4M98A

Acetyltransferase domain of pglb from neisseria gonorrhoeae fa1090
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
205
structure length
205
Chain Sequence
NRKLAVIGAGGHGKVVAELAAALGTYGEIVFLDDRTQGSVNGFPVIGTTLLLENSLSPEQFDITVAVGNNRIRRQITENAAALGFKLPVLIHPDATVSPSAIIGQGSVVMAKAVVQAGSVLKDGVIVNTAATVDHDCLLDAFVHISPGAHLSGNTRIGEESRIGTGACSRQQTTVGSGVTAGAGAVIVCDIPDGMTVAGNPAKPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical analysis and structure determination of bacterial acetyltransferases responsible for the biosynthesis of UDP-N,N'-diacetylbacillosamine.
pubmed doi rcsb
source organism Neisseria gonorrhoeae
molecule tags Transferase
molecule keywords Pilin glycosylation protein
total genus 72
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2013-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17836 PglD_N PglD N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4m98A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m98A01
2GLTA 2IP4A 3NZ2A 2V0LA 1G95A 3R1WA 4RZQA 4M99A 3P47A 4J09A 2PN1A 4MA5A 3F1XA 1KJQA 3ST8A 1T3DA 4MV1A 1EZ1A 1SSTA 3R5AA 3ORRA 1KQAA 3ETHA 2R7LA 3K5HA 3RFCA 1KGTA 3SRTA 4MV8A 1FWYA 3PMOA 1B6RA 3R0SA 1DV2A 2ZDHA 3E5NA 4DCLA 3VPBA 5C1PA 1EYZA 1HV9A 1QRLA 2WLCA 4EQYA 1I7LA 3VBMA 3R23A 3KWDA 4EGJA 3I3XA 4HNVA 4E75A 3VNPA 2FB9A 3TV0A 1UC9A 1M6VA 2R7KA 2VPQA 1PX2A 5K2MA 3VA7A 3BSWA 2YYAA 2OI6A 3R5CA 2YZNA 1YP4A 3R5HA 2R87A 3EH0A 4MFGA 3WO1A 5ADXU 1HM8A 4QSHA 5I47A 3TWDA 3CJ8A 2W6ZA 3TK8A 2I80A 3R5BA 4MV9A 4EGGA 4HZCA 1C30A 1GSHA 3V4SA 3OTMA 3N8DA 1QRFA 1A9XA 5L6SA 3MC4A 2XCLA 4R7PA 4MA0A 5DEMA 2W6NA 1KK4A 2TDTA 2GPSA 5AFUU 4IHGA 5F42A 4HZDA 3Q1KA 3G8DA 1YP2A 3R8YA 3TW6A 3OTZA 2W6OA 4HURA 3BFPA 2W0VA 4HCQA 4IWXA 1T36A 2WLDA 3VBNA 2GPWA 4EA9A 1E4EB 1KJJA 1KRUA 1AUXA 3VMMA 3ECTA 4DLKA 4G3SA 3VPCA 5AFUV 3VBLA 1OCXA 2ZDGA 2RIJA 2WLFA 1DV1A 1XATA 4HR7A 1BNCA 4ZQIA 2GGOA 2YZMA 2YRXA 3JZIA 5DMXA 4E79A 1KJIA 4DIMA 3FWWA 3FSYA 3R5FA 3FTTA 3WNZA 5C1OA 5E3PA 3VOTA 3VBIA 3MQHA 1V67A 2W6MA 1KRVA 2WLEA 4FU0A 3C8VA 1CE8A 3DK5A 5JQWA 4M9CA 1EHIA 1I7NA 2DZDA 1QRGA 4N69A 1ULZA 4KNRA 2I87A 5DG3A 2QF7A 4IHFA 3SPTA 2IUAA 4EAAA 3EG4A 5DEPA 3DHOA 1KRRA 4KPZA 4R37A 3OUUA 1KEEA 4ISXA 3KWCA 2W0WA 1XHDA 2W6PA 3I3AA 2R84A 4MV3A 3I12A 4MV7A 3TISA 3EEVA 4KPXA 2ICYA 2AQ9A 2I8CA 3BXYA 4MV6A 4M98A 2VR1A 3LP8A 1B6SA 4AC3A 5ADXV 3RV4A 1YP3A 1CS0A 1MR7A 4MZUA 2V5AA 1E4EA 2YS6A 1HM9A 3HB9A 3Q1XA 4E6TA 3VBPA 4M2AA 1QRMA 3OW5A 3JQYA 3R3IA 2VHEA 2Q4JA 4E4TA 1MR9A 3D8VA 5H80A 4EGQA 3BSYA 2OEFA 4AA7A 2PVPA 3TDTA 4KNXA 3HO8A 2V59A 2V0IA 2YZGA 5E3RA 1BXRA 2VQDA 3FSXA 2R7MA 4K6RA 4N6AA 2QKXA 4EABA 2R7NA 3FSCA 3GUEA 2FKOA 4N6BA 4IWYA 1KK6A 3BSSA 4J6EA 3GVDA 1AUVA 3U9SA 3HBLA 4E6UA 4G3PA 3Q2OA 4G87A 3RUPA 3AX6A 3KWEA 4AAWA 3LWBA 4M2BA 3ETJA 1FXJA 3BRKX 2OEGA 3N6RA 1LXAA 1TDTA 4HUSA 2CZGA 1G97A 2YW2A 4E1KA 1UC8A 4L1KA 4ME6A 4C5CA 3OUPA 1QREA 3V4EA 1VKZA 3VPDA 2IU8A 3OUZA 1JDBB 4IZOA 3TIOA 2ICXA 5BPFA 2C00A 2XD4A 2DLNA 3SE7A 3MQGA 2R86A 4EA7A 3R3RA 4HNTA 3VBJA 4G3QA 1KJ9A 2ZDQA 4WD3A 2V0HA 3DJ4A 1V3WA 4M9UA 5D8DA 3TQTA 2V0KA 3VBKA 3MJFA 3R5XA 1QQ0A 3P1BA 2W6QA 4M28A 4H7OA 3IXCA 4MV4A 2IC7A 3V4ZA 1KJ8A 2OI5A 2NPOA 3T57A 2OI7A 1IOVA 2Z04A 3U9TA 2IU9A 2YRWA 1GSAA 3FSBA 2W71A 4MAMA 3QFFA 4EA8A 3FS8A 3BG5A 3R2WA 2J9GA 4C5AA 2PBZA 4KQLA 3ORQA 4HNUA 3R5DA 3WO0A 3K5IA 1THJA 4IHHA 1IOWA 4EG0A 3AW8A 2P0AA 2I5KA 1C3OA 2P2OA 5U2KA 2VD4A 5L6VA 3HJJA 1SSMA 4MYOA 2JF3A 4J18A 3G8CA 2QIAA 1S80A 1KHRA 5BPHA 1PK8A 3GOSA 4R36A 3HSQA 3JZFA 1KK5A 2V0JA 2YS7A 4GGMX 3FOQA 3RV3A 3OU9A 4C5BA 5E3QA 2W70A 3IGJA 1J2ZA 1HM0A 1GSOA 2XATA 2DWCA 4N27A 2WLGA 2V58A 2JF2A 1GLVA 1Z90A 3D98A 1SSQA 2QIVX 4FCEA 2GGQA 1MRLA 1KGQA 2R85A 2QK4A 3K3PA
chains in the Genus database with same CATH superfamily
3GZ4A 4ECEA 4E94A 1Z2DA 1B0PA 2JH3A 1MABB 4X8HA 4EFKA 3ZOZA 4CQJA 1HMPA 1NI4B 4DLAA 3P47A 4AZSA 3HCDA 4UBIA 3ND5A 1LVGA 4EG6A 3DS8A 3SYLA 3G2KA 3Q3IA 5AOVA 2R11A 1J24A 4F9EA 5C4MA 3BGWA 3FPKA 2WOOA 4YI5A 3K9QO 3V48A 1OROA 3VHRA 5AI9A 3ZD7A 1Q20A 2CXXA 2XWBF 1HQCA 1YR9A 2QRZA 3PXXA 4YT5A 5HRCA 3OM0A 3E53A 1RZVA 3VPSA 4AN1A 1D2RA 2DG2A 4CEIB 4ZYVA 1FUUA 4YYZA 3G2OA 3M4XA 3MIZA 1RDFA 4G0ZA 4RIHA 2I4RA 2PX6A 1LC0A 2WHQA 1MJFA 1V1MB 3N7UA 3LTEA 4FFMA 1JRLA 4I08A 4X1YB 4E3WA 4LF5B 5B12A 3LSTA 1LBHA 1D2MA 3ETHA 1L4NA 1N0UA 1K5HA 4F56A 1MVOA 1PJLA 3B13B 4LJSA 4C2UA 1NYTA 2FPPB 2ZRAA 3SRTA 1EGHA 1JWAB 2J67A 4A91A 1R6UA 2IZZA 1E0DA 1KSFX 1UM8A 1SH7A 2Y0CA 5G0UA 5DHQA 3Q7SA 3ED1A 2ZANA 4J1TC 5TE9A 3IRUA 2WLCA 2IIVA 3FYUC 2BFNA 1QUFA 4I6EA 5E3JA 3LYAA 4M55A 4B87A 4DR7B 3S1AB 3HU2A 1KVSA 2EYUA 2HCJB 4DMRA 5JD6A 2R5NA 4F8EA 3CBQA 4X1YA 2FZ4A 4K9NA 4LRSB 3VPFA 1E9DA 3ELBA 5BRAA 2CJXA 3PXAA 4PAOA 2FWAA 2H1SA 2GA8A 1VYTA 3AHGA 1D4OA 3KLPX 4LYFA 4KWHA 1I5EA 1KZ1A 4CKWB 4PTZA 1BH6A 2D1FA 2OXCA 4J1QA 4X92A 2C58A 1W1UA 3CEHA 4K9DA 1SXGA 3ZWDA 3MWEB 2ODAA 1DIHA 4UHDA 3ZXXA 4QT4A 4WMLA 4WT7A 1SG9A 2BRUA 2JGIA 3EMVA 3GLQA 3IDFA 4I14A 3ILSA 5HBGA 4CFYA 5BMVB 3B9PA 3HQ4O 2HC9A 3LIIA 1PSZA 2X1HA 3NALA 4YCJA 3ZNPA 1YC5A 3NT2A 1XOIA 2FCRA 4MUGA 3FD8A 4PCLA 2H17A 1N2BA 