3HYCA 2XRMA 3O3CA 5EJ6A 4Q39A 1KA9H 5IF3A 1GNTA 2ADFA 2AL7A 3QVJA 1V39A 4UCQA 4ALLA 3YASA 4J03A 4FD2A 1OAAA 1HDIA 1W4RA 3I3OA 4KQCA 7ABPA 2IOHA 1JDPA 2K2QB 1X80A 3LLSA 3UK7A 2IDJA 3JSXA 4LJKA 4PPGA 1RI1A 5GM2A 4F97A 3AEYA 3GNTA 1WXXA 4KQ9A 4C4ZA 3NVKI 1JS1X 2O8EA 2Q3MA 3WQRA 1NZJA 1OXVA 2YN4A 3IQEA 3TK8A 3FH0A 1DADA 2JJ1D 3MF4A 3OIFA 2P6MA 3P2MA 4DNFA 3BD7A 3A9TA 3MGBA 3SS7X 1ZCZA 3VNRA 5C4IA 2J7KA 3ADDA 2W0WA 4UDOA 3MT9A 1HKHA 2ZB4A 1D4OA 2RHJA 2NN3C 3R3YA 5KNCH 3F67A 4WLOA 3H2GA 2B36A 4W7IA 5TLSA 2QTHA 2CLCX 4C7OB 1D0SA 3CUUA 1YS9A 1R3UA 3MGKA 5FO1A 1H6AA 3VU1A 2WTNA 2NT3A 2PRJA 1CJSA 4U7TB 4DV6B 2W70A 4D8WA 3L43A 1GNSA 3JYNA 2WC1A 2G8NA 3QV1A 3H3FA 4O4JF 4CI9A 4ZQEA 3HNRA 2BD0A 1GSIA 4D4LA 5ICCA 4ZZ1A 3P52A 5K03A 4OLFA 3LY9A 5IM4A 3VNUA 1XRLA 1XROA 1E69A 3BH7A 2FG6C 3PC6A 4Y2GA 2QPLA 1F8YA 3GEHA 1UINA 2PGNA 4EPTA 1JRLA 2VRWA 3DJYA 3HKDB 4AKEA 4LSGA 4JBIA 1W36D 1D8TA 1EFVB 4I4TF 3X1ZA 1QYWA 2A0KA 1IBSA 3RLIA 3LBHA 4A0HA 4BNIA 5TJHA 3EIOA 3GJQA 3VKGA 4MUGA 4GXNA 2QTVB 3C15C 4LMBA 4U2EA 2G9NA 2IYRA 4L72A 1DJMA 4FBMA 2B83A 5JC1A 2FGJA 1H3NA 3ZE6A 5CEEA 3OOWA 3OPYA 2GCEA 1UUFA 4F1WA 3EOAI 1L5LA 3EBOA 4XQ9A 4B31A 4G1EB 1UF9A 1P3Y1 2PCLA 1OYVA 4LZAA 5HR5A 5DYWA 2YOGA 1Z8DA 2EJVA 4MHSA 4Z49A 5TE9A 2WWTA 4MPDA 5AJWA 4GF5A 1NOKA 4B76A 1E1DA 1JG4A 3Q7TA 1MB2A 1ZUIA 2QM7A 4FB4A 5C4MA 1RAGA 2V7BA 3FHJA 2RK6A 4WK0B 1FDTA 4PV7A 2QYHA 1DCTA 2HADA 1UFKA 2HY7A 4MRSA 1ZU5A 2VP9A 3BIFA 1N6NA 4PIPA 4B3JA 4YQYA 4D5EA 2OZPA 2BFEB 3DZGA 1B0ZA 1E89A 2ZYAA 2JKZA 5ILGA 2OFWA 2G4CA 2OOKA 2R1ZA 3AP3A 2TSYB 2QRVB 3SHOA 4WGGA 2DE0X 3G6KA 2O7QA 3FBTA 4MMYB 1ZS9A 2AZDA 1O89A 4JWTA 5GMOA 3DWFA 2P9EA 4FKBA 3VO2A 3AI7A 3WLFA 1DIAA 2FFAA 4Q3OA 1XZHA 4JKIA 3WOVA 4S1OA 4WGFA 5E38A 1UK7A 2QLNA 1K9SA 4M1EA 1KDZA 3BHIA 3TSCA 4A0QA 2P1RA 4K6HA 5AVVA 1U3VA 2G36A 2CBZA 1RR6A 1HFEL 4BFUA 1MRNA 1WWKA 2XUGA 3D54D 2I7TA 4CM9D 5DHFA 1ZAKA 2ZRPA 4W99A 5AI6A 4DZRA 2BFDA 2CHEA 2YV5A 3Q5EA 5BQ5A 4CR8A 5KYYA 2X6TA 3QVOA 4KXLA 5CTAA 1JEJA 1G5HA 3AWIA 1AUPA 2BVNA 3IP3A 1TQ4A 2EKPA 3FSRA 4AP9A 1Z36A 2JG3A 1SOVA 2QU8A 4F3TA 1XG5A 3VDQA 4R98A 2YWDA 1Q3HA 3B13B 3RS5A 3SOZA 3ZEAA 4AZ3B 2AKEA 3R9WA 3NYQA 3ZTTA 3NT5A 2PMWB 3KXIA 5A0TA 1WHTB 1TYEB 3RVOA 2V59A 3LLVA 5E9WA 1WZUA 5CD9A 1EX7A 3ZCVA 3CRRA 1JL3A 2H1RA 2NACA 4XPIA 1NUQA 4ZAXA 1P2VA 1CJBA 4UU1A 5ALWA 3LKZA 5EEGA 3HCBA 1ZWKA 1BWSA 1ZUWA 1KSGA 5AI8A 4ESEA 3Q8LA 1LLDA 2JAHA 1W29A 4LHZA 1T8UA 4CQLA 3FSJX 4IJQA 1J0CA 4YROA 4WOBA 2ZJ8A 3D64A 2B6NA 1CE8B 1QQ5A 4A0FA 4LZZA 1II8A 2IF2A 1B41A 3JWIA 2PZMA 4D4JA 3KXKA 1RFGE 1T4GA 2X0EA 4JLMA 3UGTA 4M89A 2FNAA 2ECKA 2FEKA 2PX5A 1QZ3A 5GONF 5DI3B 3LCRA 2OG2A 2WYHA 4QO8A 4UDNA 1DZ3A 2WF5A 2OY0A 1JAIA 3GPDG 3O4IA 4J1SA 3ILVA 4KWIA 2PD3A 4W6QA 4YRDA 3T12A 4IOMA 3VSCA 3ZZNA 3O8QA 2OBYA 2VWGA 1VL6A 2VPYA 2ZIXA 3AF4A 3IAUA 2EFJA 3ESCA 4CIAA 2X8BA 2FPLA 3ET5A 4FR5A 2BONA 3M1AA 4RIIA 4Y3UA 1Q1GA 1NVMB 3LFHA 3MOIA 4MV6A 8MHTA 3OEYA 4RA6A 2B9VA 2QMYA 4FPXA 1TEVA 2ZTMA 3ELUA 4F84A 3LLCA 4G89A 4DLYA 5AK3A 4CQMA 2J6HA 4IDQA 4EPYA 5JU6A 1KFKB 2H52A 5BR4A 5AKKA 3IDAA 1JG6A 5G41A 5M3BA 1E1CB 2PLNA 2WDPA 4NHEA 3WXBA 1WUJS 4IEEA 1XKTA 3LYAA 5LQJA 2P35A 3RREA 2GCGA 1CQJB 5CUQA 2E7ZA 3TVYA 4F8EA 2G80A 1M66A 4AW9A 2EP7A 3R3IA 2WYVA 2YS6A 3OAAD 2BGNA 1L4NA 4GLFA 1XRQA 4L0MA 3F5FA 4P7GA 2VHXA 3JQBA 4XYBA 1O9HA 2DFKB 4MRAA 3PQ7A 3S8YA 1OVGA 2E1RA 7MHTA 5LMZA 3H2BA 1GKIA 3W8NA 