1QWOA 1U7HA 3WRYC 1YMVA 4NDZA 1NU8A 1G18A 3U3OA 1RXWA 2JLVA 2Z5FA 2IXDA 1LXCA 1FTNA 2DWPA 2BHTA 5H5JA 2AKEA 2C3PA 5JXJA 4CHGA 4J7UA 2G06A 3R41A 2GVDC 2Y66A 3SXUB 1R0XA 4M8NE 3LXUX 3K20A 5BQ5A 4NMHA 5AUQA 3L0ZA 4ZV9A 1EFKA 3D8BA 4LRWA 4ASUD 3AV3A 3NDBB 1SWWA 4TV8B 1FMJA 2HT6A 4P32A 1ECJA 2D7CA 1H4TA 4L0DA 1RTTA 3ZV4A 1LBQA 4C6TA 4OAOA 4YWHA 1UPAA 1XWIA 2HO4A 2YWHA 2UKDA 3E18A 3JAWB 3QXSA 4OK6A 1TU0A 2RIPA 3MC4A 2YXEA 5CH8A 3ZK8A 4B6PA 3RLIA 3SX2A 3FZEA 4X8LA 3AZQA 3IPYA 1SUFA 4P7JA 2WBLC 3O3CA 1U0NA 2P6OA 1UDWA 4F2PA 4DM7A 4C4ZA 1YR2A 2WYHA 1HC7A 5AFUU 3H8SA 1NTOA 1QHHA 4RLQA 2KLBA 4ZYXA 2JLSA 3UF0A 1IXKA 1XX6A 3G8DA 2O2IA 4ILEA 3SJCA 1TVEA 2LE0A 3R7SA 2FZWA 3WJ7A 3J81A 2G76A 2QDXA 1B41A 5C53B 1CUSA 1CSEE 5KTSA 2GZHA 3TW6A 1VGRA 4BGIA 4OQDA 2JANA 1G8GA 4PBRA 3RTAA 1B76A 4QG3A 1Z5GA 1B8NA 3FNGA 1RSZA 1JXAA 1M75A 2LBPA 3WL6A 4II2A 4DMLA 1S7CA 1E3EA 1TQHA 4DLPA 3PCXA 3BDVA 2D2FA 3P96A 2GPWA 3M6MD 1K27A 2XW6A 3DMYA 3PU6A 4CR7A 2VH1A 4QODA 1OH6A 4JLNA 3TIXB 2G0AA 1E6CA 5JZVA 4UW9A 2ZM6B 1P0FA 3KE8A 5TXGA 1AF4A 1JVSA 1ZNXA 2P2SA 4G3SA 3EGEA 4B2YA 4TQAA 1E6MA 1ODTC 5M34A 1GFIA 3JYLA 2G9ZA 4D0NA 3GEIA 4GS5A 3TMKA 4GOMD 4PV7A 1TEZA 4IPTA 4ZTBA 4DLTA 3OC0A 1GPWB 1ML3A 2GN1A 2HGZA 1AGNA 3GAMA 2EARA 3QVKA 4CIDA 4DBZA 3HVKA 5BQPA 1UM9A 4D0SA 4KB5A 2IS4A 4H7EA 3D54D 1M54A 4U7DA 1HLPA 5JCJD 3V8QA 3G7UA 4D8VA 3P9IA 4C0WA 3GRCA 4ZAWA 2YQ5A 3PP8A 3SIWA 5FHQA 3UT5A 2FE4A 1L5ZA 4OQYA 3ZDYB 2P11A 1XSEA 4FWIB 4TRJA 5L3VA 2XB9A 2O4UX 3TIIA 3I53A 2ECPA 1O9HA 4MUEA 3EF3A 2PBFA 3C3DA 4EP1A 3HN6A 4ZWNA 2JGDB 1JDBC 1Q1BA 3HNRA 3H4TA 2CGEA 3CZ4A 3PC7A 4MKIA 4TWIA 1C8LA 5EMLA 4BNVA 3AGPA 1FLDA 4FB4A 4OXQA 1XD8A 4LFAB 4OJMX 4PGFA 4Y6SA 3RWOA 5IHXA 4N40A 4PG7A 1Z63A 3THOA 4BGVA 3WA6A 1PIWA 2HD4A 1U31A 1TFRA 4IIUA 3VR4A 3C41J 3MBIA 2C96A 3ZXYA 5LQMA 2W2KB 5TB5A 2BGNA 1WHSB 3C3JA 3CYFA 4LXIA 3RJTA 1DC3A 4WFIA 3BIWA 3B9RA 1AKUA 3QKWA 4QU8A 1EE9A 1TD1A 1ZJ6A 2BM0A 1K8RA 5EJEA 1F48A 5A9SA 3UMRA 5I45A 4G9BA 5I7SA 1VOTA 3LLSA 2XRMA 1YVDA 4GGPA 2ZR7A 1FZQA 1GZSA 1I4EB 3CSDA 4RGVA 4I9FA 5GONA 1FPMA 3G1TA 3RC3A 4KPZA 4MWBA 2JFFA 3CCBA 1ABFA 4G26A 4HNGA 3W4KA 3FVTA 2JPDA 1AHIA 1KKLA 1O03A 2VJMB 4JBYA 4BKOA 2QMZA 2W6PA 4DLYA 5GZ1A 4MYUA 1APBA 2FXIA 4C76A 3BGIA 3ZWMA 1C0KA 1X92A 4QUGA 3WNCA 1OXVA 1JEQA 1IJEA 3U3MA 1F3OA 4DEVA 2BSXA 4KR2A 1BYUA 1KZ9A 1X1RA 4G89A 4XGRA 2GCEA 3D3QA 4FE7A 3IVAA 1IHPA 1EAYA 1TZKA 3PC8C 4TWAA 1PLJA 3TH5A 5TVKA 5I7HA 1BXGB 1JN0A 3O31A 4LSWA 5TSDA 3GQAA 4DCJA 5EJ8A 5E1DA 5JH7F 4HWOA 2CNKA 2PWYA 3D4PA 4XGNA 2BFBA 4TL6A 3UWMA 2B1IA 4RF4A 1SIWA 1Z0UA 2LIPA 3BHJA 3KR2A 5AM1A 3RRNA 1F4PA 4JC0A 5FAXA 2ZPUA 1N9KA 3OPMA 3OU2A 3OZRA 3TIVA 3UT0A 5L3ZA 1YR8A 2JIMA 1B6TA 4TTVA 4LPSA 2J0VA 3E23A 5DE3A 4ZEXA 4A2QA 1RJEA 3FPJA 4PPNA 4Q4LA 1FSFA 5ALYA 2EWVA 4AZWA 2P65A 3EOZA 1J5XA 1OKKD 2DH6A 1DEOA 2W5UA 3GQBB 1A7AA 4AMGA 3AW9A 4O3FA 1ISHA 3V7YA 1CXZA 4HI0E 1YDEA 3L0CA 5KSZA 1LDGA 2H3HA 2DGDA 2ZRFA 2Q4JA 2QY6A 1QG4A 1U8ZA 2R2GA 4UCWA 1H1DA 2Q4EA 5CUQA 1HRKA 1JW9B 2B5WA 4J4HA 1QOQB 2FJPA 2QT9A 4WUTA 1G3UA 2YOGA 3BMXA 3OHSX 4EELA 4NAHA 3IJ5A 2X40A 2YXBA 3DMDA 4YR9A 1S96A 1IHDA 1THZA 4QO8A 5IM5A 1CQPA 3FYUA 2ZTSA 4FT2A 2YWDA 4QGBA 1HKUA 4BZQA 2V0IA 2ZUDA 3PEUA 4GWLA 2ZUVA 3DT8A 1Z4LA 5F1PA 1KWGA 4C88A 3QUCA 4HGRA 5DHPA 2J32A 4F12A 2X8JB 3S8EA 1AJEA 1R5NA 2CEAA 3NKVA 1LI4A 5IJ9A 5ECYA 4S1VA 3VR5H 4FB5A 3ZBUA 3AR7A 4BEWA 4NAUA 1F0KA 2FUG6 4F72A 5B58C 1OQAA 3RIHA 4BVLA 3G9UA 4UUPA 1YDGA 8AT1A 2CL7X 3CUKA 3D4NA 2AG6A 2NYUA 3DKRA 2GPTA 3NHJA 3TLAA 4FXPA 4F91B 4KGXA 4C0XA 2OV8A 2P4SA 2IU6A 2WB4A 3IUSA 4UAJA 4PG8A 3HI6A 4OM7A 3JQ7B 1T6NA 4IWYA 2CCKA 3UO8B 5CVTA 4MYRA 4EPRA 4QDTA 4AYXA 3CE6A 3NRJA 3ER8A 4D81A 2M6LA 1G1MA 2ET6A 4LJ7A 1EWYA 4B5KA 3WL5A 2BH9A 4MS1B 2VEDA 4B7ZA 2B8EA 2FN3A 4PXSA 4FOOA 1TK2A 1LNQA 3V1LA 2FW0A 4DG8A 5DNUA 1QCCA 3R6GA 2ZRKA 2I2FA 4OKNA 5LYYA 2IKSA 4QOSA 2PYIA 3H42B 4Q3AA 3KWEA 5T57A 1IUOA 5KVQA 3FZQA 3UAZA 1DAIA 5EIHA 2Z8YA 2OEGA 5A3RA 2WUEA 4YP6A 1OOEA 2LKDA 3ZHQA 5K1ZA 2EKQA 2XOKD 1Z45A 1K08A 4PRLA 3VJMA 3HV2A 1JJBA 3W8RA 1JE0A 1NW5A 4R7TA 4IQ4A 1CUYA 1MC5A 2BCEA 4PS0A 5KTYA 4PAMA 2JLBA 1BWPA 2OZLB 3BCUA 3HP7A 3ZJUA 2FSUA 4IOJA 3CUSA 3ND6A 4PX2A 4KUGA 3DKVA 4UREA 2CUTA 4C9BA 4CQMD 2J3JA 1W0JD 2J3KA 2XDQA 1KY5A 2V6IA 3EGCA 1ZXBA 3L2OB 3EMKA 2DYKA 2LW7A 4WK4B 3MYRA 3GLHE 2VPIA 2QORA 1WV1A 5CM9C 1ZK0A 2O3UA 3KJIA 4GXTA 4TTRA 1XWWA 3UAXA 4EHJA 3AUYA 3KVYA 2K7ZA 2ZBGA 3F3YA 5GM1A 2XGOA 1WA5A 4H1VA 1E61A 2OV6A 1OFUX 3IPCA 4QBHA 5CLQA 4ZHQA 2H06A 4JKYA 5LYJB 4YCAA 5BWNA 2RH9B 2PHZA 1HE8B 5KTNA 3T1VA 2P6NA 3S70A 3BWXA 4MR8B 1YQWA 2QN3A 4OBEA 1C9KA 2SKEA 3PWKA 3ZWYA 3GFSA 3MWDA 3GG2A 2HR1A 4N6NA 3AUXA 2YBEA 1BCRB 4KMRA 4XDYA 1EFPA 4BB9A 1KQFA 2HHHB 1JU3A 4LZAA 4M1YA 4ZVKA 3FUWA 5JAIA 3EGDA 4YRTA 1VPLA 1S2DA 1P7CA 4H7OA 3PDUA 2CUZA 3LHFA 2GBIA 1BFKA 3IB3A 5JWHA 2YTZA 3FJOA 4NYJR 1ZD1A 3KWJA 2Y6UA 3NHKA 3T1OA 2NP6A 2QGZA 1VMDA 4LDZA 3LY9A 4LX8A 4CI0B 4MPRA 5LJIA 1IBMB 2AFVA 1DAMA 2IOHA 4PHGA 2YWRA 4HJRA 1RM4A 1YS2X 4KAFA 4LWQA 4D74A 1VBFA 621PA 1XPUA 3LX5A 3IAM6 3R09A 4H4EA 4RPKA 5GJCA 4L50A 4MKRA 2Q9UA 