3OQOA 1SIBE 2NQ8A 2OK7A 2D0OB 3E27A 3KVYA 4HDAA 4DMHA 4EFMA 1YE5A 3JAMA 2XZLA 2OBLA 5AKLA 4OXIA 3S2YA 1M6WA 4TPKA 2XVXA 1DIGA 2ZKIA 3VZBA 3N7UA 3MOGA 3ACDA 3QHQA 3THWA 4XB6B 4AF7A 1RLOA 2D1SA 1KZ6A 1MD9A 2FPXA 3VDRA 3NGMA 4BO9A 4E51A 4JX9A 3TRKA 4ZDJA 3AIIA 2FKAA 2AD1A 1NPDA 2FZEA 1E1RA 3B78A 3UN1A 5CD1A 1U5BB 3JAWB 1F6WA 2W2OA 3EC7A 3CA8A 3ELDA 4LYDA 3LBAA 4XDGA 4RZUA 3DBRA 3FOZA 4PO1A 5LDGA 5FOXA 4PTZA 3L8YA 2CE2X 4RHUA 5IVPA 5DEPA 2IC5A 3U61B 1QGZA 2UVPA 2ZJOA 3DDUA 2ZJAA 2ZXUA 1DO0A 3WB9A 4UMFA 1WABA 5I9TA 3E48A 4OQZA 3KYBA 3FROA 4MVXA 1QGAA 1E7RA 4PR0A 2YY5A 2VWPA 1AE1A 1YQGA 4P22A 3WNZA 3MAJA 1IN4A 4CFZA 3A6EA 2D0PB 4I14A 4FQ5A 4AULA 1H4SA 3VYUB 3BIXA 3P9SA 1IQUA 2Q99A 1OVMA 1JKJA 1U8YA 2C3PA 2QU7A 4LOJA 2EHDA 2JVIA 3V1UA 4AP5A 4C0SA 1SHLA 2NZ2A 3NYIA 4LV6A 3EUAA 4QPZA 4X6XA 4BBPA 5JI2E 3G88A 4K05A 1DGQA 4ENVA 4AY3A 1F4PA 4OXKA 3VHXB 1FMTA 4ZU1X 3SZ3A 1VBKA 5BNZA 3ANLA 2YW9A 5JSZB 1VSUA 4KR6A 2VTBA 2EC5A 4EZIA 5JZOA 4WXEA 1C7JA 3QVVA 1SHUX 2V6GA 1PNRA 3W0LB 1ZVJA 4NTZA 1ZQ1A 1ZSYA 3AI1A 3TZQA 2CFTA 1QFYA 2J32A 1PFUA 4RCVA 1WHSA 1W7AA 3ORRA 4IGKA 3K8OE 3IYLW 3WHPA 3ZOZA 3VZQA 2P3QA 2YV3A 5FULA 5HZMA 2WMOB 4QDTA 1N0IA 2LCQA 2VHEA 2IP1A 4CEIA 3IMEA 3NDRA 1ECFA 2O7SA 3LO8A 1U1CA 1QGYA 3UQZA 2ONJA 4C3OB 1EDZA 1NXXA 2DB3A 1GNPA 5FWDA 1L9KA 2AQ8A 3WGMA 3K2EA 4HX2A 4FFDA 3TSOA 5BN5B 5CW1A 3SC4A 3ZQUA 1KYIA 1YQXA 2FW1A 3FWNA 4I3GA 3EZ2A 4K9OA 5TNXA 4CG3A 3WRYC 2PQ0A 2RIJA 2PHZA 2NTEA 3U4QB 2ZUEA 3INGA 3DTVD 1T6ZA 4JMLA 1R0WA 4QVGA 1JLMA 1PAUA 3LG2A 3ROFA 3S2ZA 5LLTA 3MW8A 1XTPA 3DZDA 4BX8A 2R6GA 3L79A 2QAGA 1ZJ4A 2IF0A 5EYPB 4R54A 3TISA 3Q6NA 1I2ZA 6NULA 1AGPA 1GEEA 4EJSC 4QA9A 4IUCS 4AS2A 2ST1A 4AXBA 5AVRA 4IIEA 2R00C 2XT6A 4B47A 3M1YA 3PPVA 3L9XA 3OW5A 2V5AA 3VPSA 3ZNPA 1UPXA 4KYIB 2WLGA 1XCMA 2PX2A 3SC2B 4Q21A 3FWPA 3LWZA 3JZDA 1L4UA 1JVBA 1VE6A 2ZBVA 1WW3A 2FEOA 3D6JA 3NTOA 1QFMA 4GECA 5D87A 3P9YA 4BFLA 3M49A 4JB8A 3OZCA 3DONA 3G2HA 3RVPA 4PPFA 4C0HA 1CQPA 4FFWA 3NOVA 4X20A 4HUQA 2AN5A 1M1NB 1PW5A 2JJ1A 4JNCA 5A5GA 5HP4A 4NFLA 4RK1A 3KKOA 4CM4A 2IUTA 5E3RA 3OZFA 2XADA 5LOVB 3C8UA 1E61A 5D3MB 3GLIB 1FU7A 1PDOA 2BZSA 3AERA 3TM4A 4TV9F 3OLZA 3X1YA 1NC1A 4LOIA 4J16A 1A71A 2XOEA 4R0MA 2B25A 4EAQA 1NFFA 2UUCB 3GLUA 1Q77A 4FGLA 3KWCA 2PTHA 3AO0B 5DM0A 2GO7A 5K6AA 3H9EO 3IHLA 5AKXA 1WB6A 3OECA 4ZK2A 3DV9A 2FB9A 2QXTA 2WAXA 2PM8A 3KT0A 4I9NA 1BXZA 4F9GA 4DC0A 3NV9A 2YDXA 5HKKD 1L7DA 4RZ2A 2DCMA 1ZD4A 4DT1B 2IOQA 3NHJA 4KX5A 4LRXA 3GFSA 3OH0A 2P6PA 4LXQA 4OYRA 4PFQA 1JDVA 2R6AA 2VHTA 5DNDA 4JOBA 3ZW7A 3KXPA 4CLRA 1EK6A 1BVUA 2P41A 3BA1A 4LBWA 2YMMA 5AVJA 4CF6A 1ZITA 1RKVA 1UZUA 2F17A 1EINA 4KMMA 3TD6A 2IU8A 1JMYA 3WYEA 2BP7A 4EFKA 2D5LA 1YMUA 1ZVMA 2D5IA 2RJ3A 1W4ZA 1RVDA 2Q6OA 3MVEA 3RU2A 2QM0A 2NW6A 4R69A 1VE9A 4BNMA 4I1VA 1NNSA 4RGVA 1ZK2A 5DCWA 5DXJA 3ZE9A 2WUDA 3EGXA 4LJ6A 3BF8A 3V42A 3DOUA 3GJ0A 3VJKA 1R5JA 3DBIA 4LIPD 1YBFA 4TTAA 3HZZA 1WDWB 3ZBUA 4OU4A 4AUNA 3D4BA 1V3VA 1CJCA 4P31A 4JI4B 2OQVA 2OEGA 3DL0A 5LA6B 1GGJA 1O08A 5J2TA 3O47A 1KYVA 4RZSA 3MLBA 1JQEA 3HUEA 3PDHA 4Z86A 3V3TA 2FZLA 4CMGA 3OTOB 1BW9B 2RGWA 4MVJF 4P9NA 1QF9A 2WHPB 2YNMC 3PJEA 3LWNA 1OWMA 2GAOA 5JOQA 3EZ7A 3IOEA 3PNMA 5K1ZA 4H08A 4BFZA 4JQOA 1G2PA 3LIIA 2IUUA 2DUJA 1XN1A 2E9SA 3P9ZA 4BBZA 5BPFA 5K99A 5DWVA 1UEIA 3RFVA 1DEOA 4HAZA 2D7DA 4H3HB 5HOEA 2CDCA 2BGIA 3KWJA 3Q6MA 1WEHA 3TLCA 2X0KA 3OT1A 4KQLA 1PWHA 3P9KA 4G0YA 