3GCXA 1YRLA 4KQ1A 1JEAA 3PENA 4C22A 1AO0A 4MMXB 2ZRDA 1ULBA 3ZE7A 4DGQA 3UKOA 4LRXA 3CNBA 1HGXA 4RANA 2PRIA 5ADWA 2CFTA 2GRAA 4B6RA 1ZGJA 1V41E 3HV0A 4P7GA 3TRFA 2YJ4A 1A5SB 4IGIA 1UJ4A 1VJTA 1W94A 2BDEA 3VR3A 2CMGA 3NBMA 4DA4A 1PJRA 1GIAA 4ZVQA 3O91A 1DRVA 1AN0A 2HXYA 2QTZA 3GRFA 2X86A 2EFJA 2WJ6A 4IHHA 2IV2X 1P6UA 2QQFA 2D3WA 1Y3DE 3QWIA 4RMJA 3H9UA 2O07A 1ZZGA 2IPAB 1OWNA 2WR8A 3C6KA 3IVRA 1UXKA 3JSAA 5L6VA 3EVAA 3FJYA 3HJJA 4I3FA 3RC8A 1QO0A 1VHWA 1L8QA 1OILA 4MX8A 3TI9A 4DR6B 2R5FA 3K1YA 1CDOA 4FFBB 4CODB 2D6FA 3BA6A 1K6EA 1USKA 1WB9A 2HL6A 1GZ3A 1KHRA 2JGRA 3OPNA 4GSLA 1EA5A 2NWQA 1OI4A 1R18A 1NP6A 2NT4A 3AWIA 2H65A 1JKIA 5J4YA 4MRSA 1EFVB 721PA 3RYCB 3U3XA 3IAS1 1N92A 4ZI7F 3CUTA 4WPGA 2FMTA 3RVOA 5LJLA 3V33A 5KC9A 2ZAIA 4Q3CA 4MI1A 4JLVA 2VDVE 4DV3B 1JLLA 1TJNA 2O3TA 2RGDA 1MT0A 1E20A 1O96B 5AJVB 1JG1A 2WJIA 2EP8A 3LYLA 1H8ED 4AFNA 2OCXA 2ONZA 5FUYA 1RLIA 5CCEA 1E96A 3K1AB 3LQFA 2XF2A 2XATA 1ZW1A 2A30A 4INPA 3D59A 3ZHSA 2E4VA 4ZEWA 3HCBA 4BFSA 3HJHA 3DDWA 3QXGA 4RK4A 2CDAA 3SN6A 3L7BA 2AKYA 1H2HA 2IIQA 1HFEL 2JIQA 2RC5A 1W47A 1TQ6A 2WUDA 3N07A 3PT9A 3DCNA 4UTOA 3UB2A 1FJ2A 3UH0A 2FFAA 2H07A 3DGFC 5JS1A 3B2QA 1NBME 1YL6A 3M5WA 4RKWA 3EQZA 3L0SA 2QPAA 2YVUA 4EUSA 1RMQA 1Q1ZA 4L3VA 1QZUA 2C3MA 4F6RA 4DR1B 2CXTA 4MPJA 2Q3FA 2ONCA 3MUNA 2VHQA 2OLEA 3OOEA 2V9ZA 1CRPA 2BEVA 1L5LA 4PE5B 1EFDN 1ILEA 4GU5A 3RC1A 2DKNA 3K8YA 5IBRA 3TJRA 4TSFA 2WFZA 4MP8A 4ND2A 1CYDA 2E4UA 1FBNA 1XI2A 1DGQA 1OSNA 5ILOA 2BGUA 1SSTA 1DPGA 2D54A 3I1JA 3ES9A 1AUQA 3TOZA 5K45A 1ZWLA 3KSAC 1THTA 2I3AA 6Q21A 2PX4A 3KT3A 1W2WB 5K3CA 4BCCA 3SY8A 1T0PA 3OM1A 3R77A 1U28A 2BGTA 2JKYA 2AB0A 3ZZTA 1SG0A 3CLTC 1D8AA 3H5IA 1AZTA 2VRNA 1JIVA 5JY1A 3KSUA 4R2HA 3OUTA 4EVRA 4GUAA 2B2XA 4GRAA 1JA1A 1SFRA 1T34A 2Z3WA 4FS3A 4N5HX 2FMKA 2ORVA 4UMEA 1XA0A 5EJMA 2VQEB 2VXBA 5EE5B 3RIMA 1FNBA 3DE5X 4G5OA 5IVIA 4JY7A 4TWJA 5ICSA 1RHRA 4IM7A 4TMFA 4PX3A 4Z1MD 1X94A 4G07A 4Y0NA 4EGJA 3TLMA 4D0LB 1NNI1 2F62A 3ZI7A 5D87A 4D8WA 5IMSA 4KBGA 2IHKA 3A4LA 2IGBA 3KC2A 4M1KA 4O2BF 1L4FA 2ZXFA 3ADKA 4DWJA 3QWHA 2XNSA 5LMNB 4P0PB 1PT9A 1SUIA 4KAJA 1ZRMA 3BB4A 5KEIA 4PYMA 3T7DA 2ID9A 2NXJA 2VPQA 4MWOA 1XA4A 2XXAA 3NBQA 5K0ZA 3A37A 3CW8X 4FOLA 3IHTA 4KFTA 2BSAA 4J90A 4N39A 5FT9A 3SQNA 3A36A 1C3EA 4M0EA 4X1OA 4X8OA 3KZKA 4QDZA 2UYCA 5A5GA 3OECA 4JITA 2MYNA 4DLLA 3ZHCA 2LGJA 3AL3A 1G9TA 5CB4F 4JKIA 5K8LA 4I99A 4OB6A 4FLEA 3C1OA 2JCSA 3EFOA 5C5IA 5I7UA 1XCMA 1XROA 4PLPA 3AF2A 3BWVA 3L05A 3QSGA 2PS1A 2RJOA 3UH1A 1TJPB 3HXQA 2NIPA 3QWBA 5HM8A 3GEHA 3TWDA 3T4PA 2W2LA 5ICGA 2K6GA 3GJ4A 3TF5A 3ST7A 1P0MA 4URWR 3KUDA 4Z7QB 4L0CA 3LGAA 4QVGA 3S2UA 1D2CA 2GESA 1WEHA 2SCUA 4IQFA 4C0SA 4ZYLA 1BDIA 2V8OA 1C30A 1P7PA 1E2EA 3OT1B 1GUYA 4BKRA 4YRMA 1CUUA 1EJ0A 3OO0A 1DO2A 2CDBA 3LUDA 2CE7A 1Q15A 3DLHA 3G5UA 4NOMA 1QAQA 3A2LA 3A06A 5CJJA 1XGKA 1OZGA 3SJUA 3MMPA 1AGYA 3MJCA 3C3CA 2ZWPA 2M6KA 2VP0A 1M5TA 1TA0A 4PIVA 2AJBA 4G9GA 5B57C 4JVOA 3Q5EA 3P9KA 2YH2A 3IO5A 4KUEA 3WLNA 2WUVA 4O5OA 5TRTA 3R3WA 1AO3A 1IY1A 5JCPA 5CX4A 3ESQA 1EHCA 5H68A 3TQIA 2YC2C 2E9SA 5PNTA 4FFDA 4Y9RA 4FYHA 1DWUA 2FSIA 4JC4A 2DBRA 3NVDA 3UENA 1MW8X 3OG9A 3GUZA 4KXNA 5TPZD 3DWIA 1P9LA 1ZBDA 3ZHBA 4QVIA 1PW7A 2IDMA 3NHRA 3W5AA 4JV5B 1IN1A 2QMQA 1O6CA 2O57A 1ENYA 1QR2A 3EIOA 4JLJA 2W0VA 3FGZA 2W6IA 3WMEA 3N3AC 2FSPA 4BO3A 4DDKA 1L8LA 2L19A 4RD2A 4ZOAA 3DLPX 1XXHE 1E4EB 3SZ3A 1Y1RA 4KQJA 4L7QA 1DFHA 3BK2A 1XO1A 1MJGM 4RJIA 5EJ4A 1OWPA 4BFZA 4DARA 3P20A 3TXYA 2AOXA 3VVMA 3VMMA 3WXBA 1B1AA 2YMQA 2BUAA 2CYBA 3ANTA 2PR7A 3H1BA 5HP4A 1ZSYA 1YNOA 2HFKA 1F51E 4B4OA 1NU6A 1M2JA 3EVTA 1IXSB 3Q12A 4OB7A 1WXDA 1I0LA 3TK1A 2B98A 2HPZA 4K81B 3ZCRA 4DPMA 1QSGA 4ZZ1A 2JRCA 2WF9A 3PS9A 5KTOA 1M34E 1R6AA 4OQXA 1X7XA 5KTRA 4P6VF 3BA1A 1SC3A 1WL8A 1KI1A 2FZVA 1T5IA 3PFNA 4OYLA 3IE1A 1ENZA 1HQKA 1MB2A 1T29A 2XNDA 4JYMA 5BMVA 1AQIA 1YBFA 4I36A 3FWWA 2VHWA 3WP0A 4NBKA 2PZLA 1Y8QB 3O93A 1EFHA 1YSCA 3GZNA 4NV3A 4ZYZA 3H13A 4AP6A 4L5BA 5AJZA 4WI1A 1YZYA 4X5OA 2BI4A 2YXNA 4WUVA 1XAHA 1NOJA 4ATNA 3W8EA 4Q1CA 1DAGA 2OV1A 4FFOA 2CJPA 3O4JA 3Q88A 1X7XB 4Z0PA 4DB4A 1SKAA 1AA6A 2C0QA 1SCBA 2AD1A 1FU4A 4I5DA 4YMWA 4CQLA 2VZ9A 2ZT8A 3RYIA 1YQEA 2RHTA 3ZTYA 5E3HA 4WN3A 3FSGD 3QVOA 2W2MA 3BF7A 2I87A 3QF4A 1QVZA 3NGXA 1P4HA 1KYWA 1Y6QA 3K9GA 2H1WA 1NVKA 1P4RA 4OL9A 1HE2A 4UATA 4DKJA 2XX3A 2IPMA 3U49A 1W581 1GZHB 3IJRA 4P38A 3IBGA 3ROTA 4KIWA 1YOBA 3AVQA 1P17A 3GT3A 3CNEA 3MWKA 4MV3A 3TZHA 1CJBA 1GXSB 3EZFA 4B4WA 2QTWB 2V98A 1I4DD 1OLXB 3DFZA 3KIPA 2NM0A 1VJ5A 1RQGA 2C2WA 2I71A 5CFRA 2PZMA 1N6OA 4TLDA 1B6SA 2JF0A 1KMCA 3S5JA 4F4CA 3KHKA 4QAJA 5IXYA 4Q24A 2XCTB 2XDAA 4D45A 5BV2P 1EVYA 1G64A 4EVQA 4N8SA 2Q5LA 2OT3B 4NU6A 4AKGA 1AHPA 2I1WA 1WMEA 2PNFA 2WLSA 3GGPA 4EGAA 3VDNB 2V7PA 4JYPA 3TZKA 4JVLA 3HB9A 2ZT5A 1J6UA 1FTSA 2VYFA 3BL5A 3F67A 4LZOA 2VK8A 5FLEX 2AJTA 5JSYA 4D43A 5AVVA 1LRKA 4W5HA 4B7XA 3KLOA 4QZVA 3GC6A 4GG1A 2W98A 5FI3A 1BXZA 1LSUA 1U1GA 5BYAA 1NNEA 2CFSA 1RR6A 1LJ8A 3L02A 1V8DA 5CCDA 1DIOB 3VU8A 4CF3A 1GNTA 2FFQA 2NZ8A 2ZSKA 4Q9DA 2M6RA 3T5PA 4GP7A 4R3WA 4ZVLA 3PX2A 2IWRA 3BGSA 3W2TA 1Z4PX 1ZD5A 4JELA 3P4UA 2P8JA 1PWZA 