4QPDA 3R7LA 2HZBA 3L8EA 4D74A 3IBFA 1T0PA 1V7ZA 3FGZA 3TTWA 2J9GA 4E32A 1IZ9A 3P9PA 5CB8A 4AFNA 3E9CA 3QQ5A 4XUDA 3LHSA 3C1TA 3PCRB 1R64A 2O05A 3ZJYA 4CM9A 3TRFA 5JBQA 3PYLA 1CZHA 2J6CA 2WE8A 1PBNA 2Z4TA 4ZVKA 2CXUA 2G9VA 3IELA 1G3IA 1K06A 4CGZA 5CPFA 1FXSA 1YJXA 5DO9A 4BP9A 5KWSA 2I4RA 1EVZA 1HYQA 2JFZA 2PJUA 1FSGA 1E3JA 1MP0A 5TS2A 3NWOA 2PL9A 3FYHA 1T0BA 2XQJA 1Z4MA 2WU4A 4XGNA 1HV8A 1YR8A 3LWDA 1Q7BA 2WFLA 5HILA 2JCBA 4YUVA 4BLVA 1NP6A 3KUDA 2O1EA 4LNAA 1OAOA 1JUDA 3UAOA 2DHEA 2GYYA 4FFBA 1U7XA 1WUIS 1XHEA 4XARA 4HVCA 2RGGA 3TR0A 1XPJA 1ZMXA 1Q7GA 5FD8A 3KSAC 1QTQA 1Z6XA 2PY6A 2QORA 1ZNQO 4LWQA 2R25B 2EKZA 1QC5A 4RU1A 3STVA 4TYYA 3TAHA 4B34A 5F51A 4ALJA 1L3IA 1LRJA 3HLTA 2ZSIA 1PSZA 2YIDA 4GU5A 3IJEB 4HC4A 5ALYA 4XDYA 1NULA 2DBVO 2ANBA 4XQ0A 4ZT6A 1ESMA 1IATA 4ER3A 1D2MA 4UVIA 2XGJA 1O9GA 1ZXXA 2IYTA 1KRXA 1Z2OX 4RSHA 2CNWA 3CO0S 4DW8A 3QE9Y 4JBYA 1SKYB 2FEMA 4HH1A 2JHGA 4L5BA 4L4XA 3GC6A 4WUVA 1WOMA 3LPDA 4FD3A 3SMVA 5FPQA 3GLIE 1XTUA 1X8KA 5AM3A 4BFVA 2JH8A 3BWXA 1MIHA 4URUR 4A6XA 2G0NA 4ZT4A 1GKYA 1B2LA 2C1EA 1C7ZA 1HE1C 3GQ9A 2XMCA 2QP3A 3E4CA 4ZOLB 1WZ2A 2ZRDA 2CV2A 2CJYA 2X7HA 4F0JA 4AECA 2SHKA 3ABIA 1V8DA 3CJQA 3ORQA 2O50A 5EXSA 1H5QA 2HQBA 5T3UA 1Z45A 2WDZA 1SU6A 3FA2A 1ZDMA 5DBGA 4UDXX 3K0KA 1XP5A 3GPCA 4OHPA 1XC7A 3EEYA 1PZNA 5DV9A 3TEFA 4DLSA 1YRYE 2EKBA 2MR6A 4UHHA 2PMEA 5BWOA 5JD3A 4V03A 1O4WA 2NZYA 1U2GA 4KXUA 3E35A 1FP1D 1JB9A 2P8SA 1GPUA 2YY7A 4EYSA 3N5CA 1D9XA 1O77A 3H17A 3HJBA 3O1IC 1AU9A 2VNJA 4OQLA 1KAHA 4BGUA 5HIKA 5LIRA 2OGZA 3OAAA 3W5UA 2ES4A 3EG5A 4HMOA 1QCCA 3AEXA 3ZE8A 1IBCA 4UQPA 4CKCB 4UBJA 2FFHA 2V7EA 5AUQA 3V1NA 3M2TA 2J9ZB 4FCCA 1E20A 2V0CA 1G0NA 4ZQBA 4OQYA 