3UHAA 1DOAA 1E0AA 4Z49A 4QNRA 3TL6A 2HDWA 2DTXA 4EYOA 1JSZA 4Q3NA 2FLWA 4K7JA 5CVVA 5DFAA 5HQJA 4QPDA 3BXOA 1TT7A 2P9BA 1P9WA 1TO1E 2Y2UA 3IDZA 1X6VA 1NVWQ 2NZYA 3NFRA 3QYAA 4TLCA 4JLKA 5A3VA 3VYWA 5TMEA 1X8JA 2FR8C 2M9MA 3ZWVA 1H9CA 1C0IA 1VLZA 2H08A 2VQDA 4X1IA 4CF5A 4KITB 1DAHA 3T99A 4XZ3A 1ICIA 4ZOCA 1I7DA 1CK4A 4H31A 2Q6VA 1CVLA 4OHPA 3FPBA 4D26A 4BOYA 4NV0A 5A5FA 4C0QC 3SEAA 4N6AA 4DTCA 1N5KA 2WZDA 3U48A 1E3IA 2RKBA 3MT0A 1V1MA 1T2VA 5B36A 3RSQA 1EVKA 1XRSB 2WZBA 4ZREA 4YAGA 4LOJA 5KWJA 4QE3A 1GNSA 2C95A 2R7NA 2Y68A 4LYHA 4O2AF 2BOVA 2ZQZA 4RY9A 5I3CA 1GUBA 3NXKA 3MGCA 1C4WA 1Z47A 5BUCA 1NQOA 1NW6A 2WSYB 2O8CA 3HYLA 2GNPA 1DI0A 4J6EA 4U2BA 2ZIXB 5DMHA 4OFBA 5K0LA 2OGUA 5CBPB 5JADA 2XXJA 3KVOA 4WINA 2B99A 2J0QA 4JK3A 3H05A 3JU3A 3SXUA 2JFOA 2NZXA 1FP6A 4HDAA 1E79A 2BEJA 4H7HA 1AURA 1GA6A 3JYHA 3ISTA 4ALJA 2AWNA 3DTTA 3ULKA 5AW8A 3E5MA 1H2EA 2HUNA 2ZB2A 3ENVA 1JTVA 4MQ6A 3RS7A 2X9LA 1NN5A 2Q49A 3I4FA 3EEIA 3L8ZA 3LWBA 3PKJA 3HMKA 4RTNA 3I61A 4BP9A 4PC2A 3QOYA 3O74A 3D8NA 4MVJE 1BXGA 1ESEA 4WLVA 3ZYCA 2D0DA 4EHDA 4CKWA 1PTKA 1HSOA 4J3FA 2GKGA 3OZCA 3HRIA 2EL7A 2QVLA 3JYNA 3WBJA 1A98A 3C3AA 3AESB 2ZS8A 4DVGA 2Y1WA 3RU9A 2HNBA 1ZOLA 2Q9BA 2HHJA 1HFKA 3CCFA 3FYSA 2C7RA 3G6WA 2COEA 4S35A 1TTTA 4IHJB 3PR1A 2AW5A 3OJLA 4Y67A 4E4RA 4NMXB 1R8XA 2QMOA 2Z83A 5CJ2A 5ALNA 1P62B 1CVRA 1BS9A 1RHQA 2P7IA 1DT3A 2Z9BA 2YW9A 2ZU0C 2ADOA 4ARAA 4P3YA 4WGGA 5GJBA 4HDKA 4M9SA 4C7MA 1GAEO 1C7IA 4MUFA 3X44A 4JUCA 4ALNA 4IKPA 4M46A 5A06A 1JLHA 1YCGA 3LDAA 1GXSA 4O4HB 1FFAA 4E13A 4YUZA 4W1PA 2D8MA 4YDRA 5ILQA 1J8QA 3QLEA 2R6ZA 4JI5B 3SXPA 2IC5A 1WMAA 4I4LA 4ILKA 4M0LA 4B6FA 1T2UA 3OM8A 2FW7A 1KYZA 4HH4A 1PEKE 4Y2TA 3RH0A 2ZDQA 4WD3A 1YVEI 1IYZA 2X8JA 3UGQA 4UQLA 5JTUA 2V0HA 1RIFA 1V3WA 4RD6A 1VIMA 5I4CA 3ZZ1A 1ZUIA 1G21B 3EN0A 3P71T 2H4YA 3B53X 5DW3A 1YZLA 4OLHA 1Z2EA 4MW4A 1GY8A 1F2UA 2IYOA 3Q9SA 2UXBB 2D5LA 4LQDA 1XJQA 4WIAA 5K9ZA 1QV7A 4DQVA 4G81A 3HA5A 3VKVA 2NPOA 1VL0A 1EWTA 2XQJA 1ACMA 3WLLA 3BGDA 3QIAA 1FZTA 5ITWA 4MH0R 1V47A 2OCAA 1J8MF 2AXEA 2A9OA 5D2CA 1FA9A 1EUZA 3Q4GA 4BQNA 3CTMA 2FSVC 2EQ5A 1Z9BA 2RGUA 3A1FA 4OXNA 1X1TA 4Q9KA 1KVQA 1YZTA 4KC0A 1HZJA 4BFLA 4D2IA 4E2WA 1VJ1A 1DARA 2F1OA 4JGBA 3T3DA 1UJ5A 1VFPA 2Q07A 1YI1A 2YBDA 3NPAA 4HFJA 1E5DA 2RGAA 2VF7A 3TD9A 3RSZA 3KKOA 1RBYA 3BUSA 3ZVLA 3AOEA 4MYTA 4AUEA 4EQ6A 2WKQA 3I2FA 2OP1A 1NE2A 1DBWA 2QXTA 3QMWA 4L76A 3WTCA 2OFPA 5A1JA 2Y77A 4F0JA 2QL9A 4PTYA 2KBEA 3H5TA 5JZ9A 2HYIC 3H2BA 3FCCA 3MVEA 5A9SB 4IMRA 4RLHA 2B9VA 4LK2A 4BNKA 4M0MA 4NE7A 2R48A 1GZUA 3JYQA 4BXOB 2IYPA 2O2DA 1J0AA 3PIDA 1EVEA 2R751 3ZKAA 2H00A 4A6EA 7MDHA 4YRJA 3HXKA 3WOVA 4PLCA 1HDIA 2PRJA 2E2WA 3K0SA 4P22A 4E07A 4L0MA 5HEKA 5IYZA 1YU6A 4EK9A 1N9GA 4MVJH 1SKYE 2JC3A 4FDLA 4BKQA 5IT4A 4NPHA 4B6GA 4Y1GA 4NTZA 3OEED 1IONA 2QUKA 1YH3A 2OO3A 2C4KA 4JSRA 5ALLA 2F55A 4A36A 2JGDA 5GQSA 1TLFA 2AEMA 1NY6A 4K6MA 3E9YA 4YCBA 5FL7D 2F9MA 3WNVA 1WUIS 5B58T 1JALA 1UMDB 2YJ3A 5AKJA 5C8YB 4G4IA 4GLOA 1CULC 1ORWA 1RKUA 1EE2A 1E1CA 2OCBA 3GLVA 1IOZA 4OJYA 3TEJA 1RKVA 2Q7XA 4QQNA 4D25A 1E32A 4Q02A 2WIDA 4BNLA 4DRXB 2OUIA 3LL7A 4MUJA 4RFLA 3IGJA 3GQBA 1B14A 1I6MA 3UMCA 2IX3A 5DBFA 1BTOA 1ZU4A 1W5FA 3P9RA 3UQYS 5IFKA 1UMCA 2AK2A 3DZDA 1YB1A 1U0GA 3HJTA 2WLTA 4ZOEA 1RPNA 2ERXA 1Q1NA 4XTRA 3B12A 1W93A 3SBEA 4OHCA 3HXMA 3W4IA 4HLNA 2PS9A 3DR5A 3D98A 1IN4A 2FP3A 4FGSA 4HF7A 2EZ4A 2GAAA 4RA6A 4C4SA 5CA0B 2B78A 2PT7A 4KIFA 7MHTA 3MMNA 1V37A 1BOFA 3QHQA 1WMFA 1T43A 2CK3A 2A2ZA 2XYVA 5D3ZA 1N1GA 4PW0A 3WV5A 1XZIA 2V0LA 2ZYAA 3PC8A 3ZS8A 4RTKA 2ZIUB 4J09A 3FUUA 4WKOA 1KFBB 4N5NA 4D97A 3G85A 5AXAA 3JRNA 1P0IA 5I7OA 1VKOA 1U2ZA 1NAIA 3AI3A 1UPTA 1R1DA 5IAJA 1YJAA 3RHTA 1IJKA 1RAIA 1V6SA 2QZ4A 3DVAB 2WDPA 2WKSA 3KM0A 1GT91 2OB2A 3KT6A 4AY6A 2C03A 2K4MA 4EW3A 1RRGA 4CJXA 2PT5A 3F2VA 3BWYA 1EXVA 4D3ZA 4J29A 4ZI2A 3MS4A 2CLFB 3NIWA 3EPLA 1TPZA 3I4CA 5E0OA 5FBHA 1DDIA 1ESZA 5EJ5A 5EKDA 1JQ3A 4LE2A 3U40A 2OFOA 4G5XA 3DMGA 1NVXQ 1WPXA 3C14C 1M10A 3SLRA 1HXHA 5G4KB 3RFCA 3S99A 3L4KA 4JFAA 4GPIB 1WNFA 3DYVA 5EMHA 5MN5A 3I9FA 2OV2A 5JYEA 4MVJM 2FF7A 3PMOA 1M6VB 1LFAA 3PEFA 4M1EA 2XE4A 5F23A 3AUJB 5GMOA 2XV1A 1U9IA 1B23P 2NUAA 3OZSA 5F7ZA 4B09A 1E1NA 1OYVA 3OEHA 4MQLA 5D00A 2O0KA 3C6YA 4GL2A 1UQTA 3ZE1B 1YJCA 4WKCA 2VK1A 1NTRA 2G9QA 1FLAA 1NVDA 3DE7X 1ATZA 1ZIDA 3DT6A 4ZALA 1Q17A 2WVGA 3TSOA 1CZKA 3L93A 3VNPA 2IEIA 4Z8YA 1XEXA 1NDHA 3ZVMA 4IJ6A 4KPGA 4XOIA 3VH3A 5I3ZA 1ZNWA 2YFQA 3B38A 3L0DA 4FQ7A 5FWAA 1KOLA 1PW5A 4BB5A 1FJGB 1R9NA 4H08A 2QP9X 2QP4A 1KI2A 2JIDA 3EXHA 3AG6A 4TUYF 4XQCA 5ALOA 5EJIA 2FPLA 1Z2AA 3TR0A 4OG2A 5EG5A 1HNNA 4ZODA 1HO3A 2GPBA 3K70D 2FQ1A 4FX5A 3OZGA 2ZJAA 1K0FA 3GCZA 3SLKA 1TZJA 1P0CA 2J3IA 2OZLA 4FZRA 4G6ZA 4EX7A 1O96A 3OZEA 4EB3A 1URPA 1GUZA 4BNMA 1NOIA 1TK9A 4V0ME 5DI9A 3WGZA 1KMNA 3MF4A 4F4HA 3WO1A 4Q16A 1BFDA 1Y9AA 4H0CA 4I1IA 5I47A 3QUTA 4DLNA 3N74A 5LQAA 4IIXA 4OD0A 2NO0A 2OG2A 2P4UA 2N3ZA 2W6ZA 3HSSA 3M49A 3DHVA 4R41A 4UQPA 1RJWA 3ESYA 4WXPA 1YQQA 3ADOA 2M98A 1AKQA 3DKKA 3KBBA 4IOMA 3ZV7A 4PZ0A 4M8KA 5LB4A 3EC1A 1LV7A 2DHCA 4A15A 1JR4A 2F1HA 3H5AA 4TSKA 3BGVA 3GF4A 3R7DA 3IL2A 