4QYSA 1KEKA 3V32A 1VSTA 1V45E 1WDKA 3CF0A 4RD2A 3RVMA 3W9BA 1NVFA 1W8DA 1DT5A 1EE2A 3H83A 3LVQE 3HI6A 5ERXA 2G1JA 4OKIA 3IMKA 3LXMA 3D6MA 2YICA 2QR3A 5IEBA 1EJBA 4MHOA 4V1CA 2D5CA 5A5DA 2CNNA 5CFOA 1XAIA 4W5RA 1YKFA 2W6JD 3G1TA 3ZYCA 2IHYA 3MLEA 3C39A 4FWIB 5FDFA 5JQGB 2PA3A 3FLEA 5THKA 4PZZA 4LNUA 4WACA 2QENA 2QSUA 2DHDA 1PWZA 3S40A 4BO6A 4TL7A 2PUCA 2EZ4A 3MRTA 3QPDA 4QRDA 2AOVA 1NV8A 2GKGA 1JHZA 1U2QA 1KPIA 4HFJA 4JLBA 3I6MA 4MI6A 4UNPA 4DCPA 1U2SA 4B0OA 1Z4QA 2C3MA 2K6GA 1XNQB 3N8GA 3PFIA 4L07A 4Z53A 3OQVA 4OLBA 2BTQA 4GI5A 1G3RA 3JVVA 4QBHA 3I32A 3AVWA 3JQPA 1LVHA 1YAJA 4ZRDA 3EVFA 1RQLA 3OMXA 4GI2A 1II0A 4S0ZA 5EQJB 1XR3A 4DYDA 2BTEA 1GXSB 4IOKA 4D92A 2VP5A 4WFIA 3UMRA 3T5CA 2XCIA 3RASA 5HQ3B 4REQB 2PGOA 4GQBA 5ERGB 4CCWA 3PXEA 3IP6A 4G2TA 4P8RA 4ZJUA 1QOZA 1UBEA 1ZW6A 2I76A 3NTQA 4O0MA 1MB3A 1XDUA 4WKCA 1KRHA 3JCZA 4NU5A 4F3CA 2QVXX 5CDHA 2HO5A 3CINA 4C5BA 4AJIA 4MV1A 4ND8A 4N48A 1MA0A 1TIBA 2KJQA 2VLBA 5KOHB 4UPVA 3DDNA 1HYHA 2XLCA 4RTKA 4NJOA 3M6WA 5EG5A 2ON6A 2PH5A 3I64A 1ZVVA 2Y77A 1U0OC 2V4MA 2YVAA 1MR9A 1PQYA 3QE0A 3IQIX 2IPXA 2FSVA 1X7ZB 3IUPA 1PQUA 2X0NA 3EZXA 4YO7A 3SSMA 5L3QA 1BU5A 5DU2A 4EHNA 1NM5C 4HVTA 3WGTA 4HGPA 3KXDA 1Z38A 3C4VA 2PXAA 3NHKA 5F4ZA 1F8XA 4H17A 1RKQA 2ZRIA 1DKPA 5FBVB 3S1SA 1FIUA 4J2HA 1K7FB 2C8LA 2ODAA 3O3MB 3NUQA 4EF4A 1QPGA 4F1KA 2J67A 1V16A 3RAPR 3WY9A 2WNIA 3DTVA 1F5SA 1H22A 5A3SA 3JQ7B 2ID4A 3QKSA 2XVYA 2JBWA 3BH6A 3ETCA 5NLLA 3KD3A 4HXGA 3O1LA 2FGKA 2BRUC 1THGA 2JFNA 5A06A 1PG0A 1NW6A 2PWBA 2RBEA 4ESOA 4EW1A 1VCNA 4JXZA 2PWAA 4L57A 4EO9A 2VFAA 3FUCA 5AM2A 4RNDB 1LJLA 4YC7A 4YLGA 4W5HA 3EXEB 4JUFA 3IJRA 1V1RA 1RWNA 2XQVA 5EE0A 2J30A 1QM5A 2QTCA 3OZDA 3BH0A