3RUFA 3NVKI 3AM3A 5IYZF 2OFFA 1GR1A 2WWYA 4DUPA 1H6DA 5F5NA 2G6BA 4ARBA 3TNJA 1HLGA 5JRJA 1SRQA 4PTLA 4U2EA 2OAQ1 1BMTA 5DEMA 2PS3A 4IO0A 4RSGA 4JBNA 2FN7A 3IA2A 3HVHA 2FRXA 3F8TA 2PLFA 4PEVA 1KNXA 2P1DA 1KTIA 2TDTA 3L7JA 1XMJA 5CPFA 4DBLC 2CYAA 4MKXA 4FC7A 3FHJA 2QZJA 3SMVA 3THXB 4XUEA 1Z5NA 3R9XB 3IKVA 1V8PA 4L28A 3D3JA 3SBXA 2WF7A 5L7YA 2VT2A 4PYIA 1EBFA 3JASB 1BDJA 2FVXA 2ZCVA 3CKLA 3IEPA 4JUBA 4N7BA 5FYDA 3SHFA 1AH2A 4O4IF 3K9LA 2NACA 3ZE2B 4FD3A 4HURA 3OZVA 3JTEA 3WBFA 1JHAA 1YXMA 3M5DA 3E61A 4D4IA 1W1IA 3GYGA 3MJHA 2AL7A 3UY4A 2C78A 1IBCA 1TZ2A 3RADC 1P2DA 2HKIA 2XVXA 4YRRA 2ZPAA 3PC4A 3N7AA 5HGJA 1NDUA 2A33A 2C9DA 3ZLUA 4DCTA 2LDXA 3IV6A 4XWGA 4IXTA 3EIFA 3LUGA 4XIYA 2ZIAA 4U7FA 1F5SA 3EWSA 1CKEA 2R9VA 3NC0C 4LI0A 2Q8PA 3BMQA 5AQEA 2YIMA 4AG5A 2CHGA 4X7RA 5EE9A 1FX0B 3MRVA 2BJHA 1XATA 2BRUC 3JQ8B 4HXEB 3AKEA 3BX1A 1YONA 4MXDA 1WG8A 2C2OA 5KYTA 3VR4H 4EO9A 3W5UA 4ZQIA 3GLIA 2ZBRA 5BR7A 5EKTA 5K09A 3DOCA 3LCUA 2JJYA 1UBRS 1ZRNA 1Y7TA 4X3CA 3OA0A 5TPZA 3CUWA 3ITEA 1FFDA 2P9JA 3HHEA 2DXIA 2NVWA 1W75A 1LSSA 2CVPA 4LIPD 1FNCA 2AG5A 3P9PA 3X2EA 5TQ0B 2VYVD 4QU0A 1XP5A 3LY8A 2WJ3A 4UVIA 3FMOB 2O2HA 3VPAA 2ZTLA 3TX6A 4C6HA 3G8BA 4HT3B 2O50A 3NRBA 1YQTA 4DSAA 3ZWBA 4G0QA 3WE7A 1I14A 1AQ6A 1R9MA 1YQDA 2RGXA 1OU4A 2WILA 3SJAA 4FCTA 3RYCA 2SCUB 1EP2B 3GRVA 4EMBA 5BWOA 3ICCA 1SKMA 2HDHA 3A31A 4EMUA 4E4TA 3IUQA 1YQGA 3NNSA 3NV7A 4YMVA 4BUJA 1P1CA 2EC5A 5B3KA 3WYAA 4EW2A 3C1TA 4JX9A 5ECWA 3DEIA 1B0ZA 3RAPR 1M67A 4GOOD 3FZNA 3ENNA 1BMDA 1P2VA 3SHWA 2WWFA 1TOAA 1U2EA 2QS9A 2IZ7A 3PFWO 4GZMA 4LJAA 4BC1A 3DLAA 2NPFA 2Q7OE 3L4JA 3COZA 5F3WB 2J7KA 4WLOA 4KXQA 2OD2A 4UU7A 3FPLA 2MYUA 4MAAA 1ONOA 1WXXA 4ISXA 4BEJA 3OH0A 3KWCA 2IYAA 3LT0A 4WWHA 3KKLA 3UXYA 4H7JA 4P3PA 2BSQA 3CPEA 4F38A 1VCMA 1FXWA 4HDSA 5KMGA 1JLRA 3AB7A 4YCSA 3B8HA 3IPLA 3U4HA 4OP2A 4Q1EA 1H2WA 5KWSA 2VTKA 1FP1D 1ACLA 1HT2E 4BJ5A 5B7QA 1Z88A 1Z7GA 2PH3A 2GPYA 2OFWA 3JVDA 5FWYB 3GLGA 1SCUA 4MGIR 4UNSA 2DOKA 1MB3A 2G28A 3IB6A 3FY4A 4GPZA 1YCDA 4EYQA 3OPYA 2GBLA 3Q3HA 2YOHA 1E2QA 3IVGA 5ADXV 4X60A 4WBNA 5JEDA 1YASA 4V39A 4EO7A 3V8VA 1TW3A 4TTPA 4IDFA 1ST2A 4DCCA 4G86A 4FX2A 3H1PA 3TL2A 3REQB 4MZUA 5JYDA 1UDAA 4KO2S 1J49A 4GE3A 1XZHA 1KHTA 4L5JA 1DDGA 2B94A 2GO7A 1YVPA 1JHQA 4B47A 4EI2A 1SQ5A 1A9RA 1JIQA 4IS3A 4L8GA 4E6TA 3C45A 1I01A 4NULA 2MSKA 1KMHA 4GH5A 2P27A 2X77A 3VBPA 1CP2A 2BKEA 2XMPA 2FFBA 3KPYA 2ZYVX 3SYMA 1RHMA 2HH9A 3G5AA 3HABA 5EOVA 2KM1A 4U0JA 4AUKA 4BVEA 3R3IA 2VHEA 2V7EA 3F9IA 4IIJA 1K4MA 3FOBA 3UJ8A 1CY4A 5FUVA 1UFOA 1U2DA 4GR5A 5L51A 4AI6A 4ZGGA 2EFEB 4WKBA 2CMDA 1J23A 1Y5LA 2H1HA 1O87A 2OSBA 3JWIA 4NBRA 2IV7A 4BVAA 3HTXA 1U04A 3AMVA 3DZFA 5JJIA 1P61B 2PGXA 3M6LA 1V7CA 3HO8A 4W7SA 3CVVA 1G2PA 2V7TA 1S3FA 4NEQA 3UPTA 2DWUA 3PQ8A 3G2NA 3PDIA 1YZVA 1PSDA 1ZESA 4PZZA 5KC8A 3M81A 3TAHA 1II0A 4OATA 1ECFA 1Y8QA 2QTAA 2GCOA 1ISGA 1K1EA 1BG6A 2ZRCA 3EYAA 4RMIA 4NCHA 1JPUA 3ECSA 2G5TA 3R0ZA 4HPJB 4PLGA 2VF8A 4LFCB 4P5EA 3VOAA 5DXFA 3W04A 1N9ZA 4XXHA 4V0KA 1RACA 1AS3A 4CTJA 3KYDA 2VXYA 2WM8A 5TARA 3T9BA 1Q6YA 3WGGA 3WP1B 4F9FA 3LRPA 2W83A 3WVNA 2QVBA 3PTAA 2WG1A 4WBNF 3AUUA 4HMPA 5ULLA 1OGYA 3GLIE 4HSGA 1OT5A 2OCYC 3FHLA 4DIOA 3ELDA 5F21A 2WJYA 3PL1A 3N2KB 1U4NA 2VQSA 5F1OA 5BV1A 1G2IA 5K5EA 1X80B 2HMVA 3BXGA 3JQBC 1IZZA 3EF0A 3O92A 3TAXA 5CB4A 5B7PA 1VBKA 1J8VA 3M6XA 5CDYA 4W1RA 1TFUA 4D96A 1CPYA 3F6YA 1C9EA 3ZHRA 3WLSA 4FFSA 3GPIA 1OX4B 5ALZA 2CJFA 3ZJ4A 1PJCA 3IUPA 5JZSA 2POQX 4LOIA 6REQA 5EJ7A 4GFDA 1UR5A 5KB3A 3Q2OA 2PY6A 2I67A 3L7OA 2PUBA 5ES4B 4F60A 3RVMA 1XZ8A 1UXHA 2IZOA 2BFCB 3D31A 1KEUA 5ICMA 4XGQA 3A25A 3K8QA 4RZ3A 2BTQB 2WWWA 5CG2A 3MUOA 5JSFA 2GWHA 2PBRA 2FJ0A 3FCAA 3H3FA 3NYQA 4LZJA 1X1DA 3R0XA 3OHPA 3A27A 3NI2A 4EJ2A 1PNQA 5AHXA 3QHAA 1HBJA 2DTEA 4ZOBA 5EE0A 3U3DA 3G0OA 4JQOA 4OK5A 4LF8B 4G41A 1D09A 4RAQA 4BNXA 4Q3LA 1EWRA 5AJUA 2OKCA 4IR7A 2CZGA 4H7DA 2HA5A 1CHDA 1CRLA 3KAQA 4EJFA 5C5EA 3AM1A 5FA8A 3PLAE 4UFOA 1BX1A 2EIXA 1WCV1 3E9ZA 4EG4A 2ZIWB 3CZRA 1NSTA 1NHGA 1PR2A 4D4MA 4O0MA 4L08A 3ZLTA 1V35A 4E4YA 3ABRB 3TTUA 2RAPA 3VC1A 1AQYA 5J2UA 3F6CA 2D2IA 4DNXA 1U0JA 4GIBA 1HDXA 1Z8FA 1QO9A 2AFIA 2BGIA 3V42A 4DTIA 1NRJB 3O90A 1C30B 4PR0A 5DV9A 2P4HX 4RD0A 4CEIA 3TIOA 1HEUA 1FB5A 2QTVB 3GGSA 3NX4A 4L2IB 2FSGA 2LIVA 2W43A 1OB2A 1OHHA 5FTJA 2W2OA 3CSSA 1N33B 2AR0A 1QFYA 1G8PA 1MPTA 3E2IA 3V9PA 3TWOA 3ZCTA 2H4XA 2C3OA 3RUEA 4HH3C 3LT4A 4BV3A 3KAPA 1AG9A 2V5VA 4K0RA 2Z5LA 2GHQA 2FLVA 2QV0A 1RKQA 4ZVOA 4C87A 1JSLA 1QV6A 3ROPA 4QO7A 2VHTA 2V6MA 2WQ7A 1QH9A 2G82A 2PGOA 3UCEA 4ESVA 4OX9Y 2W6QA 3F1LA 1WD5A 2Y6VA 2QRUA 5IK2A 4DQKA 4QPZA 2WTEA 1D1TA 3V4VB 1YT5A 2JVJA 5DXJA 4NMWA 3WSWA 2HLDA 1NJ2A 3I28A 4M8SA 4QEZA 4ROTA 3WFIA 1OF1A 4ODIA 1MRNA 3I1IA 2ZREA 4R81A 5CYPA 4W1QA 3GY0A 4W9NA 1NXSA 3WQSB 1YA4A 1I2MA 2X4DA 3BFKA 4R2KA 4R1SA 3EFBA 4C1NA 1YR1A 3B9BA 3P5BA 2VEOA 1U7ZA 3DBOB 2PV7A 3NM5A 3HPQA 3VXKA 5B7GA 1NW7A 3BFVA 3ENWA 2BCJQ 1HM5A 4KWEA 3JV7A 4ZGWA 3IAAA 5EHNA 3ZTWA 1NFFA 1NQUA 2RGWA 1TUBA 4KYUA 3R2WA 1CWUA 3DC7A 4TGLA 3RIYA 4A1FA 4IVNA 3U3JA 4U0KA 3FWKA 1RRMA 1ND5A 2X22A 1OLSA 1BW9B 4L4XA 1NNLA 1YMUA 4ENTA 1Q0UA 4WTOA 3A2KA 1EX9A 4OK3A 3UJPA 5L4SA 2J4CA 1J2UA 2QTFA 2ZETA 4NC9A 5I4BA 1XN4A 4EG0A 1ZN8A 3FDZB 5DM2A 2VIIA 2QN8A 1CF9A 1QC5B 3H17A 4QXPA 4UUMA 3JAMA 4UDNA 2CFCA 5KAPA 2IH5A 4QYXA 5KNDH 3T35A 3TLGA 1N3LA 1IQRA 3PFHA 5EA2A 1DJLA 5JMPA 3SDBA 2ZUTA 4GPTA 1JQDA 3IT2A 4ZV7A 3KDPA 5G0WA 4BUZA 3TIGA 2BMFA 1PGQA 3HDGA 3T7KA 2VJKA 3PD1A 1AKMA 3FPHA 4R8KA 4NMLA 3G9QA 4NONA 4DLUA 3MWJA 1QP0A 3ZQJA 3CMCO 2X7XA 3ILXA 1PZFA 1QOPB 1P2GA 4KXUA 5EAIA 2WSLA 2AR9A 3UWSA 1OZFA 3VBEA 1XRLA 4Q4CA 4DHEA 1TB4A 3GA7A 4FKBA 5DT2A 4CG1A 4HGNA 3UGJA 2XMGA 5AI0A 4N9QA 3V3KA 3V55A 1IU9A 2W70A 5K0GA 1DCTA 4EGSA 2V1XA 1W96A 5DNAA 5AOCA 3I0NA 4WLFA 1R5JA 1ZD2P 2ENWA 3WKBA 3GPLA 3W5BA 2PGAA 2V58A 1FDRA 5KOYA 3LBYA 3VTAA 1NI5A 2QR3A 3F7OA 4DLWA 1KAOA 3GD5A 4ZIRB 3ZHOA 2VDKB 3DFFA 3NUGA 2QIVX 3CF4G 3KG2A 2VRBA 4QRIA 5FBLB 1IY2A 5HIAA 2WE8A 4Z3DA 4BE7B 2NQTA 2R85A 1XAIA 3C39A 2AR7A 3RVJA 3R6TA 2RB4A 4M49A 3O03A 1G41A 4KQ6A 3WWCA 5K0CA 2Q4DA 3U39A 2HDNB 5KYYA 1G95A 2D2VA 1N8TA 3F46A 3DYIA 4KIUA 4AY3A 4LFBB 4XAQA 3OAAD 2DFDA 2JFHA 2ZYUX 3O75A 3LFTA 4B8YA 4MA5A 1CS0B 1KJQA 5AI6A 3HUTA 4URHA 3FSEA 4W8GA 2P8SA 4AT1A 3HI4A 3RK0A 4HFMA 3EHDA 1V9CA 1RLOA 1SOUA 4FYIA 3E9EA 4X45A 1AOXA 5LQSA 1JJIA 3C48A 3GP3A 4JOSA 4PYRA 4Y9UA 2WG2A 1H2XA 3ORRA 3O47A 1XMQB 1N2CE 1JH9A 1Q50A 2N75A 3LT5A 3IIIA 2IU0A 5G41A 1EUQA 2Z3ZA 1E1QD 1LLFA 2JBAA 3AY3A 4D8TA 1M0SA 4F3NA 4URVR 5HKKA 2HW8A 3P9NA 5LLTA 3R0SA 3A6GA 1QFZA 3IEUA 1YULA 2JGMA 5JW6A 4JGGA 4B4DA 5FPKA 5CBPA 1U65A 2BGRA 3MD0A 2WTBA 3TTVA 4B44A 4QBTA 1HV9A 1YRYE 2DY0A 1TTQB 4LA4A 1VBNA 1N3BA 2YMMA 3ZDEA 2QSJA 3DXZA 2NZJA 2PFGA 1N9GB 4MPDA 4FHDA 2IV3A 1C8VB 2R1ZA 1RKBA 3OE7D 4IEIA 1XPJA 2XRYA 4O0LA 5DM4A 3V1TC 3C6QA 1HLDA 1WF6A 3EIXA 3TV0A 2FP4A 1HR0B 2XMCA 5JAUA 5IKOA 2NZ2A 2Q28A 2Q2VA 2XY4A 4X91A 2HSZA 3RSHA 3H1EA 3OA2A 5AD1A 1DX6A 2JIZA 2COKA 3WHKA 1Y7HA 2IY9A 2TSYB 4DNQA 1O0BA 1QMPA 5BT9A 4E14A 4AJ2A 2YWFA 4FZ5A 3HS3A 3D3EA 4CTOA 3R5CA 5C52B 3H65A 1KDPA 2YZNA 1XQYA 3CRNA 3OESA 2EW2A 5IRCD 4KE8A 3T1QA 4YRDA 1O77A 2RG1A 1JEQB 4N5IX 3SYNA 3GFGA 1MO3A 1EX6A 1VMEA 3MGKA 2OSVA 4V3CA 2HA4A 4IMIB 2VXOA 3OICA 4KTVE 3IQFA 3N5CA 2Q3EA 3MMSA 2GB4A 1BDBA 3GDHA 4E2XA 4F86A 3A10A 2O8CB 3I64A 2D59A 2XXBA 4LZPA 1YZKA 4KZKA 4BE4A 1FQOA 3BKWA 4IV5A 1RWOA 3PFFA 5FHRA 4YPFA 3X1MA 4PQFA 7AT1A 3M5CA 5H59A 5DHAA 3NCTA 4EENA 3M89A 1KAMA 1PK7A 5LZ2A 2ERYA 2H5JA 2NU8A 5E6RB 2MR5A 3MLBA 4R1TA 2CEKA 1U0TA 3W8FA 2PXXA 4MGYR 2OCDA 2AFHA 1P5FA 1GTRA 2BEUA 2ZRHA 5TT1A 4AMZA 3R8FA 4HB0A 1Z2FA 1ZNZA 1Y4UA 4HGZA 4ED9A 1Z5VA 2OHIA 3SSNA 3PPXA 4NFSA 2H29A 3Q7RA 3GFBA 4M8LA 3LTNC 1FIUA 3D4IA 1NMSA 1JQEA 1US8B 1S02A 3B2NA 1KK4A 2VSXA 4AJ1A 3B2EA 2XCRB 2AOTA 2O5RA 5D01A 3N2ZB 4J0CA 4FNOA 2GM4A 1YAHA 2YIDA 3CLRC 4DA7A 3D3WB 1FVOA 3HCPA 1NBOA 3N28A 3DTVA 1NDQA 2Q9CA 2A1UA 3AV0B 3D0KA 3Q1KA 2F8SA 4GX0A 1CUVA 4RKFA 3UA3A 1H1LB 3WWZA 4UCFA 1A9SA 3CX8A 3KR0A 3OOJA 2GETA 1IE3A 1Z25A 5E38A 3B3GA 1H4VB 2F3UA 5KU1A 2YV2A 4XWOA 4UNNA 3LBFA 3L7CA 4HDMB 1L7RA 1KP3A 3I42A 3MA0A 2ACEA 4G8DA 5G40A 3PEVA 4R40A 5CFQA 1KRUA 2QD4A 1QHHB 1T1EA 2NVOA 3MJTA 1Q14A 5D3MA 1SEVA 3A70A 4AULA 1T4BA 1GA1A 1U9YA 4DCMA 3K16A 2YVQA 3LHKA 3FHTA 3O4HA 3VPCA 3FUVA 2VDMB 4N7RA 4TXMA 4K9RA 5DASA 1XRMA 4EJSC 1Z15A 2ZLBA 3AR2A 2RIJA 4PRZA 1ESCA 1UP7A 1PL0A 1XHFA 2H9YA 4DILA 1QIKA 4BO2A 4YRLA 5KOHB 2WYWA 3AHJA 3L18A 1E3MA 4CU2A 3FUCA 5M2QA 5FJIA 5KKAA 1XHEA 1CJVC 4UKDA 5KOJB 3G9TA 4LQLA 1TU4A 3K0BA 4PR3A 4RAOA 1YRWA 1KYQA 1N2XA 1JQBA 4US2R 1U7TA 4ON9A 1W46A 1LRJA 4FE4A 1UZLA 4BNZA 1KJIA 6ADHA 1JMVA 3B6ZA 1XJ5A 1QIGA 3OT5A 3TJMA 3ZGXA 4DDUA 3EPJA 2WP8J 3KUKA 3WAKA 3ZJTA 2IDJA 1LNSA 3AHHA 1JV2B 3OMXA 2O2CA 3CH6A 3LC0A 3QJ5A 3FTTA 4CIYA 3O8OA 5F76A 1K92A 2FZLA 2J08A 4F2WA 2YJNA 1LVUA 1UBMS 1BC5A 2WSIA 4OQLA 4FDUA 5E4YA 3U0VA 3WC4A 3ZE6A 4EQZA 5K4GA 3FTFA 3P52A 6PFKA 1XDWA 1DRJA 5DK6A 4GKBA 4LHWA 1LF5A 4J2HA 3VNQA 4IGFA 4LAFA 3Q8LA 3W9BA 2W6MA 4G4SO 2B3DA 1VJCA 2QM3A 4RC9A 2VCHA 3CWZA 3NAGA 2A5GA 3W9UA 2ST1A 4NP6A 3TDKA 3ZLBA 4Q3BA 1M6NA 3IQZA 4RSMA 5C8ZA 3YASA 1R4MB 4WCVA 4DV7B 4TTSA 1XPRA 2DTDA 2QF7A 4EI9A 4HDCA 4IHFA 1BZYA 1ODFA 3UWKA 5BWCA 5DF1A 4NE9A 1IN6A 1S01A 5F4ZA 3K1TA 3PRYA 5JSZA 4Q4HA 1QS0A 1YQUA 2J5XA 3QX7A 4PNPA 3OH1A 3K31A 1J06A 3EW7A 2DFPA 3OFSA 5JDCC 1OXMA 3VV3A 1QRTA 3GK3A 4MR9B 4E5KA 4UNRA 5AK5A 5BNIA 4IF4A 1GU1A 2H4ZA 4OYYA 3NXSA 4EECA 3THXA 1XL0A 5DEOA 1KWKA 3EEVA 4GMGA 4V0SA 2AQ9A 1P7VA 2WAOA 2CVQA 3EWAA 1R4MA 4MR8A 4OP1A 5ALJA 4C3OB 3DMTC 3PWSA 3STVA 3Q8KA 5CIQA 5HF6A 3I9KA 3M34A 1R7RA 3BZUA 4F8JA 3DMRA 1KO8A 2I6FA 3AIKA 2E4AA 4H3KB 5FRDA 2FX2A 2H5IA 1RS0A 2OZEA 3QTTA 4IDOA 3EY4A 4QUDA 4WEQA 4PG6A 4A7PA 1QORA 2Q9AA 4QDJA 4YJ3F 2WIFA 4WN9B 3R7FA 3VUEA 4E5PA 5ITSA 4O59O 4QBGB 4E5DA 1H3EA 3I39X 5C5CA 4W8OA 2RGNA 2FZEA 4RJKA 4EHKA 4ER6A 2FPMA 3C6BA 1XTTA 3NGLA 2HIAA 4LMRA 4OXIA 3L4BC 4I2VA 4CTNA 4JI0B 1JDUA 4KHPB 5B2EA 4HQNA 4BLWA 3ZCVA 2VBIA 4CEHB 4KAAA 3GJRA 3EQ9A 4M1OA 1JPNA 1GVHA 5AVOA 3DFMA 1TKBA 4G5SA 3S1SA 2YFYA 4EY7A 8ABPA 3MWLA 3VKHA 1NJSA 3CXRA 1MV8A 1T5SA 5IKEA 4KXFB 3IH5A 4AA7A 5REQA 1M74A 1R5BA 1SQGA 1ZH4A 2IHJA 2QW0X 3KEGA 3VSBA 3MLEA 2PX3A 2I66A 2IX9A 2Y1CA 1S1MA 4ZRMA 1AK1A 2ATVA 3V8EA 2QX6A 3PWZA 1FDIA 2JAOA 3P0EA 3P7MA 4TYPA 4ADSG 3ZWWA 1TMKA 5JCOA 4CGZA 2Y4OA 4N41A 4LV5B 3DZJA 1AX9A 1CHNA 4M88A 1V3TA 5E3RA 3OLVA 3OEHD 5DHSA 5AI4A 4CV1A 1DKUA 1LPMA 2WD9A 3JD4A 4OFZA 1D0VA 1F0YA 4XFDA 3SOZA 5KNBA 1LGYA 3C5CA 4MNTA 5H4HA 2VJNA 1GZ7A 1BVHA 1CU1A 5CDSA 5CDTA 2AW3A 1MQ8B 3T3IA 1ZL2A 3KD2A 4EKIA 3QTBA 1F3LA 1EVLA 3FWHA 4A0GA 5KYWB 3W6ZA 3PHJA 1E3TA 1SD1A 1PVVA 3AXSA 2AE1A 3ZWAA 5BWMA 2YHAA 1G2OA 1GTG1 1K5DA 1Q83A 4PZEA 5G4KA 1FRVA 2ECKA 4C43A 1Y7LA 3TNLA 4G1EB 3ZIDA 5IT5A 2FG7C 2H9IA 2X5KO 2Y93A 3GEBA 1P77A 3C3WA 1C0LA 5KOHA 4HN9A 4M7OA 1DCFA 2FRDA 4L5AA 3S8YA 1T26A 2HFJA 1KU0A 2WPNA 4IAOA 1K8YB 4NR0A 4DLZA 3G2IA 5G4LA 4B74A 3FOZA 4JNCA 3A3OA 1XIVA 3K1ZA 4DRYA 2V0NA 2VP3A 4MO9A 4AF8A 3SJZA 1JSCA 1PZEA 4ACAA 3CR7A 4KR7A 2CNBA 4RADA 4O25A 4RV4A 4Q37A 5H70A 3HB1A 3ETNA 3JQ7A 1J0DA 4QGHA 2MMGA 4QXOA 4QXRA 4BIMA 4TRRA 2R1TB 3VH2A 3HBFA 1GRVA 3K94A 3WLHA 5B4TA 3FVVA 3M83A 1WY5A 3NFYA 4UTZA 3INRA 4X44A 1RQXA 1UEJA 2OV4A 2VF4X 3N75A 4YFYA 1FVFA 1WS6A 1ZXXA 5TGZA 5FO0A 3H5WA 2Y8EA 3KZOA 4K6FA 3KPJA 3FTEA 3AVVA 4YAUA 3EDCA 1NF9A 3KLNA 1G97A 4WDRA 5ITVA 1QJCA 5AK6A 2W37A 2Z8YM 4HDNA 4XVHA 2WMDA 4I1YA 4F1WA 4H3HB 5FP0A 1MFZA 1DB3A 3MELA 2EBWA 5DYYA 1RRCA 1GPYA 3W5SA 3NBXX 1B73A 2BGJA 3VYVA 1SPXA 5DGCA 4Z1MA 3VPGA 4EHAA 4FD2A 4Q4HB 1DKPA 2R4TA 2OG1A 4I4TB 5J63A 2QJWA 1P44A 3O1LA 1U8EA 2BMJA 3KKEA 1O2DA 3O38A 1P91A 2QX4A 3OSUA 4UEQA 3STTA 4NBVA 3UMJA 9MHTA 3OJXA 2ZZNA 3BH7A 1KI7A 3VNBA 4QJ5A 3K0AB 4QBKA 2DLNA 4RWZA 2B92A 4CMEA 2R86A 3WDKA 4JOCA 2VP9A 3GQ8A 5F3DA 3RHSA 1E9VA 4ZPXA 1AKVA 2DULA 1H05A 1MORA 1TE2A 2A58A 3JAKB 4FWBA 3VBJA 3G9XA 3UQZA 1R50A 5K8CA 1ORHA 1A4RA 2JJ8A 4EJSA 5TMBA 3AZPA 4RTSA 1RJFA 3CR3C 4S05A 1TNDA 4W5QA 3LPCA 5G1OA 2RJ3A 2D5BA 2IYNA 2XZPA 4HQOA 5EIOA 3EVCA 3H9EO 3O7MA 4RBNA 4DZZA 2B7BA 2CVOA 1RHUA 1MIOB 3UOGA 1XRPA 3PJGA 4FTWA 1TMGE 2FW9A 1DQYA 2Y1GA 3F7TA 3Q10A 3TLYA 5CA1A 1EDDA 1FFCA 2YCLA 4R7ZA 4CCSA 3EY9A 4CLHA 4ENUA 3HJUA 5EJFA 2OMKA 2QG4A 3AKDA 3ZV3A 2PWBA 4LXXA 2EEZA 4RTPA 4HDRB 3U9TA 1UCFA 5JOQA 2HZ7A 2E55A 3QEJA 4P33A 1D4AA 4XQGA 3W9YA 4OFXA 3QPCA 3G8YA 1C3OB 4RENA 4Y9SA 1RFLA 2QZSA 3FMGA 2IOFA 4EA8A 3BG5A 3IP7A 4MWSA 6REQB 1HE5A 2B20A 4R5MA 1HT0A 3JQBA 4IWNA 4E88A 2QAIA 3GUCA 1SBTA 3EFOB 1DXHA 4GKVA 4J0HA 3PNLA 3SS7X 1FDWA 2GM5A 5J5CA 1VRVA 1E89A 1P5JA 3M82A 5HCNA 5AM3A 2R1VB 4W5RA 1THJA 1YIAA 1QYRA 3CLSC 1FX0A 5IDYA 4II3A 4KLRA 4ROSA 4FMCB 1N5LA 3D7RA 4UBLA 1BWQA 1C3OA 1CF2O 1M9NA 3B6KA 3DL7A 3DZCA 3HYTA 1YKFA 1QGUA 1FYVA 2G70A 2FGJA 5DCUA 3JZMA 1ECLA 2ZW9A 3QVTA 2BI7A 4UDYX 2C9MA 2HF7A 3EASA 4N0MA 4QQKA 3ZE0B 4B9AA 4U6NA 2VWPA 4U9IS 2PLAA 1LB1B 1CUHA 4URZR 1AA9A 3FIUA 4JJKA 5LBTA 1QIFA 4BU0A 1H2RS 4INOA 3E9DA 4KQ2A 2IDZA 2P41A 1Z7WA 4UTNA 2IT1A 1TO6A 5FWYA 3GLGB 1KP2A 4L5CA 4QYSA 5ALWA 1XVLA 3LFUA 1Q92A 5EVCA 2H1CA 3ADCA 4PLYA 4R36A 4XVUA 1IATA 3PD7A 1SU4A 2Q5IA 4B0OA 3ZNOA 3MWFA 5KZMB 4PFJA 2JFGA 3K70C 1VDMA 2HCBA 2V97A 4BVFA 5CFZA 5LDHA 2YS7A 1C29B 1YWGO 4GM4A 1T9GS 4MK4A 4OSOA 1F06A 3UCFA 1VQ1A 5IHPA 3AEXA 5DLEA 4B2IA 4ZVVA 5IP5A 1PZGA 1JUDA 3NP9A 4NMMA 2VQ3A 1R6DA 5D6NA 5ENZA 3DZGA 2NSJA 2DWCA 3U13A 5A7HA 2ZWIA 3OWOA 3BL8A 3F2IA 3RJ5A 1IULA 3X2SA 1UXGA 1N2SA 2XGGA 1XMVA 2FTKE 2PG3A 2HIHA 3T0IA 4CG2A 3PE4A 1AVTA 1ID1A 2DCMA 3SS8A 3RBVA 4DN6A 1L5SA 3L41A 3PYXA 5JTTA 4FCEA 2YZ7A 1QIEA 1RI2A 2VTVA 3U80A 4M0UA 1KO4A 2QMEA 5LL6P 1OX5A 4LGCA 1VXOA 3NZ2A 2ILTA 1G7CA 2V54A 4Y1RB 3TLZA 1ZAKA 3CLVA 2P3OA 3FKSA 2PX5A 3GFPA 3HN7A 3VC7A 3PE3A 2AEEA 1BHJA 1BN7A 1UJMA 3OC6A 1UUFA 2NX2A 3AJAA 3I9LA 2BGGA 4Z9BA 2GMWA 4RQTA 1H8HD 2ZU6A 4D9FA 5EWJA 3TVTA 2WVAA 1BDMA 2PZ8A 3HA2A 4OTZA 1UPCA 1YOVA 1BVRA 1OTHA 1COWA 5K20A 1K8ZB 2V6GA 1MAUA 3LW8A 4BU1A 4UTPA 3R24A 1ACJA 5B5SA 3OFJA 2XB8A 1A7JA 2OWDA 2PAAA 3GUUA 5J2UF 3R5AA 2C42A 3KT0A 1QPBA 5KVSA 3TW4A 4RKQA 3RSGA 1C9NA 3V4OA 4JJ8A 1WPQA 2GEKA 4JHLA 1BKDR 3VI4B 1E9AA 3IA7A 3TE6A 3K6SA 3T9EA 3L46A 1T1RA 3FKQA 2V6FA 1Q0LA 2DLDA 1PG5A 3MUEA 4LNUA 3COSA 5EWMB 1W35A 3E5NA 3NGMA 4OKIA 3R75A 3UUFA 5AWFC 4J1SA 4TUYA 1CG6A 5CDGA 1NZFA 2GCIA 1J90A 3LLCA 2I3GA 2PFKA 2JRLA 1T2CA 2GDJA 1ZO8A 3A6HA 5DSXA 3KWDA 4M38A 1CNMA 5E9JA 4D8UA 3L79A 4LXQA 1HG1A 1A72A 2PUVA 3EZYA 3RUCA 1V3VA 1CDZA 2D1TA 3U9LA 4AP5A 3BIJA 4F7DA 3I9NA 3HLTA 1KYVA 1NATA 1YVUA 5TT0A 1E62A 4LMAA 2XT9A 2PJZA 3JRWA 2RMKA 1WUJS 1HDYA 1WXWA 4I4NA 1XXHA 4LOAA 2D7JA 5DP2A 1VYVA 4OY3A 5JMTA 1YR6A 1XQWA 2CV1A 1EUCB 4BKUA 1RAGA 3BSWA 1NP3A 1SCIA 2YYAA 4X85A 2C0CA 5EE1A 3T7IA 3QVUA 3DEHA 1W88A 2UZ1B 3U4QB 4PLZA 2OHJA 4QG7A 4YRAA 2MSLA 1MO6A 221PA 3CVOA 3JALA 2FFJA 3KJZA 4BNYA 4ZFNA 5A6SA 3CT4A 2AZXA 2H2DA 4IEFB 3SX0A 3AF4A 4G5HA 4HEHA 5KQGA 2AHOA 1NMZA 3OO1A 4FONA 3VR2A 3U44A 2C97A 2Q3LA 2OENG 2BC9A 4FFPA 2LPMA 2WOJA 4QJBA 3OTQA 4BY9E 4JWTA 2JFBA 2AMFA 4W99A 3UBTA 1LDMA 5FNVB 2QLMA 1M0TA 3VVLA 4KVZA 1GGHA 3LQ2A 1CUCA 1WZIA 3ZVKA 3U7EB 1T1IA 2I80A 3KHSA 1UQUA 5DTRA 1JDNA 1TJ3A 1JG3A 1VB5A 2WPDA 2ZK7A 5ETJA 4ZD6A 3RHZA 4B6JA 3VKGA 2J9XB 3P9QA 1GU7A 3RYFB 3S7TA 4ZT2A 1IB0A 3BJEA 3A1CA 3BD7A 1XDZA 1H22A 2PD6A 1QB8A 1ZK3A 2AA3A 3G17A 3LNTA 3T5GA 3KKPA 2IS2A 4QYIA 2W90A 4TWBA 4CCYA 2A0UA 4FN5A 4D6PA 1ADGA 3UCXA 8ADHA 2CXNA 2WAYA 3N6VA 4KJXA 1YS4A 4A8TA 4QFDA 2ZI6A 3WS7A 4U6SA 1JU4A 2HV9A 3DCJA 4U5QA 5C1IA 3WWDA 2X14A 3NBKA 1QLWA 2EFGA 2NU6B 2YYSA 4DGSA 2R1UA 3NTVA 4GBED 4DJTA 4CTMA 1U7DA 2GPSA 2N46A 4OKSA 1DZ3A 1GSIA 1NN0A 2IU3A 3CKKA 4GOND 2NU7A 4HS9A 3BXFA 4ALIA 3HLYA 3VHLB 4EPTA 3KPWA 5TNXA 1TVCA 4IOKA 3UFXA 5FWXB 4QXMA 5J4HA 5ALRA 1OTYA 4KN8A 4ZT3A 3UN1A 4C4YA 2TMYA 3L9XA 5DRTA 1MQSA 1T24A 2AOVA 4FYWA 4Z7OB 1MJ5A 4QYTA 5JSQA 2Z57A 4LGYA 4GSYA 1JEOA 5HCIA 4I9NA 4ZI5A 2HWKA 4AS1A 3NC4A 3TGLA 4JP5A 2J5BA 1XYVA 4V2UA 3RSOA 3U7RA 1UP6A 3GFTA 1LQUA 3QEKA 1E1YA 5T6MA 2FPXA 1PKEA 4G2NA 1VMIA 1TUBB 4MEAA 3S1AA 5EJ2A 3E7WA 4HAUA 2QLFA 4IUBS 3UMFA 4GKJB 2FUCA 4DLSA 4M22A 1PAUA 1T0JB 2IP2A 3RI3A 3VBLA 4FYKA 1P5RA 2YFHA 4LXYA 3RWMB 2ON6A 3LE8A 2ZDGA 4YJGA 3GI1A 2UUBB 5HIJA 1YE8A 3JQPA 3FCXA 2B0CA 1SU7A 1S5PA 2WE7A 2C9BA 1MOPA 3AVPA 4IIBA 4DQ0A 4ZHQF 1ZIPA 4Q7MB 1J21A 4UHHA 3D2AA 3PUZA 1N0VC 3N2GA 3EGVA 4HAZA 3HWSA 1QAOA 1O5TA 3NJ4A 3GLFE 1JLKA 3OQIA 3BEDA 3PRHA 5I7VA 1NVAA 4MITA 4DMHA 4DT1B 5MGBA 1Z2PX 3NHSA 1XELA 4JJAA 4RYDA 3I2HA 3CVYA 2Q3MA 2O7VA 3KQKA 2GKSA 3EBPA 5EHQA 4RETA 1A8IA 2OZKA 1TC2A 4ZMRA 2VPTA 3QU5A 3VR6D 3KQNA 1G66A 3PD0A 1SULA 4C4AA 2UZIR 3EXFB 3PNSA 3RODA 4EKYA 1XYGA 1N2IA 1CFZA 3H5OA 3HU5A 5HCUA 4PYQA 4TUYB 4MDEA 5J2TA 1IDN1 1JIIA 3B1KA 4MUBA 5I8ZA 2O8FB 4TT3D 3LMKA 2B36A 5FPHA 3A0RB 4IVRA 4B32A 2X0JA 4XLTA 4ZO4A 4YQEA 3KKQA 4NEGA 3SZOA 1N6HA 3CQ9A 4CI9A 2I91A 2XTJA 1CE8A 3DW1X 3AI1A 3HU1A 5FLYA 3S2YA 4B2LA 3A6PC 1LJLA 1QQ6A 3TX2A 2IEBA 4KO3S 3LY5A 4GVXA 3P0HA 1ZUNA 1B8PA 4J91A 1AUOA 1JXQA 2G4VA 1UBKS 2WNHA 1V8ZA 3GUYA 3BE8A 1H0SA 3QQPA 1RXUA 1YZHA 4G85A 5A2QA 4R8RA 1ZW6A 1XNJA 2WF5A 4CYMA 3DO8A 2PZFA 3OUUA 3R0JA 4ZTZB 1YDMA 1ZH2A 4KLCA 4NJEA 1UXOA 3TR6A 2FY8A 1EM8B 2OILA 2SKCA 3E5HA 3T9DA 4R1NA 1DBIA 1K3UB 5H3HA 3T7TA 1B1CA 3JQ6A 4RKEA 3DLTA 5HRUA 3MS7A 1OA1A 4G5FA 1CR1A 3VR4D 5FPSA 4M1TA 1V1RA 2XUFA 4BMZA 5BN5A 5F52A 5KSYA 4N0QA 3HCEA 1XXLA 2Q1SA 1A50B 2I4TA 3E05A 1YP3A 1NL3A 3U4IA 1P1FA 4OJKA 3OFND 4A6XA 4B7UA 2Z2IA 1CS0A 2GJAA 3PGLA 1AY0A 4F6CA 1Q7CA 1SXJB 3IMGA 3K09A 4FMDB 2G5GX 2RC6A 1MOZA 3Q6NA 5B1YA 2VYND 1CUAA 3H5RA 2QHXA 2YYZA 3BPSA 3LT2A 4PVCA 2VHUA 3L6DA 4QL3A 4GZLA 4S1NA 3WRXA 2IIBA 4QYIB 2W8BA 1IFXA 2XB6A 1YL5A 3OCZA 2PJDA 3OZTA 4MCJA 4NFYA 4XPZA 2Q29A 3HJGA 2H7CA 4R68A 4A2WA 2G09A 3AUKA 4QTTB 5KYXA 3GAAA 4HS4A 3V7UA 1WXFA 1PU2A 4OGGA 1O94D 4PBTA 4H16A 5EXSA 4M1ZA 4ZVSA 1YC2A 1ECCA 2WIBA 4GI5A 4NK4A 4W1SA 2VAWA 1SVOA 1PGNA 1VMAA 3SHQA 1GGVA 3BRWD 3JARB 3WGVA 2SBTA 3GNLA 1RHKA 1LK7A 3NASA 4N7JA 1V6CA 3K09C 4WADA 2GKOA 2W7TA 3BXHA 4TKUB 4FHEA 4X94A 3WK9A 3UFXB 1L7BA 2QX8A 2V59A 3S2ZA 3SZUA 1RXVA 2JKVA 4GPEA 2ALJA 3QKSB 4MROA 3BRCA 5JAQA 4LC0A 1FEZA 3GXOA 3VOSA 5F2NA 3GELA 1VC2A 4ARZA 2PKQO 1G5IA 3CB2A 3VPXA 1IQPA 2XNJA 3ZD8A 4ALLA 3VV2A 4J3JA 3P4XA 5EE3A 5K3FA 5CW1A 3WQBA 1DS6A 3ANYB 2IYXA 2O8VA 3W7BA 1G16A 1FVHA 1L1EA 1PJQA 3I92A 4NBSA 2ZI4A 2AWOA 3CB4A 3MLAA 2XQFA 1T9BA 1PLKA 2XMDA 4L85A 4YDHB 4PZYA 1KSJA 1DQZA 2FEPA 1A9PA 1N78A 2A5DA 4AMBA 4DC9A 3I1FA 4HGYA 1WHSA 2OMEA 2HV8A 2IXBA 2B8NA 2YQZA 3BJZA 3CS3A 2GQ0A 4H35A 3QEOA 5A4KA 3FSCA 3GUEA 3FETA 1YS1X 2AIRA 4N6BA 4I6JA 5C7OO 3TAUA 5ICCA 1IEXA 2WM3A 2VYVA 1JHDA 3VZRA 1YI8A 1EP1B 2C7VA 1HWYA 3FNFA 4M36A 2H2GA 3KB8A 1KVUA 3W3AD 3I09A 3R6DA 4JT2A 5E7QA 3RROA 1YZUA 1N2ZA 3EZ7A 1ECBA 3OZUA 3KV1A 2REQB 1DC6A 1G3RA 3AEQA 5HW0A 1G9SA 2QXYA 3CTPA 3KPVA 1J2RA 2NO6A 3WWEA 1A77A 3RKSA 2Y92A 3BB3A 3CEAA 3MTAA 2EFYA 1NXXA 2PT9A 1KVTA 3RUPA 4D9BA 4XE5A 3AF0A 4EVSA 1M5RA 1JFTA 2A3NA 4ZT6A 1JWBB 1HQDA 2QE7A 4U3JA 1IB6A 4MQBA 1QE5A 5H3CA 4ZYTA 3AVXA 4HWPA 5DHFA 4BP3A 5JMOA 5C1BA 3MBOA 2NO1A 2QYOA 3EGOA 3KTAB 2YNMA 2XYQA 1U4OA 2O9JA 5FX2A 4BQSA 2ZQ5A 4AVYA 1E9FA 3LWDA 3ETGA 1ZR2A 4EFNA 2JA1A 2NPIA 1QTNA 2VUHB 2PZGA 4EL5A 5FQOA 2A1UB 2YW2A 3H5VA 4FFVA 1Q0HA 2E49A 5K6AC 1PD0A 4ND5A 4DCGA 2G80A 4E12A 5J59A 5IDXA 4L1KA 1G9XA 3WSVA 4PU0A 2ZGVA 3F5SA 1D6MA 1UKEA 3IUYA 2VA8A 3MEQA 3H19A 2XUHA 4J4BA 2HBYA 4PGHA 1VKZA 3A32A 5UKDA 4AS2A 2P0YA 1SHTX 1MEOA 3OX3A 1PBNA 4X41A 1XA3A 1J97A 3T41A 1AHHA 1MHPA 2LCFA 2WYIA 4HQ0A 2HSDA 4Q4DA 4X64B 5DCLA 1USWA 3RD5A 3M6IA 4V0QA 3ZHUA 1X7HA 3BXZA 3SC4A 5FCDA 4F04A 4LY3A 4HKTA 1CRZA 1W4RA 3Q3CA 3AT1A 5K0SA 3PEYA 4JR1A 4HNTA 3VKUA 1KJ9A 3FBTA 1L2TA 1D04A 2A3RA 4PANA 4Z1OA 2XZOA 2V0KA 4R5HA 1E3QA 1E9CA 2JJ2A 2WHYA 3VX3A 1ODIA 3IAM1 4XYLA 1VE5A 3H6GA 3QE0A 1Q1QA 3BTUA 4HNHA 2NUAB 1XVTA 2EXXA 1LWOA 3LQ1A 1VJDA 5H1YA 3UKDA 1ZYUA 4LSMA 4BRSA 1E2BA 4L8YA 1EVJA 2CNDA 3PX7A 1WCXA 1KJ8A 4MPTA 1Z5PA 1NM5C 4URFA 3RVDA 2C2MA 1IPHA 2QRKA 1VPEA 4WESB 1E6LA 2WJAA 3I0ZA 2IEZA 4JI6B 2I3ZA 4IHJF 2VDPB 1NGSA 4KVGA 4DQDA 5DGTA 1CYEA 2Z2ZA 4XWYA 5KQSA 2ZXUA 2F90A 3F6RA 2Z30A 1DP4A 3OOWA 4LOLA 4ZDJA 3N8GA 4MS1A 4C78A 5FOSA 2BFEB 4B73A 4DCSA 4W5OA 2CNOA 1A2OA 3GH3A 4C89A 4OHVA 2G1KA 1NUSA 1X0VA 4W9RA 4XM2A 1V9SA 3PIRA 1SBZA 1E6EA 2H0AA 3RBXA 1ZNYA 5DGHA 2YV5A 4II7A 3RS5A 3S8MA 2WWGA 3KZVA 1I1NA 4K3UA 1E2LA 1SCQA 5LUBA 3TDNA 4BNFA 4RVOA